1NP8A

18-k c-terminally trunucated small subunit of calpain
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
149
structure length
149
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A second binding site revealed by C-terminal truncation of calpain small subunit, a penta-EF-hand protein
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 58
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1np8A00
2KAXA 2WCFA 3OX5A 2JT3A 1C7WA 5CSNA 1ZFSA 2K7OA 1S3PA 2LLTA 3BOWA 1EG4A 4N5XA 4MZLA 2NCPA 3EKJA 3E3RA 4P2YB 1EJ3A 1SK6D 2AAOA 4FQOA 3DF0A 1UWOA 1NYAA 1Y6WA 2OTGC 1OMVA 3BUNB 1KWOB 3WNXB 2JU0A 3HX4A 4I5NB 1KFUL 1B1GA 1PK0D 3JVTC 1OE9B 4CFRA 4CFQA 5HLOA 1XFUO 1U5IA 1W7JB 1YX8A 1IJ6A 2KQYA 1H8BA 3FIAA 2F3YA 1SL9A 1UHKA 2ZKMX 1C7VA 2KBIA 3PM8A 4JQ0D 1SCMC 4MSPA 2M7LA 2WCBA 3CGAA 1DF0A 3FWBA 5TNCA 1XFVO 3LLEA 1CB1A 4WQ2A 3SG6A 2TN4A 1YUSA 2HETA 1S5GY 1KQMC 2PALA 1KFUS 3M0WA 3MSEB 1NX1A 1BT6A 1YX7A 2GV5A 4GGNA 3RM1A 4CIDA 3TDIA 3TDZA 2MRDA 4M2OA 4HRHA 1FW4A 1B8LA 4MEWA 1F70A 5JOLA 1TNPA 2JTTA 1CLLA 1BOCA 5D69A 2JTZA 2SCPA 1OZSA 1L7ZA 4N1FA 1YVHA 2JRFA 1RECA 5HKZA 5HKYA 3VGOA 2KI6D 1IKUA 1JFKA 2O60A 1FBVA 4GGFA 1JSAA 1NX3A 3CZTX 4ETOA 4FTGA 1CDNA 1XO5A 2I7AA 1YURA 1QS7A 1KFXL 2KOTA 2QPTA 1Q80A 5DKRA 1CNPA 2LCPA 4DS7A 2M7NA 1YR5A 2F33A 4YBHB 2CXJA 1MXLC 2Y4QA 3AAKA 1K9PA 1EXRA 1E8AA 1GQMA 1HT9A 3DVEA 4NDCA 4DIRA 2HQWA 1TNQA 1SCVA 3BUOB 2G2BA 1HQVA 2M8UA 2MLEC 1WLZA 3AKAA 3DVJA 1B9AA 3AAJA 3PSRA 2LVIA 3C1VA 1TN4A 2DOQA 1QV1A 2OS8C 5CSFA 1SL7A 3BUWB 3PLFB 1SY9A 1CM4A 2ZRTA 4R1EA 5GQQC 5HLVA 3SIBA 2M0RA 3TUYC 2KDHA 2Q4UA 1JWDA 1GGZA 4HSZA 2CCMA 1QASA 1OOJA 4DUQA 4QJ4B 1TIZA 5IBWA 4NDDA 3D0YB 3IF7A 1K96A 1QIWA 4JWQA 4NQGA 2L5XB 1CMGA 3CWGA 3KHEA 5ER5A 2EC6B 1A2XA 1WLMA 3D10A 1PULA 2EGDA 2FOTA 2LC5A 4PHKA 4XJKB 1UHHA 1UP5A 1K9KA 2BE6A 3KEVA 1A75A 1M46A 3OB2B 3SG5A 1IG5A 1ODBA 2E30A 2KI6C 1KCYA 2M3WA 5CSIA 1OSAA 1SBJA 1WRLA 3GOFA 3I5IB 3DF0B 3DVKA 2KSPA 2M1UA 4C0KA 1TNXA 1J1DA 1AUIB 4YRUA 2MBXA 1G4YR 2K2AA 2BKIB 4D1EA 4JPZB 1WRKA 4USLA 1SMGA 2GGMA 3BUMB 1U5IB 2K7DA 5KU1A 5I8NA 2MHHA 2MLFC 2KFGA 2KAVA 2WCEA 1IGVA 4GGFC 1DT7B 3NSKA 2KGRA 1B47A 1KSOA 3EVRA 4BY4A 1J7RA 4U8DA 2VRGA 5CPVA 1IJ5A 1UUSA 1W7IB 1RK9A 1K94A 1K2HA 1G8IA 1QVIZ 3FWCA 4PE4A 1J7QA 2LMVA 1GGWA 2LAPA 3BQ3A 3F45A 4NDBA 2EHBA 2BKHB 2KGBC 1AJ5A 3KF9A 2LMUA 1FF1A 2K8MB 1K93D 3OHMB 3I5FC 1SL8A 1Y1UA 1XVJA 2Q91A 1JC2A 1WRZA 1IQ5A 4YGBB 1M39A 3PATA 4AQJA 1UHIA 1A4PA 2LUCA 1B4CA 2V53A 4YI9A 5ER4X 1Y1XA 1CTRA 2L0PA 1SNLA 2P6BB 4GNKB 2M9GA 4MZJA 1SW8A 3BUXB 3VRQA 2M49B 4MN0A 1K90D 1DJWA 1S26D 1UHNA 2JQ6A 1SR6C 2BECA 5AFPA 1MR8A 2JNXA 2OTGB 4L9MA 2LVKA 5I2LA 5AERA 3BXKA 2K7CA 1V1FA 1PSRA 1DGUA 2KAYA 2NLNA 1PSBA 3JVTB 1SRAA 1ZUZA 2WORA 1KK7Y 1ZMZA 3I5FB 4OV2A 1DJZA 4PE1A 3WHUB 2Y5IA 1VRKA 1CLBA 1S6IA 2I2RE 5F6TA 1DJHA 2PRUA 1NX0A 2WNDA 1M45A 2ZN8A 4Q04A 2BBMA 2LMTA 2BL0C 1Y1AA 1S6CA 1SCMB 4QJ3B 4PDZA 2BBNA 2G9BA 2KI4C 2LP2A 1NSHA 2MA2A 1JUOA 2JT8A 1XYDA 1FI6A 1OMRA 1KQMB 1YRTB 1B7TZ 3CR4X 1OMDA 3GK2A 2SASA 1BR4B 3LK1A 3PALA 4GFTA 4TNCA 1PRWA 1YTZC 1A75B 1DVIA 1ALVA 1AHRA 1QIVA 1NUBA 1K95A 1QLSA 4WQ3A 1BODA 2BE4A 3OB1B 1BMOA 4IL1A 2PVBA 1DGVA 1B8RA 1PVBA 2JXLA 2ZNEA 2NXQA 3JTDC 1R2UA 1J7OA 2KHNA 3I5HC 1BJFA 2LNKA 2HPSA 1KFXS 4ORAB 4ORCB 1CKKA 4M2PA 4MZKA 5J3XA 2LUXA 2PSRA 1NCYA 1QLKA 5AXIA 1TCFA 1S36A 1SPYA 1YUUA 2L4IA 1TOPA 1WY9A 3CS1A 1AJ4A 5DKQA 1NIWA 1J55A 1XFXO 2KFFA 1CFDA 4GAOA 2HF5A 1WDCC 2ZFDA 3SG3A 4PHMA 2KYFA 2JOJA 3TS5C 2ISDA 1F8HA 2PMYA 3BOWB 1CFFA 3ZWHA 5AANA 1KSMA 3OP0A 1H4BA 4MRYA 2NCOA 1G33A 2OS8B 3I5HB 1LKJA 1F71A 2LHIA 4YGAA 3TUYB 3O4YA 2L98A 1ZOTB 4XYNA 1JF0A 1S1EA 1Y0VH 4C0LA 1BG1A 4BY5A 4YI8A 2JPTA 3WXAA 2OPOA 3DVMA 2L4HA 1MXEA 2WC8A 4OR9B 2JULA 2FCEA 2LM5A 2M29A 3EKHA 2F8PA 3CTNA 1V1GA 1EL4A 3BYAA 3EK7A 4MBEA 3RLZA 4AOMA 4AQIA 4C0JA 1WDCB 4DRWA 3TDUA 1DF0B 2Y1NA 2A4JA 2D8NA 4PALA 1QV0A 1KWOC 1FPWA 5JJGA 3EVUA 4PHJA 1F55A 2WOSA 1J7PA 4A4BA 1JF2A 1OQPA 1BF5A 2Y1MA 4PHNA 1KQVA 3ICBA 1AP4A 2BCAA 2LLUA 3H4SE 2LVJA 3VRNA 1AVSA 2L51A 4PE7A 3GK4X 3VRRA 1C07A 4XJKA 3IQQA 5AEQA 5KTYA 2QACA 4N1GA 1J1EA 1QX7A 1S6JA 2I94A 1QTXA 3IQOA 3AKBA 4I5LB 4YGEB 1CM1A 5B8IB 5D7FA 2LVVA 1FI5A 1XK4A 2ZNDA 1DTLA 1N65A 3HCMA 5HKWA 1KK8C 4ZCVA 1XA5A 1UURA 1CDLA 1NWDA 1YVLA 1QATA 4M2QA 3NSLA 1JFJA 1F54A 4YGDB 3SJSA 3PN7C 2I18A 1MWNA 1XFYO 1AK8A 2JZIA 2KBMA 1MUXA 3KO0A 1BLQA 3EK4A 5K89A 1IQ3A 1CFPA 3I5GC 5BPJA 1RROA 1RTP1 2LE9B 1F4OA 2AUCA 1DJYA 1IRJA 1F4QA 3SG7A 5KSZA 1QXPA 3SG4A 4GBAA 1TTXA 1CMFA 4GPLB 5I2OA 1PALA 2IS9A 3VRPA 1YUTA 2BCBA 2MJWB 1LVCD 2FJUB 2K2FA 3LCPC 4GUKA 5G08A 1BR1B 3K21A 2NZ0A 5HYDA 1KK8B 3PFVA 1QVIY 1SKTA 1TRFA 1MQ1A 4DCKA 2JNFA 1NPQA 1M31A 3O78A 3QRXA 3DD4A 1OZOA 1IWQA 3LL8B 1SR6B 2ZN9A 2FCDA 3PN7B 2BCXA 3NXAA 2H2KA 4P5OE 1DJGA 2KYCA 3NSIA 5I2QA 1RWYA 1LA0A 3O6BA 3I5GB 1EG3A 4HRGA 1LINA 2H61A 3WHTB 4ICBA 1TNWA 2RGIA 1N2DA 2CBLA 1L2OC 1PVAA 1MHOA 4MRXA 1CDPA 4OKHA 3SG2A 2EC6C 3NSOA 2BL0B 2O5GA 1D1OA 3FS7A 4UPGA 3GK1A 3O2PA 4YGCB 2KI4B 4HREE 2LV7A 1B8CA 2K61A 1CLMA 1TCOB 3OX6A 2F3ZA 2JXCA 3ZNIA 3A4UB 1XK4C 4A4CA 3CR5X 2LLSA 3I5IC 1QX2A 4CPVA 4CLNA 2L50A 2KNEA 2K0JA 2CTNA 4ORBB 1CDMA 1N0YA 1RJVA 1QX5B 5FYXA 1R6PA 4WRIA 3JTDB 2LP3A 1ALWA 1MF8B 3CLNA 4MLWA 1LA3A 1NCZA 2F2PA 2MAZA 2M97A 1YRUB 3VROA 1L2OB 2L2EA 2AMIA 2JT0A 4OVNF 1K9UA 4E68A 1GJYA 2E6WA 2M1KB 1SYMA 3LK0A 1NP8A 3A8RA 4PE0A 4QJ5B 2JWWA 4I5KA 1K8UA 5CSJA 3KPXA 2HQ8A 1XFWO 3SIAA 1M63B 2KFHA 2GGZA 1UHJA 1B7TY 1DJXA 1S5GZ 1CFCA 1EH2A 1X02A 2CNPA 2R2IA 1ZACA 4I5JA 1JBAA 4ZCUA 2K7BA 1BU3A 2COLB 2KQ6A 2LHLA 2JC2A 4OCIA 3TS5B 1DMOA 5PALA 3CR2A 1NX2A 3EVVA 2ZRSA 3TZ1A 1KK7Z 1A03A 1RFJA 1LXFC 2CT9A 5DKNA 1QJTA 2LANA 1XFZO 3EK8A 3D0YA 4PCWA 4F0ZB 1NCXA 4MVFA 1DJIA 2B1UA 1A29A 1IH0A 2PASA 2F2OA 2H61C
