1NP8A

18-k c-terminally trunucated small subunit of calpain
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
149
structure length
149
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calcium-dependent protease, small subunit
publication title A second binding site revealed by C-terminal truncation of calpain small subunit, a penta-EF-hand protein
pubmed doi rcsb
source organism Rattus norvegicus
total genus 58
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1np8A00
2BCBA 5JJGA 2B1UA 1MHOA 1UHHA 1S1EA 1K9PA 4GGFC 1YRUB 1YVLA 1RTP1 1UHIA 1UURA 1K95A 2F3YA 4ICBA 3E3RA 2LVJA 2LNKA 4QJ4B 2MA2A 4D1EA 5FYXA 2AUCA 1KSOA 1JBAA 5I2LA 1OQPA 1RFJA 3BOWB 2LUCA 2MHHA 2F2PA 1QLSA 4PHJA 4XYNA 1A4PA 3DF0A 5HLOA 2A4JA 2HQWA 4YI9A 1IRJA 1ZUZA 3LK1A 2I94A 2ZRTA 5I8NA 2H2KA 1K96A 1B4CA 2LMVA 2I18A 1TN4A 1K94A 1LVCD 2KAVA 3