chains in the Genus database with same CATH superfamily
2PYQA 1OW4A 2KAXA 2WCFA 3OX5A 2JT3A 3R72A 1C7WA 5CSNA 1ZFSA 2K7OA 1S3PA 2LLTA 3BOWA 1EG4A 4N5XA 4MZLA 2NCPA 3EKJA 3E3RA 4P2YB 1EJ3A 1SK6D 2AAOA 4FQOA 3DF0A 1UWOA 3OBVA 1NYAA 1Y6WA 2OTGC 3D78A 1OMVA 3BUNB 1KWOB 3WNXB 2JU0A 3HX4A 4I5NB 1KFUL 1B1GA 1PK0D 1T14A 1P28A 3JVTC 1OE9B 4CFRA 4CFQA 2H8VA 4INXA 5HLOA 1XFUO 5EL2A 1U5IA 1W7JB 1YX8A 1IJ6A 2KQYA 1H8BA 3R1VA 3FIAA 2F3YA 1SL9A 1UHKA 1TUZA 2ZKMX 1C7VA 2KBIA 3PM8A 4JQ0D 1SCMC 4MSPA 2M7LA 3B87A 2WCBA 3CGAA 1DF0A 3FWBA 5TNCA 1XFVO 2WCJA 3LLEA 5HL1A 4WQ2A 1CB1A 3SG6A 2TN4A 1YUSA 2HETA 1S5GY 1KQMC 2PALA 1KFUS 3M0WA 3K1EA 3MSEB 1NX1A 1BT6A 4PT1A 1YX7A 2GV5A 4GGNA 3RM1A 4CIDA 3TDIA 3TDZA 2MRDA 4M2OA 4HRHA 1FW4A 1B8LA 2QEBA 4MEWA 1F70A 5JOLA 1TNPA 2JTTA 1CLLA 1BOCA 1ORGA 2JTZA 5D69A 2SCPA 1OZSA 1L7ZA 4N1FA 1YVHA 2JRFA 1RECA 5HKZA 5HKYA 3VGOA 2KI6D 1IKUA 1JFKA 2O60A 1FBVA 4GGFA 1JSAA 1NX3A 3CZTX 1W9ZA 4ETOA 4FTGA 3SS3A 1CDNA 1XO5A 2I7AA 1YURA 1QS7A 1KFXL 2KOTA 2QPTA 1Q80A 2YGUA 5DKRA 1CNPA 2LCPA 4DS7A 2M7NA 1YR5A 2F33A 4YBHB 2CXJA 1MXLC 2Y4QA 3CZ2A 3S0GA 3AAKA 1K9PA 1EXRA 1E8AA 1GQMA 1HT9A 3DVEA 4NDCA 1J7OA 4DIRA 2HQWA 1TNQA 1SCVA 3BUOB 1OOFA 2G2BA 1HQVA 2M8UA 2MLEC 1WLZA 3AKAA 3DVJA 1B9AA 3AAJA 3PSRA 2LVIA 3C1VA 1TN4A 2DOQA 1QV1A 2OS8C 3L4LA 5CSFA 1SL7A 3BUWB 3PLFB 1SY9A 1CM4A 2ZRTA 4R1EA 5GQQC 5HLVA 3SIBA 2M0RA 3R1PA 3TUYC 2KDHA 2Q4UA 1JWDA 1GGZA 4HSZA 2CCMA 1QASA 1OOJA 4DUQA 4QJ4B 1TIZA 5DICA 5IBWA 4NDDA 3D0YB 3IF7A 1K96A 1QIWA 4JWQA 4NQGA 2L5XB 3UO9A 3CWGA 3KHEA 5ER5A 2EC6B 1CMGA 1A2XA 1WLMA 3D10A 1PULA 2EGDA 2FOTA 2LC5A 4PHKA 4XJKB 1UHHA 1UP5A 1K9KA 2BE6A 3KEVA 1A75A 1M46A 3OB2B 3SG5A 1IG5A 1ODBA 2E30A 2KI6C 1KCYA 1TUJA 2M3WA 1OSAA 5CSIA 1SBJA 1WRLA 3GOFA 3I5IB 3DF0B 3DVKA 2KSPA 3IVTA 2M1UA 4C0KA 1TNXA 1J1DA 1AUIB 1Z4HA 4YRUA 2KLEA 2MBXA 1G4YR 2K2AA 2BKIB 3N7HA 4D1EA 4JPZB 1WRKA 4USLA 4INWA 1SMGA 2GGMA 3BUMB 1U5IB 2K7DA 5KU1A 5I8NA 2MHHA 2MLFC 2KFGA 2KAVA 3BFAA 2WCEA 1IGVA 4GGFC 1DT7B 3NSKA 2KGRA 1B47A 1KSOA 3EVRA 4BY4A 1J7RA 3B7AA 4U8DA 2VRGA 5CPVA 1IJ5A 1UUSA 1W7IB 1RK9A 1K94A 1K2HA 1G8IA 1QVIZ 3FWCA 4PE4A 1J7QA 3FE6A 2LMVA 3Q8IA 1GGWA 3B6XA 1OOIX 2LAPA 3BQ3A 3F45A 4NDBA 3S0BA 2EHBA 5FI7A 2BKHB 2KGBC 1AJ5A 3KF9A 2LMUA 3DXLA 3OGNA 1FF1A 2K8MB 1K93D 3OHMB 3I5FC 3NHTA 1SL8A 1Y1UA 1XVJA 2Q91A 1JC2A 1WRZA 1IQ5A 4YGBB 2JPOA 1M39A 3O4XA 3PATA 4AQJA 1UHIA 1A4PA 3BFHA 2LUCA 3S0FA 1B4CA 2V53A 4YI9A 5ER4X 1Y1XA 3FE9A 1CTRA 2L0PA 1SNLA 2P6BB 4GNKB 2M9GA 4MZJA 1SW8A 3BUXB 5FI2A 3VRQA 2M49B 4MN0A 1K90D 1DJWA 1S26D 1UHNA 2JQ6A 1SR6C 2QEHA 3B88A 2BECA 3FE8A 1Z2CB 5AFPA 1MR8A 2JNXA 2OTGB 3CABA 2LVKA 4L9MA 5I2LA 5AERA 3BXKA 2K7CA 1V1FA 1PSRA 1DGUA 2FJYA 2KAYA 2NLNA 3BJHA 3B86A 1PSBA 2PQLA 3JVTB 3S0AA 1SRAA 1ZUZA 2WORA 2BAPA 1KK7Y 1ZMZA 3I5FB 4OV2A 1DJZA 4PE1A 3WHUB 2ERBA 2Y5IA 1VRKA 1CLBA 1S6IA 2I2RE 5F6TA 1DJHA 2PRUA 1NX0A 2WNDA 1M45A 2ZN8A 4Q04A 2QEVA 2BBMA 2LMTA 2BL0C 1Y1AA 1S6CA 1SCMB 4QJ3B 1OOGA 3NHIA 5FI6A 4PDZA 2BBNA 2G9BA 2KI4C 2LP2A 1NSHA 2MA2A 1JUOA 5I94A 2JT8A 1XYDA 1FI6A 1OMRA 1YRTB 1KQMB 1B7TZ 3CR4X 1OMDA 3D74A 2SASA 3GK2A 3V2LA 1IIOA 1BR4B 3LK1A 3PALA 4GFTA 4TNCA 1PRWA 1YTZC 1A75B 1DVIA 1ALVA 3UNWA 1AHRA 1QIVA 1DELA 1K95A 1QLSA 1NUBA 4WQ3A 1BODA 2BE4A 2WC5A 3OB1B 1BMOA 3PJIA 4IL1A 2PVBA 1DGVA 1B8RA 1PVBA 2JXLA 2ZNEA 2NXQA 1XFRA 1R2UA 3JTDC 2KHNA 3I5HC 3L47A 1BJFA 2LNKA 2HPSA 1KFXS 4ORAB 3D73A 4ORCB 1CKKA 4M2PA 3S0DA 4MZKA 5J3XA 2K60A 2LUXA 3S0EA 2PSRA 1NCYA 1QLKA 5AXIA 1TCFA 1S36A 2KLDA 3NGVA 1SPYA 2L2CA 1YUUA 2L4IA 1TOPA 1WY9A 3CS1A 3L4AA 1AJ4A 5DKQA 1NIWA 1J55A 1XFXO 2KFFA 1CFDA 2WCMA 4GAOA 2HF5A 1WDCC 2ZFDA 3SG3A 4PHMA 2KYFA 2JOJA 3TS5C 2ISDA 1F8HA 2PMYA 3BOWB 3CDNA 1CFFA 3ZWHA 5AANA 1KSMA 1DEKA 3OP0A 1H4BA 4MRYA 2NCOA 2QEOA 1G33A 2OS8B 3I5HB 1LKJA 1F71A 2LHIA 4YGAA 3TUYB 3O4YA 2L98A 1ZOTB 4XYNA 1JF0A 1S1EA 1Y0VH 4C0LA 1BG1A 4BY5A 4YI8A 2JPTA 3WXAA 2OPOA 3DVMA 3D75A 2L4HA 1MXEA 2WC8A 2WCLA 2JULA 1DQEA 2FCEA 4OR9B 2LM5A 2M29A 3EKHA 2WCHA 2F8PA 3CTNA 1V1GA 1EL4A 3BYAA 3EK7A 4MBEA 3RLZA 4AOMA 4AQIA 4C0JA 1WDCB 4DRWA 3TDUA 1DF0B 3CYZA 2Y1NA 2A4JA 2D8NA 4PALA 1QV0A 1KWOC 4JD9A 1FPWA 5JJGA 3EVUA 4PHJA 1F55A 2WOSA 1J7PA 4A4BA 1JF2A 1OQPA 4FQTA 1BF5A 2Y1MA 4PHNA 1KQVA 3ICBA 1AP4A 2BCAA 2LLUA 3D76A 3H4SE 2LVJA 3VRNA 1AVSA 3PM2A 2L51A 4PE7A 3GK4X 3VRRA 2L5YA 3DYEA 1C07A 3EG5B 3IQQA 4XJKA 3CZ1A 5AEQA 2QACA 3QMEA 1J1EA 1QX7A 4N1GA 1S6JA 2I94A 5KTYA 1QTXA 3IQOA 3AKBA 4I5LB 4YGEB 1CM1A 5B8IB 5D7FA 2BNXA 2LVVA 1FI5A 1XK4A 2ZNDA 1DTLA 1N65A 3HCMA 5HKWA 4KYNA 4OZDA 1KK8C 4ZCVA 1XA5A 1OOHA 1UURA 1CDLA 1DC1A 1NWDA 1YVLA 1QATA 2GTEA 4M2QA 1LS8A 3NSLA 1JFJA 1F54A 4YGDB 3SJSA 3PN7C 2I18A 1QWVA 1MWNA 1C3YA 1XFYO 1AK8A 2JZIA 2KBMA 1MUXA 2P70A 3KO0A 1BLQA 3EK4A 5K89A 1IQ3A 1CFPA 3I5GC 1C3ZA 5BPJA 1RROA 1RTP1 2LE9B 1F4OA 2AUCA 1DJYA 1IRJA 1F4QA 2WCKA 3SG7A 5KSZA 1QXPA 3SG4A 4GBAA 3RZSA 1TTXA 1CMFA 4GPLB 5I2OA 1PALA 2IS9A 3VRPA 1YUTA 2BCBA 2MJWB 3SS5A 1LVCD 2FJUB 2K2FA 3LCPC 4GUKA 4IJ7A 5G08A 1BR1B 1TWOA 3K21A 2NZ0A 5HYDA 1KK8B 3PFVA 1QVIY 1SKTA 1TRFA 1MQ1A 5D3OA 4DCKA 3SS4A 2JNFA 1NPQA 1M31A 3O78A 3QRXA 3DD4A 1OZOA 1IWQA 3LL8B 1SR6B 2ZN9A 2FCDA 3PN7B 2BCXA 3NXAA 2H2KA 4P5OE 1DJGA 2KYCA 3NSIA 5I2QA 1RWYA 1LA0A 3O6BA 2P71A 3D77A 1SSEB 3I5GB 1EG3A 4HRGA 1LINA 2H61A 3WHTB 4ICBA 3DY9A 1TNWA 2RGIA 1N2DA 2CBLA 1L2OC 1PVAA 1MHOA 4MRXA 1CDPA 4OKHA 3SG2A 2EC6C 3DZTA 3NSOA 3VB1A 2BL0B 2O5GA 1D1OA 3FS7A 4UPGA 3GK1A 3O2PA 4YGCB 2KI4B 4HREE 2LV7A 1B8CA 2K61A 1CLMA 1TCOB 3OX6A 2F3ZA 2JXCA 3ZNIA 3A4UB 1XK4C 4A4CA 3CR5X 2LLSA 3I5IC 1QX2A 4CPVA 4CLNA 2L50A 2KNEA 2K0JA 2CTNA 4ORBB 1CDMA 1N0YA 1RJVA 1QX5B 5FYXA 1R6PA 3BFBA 4WRIA 3JTDB 2LP3A 1ALWA 1MF8B 3CLNA 4MLWA 1LA3A 1NCZA 2F2PA 2MAZA 2M97A 1YRUB 3VROA 1L2OB 2L2EA 2AMIA 2JT0A 4OVNF 1K9UA 4E68A 1GJYA 2E6WA 2M1KB 1SYMA 3LK0A 1NP8A 3A8RA 4PE0A 4QJ5B 2JWWA 4I5KA 1K8UA 3CZ0A 5CSJA 3KPXA 2HQ8A 1XFWO 3SIAA 1M63B 2QDIA 2KFHA 2GGZA 1UHJA 1B7TY 3R1OA 1DJXA 1S5GZ 1CFCA 1EH2A 1X02A 2CNPA 2R2IA 1ZACA 4I5JA 1JBAA 2WC6A 4ZCUA 2K7BA 1BU3A 2COLB 2KQ6A 2LHLA 2JC2A 4OCIA 3TS5B 1DMOA 5PALA 3CR2A 1NX2A 3EVVA 2ZRSA 2KPHA 4F7FA 3TZ1A 1KK7Z 1A03A 1RFJA 1LXFC 2CT9A 5DKNA 1QJTA 2LANA 1XFZO 3EK8A 3D0YA 4PCWA 4F0ZB 1NCXA 4JKTA 1DJIA 2B1UA 1A29A 4MVFA 1IH0A 2PASA 2F2OA 1GM0A 2H61C
chains in the Genus database with same CATH topology
2KAXA 2WCFA 3OX5A 2JT3A 1C7WA 5CSNA 1ZFSA 2K7OA 1S3PA 2LLTA 3BOWA 1EG4A 4N5XA 4MZLA 2NCPA 3EKJA 3E3RA 4P2YB 1EJ3A 1SK6D 2AAOA 4FQOA 3DF0A 1UWOA 1NYAA 1Y6WA 2OTGC 1OMVA 3BUNB 1KWOB 3WNXB 2JU0A 3HX4A 4I5NB 1KFUL 1B1GA 1PK0D 3JVTC 1OE9B 4CFRA 4CFQA 5HLOA 1XFUO 1U5IA 1W7JB 1YX8A 1IJ6A 2KQYA 1H8BA 3FIAA 2F3YA 1SL9A 1UHKA 2ZKMX 1C7VA 2KBIA 3PM8A 4JQ0D 1SCMC 4MSPA 2M7LA 2WCBA 3CGAA 1DF0A 3FWBA 5TNCA 1XFVO 3LLEA 1CB1A 4WQ2A 3SG6A 2TN4A 1YUSA 2HETA 1S5GY 1KQMC 2PALA 1KFUS 3M0WA 3MSEB 1NX1A 1BT6A 1YX7A 2GV5A 4GGNA 3RM1A 4CIDA 3TDIA 3TDZA 2MRDA 4M2OA 4HRHA 1FW4A 1B8LA 4MEWA 1F70A 5JOLA 1TNPA 2JTTA 1CLLA 1BOCA 5D69A 2JTZA 2SCPA 1OZSA 1L7ZA 4N1FA 1YVHA 2JRFA 1RECA 5HKZA 5HKYA 3VGOA 2KI6D 1IKUA 1JFKA 2O60A 1FBVA 4GGFA 1JSAA 1NX3A 3CZTX 4ETOA 4FTGA 1CDNA 1XO5A 2I7AA 1YURA 1QS7A 1KFXL 2KOTA 2QPTA 1Q80A 5DKRA 1CNPA 2LCPA 4DS7A 2M7NA 1YR5A 2F33A 4YBHB 2CXJA 1MXLC 2Y4QA 3AAKA 1K9PA 1EXRA 1E8AA 1GQMA 1HT9A 3DVEA 4NDCA 4DIRA 2HQWA 1TNQA 1SCVA 3BUOB 2G2BA 1HQVA 2M8UA 2MLEC 1WLZA 3AKAA 3DVJA 1B9AA 3AAJA 3PSRA 2LVIA 3C1VA 1TN4A 2DOQA 1QV1A 2OS8C 5CSFA 1SL7A 3BUWB 3PLFB 1SY9A 1CM4A 2ZRTA 4R1EA 5GQQC 5HLVA 3SIBA 2M0RA 3TUYC 2KDHA 2Q4UA 1JWDA 1GGZA 4HSZA 2CCMA 1QASA 1OOJA 4DUQA 4QJ4B 1TIZA 5IBWA 4NDDA 3D0YB 3IF7A 1K96A 1QIWA 4JWQA 4NQGA 2L5XB 1CMGA 3CWGA 3KHEA 5ER5A 2EC6B 1A2XA 1WLMA 3D10A 1PULA 2EGDA 2FOTA 2LC5A 4PHKA 4XJKB 1UHHA 1UP5A 1K9KA 2BE6A 3KEVA 1A75A 1M46A 3OB2B 3SG5A 1IG5A 1ODBA 2E30A 2KI6C 1KCYA 2M3WA 5CSIA 1OSAA 1SBJA 1WRLA 3GOFA 3I5IB 3DF0B 3DVKA 2KSPA 2M1UA 4C0KA 1TNXA 1J1DA 1AUIB 4YRUA 2MBXA 1G4YR 2K2AA 2BKIB 4D1EA 4JPZB 1WRKA 4USLA 1SMGA 2GGMA 3BUMB 1U5IB 2K7DA 5KU1A 5I8NA 2MHHA 2MLFC 2KFGA 2KAVA 2WCEA 1IGVA 4GGFC 1DT7B 3NSKA 2KGRA 1B47A 1KSOA 3EVRA 4BY4A 1J7RA 4U8DA 2VRGA 5CPVA 1IJ5A 1UUSA 1W7IB 1RK9A 1K94A 1K2HA 1G8IA 1QVIZ 3FWCA 4PE4A 1J7QA 2LMVA 1GGWA 2LAPA 3BQ3A 3F45A 4NDBA 2EHBA 2BKHB 2KGBC 1AJ5A 3KF9A 2LMUA 1FF1A 2K8MB 1K93D 3OHMB 3I5FC 1SL8A 1Y1UA 1XVJA 2Q91A 1JC2A 1WRZA 1IQ5A 4YGBB 1M39A 3PATA 4AQJA 1UHIA 1A4PA 2LUCA 1B4CA 2V53A 4YI9A 5ER4X 1Y1XA 1CTRA 2L0PA 1SNLA 2P6BB 4GNKB 2M9GA 4MZJA 1SW8A 3BUXB 3VRQA 2M49B 4MN0A 1K90D 1DJWA 1S26D 1UHNA 2JQ6A 1SR6C 2BECA 5AFPA 1MR8A 2JNXA 2OTGB 4L9MA 2LVKA 5I2LA 5AERA 3BXKA 2K7CA 1V1FA 1PSRA 1DGUA 2KAYA 2NLNA 1PSBA 3JVTB 1SRAA 1ZUZA 2WORA 1KK7Y 1ZMZA 3I5FB 4OV2A 1DJZA 4PE1A 3WHUB 2Y5IA 1VRKA 1CLBA 1S6IA 2I2RE 5F6TA 1DJHA 2PRUA 1NX0A 2WNDA 1M45A 2ZN8A 4Q04A 2BBMA 2LMTA 2BL0C 1Y1AA 1S6CA 1SCMB 4QJ3B 4PDZA 2BBNA 2G9BA 2KI4C 2LP2A 1NSHA 2MA2A 1JUOA 2JT8A 1XYDA 1FI6A 1OMRA 1KQMB 1YRTB 1B7TZ 3CR4X 1OMDA 3GK2A 2SASA 1BR4B 3LK1A 3PALA 4GFTA 4TNCA 1PRWA 1YTZC 1A75B 1DVIA 1ALVA 1AHRA 1QIVA 1NUBA 1K95A 1QLSA 4WQ3A 1BODA 2BE4A 3OB1B 1BMOA 4IL1A 2PVBA 1DGVA 1B8RA 1PVBA 2JXLA 2ZNEA 2NXQA 3JTDC 1R2UA 1J7OA 2KHNA 3I5HC 1BJFA 2LNKA 2HPSA 1KFXS 4ORAB 4ORCB 1CKKA 4M2PA 4MZKA 5J3XA 2LUXA 2PSRA 1NCYA 1QLKA 5AXIA 1TCFA 1S36A 1SPYA 1YUUA 2L4IA 1TOPA 1WY9A 3CS1A 1AJ4A 5DKQA 1NIWA 1J55A 1XFXO 2KFFA 1CFDA 4GAOA 2HF5A 1WDCC 2ZFDA 3SG3A 4PHMA 2KYFA 2JOJA 3TS5C 2ISDA 1F8HA 2PMYA 3BOWB 1CFFA 3ZWHA 5AANA 1KSMA 3OP0A 1H4BA 4MRYA 2NCOA 1G33A 2OS8B 3I5HB 1LKJA 1F71A 2LHIA 4YGAA 3TUYB 3O4YA 2L98A 1ZOTB 4XYNA 1JF0A 1S1EA 1Y0VH 4C0LA 1BG1A 4BY5A 4YI8A 2JPTA 3WXAA 2OPOA 3DVMA 2L4HA 1MXEA 2WC8A 4OR9B 2JULA 2FCEA 2LM5A 2M29A 3EKHA 2F8PA 3CTNA 1V1GA 1EL4A 3BYAA 3EK7A 4MBEA 3RLZA 4AOMA 4AQIA 4C0JA 1WDCB 4DRWA 3TDUA 1DF0B 2Y1NA 2A4JA 2D8NA 4PALA 1QV0A 1KWOC 1FPWA 5JJGA 3EVUA 4PHJA 1F55A 2WOSA 1J7PA 4A4BA 1JF2A 1OQPA 1BF5A 2Y1MA 4PHNA 1KQVA 3ICBA 1AP4A 2BCAA 2LLUA 3H4SE 2LVJA 3VRNA 1AVSA 2L51A 4PE7A 3GK4X 3VRRA 1C07A 4XJKA 3IQQA 5AEQA 5KTYA 2QACA 4N1GA 1J1EA 1QX7A 1S6JA 2I94A 1QTXA 3IQOA 3AKBA 4I5LB 4YGEB 1CM1A 5B8IB 5D7FA 2LVVA 1FI5A 1XK4A 2ZNDA 1DTLA 1N65A 3HCMA 5HKWA 1KK8C 4ZCVA 1XA5A 1UURA 1CDLA 1NWDA 1YVLA 1QATA 4M2QA 3NSLA 1JFJA 1F54A 4YGDB 3SJSA 3PN7C 2I18A 1MWNA 1XFYO 1AK8A 2JZIA 2KBMA 1MUXA 3KO0A 1BLQA 3EK4A 5K89A 1IQ3A 1CFPA 3I5GC 5BPJA 1RROA 1RTP1 2LE9B 1F4OA 2AUCA 1DJYA 1IRJA 1F4QA 3SG7A 5KSZA 1QXPA 3SG4A 4GBAA 1TTXA 1CMFA 4GPLB 5I2OA 1PALA 2IS9A 3VRPA 1YUTA 2BCBA 2MJWB 1LVCD 2FJUB 2K2FA 3LCPC 4GUKA 5G08A 1BR1B 3K21A 2NZ0A 5HYDA 1KK8B 3PFVA 1QVIY 1SKTA 1TRFA 1MQ1A 4DCKA 2JNFA 1NPQA 1M31A 3O78A 3QRXA 3DD4A 1OZOA 1IWQA 3LL8B 1SR6B 2ZN9A 2FCDA 3PN7B 2BCXA 3NXAA 2H2KA 4P5OE 1DJGA 2KYCA 3NSIA 5I2QA 1RWYA 1LA0A 3O6BA 3I5GB 1EG3A 4HRGA 1LINA 2H61A 3WHTB 4ICBA 1TNWA 2RGIA 1N2DA 2CBLA 1L2OC 1PVAA 1MHOA 4MRXA 1CDPA 4OKHA 3SG2A 2EC6C 3NSOA 2BL0B 2O5GA 1D1OA 3FS7A 4UPGA 3GK1A 3O2PA 4YGCB 2KI4B 4HREE 2LV7A 1B8CA 2K61A 1CLMA 1TCOB 3OX6A 2F3ZA 2JXCA 3ZNIA 3A4UB 1XK4C 4A4CA 3CR5X 2LLSA 3I5IC 1QX2A 4CPVA 4CLNA 2L50A 2KNEA 2K0JA 2CTNA 4ORBB 1CDMA 1N0YA 1RJVA 1QX5B 5FYXA 1R6PA 4WRIA 3JTDB 2LP3A 1ALWA 1MF8B 3CLNA 4MLWA 1LA3A 1NCZA 2F2PA 2MAZA 2M97A 1YRUB 3VROA 1L2OB 2L2EA 2AMIA 2JT0A 4OVNF 1K9UA 4E68A 1GJYA 2E6WA 2M1KB 1SYMA 3LK0A 1NP8A 3A8RA 4PE0A 4QJ5B 2JWWA 4I5KA 1K8UA 5CSJA 3KPXA 2HQ8A 1XFWO 3SIAA 1M63B 2KFHA 2GGZA 1UHJA 1B7TY 1DJXA 1S5GZ 1CFCA 1EH2A 1X02A 2CNPA 2R2IA 1ZACA 4I5JA 1JBAA 4ZCUA 2K7BA 1BU3A 2COLB 2KQ6A 2LHLA 2JC2A 4OCIA 3TS5B 1DMOA 5PALA 3CR2A 1NX2A 3EVVA 2ZRSA 3TZ1A 1KK7Z 1A03A 1RFJA 1LXFC 2CT9A 5DKNA 1QJTA 2LANA 1XFZO 3EK8A 3D0YA 4PCWA 4F0ZB 1NCXA 4MVFA 1DJIA 2B1UA 1A29A 1IH0A 2PASA 2F2OA 2H61C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAX A;  2WCF A;  3OX5 A;  2JT3 A;  1C7W A;  5CSN A;  1ZFS A;  2K7O A;  1S3P A;  2LLT A;  3BOW A;  1EG4 A;  4N5X A;  4MZL A;  2NCP A;  3EKJ A;  3E3R A;  4P2Y B;  1EJ3 A;  1SK6 D;  2AAO A;  4FQO A;  3DF0 A;  1UWO A;  1NYA A;  1Y6W A;  2OTG C;  1OMV A;  3BUN B;  1KWO B;  3WNX B;  2JU0 A;  3HX4 A;  4I5N B;  1KFU L;  1B1G A;  1PK0 D;  3JVT C;  1OE9 B;  4CFR A;  4CFQ A;  5HLO A;  1XFU O;  1U5I A;  1W7J B;  1YX8 A;  1IJ6 A;  2KQY A;  1H8B A;  3FIA A;  2F3Y A;  1SL9 A;  1UHK A;  2ZKM X;  1C7V A;  2KBI A;  3PM8 A;  4JQ0 D;  1SCM C;  4MSP A;  2M7L A;  2WCB A;  3CGA A;  1DF0 A;  3FWB A;  5TNC A;  1XFV O;  3LLE A;  1CB1 A;  4WQ2 A;  3SG6 A;  2TN4 A;  1YUS A;  2HET A;  1S5G Y;  1KQM C;  2PAL A;  1KFU S;  3M0W A;  3MSE B;  1NX1 A;  1BT6 A;  1YX7 A;  2GV5 A;  4GGN A;  3RM1 A;  4CID A;  3TDI A;  3TDZ A;  2MRD A;  4M2O A;  4HRH A;  1FW4 A;  1B8L A;  4MEW A;  1F70 A;  5JOL A;  1TNP A;  2JTT A;  1CLL A;  1BOC A;  5D69 A;  2JTZ A;  2SCP A;  1OZS A;  1L7Z A;  4N1F A;  1YVH A;  2JRF A;  1REC A;  5HKZ A;  5HKY A;  3VGO A;  2KI6 D;  1IKU A;  1JFK A;  2O60 A;  1FBV A;  4GGF A;  1JSA A;  1NX3 A;  3CZT X;  4ETO A;  4FTG A;  1CDN A;  1XO5 A;  2I7A A;  1YUR A;  1QS7 A;  1KFX L;  2KOT A;  2QPT A;  1Q80 A;  5DKR A;  1CNP A;  2LCP A;  4DS7 A;  2M7N A;  1YR5 A;  2F33 A;  4YBH B;  2CXJ A;  1MXL C;  2Y4Q A;  3AAK A;  1K9P A;  1EXR A;  1E8A A;  1GQM A;  1HT9 A;  3DVE A;  4NDC A;  4DIR A;  2HQW A;  1TNQ A;  1SCV A;  3BUO B;  2G2B A;  1HQV A;  2M8U A;  2MLE C;  1WLZ A;  3AKA A;  3DVJ A;  1B9A A;  3AAJ A;  3PSR A;  2LVI A;  3C1V A;  1TN4 A;  2DOQ A;  1QV1 A;  2OS8 C;  5CSF A;  1SL7 A;  3BUW B;  3PLF B;  1SY9 A;  1CM4 A;  2ZRT A;  4R1E A;  5GQQ C;  5HLV A;  3SIB A;  2M0R A;  3TUY C;  2KDH A;  2Q4U A;  1JWD A;  1GGZ A;  4HSZ A;  2CCM A;  1QAS A;  1OOJ A;  4DUQ A;  4QJ4 B;  1TIZ A;  5IBW A;  4NDD A;  3D0Y B;  3IF7 A;  1K96 A;  1QIW A;  4JWQ A;  4NQG A;  2L5X B;  1CMG A;  3CWG A;  3KHE A;  5ER5 A;  2EC6 B;  1A2X A;  1WLM A;  3D10 A;  1PUL A;  2EGD A;  2FOT A;  2LC5 A;  4PHK A;  4XJK B;  1UHH A;  1UP5 A;  1K9K A;  2BE6 A;  3KEV A;  1A75 A;  1M46 A;  3OB2 B;  3SG5 A;  1IG5 A;  1ODB A;  2E30 A;  2KI6 C;  1KCY A;  2M3W A;  5CSI A;  1OSA A;  1SBJ A;  1WRL A;  3GOF A;  3I5I B;  3DF0 B;  3DVK A;  2KSP A;  2M1U A;  4C0K A;  1TNX A;  1J1D A;  1AUI B;  4YRU A;  2MBX A;  1G4Y R;  2K2A A;  2BKI B;  4D1E A;  4JPZ B;  1WRK A;  4USL A;  1SMG A;  2GGM A;  3BUM B;  1U5I B;  2K7D A;  5KU1 A;  5I8N A;  2MHH A;  2MLF C;  2KFG A;  2KAV A;  2WCE A;  1IGV A;  4GGF C;  1DT7 B;  3NSK A;  2KGR A;  1B47 A;  1KSO A;  3EVR A;  4BY4 A;  1J7R A;  4U8D A;  2VRG A;  5CPV A;  1IJ5 A;  1UUS A;  1W7I B;  1RK9 A;  1K94 A;  1K2H A;  1G8I A;  1QVI Z;  3FWC A;  4PE4 A;  1J7Q A;  2LMV A;  1GGW A;  2LAP A;  3BQ3 A;  3F45 A;  4NDB A;  2EHB A;  2BKH B;  2KGB C;  1AJ5 A;  3KF9 A;  2LMU A;  1FF1 A;  2K8M B;  1K93 D;  3OHM B;  3I5F C;  1SL8 A;  1Y1U A;  1XVJ A;  2Q91 A;  1JC2 A;  1WRZ A;  1IQ5 A;  4YGB B;  1M39 A;  3PAT A;  4AQJ A;  1UHI A;  1A4P A;  2LUC A;  1B4C A;  2V53 A;  4YI9 A;  5ER4 X;  1Y1X A;  1CTR A;  2L0P A;  1SNL A;  2P6B B;  4GNK B;  2M9G A;  4MZJ A;  1SW8 A;  3BUX B;  3VRQ A;  2M49 B;  4MN0 A;  1K90 D;  1DJW A;  1S26 D;  1UHN A;  2JQ6 A;  1SR6 C;  2BEC A;  5AFP A;  1MR8 A;  2JNX A;  2OTG B;  4L9M A;  2LVK A;  5I2L A;  5AER A;  3BXK A;  2K7C A;  1V1F A;  1PSR A;  1DGU A;  2KAY A;  2NLN A;  1PSB A;  3JVT B;  1SRA A;  1ZUZ A;  2WOR A;  1KK7 Y;  1ZMZ A;  3I5F B;  4OV2 A;  1DJZ A;  4PE1 A;  3WHU B;  2Y5I A;  1VRK A;  1CLB A;  1S6I A;  2I2R E;  5F6T A;  1DJH A;  2PRU A;  1NX0 A;  2WND A;  1M45 A;  2ZN8 A;  4Q04 A;  2BBM A;  2LMT A;  2BL0 C;  1Y1A A;  1S6C A;  1SCM B;  4QJ3 B;  4PDZ A;  2BBN A;  2G9B A;  2KI4 C;  2LP2 A;  1NSH A;  2MA2 A;  1JUO A;  2JT8 A;  1XYD A;  1FI6 A;  1OMR A;  1KQM B;  1YRT B;  1B7T Z;  3CR4 X;  1OMD A;  3GK2 A;  2SAS A;  1BR4 B;  3LK1 A;  3PAL A;  4GFT A;  4TNC A;  1PRW A;  1YTZ C;  1A75 B;  1DVI A;  1ALV A;  1AHR A;  1QIV A;  1NUB A;  1K95 A;  1QLS A;  4WQ3 A;  1BOD A;  2BE4 A;  3OB1 B;  1BMO A;  4IL1 A;  2PVB A;  1DGV A;  1B8R A;  1PVB A;  2JXL A;  2ZNE A;  2NXQ A;  3JTD C;  1R2U A;  1J7O A;  2KHN A;  3I5H C;  1BJF A;  2LNK A;  2HPS A;  1KFX S;  4ORA B;  4ORC B;  1CKK A;  4M2P A;  4MZK A;  5J3X A;  2LUX A;  2PSR A;  1NCY A;  1QLK A;  5AXI A;  1TCF A;  1S36 A;  1SPY A;  1YUU A;  2L4I A;  1TOP A;  1WY9 A;  3CS1 A;  1AJ4 A;  5DKQ A;  1NIW A;  1J55 A;  1XFX O;  2KFF A;  1CFD A;  4GAO A;  2HF5 A;  1WDC C;  2ZFD A;  3SG3 A;  4PHM A;  2KYF A;  2JOJ A;  3TS5 C;  2ISD A;  1F8H A;  2PMY A;  3BOW B;  1CFF A;  3ZWH A;  5AAN A;  1KSM A;  3OP0 A;  1H4B A;  4MRY A;  2NCO A;  1G33 A;  2OS8 B;  3I5H B;  1LKJ A;  1F71 A;  2LHI A;  4YGA A;  3TUY B;  3O4Y A;  2L98 A;  1ZOT B;  4XYN A;  1JF0 A;  1S1E A;  1Y0V H;  4C0L A;  1BG1 A;  4BY5 A;  4YI8 A;  2JPT A;  3WXA A;  2OPO A;  3DVM A;  2L4H A;  1MXE A;  2WC8 A;  4OR9 B;  2JUL A;  2FCE A;  2LM5 A;  2M29 A;  3EKH A;  2F8P A;  3CTN A;  1V1G A;  1EL4 A;  3BYA A;  3EK7 A;  4MBE A;  3RLZ A;  4AOM A;  4AQI A;  4C0J A;  1WDC B;  4DRW A;  3TDU A;  1DF0 B;  2Y1N A;  2A4J A;  2D8N A;  4PAL A;  1QV0 A;  1KWO C;  1FPW A;  5JJG A;  3EVU A;  4PHJ A;  1F55 A;  2WOS A;  1J7P A;  4A4B A;  1JF2 A;  1OQP A;  1BF5 A;  2Y1M A;  4PHN A;  1KQV A;  3ICB A;  1AP4 A;  2BCA A;  2LLU A;  3H4S E;  2LVJ A;  3VRN A;  1AVS A;  2L51 A;  4PE7 A;  3GK4 X;  3VRR A;  1C07 A;  4XJK A;  3IQQ A;  5AEQ A;  5KTY A;  2QAC A;  4N1G A;  1J1E A;  1QX7 A;  1S6J A;  2I94 A;  1QTX A;  3IQO A;  3AKB A;  4I5L B;  4YGE B;  1CM1 A;  5B8I B;  5D7F A;  2LVV A;  1FI5 A;  1XK4 A;  2ZND A;  1DTL A;  1N65 A;  3HCM A;  5HKW A;  1KK8 C;  4ZCV A;  1XA5 A;  1UUR A;  1CDL A;  1NWD A;  1YVL A;  1QAT A;  4M2Q A;  3NSL A;  1JFJ A;  1F54 A;  4YGD B;  3SJS A;  3PN7 C;  2I18 A;  1MWN A;  1XFY O;  1AK8 A;  2JZI A;  2KBM A;  1MUX A;  3KO0 A;  1BLQ A;  3EK4 A;  5K89 A;  1IQ3 A;  1CFP A;  3I5G C;  5BPJ A;  1RRO A;  1RTP 1;  2LE9 B;  1F4O A;  2AUC A;  1DJY A;  1IRJ A;  1F4Q A;  3SG7 A;  5KSZ A;  1QXP A;  3SG4 A;  4GBA A;  1TTX A;  1CMF A;  4GPL B;  5I2O A;  1PAL A;  2IS9 A;  3VRP A;  1YUT A;  2BCB A;  2MJW B;  1LVC D;  2FJU B;  2K2F A;  3LCP C;  4GUK A;  5G08 A;  1BR1 B;  3K21 A;  2NZ0 A;  5HYD A;  1KK8 B;  3PFV A;  1QVI Y;  1SKT A;  1TRF A;  1MQ1 A;  4DCK A;  2JNF A;  1NPQ A;  1M31 A;  3O78 A;  3QRX A;  3DD4 A;  1OZO A;  1IWQ A;  3LL8 B;  1SR6 B;  2ZN9 A;  2FCD A;  3PN7 B;  2BCX A;  3NXA A;  2H2K A;  4P5O E;  1DJG A;  2KYC A;  3NSI A;  5I2Q A;  1RWY A;  1LA0 A;  3O6B A;  3I5G B;  1EG3 A;  4HRG A;  1LIN A;  2H61 A;  3WHT B;  4ICB A;  1TNW A;  2RGI A;  1N2D A;  2CBL A;  1L2O C;  1PVA A;  1MHO A;  4MRX A;  1CDP A;  4OKH A;  3SG2 A;  2EC6 C;  3NSO A;  2BL0 B;  2O5G A;  1D1O A;  3FS7 A;  4UPG A;  3GK1 A;  3O2P A;  4YGC B;  2KI4 B;  4HRE E;  2LV7 A;  1B8C A;  2K61 A;  1CLM A;  1TCO B;  3OX6 A;  2F3Z A;  2JXC A;  3ZNI A;  3A4U B;  1XK4 C;  4A4C A;  3CR5 X;  2LLS A;  3I5I C;  1QX2 A;  4CPV A;  4CLN A;  2L50 A;  2KNE A;  2K0J A;  2CTN A;  4ORB B;  1CDM A;  1N0Y A;  1RJV A;  1QX5 B;  5FYX A;  1R6P A;  4WRI A;  3JTD B;  2LP3 A;  1ALW A;  1MF8 B;  3CLN A;  4MLW A;  1LA3 A;  1NCZ A;  2F2P A;  2MAZ A;  2M97 A;  1YRU B;  3VRO A;  1L2O B;  2L2E A;  2AMI A;  2JT0 A;  4OVN F;  1K9U A;  4E68 A;  1GJY A;  2E6W A;  2M1K B;  1SYM A;  3LK0 A;  1NP8 A;  3A8R A;  4PE0 A;  4QJ5 B;  2JWW A;  4I5K A;  1K8U A;  5CSJ A;  3KPX A;  2HQ8 A;  1XFW O;  3SIA A;  1M63 B;  2KFH A;  2GGZ A;  1UHJ A;  1B7T Y;  1DJX A;  1S5G Z;  1CFC A;  1EH2 A;  1X02 A;  2CNP A;  2R2I A;  1ZAC A;  4I5J A;  1JBA A;  4ZCU A;  2K7B A;  1BU3 A;  2COL B;  2KQ6 A;  2LHL A;  2JC2 A;  4OCI A;  3TS5 B;  1DMO A;  5PAL A;  3CR2 A;  1NX2 A;  3EVV A;  2ZRS A;  3TZ1 A;  1KK7 Z;  1A03 A;  1RFJ A;  1LXF C;  2CT9 A;  5DKN A;  1QJT A;  2LAN A;  1XFZ O;  3EK8 A;  3D0Y A;  4PCW A;  4F0Z B;  1NCX A;  4MVF A;  1DJI A;  2B1U A;  1A29 A;  1IH0 A;  2PAS A;  2F2O A;  2H61 C; 
#chains in the Genus database with same CATH topology
 2PYQ A;  1OW4 A;  2KAX A;  2WCF A;  3OX5 A;  2JT3 A;  3R72 A;  1C7W A;  5CSN A;  1ZFS A;  2K7O A;  1S3P A;  2LLT A;  3BOW A;  1EG4 A;  4N5X A;  4MZL A;  2NCP A;  3EKJ A;  3E3R A;  4P2Y B;  1EJ3 A;  1SK6 D;  2AAO A;  4FQO A;  3DF0 A;  1UWO A;  3OBV A;  1NYA A;  1Y6W A;  2OTG C;  3D78 A;  1OMV A;  3BUN B;  1KWO B;  3WNX B;  2JU0 A;  3HX4 A;  4I5N B;  1KFU L;  1B1G A;  1PK0 D;  1T14 A;  1P28 A;  3JVT C;  1OE9 B;  4CFR A;  4CFQ A;  2H8V A;  4INX A;  5HLO A;  1XFU O;  5EL2 A;  1U5I A;  1W7J B;  1YX8 A;  1IJ6 A;  2KQY A;  1H8B A;  3R1V A;  3FIA A;  2F3Y A;  1SL9 A;  1UHK A;  1TUZ A;  2ZKM X;  1C7V A;  2KBI A;  3PM8 A;  4JQ0 D;  1SCM C;  4MSP A;  2M7L A;  3B87 A;  2WCB A;  3CGA A;  1DF0 A;  3FWB A;  5TNC A;  1XFV O;  2WCJ A;  3LLE A;  5HL1 A;  4WQ2 A;  1CB1 A;  3SG6 A;  2TN4 A;  1YUS A;  2HET A;  1S5G Y;  1KQM C;  2PAL A;  1KFU S;  3M0W A;  3K1E A;  3MSE B;  1NX1 A;  1BT6 A;  4PT1 A;  1YX7 A;  2GV5 A;  4GGN A;  3RM1 A;  4CID A;  3TDI A;  3TDZ A;  2MRD A;  4M2O A;  4HRH A;  1FW4 A;  1B8L A;  2QEB A;  4MEW A;  1F70 A;  5JOL A;  1TNP A;  2JTT A;  1CLL A;  1BOC A;  1ORG A;  2JTZ A;  5D69 A;  2SCP A;  1OZS A;  1L7Z A;  4N1F A;  1YVH A;  2JRF A;  1REC A;  5HKZ A;  5HKY A;  3VGO A;  2KI6 D;  1IKU A;  1JFK A;  2O60 A;  1FBV A;  4GGF A;  1JSA A;  1NX3 A;  3CZT X;  1W9Z A;  4ETO A;  4FTG A;  3SS3 A;  1CDN A;  1XO5 A;  2I7A A;  1YUR A;  1QS7 A;  1KFX L;  2KOT A;  2QPT A;  1Q80 A;  2YGU A;  5DKR A;  1CNP A;  2LCP A;  4DS7 A;  2M7N A;  1YR5 A;  2F33 A;  4YBH B;  2CXJ A;  1MXL C;  2Y4Q A;  3CZ2 A;  3S0G A;  3AAK A;  1K9P A;  1EXR A;  1E8A A;  1GQM A;  1HT9 A;  3DVE A;  4NDC A;  1J7O A;  4DIR A;  2HQW A;  1TNQ A;  1SCV A;  3BUO B;  1OOF A;  2G2B A;  1HQV A;  2M8U A;  2MLE C;  1WLZ A;  3AKA A;  3DVJ A;  1B9A A;  3AAJ A;  3PSR A;  2LVI A;  3C1V A;  1TN4 A;  2DOQ A;  1QV1 A;  2OS8 C;  3L4L A;  5CSF A;  1SL7 A;  3BUW B;  3PLF B;  1SY9 A;  1CM4 A;  2ZRT A;  4R1E A;  5GQQ C;  5HLV A;  3SIB A;  2M0R A;  3R1P A;  3TUY C;  2KDH A;  2Q4U A;  1JWD A;  1GGZ A;  4HSZ A;  2CCM A;  1QAS A;  1OOJ A;  4DUQ A;  4QJ4 B;  1TIZ A;  5DIC A;  5IBW A;  4NDD A;  3D0Y B;  3IF7 A;  1K96 A;  1QIW A;  4JWQ A;  4NQG A;  2L5X B;  3UO9 A;  3CWG A;  3KHE A;  5ER5 A;  2EC6 B;  1CMG A;  1A2X A;  1WLM A;  3D10 A;  1PUL A;  2EGD A;  2FOT A;  2LC5 A;  4PHK A;  4XJK B;  1UHH A;  1UP5 A;  1K9K A;  2BE6 A;  3KEV A;  1A75 A;  1M46 A;  3OB2 B;  3SG5 A;  1IG5 A;  1ODB A;  2E30 A;  2KI6 C;  1KCY A;  1TUJ A;  2M3W A;  1OSA A;  5CSI A;  1SBJ A;  1WRL A;  3GOF A;  3I5I B;  3DF0 B;  3DVK A;  2KSP A;  3IVT A;  2M1U A;  4C0K A;  1TNX A;  1J1D A;  1AUI B;  1Z4H A;  4YRU A;  2KLE A;  2MBX A;  1G4Y R;  2K2A A;  2BKI B;  3N7H A;  4D1E A;  4JPZ B;  1WRK A;  4USL A;  4INW A;  1SMG A;  2GGM A;  3BUM B;  1U5I B;  2K7D A;  5KU1 A;  5I8N A;  2MHH A;  2MLF C;  2KFG A;  2KAV A;  3BFA A;  2WCE A;  1IGV A;  4GGF C;  1DT7 B;  3NSK A;  2KGR A;  1B47 A;  1KSO A;  3EVR A;  4BY4 A;  1J7R A;  3B7A A;  4U8D A;  2VRG A;  5CPV A;  1IJ5 A;  1UUS A;  1W7I B;  1RK9 A;  1K94 A;  1K2H A;  1G8I A;  1QVI Z;  3FWC A;  4PE4 A;  1J7Q A;  3FE6 A;  2LMV A;  3Q8I A;  1GGW A;  3B6X A;  1OOI X;  2LAP A;  3BQ3 A;  3F45 A;  4NDB A;  3S0B A;  2EHB A;  5FI7 A;  2BKH B;  2KGB C;  1AJ5 A;  3KF9 A;  2LMU A;  3DXL A;  3OGN A;  1FF1 A;  2K8M B;  1K93 D;  3OHM B;  3I5F C;  3NHT A;  1SL8 A;  1Y1U A;  1XVJ A;  2Q91 A;  1JC2 A;  1WRZ A;  1IQ5 A;  4YGB B;  2JPO A;  1M39 A;  3O4X A;  3PAT A;  4AQJ A;  1UHI A;  1A4P A;  3BFH A;  2LUC A;  3S0F A;  1B4C A;  2V53 A;  4YI9 A;  5ER4 X;  1Y1X A;  3FE9 A;  1CTR A;  2L0P A;  1SNL A;  2P6B B;  4GNK B;  2M9G A;  4MZJ A;  1SW8 A;  3BUX B;  5FI2 A;  3VRQ A;  2M49 B;  4MN0 A;  1K90 D;  1DJW A;  1S26 D;  1UHN A;  2JQ6 A;  1SR6 C;  2QEH A;  3B88 A;  2BEC A;  3FE8 A;  1Z2C B;  5AFP A;  1MR8 A;  2JNX A;  2OTG B;  3CAB A;  2LVK A;  4L9M A;  5I2L A;  5AER A;  3BXK A;  2K7C A;  1V1F A;  1PSR A;  1DGU A;  2FJY A;  2KAY A;  2NLN A;  3BJH A;  3B86 A;  1PSB A;  2PQL A;  3JVT B;  3S0A A;  1SRA A;  1ZUZ A;  2WOR A;  2BAP A;  1KK7 Y;  1ZMZ A;  3I5F B;  4OV2 A;  1DJZ A;  4PE1 A;  3WHU B;  2ERB A;  2Y5I A;  1VRK A;  1CLB A;  1S6I A;  2I2R E;  5F6T A;  1DJH A;  2PRU A;  1NX0 A;  2WND A;  1M45 A;  2ZN8 A;  4Q04 A;  2QEV A;  2BBM A;  2LMT A;  2BL0 C;  1Y1A A;  1S6C A;  1SCM B;  4QJ3 B;  1OOG A;  3NHI A;  5FI6 A;  4PDZ A;  2BBN A;  2G9B A;  2KI4 C;  2LP2 A;  1NSH A;  2MA2 A;  1JUO A;  5I94 A;  2JT8 A;  1XYD A;  1FI6 A;  1OMR A;  1YRT B;  1KQM B;  1B7T Z;  3CR4 X;  1OMD A;  3D74 A;  2SAS A;  3GK2 A;  3V2L A;  1IIO A;  1BR4 B;  3LK1 A;  3PAL A;  4GFT A;  4TNC A;  1PRW A;  1YTZ C;  1A75 B;  1DVI A;  1ALV A;  3UNW A;  1AHR A;  1QIV A;  1DEL A;  1K95 A;  1QLS A;  1NUB A;  4WQ3 A;  1BOD A;  2BE4 A;  2WC5 A;  3OB1 B;  1BMO A;  3PJI A;  4IL1 A;  2PVB A;  1DGV A;  1B8R A;  1PVB A;  2JXL A;  2ZNE A;  2NXQ A;  1XFR A;  1R2U A;  3JTD C;  2KHN A;  3I5H C;  3L47 A;  1BJF A;  2LNK A;  2HPS A;  1KFX S;  4ORA B;  3D73 A;  4ORC B;  1CKK A;  4M2P A;  3S0D A;  4MZK A;  5J3X A;  2K60 A;  2LUX A;  3S0E A;  2PSR A;  1NCY A;  1QLK A;  5AXI A;  1TCF A;  1S36 A;  2KLD A;  3NGV A;  1SPY A;  2L2C A;  1YUU A;  2L4I A;  1TOP A;  1WY9 A;  3CS1 A;  3L4A A;  1AJ4 A;  5DKQ A;  1NIW A;  1J55 A;  1XFX O;  2KFF A;  1CFD A;  2WCM A;  4GAO A;  2HF5 A;  1WDC C;  2ZFD A;  3SG3 A;  4PHM A;  2KYF A;  2JOJ A;  3TS5 C;  2ISD A;  1F8H A;  2PMY A;  3BOW B;  3CDN A;  1CFF A;  3ZWH A;  5AAN A;  1KSM A;  1DEK A;  3OP0 A;  1H4B A;  4MRY A;  2NCO A;  2QEO A;  1G33 A;  2OS8 B;  3I5H B;  1LKJ A;  1F71 A;  2LHI A;  4YGA A;  3TUY B;  3O4Y A;  2L98 A;  1ZOT B;  4XYN A;  1JF0 A;  1S1E A;  1Y0V H;  4C0L A;  1BG1 A;  4BY5 A;  4YI8 A;  2JPT A;  3WXA A;  2OPO A;  3DVM A;  3D75 A;  2L4H A;  1MXE A;  2WC8 A;  2WCL A;  2JUL A;  1DQE A;  2FCE A;  4OR9 B;  2LM5 A;  2M29 A;  3EKH A;  2WCH A;  2F8P A;  3CTN A;  1V1G A;  1EL4 A;  3BYA A;  3EK7 A;  4MBE A;  3RLZ A;  4AOM A;  4AQI A;  4C0J A;  1WDC B;  4DRW A;  3TDU A;  1DF0 B;  3CYZ A;  2Y1N A;  2A4J A;  2D8N A;  4PAL A;  1QV0 A;  1KWO C;  4JD9 A;  1FPW A;  5JJG A;  3EVU A;  4PHJ A;  1F55 A;  2WOS A;  1J7P A;  4A4B A;  1JF2 A;  1OQP A;  4FQT A;  1BF5 A;  2Y1M A;  4PHN A;  1KQV A;  3ICB A;  1AP4 A;  2BCA A;  2LLU A;  3D76 A;  3H4S E;  2LVJ A;  3VRN A;  1AVS A;  3PM2 A;  2L51 A;  4PE7 A;  3GK4 X;  3VRR A;  2L5Y A;  3DYE A;  1C07 A;  3EG5 B;  3IQQ A;  4XJK A;  3CZ1 A;  5AEQ A;  2QAC A;  3QME A;  1J1E A;  1QX7 A;  4N1G A;  1S6J A;  2I94 A;  5KTY A;  1QTX A;  3IQO A;  3AKB A;  4I5L B;  4YGE B;  1CM1 A;  5B8I B;  5D7F A;  2BNX A;  2LVV A;  1FI5 A;  1XK4 A;  2ZND A;  1DTL A;  1N65 A;  3HCM A;  5HKW A;  4KYN A;  4OZD A;  1KK8 C;  4ZCV A;  1XA5 A;  1OOH A;  1UUR A;  1CDL A;  1DC1 A;  1NWD A;  1YVL A;  1QAT A;  2GTE A;  4M2Q A;  1LS8 A;  3NSL A;  1JFJ A;  1F54 A;  4YGD B;  3SJS A;  3PN7 C;  2I18 A;  1QWV A;  1MWN A;  1C3Y A;  1XFY O;  1AK8 A;  2JZI A;  2KBM A;  1MUX A;  2P70 A;  3KO0 A;  1BLQ A;  3EK4 A;  5K89 A;  1IQ3 A;  1CFP A;  3I5G C;  1C3Z A;  5BPJ A;  1RRO A;  1RTP 1;  2LE9 B;  1F4O A;  2AUC A;  1DJY A;  1IRJ A;  1F4Q A;  2WCK A;  3SG7 A;  5KSZ A;  1QXP A;  3SG4 A;  4GBA A;  3RZS A;  1TTX A;  1CMF A;  4GPL B;  5I2O A;  1PAL A;  2IS9 A;  3VRP A;  1YUT A;  2BCB A;  2MJW B;  3SS5 A;  1LVC D;  2FJU B;  2K2F A;  3LCP C;  4GUK A;  4IJ7 A;  5G08 A;  1BR1 B;  1TWO A;  3K21 A;  2NZ0 A;  5HYD A;  1KK8 B;  3PFV A;  1QVI Y;  1SKT A;  1TRF A;  1MQ1 A;  5D3O A;  4DCK A;  3SS4 A;  2JNF A;  1NPQ A;  1M31 A;  3O78 A;  3QRX A;  3DD4 A;  1OZO A;  1IWQ A;  3LL8 B;  1SR6 B;  2ZN9 A;  2FCD A;  3PN7 B;  2BCX A;  3NXA A;  2H2K A;  4P5O E;  1DJG A;  2KYC A;  3NSI A;  5I2Q A;  1RWY A;  1LA0 A;  3O6B A;  2P71 A;  3D77 A;  1SSE B;  3I5G B;  1EG3 A;  4HRG A;  1LIN A;  2H61 A;  3WHT B;  4ICB A;  3DY9 A;  1TNW A;  2RGI A;  1N2D A;  2CBL A;  1L2O C;  1PVA A;  1MHO A;  4MRX A;  1CDP A;  4OKH A;  3SG2 A;  2EC6 C;  3DZT A;  3NSO A;  3VB1 A;  2BL0 B;  2O5G A;  1D1O A;  3FS7 A;  4UPG A;  3GK1 A;  3O2P A;  4YGC B;  2KI4 B;  4HRE E;  2LV7 A;  1B8C A;  2K61 A;  1CLM A;  1TCO B;  3OX6 A;  2F3Z A;  2JXC A;  3ZNI A;  3A4U B;  1XK4 C;  4A4C A;  3CR5 X;  2LLS A;  3I5I C;  1QX2 A;  4CPV A;  4CLN A;  2L50 A;  2KNE A;  2K0J A;  2CTN A;  4ORB B;  1CDM A;  1N0Y A;  1RJV A;  1QX5 B;  5FYX A;  1R6P A;  3BFB A;  4WRI A;  3JTD B;  2LP3 A;  1ALW A;  1MF8 B;  3CLN A;  4MLW A;  1LA3 A;  1NCZ A;  2F2P A;  2MAZ A;  2M97 A;  1YRU B;  3VRO A;  1L2O B;  2L2E A;  2AMI A;  2JT0 A;  4OVN F;  1K9U A;  4E68 A;  1GJY A;  2E6W A;  2M1K B;  1SYM A;  3LK0 A;  1NP8 A;  3A8R A;  4PE0 A;  4QJ5 B;  2JWW A;  4I5K A;  1K8U A;  3CZ0 A;  5CSJ A;  3KPX A;  2HQ8 A;  1XFW O;  3SIA A;  1M63 B;  2QDI A;  2KFH A;  2GGZ A;  1UHJ A;  1B7T Y;  3R1O A;  1DJX A;  1S5G Z;  1CFC A;  1EH2 A;  1X02 A;  2CNP A;  2R2I A;  1ZAC A;  4I5J A;  1JBA A;  2WC6 A;  4ZCU A;  2K7B A;  1BU3 A;  2COL B;  2KQ6 A;  2LHL A;  2JC2 A;  4OCI A;  3TS5 B;  1DMO A;  5PAL A;  3CR2 A;  1NX2 A;  3EVV A;  2ZRS A;  2KPH A;  4F7F A;  3TZ1 A;  1KK7 Z;  1A03 A;  1RFJ A;  1LXF C;  2CT9 A;  5DKN A;  1QJT A;  2LAN A;  1XFZ O;  3EK8 A;  3D0Y A;  4PCW A;  4F0Z B;  1NCX A;  4JKT A;  1DJI A;  2B1U A;  1A29 A;  4MVF A;  1IH0 A;  2PAS A;  2F2O A;  1GM0 A;  2H61 C; 
#chains in the Genus database with same CATH homology
 2KAX A;  2WCF A;  3OX5 A;  2JT3 A;  1C7W A;  5CSN A;  1ZFS A;  2K7O A;  1S3P A;  2LLT A;  3BOW A;  1EG4 A;  4N5X A;  4MZL A;  2NCP A;  3EKJ A;  3E3R A;  4P2Y B;  1EJ3 A;  1SK6 D;  2AAO A;  4FQO A;  3DF0 A;  1UWO A;  1NYA A;  1Y6W A;  2OTG C;  1OMV A;  3BUN B;  1KWO B;  3WNX B;  2JU0 A;  3HX4 A;  4I5N B;  1KFU L;  1B1G A;  1PK0 D;  3JVT C;  1OE9 B;  4CFR A;  4CFQ A;  5HLO A;  1XFU O;  1U5I A;  1W7J B;  1YX8 A;  1IJ6 A;  2KQY A;  1H8B A;  3FIA A;  2F3Y A;  1SL9 A;  1UHK A;  2ZKM X;  1C7V A;  2KBI A;  3PM8 A;  4JQ0 D;  1SCM C;  4MSP A;  2M7L A;  2WCB A;  3CGA A;  1DF0 A;  3FWB A;  5TNC A;  1XFV O;  3LLE A;  1CB1 A;  4WQ2 A;  3SG6 A;  2TN4 A;  1YUS A;  2HET A;  1S5G Y;  1KQM C;  2PAL A;  1KFU S;  3M0W A;  3MSE B;  1NX1 A;  1BT6 A;  1YX7 A;  2GV5 A;  4GGN A;  3RM1 A;  4CID A;  3TDI A;  3TDZ A;  2MRD A;  4M2O A;  4HRH A;  1FW4 A;  1B8L A;  4MEW A;  1F70 A;  5JOL A;  1TNP A;  2JTT A;  1CLL A;  1BOC A;  5D69 A;  2JTZ A;  2SCP A;  1OZS A;  1L7Z A;  4N1F A;  1YVH A;  2JRF A;  1REC A;  5HKZ A;  5HKY A;  3VGO A;  2KI6 D;  1IKU A;  1JFK A;  2O60 A;  1FBV A;  4GGF A;  1JSA A;  1NX3 A;  3CZT X;  4ETO A;  4FTG A;  1CDN A;  1XO5 A;  2I7A A;  1YUR A;  1QS7 A;  1KFX L;  2KOT A;  2QPT A;  1Q80 A;  5DKR A;  1CNP A;  2LCP A;  4DS7 A;  2M7N A;  1YR5 A;  2F33 A;  4YBH B;  2CXJ A;  1MXL C;  2Y4Q A;  3AAK A;  1K9P A;  1EXR A;  1E8A A;  1GQM A;  1HT9 A;  3DVE A;  4NDC A;  4DIR A;  2HQW A;  1TNQ A;  1SCV A;  3BUO B;  2G2B A;  1HQV A;  2M8U A;  2MLE C;  1WLZ A;  3AKA A;  3DVJ A;  1B9A A;  3AAJ A;  3PSR A;  2LVI A;  3C1V A;  1TN4 A;  2DOQ A;  1QV1 A;  2OS8 C;  5CSF A;  1SL7 A;  3BUW B;  3PLF B;  1SY9 A;  1CM4 A;  2ZRT A;  4R1E A;  5GQQ C;  5HLV A;  3SIB A;  2M0R A;  3TUY C;  2KDH A;  2Q4U A;  1JWD A;  1GGZ A;  4HSZ A;  2CCM A;  1QAS A;  1OOJ A;  4DUQ A;  4QJ4 B;  1TIZ A;  5IBW A;  4NDD A;  3D0Y B;  3IF7 A;  1K96 A;  1QIW A;  4JWQ A;  4NQG A;  2L5X B;  1CMG A;  3CWG A;  3KHE A;  5ER5 A;  2EC6 B;  1A2X A;  1WLM A;  3D10 A;  1PUL A;  2EGD A;  2FOT A;  2LC5 A;  4PHK A;  4XJK B;  1UHH A;  1UP5 A;  1K9K A;  2BE6 A;  3KEV A;  1A75 A;  1M46 A;  3OB2 B;  3SG5 A;  1IG5 A;  1ODB A;  2E30 A;  2KI6 C;  1KCY A;  2M3W A;  5CSI A;  1OSA A;  1SBJ A;  1WRL A;  3GOF A;  3I5I B;  3DF0 B;  3DVK A;  2KSP A;  2M1U A;  4C0K A;  1TNX A;  1J1D A;  1AUI B;  4YRU A;  2MBX A;  1G4Y R;  2K2A A;  2BKI B;  4D1E A;  4JPZ B;  1WRK A;  4USL A;  1SMG A;  2GGM A;  3BUM B;  1U5I B;  2K7D A;  5KU1 A;  5I8N A;  2MHH A;  2MLF C;  2KFG A;  2KAV A;  2WCE A;  1IGV A;  4GGF C;  1DT7 B;  3NSK A;  2KGR A;  1B47 A;  1KSO A;  3EVR A;  4BY4 A;  1J7R A;  4U8D A;  2VRG A;  5CPV A;  1IJ5 A;  1UUS A;  1W7I B;  1RK9 A;  1K94 A;  1K2H A;  1G8I A;  1QVI Z;  3FWC A;  4PE4 A;  1J7Q A;  2LMV A;  1GGW A;  2LAP A;  3BQ3 A;  3F45 A;  4NDB A;  2EHB A;  2BKH B;  2KGB C;  1AJ5 A;  3KF9 A;  2LMU A;  1FF1 A;  2K8M B;  1K93 D;  3OHM B;  3I5F C;  1SL8 A;  1Y1U A;  1XVJ A;  2Q91 A;  1JC2 A;  1WRZ A;  1IQ5 A;  4YGB B;  1M39 A;  3PAT A;  4AQJ A;  1UHI A;  1A4P A;  2LUC A;  1B4C A;  2V53 A;  4YI9 A;  5ER4 X;  1Y1X A;  1CTR A;  2L0P A;  1SNL A;  2P6B B;  4GNK B;  2M9G A;  4MZJ A;  1SW8 A;  3BUX B;  3VRQ A;  2M49 B;  4MN0 A;  1K90 D;  1DJW A;  1S26 D;  1UHN A;  2JQ6 A;  1SR6 C;  2BEC A;  5AFP A;  1MR8 A;  2JNX A;  2OTG B;  4L9M A;  2LVK A;  5I2L A;  5AER A;  3BXK A;  2K7C A;  1V1F A;  1PSR A;  1DGU A;  2KAY A;  2NLN A;  1PSB A;  3JVT B;  1SRA A;  1ZUZ A;  2WOR A;  1KK7 Y;  1ZMZ A;  3I5F B;  4OV2 A;  1DJZ A;  4PE1 A;  3WHU B;  2Y5I A;  1VRK A;  1CLB A;  1S6I A;  2I2R E;  5F6T A;  1DJH A;  2PRU A;  1NX0 A;  2WND A;  1M45 A;  2ZN8 A;  4Q04 A;  2BBM A;  2LMT A;  2BL0 C;  1Y1A A;  1S6C A;  1SCM B;  4QJ3 B;  4PDZ A;  2BBN A;  2G9B A;  2KI4 C;  2LP2 A;  1NSH A;  2MA2 A;  1JUO A;  2JT8 A;  1XYD A;  1FI6 A;  1OMR A;  1KQM B;  1YRT B;  1B7T Z;  3CR4 X;  1OMD A;  3GK2 A;  2SAS A;  1BR4 B;  3LK1 A;  3PAL A;  4GFT A;  4TNC A;  1PRW A;  1YTZ C;  1A75 B;  1DVI A;  1ALV A;  1AHR A;  1QIV A;  1NUB A;  1K95 A;  1QLS A;  4WQ3 A;  1BOD A;  2BE4 A;  3OB1 B;  1BMO A;  4IL1 A;  2PVB A;  1DGV A;  1B8R A;  1PVB A;  2JXL A;  2ZNE A;  2NXQ A;  3JTD C;  1R2U A;  1J7O A;  2KHN A;  3I5H C;  1BJF A;  2LNK A;  2HPS A;  1KFX S;  4ORA B;  4ORC B;  1CKK A;  4M2P A;  4MZK A;  5J3X A;  2LUX A;  2PSR A;  1NCY A;  1QLK A;  5AXI A;  1TCF A;  1S36 A;  1SPY A;  1YUU A;  2L4I A;  1TOP A;  1WY9 A;  3CS1 A;  1AJ4 A;  5DKQ A;  1NIW A;  1J55 A;  1XFX O;  2KFF A;  1CFD A;  4GAO A;  2HF5 A;  1WDC C;  2ZFD A;  3SG3 A;  4PHM A;  2KYF A;  2JOJ A;  3TS5 C;  2ISD A;  1F8H A;  2PMY A;  3BOW B;  1CFF A;  3ZWH A;  5AAN A;  1KSM A;  3OP0 A;  1H4B A;  4MRY A;  2NCO A;  1G33 A;  2OS8 B;  3I5H B;  1LKJ A;  1F71 A;  2LHI A;  4YGA A;  3TUY B;  3O4Y A;  2L98 A;  1ZOT B;  4XYN A;  1JF0 A;  1S1E A;  1Y0V H;  4C0L A;  1BG1 A;  4BY5 A;  4YI8 A;  2JPT A;  3WXA A;  2OPO A;  3DVM A;  2L4H A;  1MXE A;  2WC8 A;  4OR9 B;  2JUL A;  2FCE A;  2LM5 A;  2M29 A;  3EKH A;  2F8P A;  3CTN A;  1V1G A;  1EL4 A;  3BYA A;  3EK7 A;  4MBE A;  3RLZ A;  4AOM A;  4AQI A;  4C0J A;  1WDC B;  4DRW A;  3TDU A;  1DF0 B;  2Y1N A;  2A4J A;  2D8N A;  4PAL A;  1QV0 A;  1KWO C;  1FPW A;  5JJG A;  3EVU A;  4PHJ A;  1F55 A;  2WOS A;  1J7P A;  4A4B A;  1JF2 A;  1OQP A;  1BF5 A;  2Y1M A;  4PHN A;  1KQV A;  3ICB A;  1AP4 A;  2BCA A;  2LLU A;  3H4S E;  2LVJ A;  3VRN A;  1AVS A;  2L51 A;  4PE7 A;  3GK4 X;  3VRR A;  1C07 A;  4XJK A;  3IQQ A;  5AEQ A;  5KTY A;  2QAC A;  4N1G A;  1J1E A;  1QX7 A;  1S6J A;  2I94 A;  1QTX A;  3IQO A;  3AKB A;  4I5L B;  4YGE B;  1CM1 A;  5B8I B;  5D7F A;  2LVV A;  1FI5 A;  1XK4 A;  2ZND A;  1DTL A;  1N65 A;  3HCM A;  5HKW A;  1KK8 C;  4ZCV A;  1XA5 A;  1UUR A;  1CDL A;  1NWD A;  1YVL A;  1QAT A;  4M2Q A;  3NSL A;  1JFJ A;  1F54 A;  4YGD B;  3SJS A;  3PN7 C;  2I18 A;  1MWN A;  1XFY O;  1AK8 A;  2JZI A;  2KBM A;  1MUX A;  3KO0 A;  1BLQ A;  3EK4 A;  5K89 A;  1IQ3 A;  1CFP A;  3I5G C;  5BPJ A;  1RRO A;  1RTP 1;  2LE9 B;  1F4O A;  2AUC A;  1DJY A;  1IRJ A;  1F4Q A;  3SG7 A;  5KSZ A;  1QXP A;  3SG4 A;  4GBA A;  1TTX A;  1CMF A;  4GPL B;  5I2O A;  1PAL A;  2IS9 A;  3VRP A;  1YUT A;  2BCB A;  2MJW B;  1LVC D;  2FJU B;  2K2F A;  3LCP C;  4GUK A;  5G08 A;  1BR1 B;  3K21 A;  2NZ0 A;  5HYD A;  1KK8 B;  3PFV A;  1QVI Y;  1SKT A;  1TRF A;  1MQ1 A;  4DCK A;  2JNF A;  1NPQ A;  1M31 A;  3O78 A;  3QRX A;  3DD4 A;  1OZO A;  1IWQ A;  3LL8 B;  1SR6 B;  2ZN9 A;  2FCD A;  3PN7 B;  2BCX A;  3NXA A;  2H2K A;  4P5O E;  1DJG A;  2KYC A;  3NSI A;  5I2Q A;  1RWY A;  1LA0 A;  3O6B A;  3I5G B;  1EG3 A;  4HRG A;  1LIN A;  2H61 A;  3WHT B;  4ICB A;  1TNW A;  2RGI A;  1N2D A;  2CBL A;  1L2O C;  1PVA A;  1MHO A;  4MRX A;  1CDP A;  4OKH A;  3SG2 A;  2EC6 C;  3NSO A;  2BL0 B;  2O5G A;  1D1O A;  3FS7 A;  4UPG A;  3GK1 A;  3O2P A;  4YGC B;  2KI4 B;  4HRE E;  2LV7 A;  1B8C A;  2K61 A;  1CLM A;  1TCO B;  3OX6 A;  2F3Z A;  2JXC A;  3ZNI A;  3A4U B;  1XK4 C;  4A4C A;  3CR5 X;  2LLS A;  3I5I C;  1QX2 A;  4CPV A;  4CLN A;  2L50 A;  2KNE A;  2K0J A;  2CTN A;  4ORB B;  1CDM A;  1N0Y A;  1RJV A;  1QX5 B;  5FYX A;  1R6P A;  4WRI A;  3JTD B;  2LP3 A;  1ALW A;  1MF8 B;  3CLN A;  4MLW A;  1LA3 A;  1NCZ A;  2F2P A;  2MAZ A;  2M97 A;  1YRU B;  3VRO A;  1L2O B;  2L2E A;  2AMI A;  2JT0 A;  4OVN F;  1K9U A;  4E68 A;  1GJY A;  2E6W A;  2M1K B;  1SYM A;  3LK0 A;  1NP8 A;  3A8R A;  4PE0 A;  4QJ5 B;  2JWW A;  4I5K A;  1K8U A;  5CSJ A;  3KPX A;  2HQ8 A;  1XFW O;  3SIA A;  1M63 B;  2KFH A;  2GGZ A;  1UHJ A;  1B7T Y;  1DJX A;  1S5G Z;  1CFC A;  1EH2 A;  1X02 A;  2CNP A;  2R2I A;  1ZAC A;  4I5J A;  1JBA A;  4ZCU A;  2K7B A;  1BU3 A;  2COL B;  2KQ6 A;  2LHL A;  2JC2 A;  4OCI A;  3TS5 B;  1DMO A;  5PAL A;  3CR2 A;  1NX2 A;  3EVV A;  2ZRS A;  3TZ1 A;  1KK7 Z;  1A03 A;  1RFJ A;  1LXF C;  2CT9 A;  5DKN A;  1QJT A;  2LAN A;  1XFZ O;  3EK8 A;  3D0Y A;  4PCW A;  4F0Z B;  1NCX A;  4MVF A;  1DJI A;  2B1U A;  1A29 A;  1IH0 A;  2PAS A;  2F2O A;  2H61 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...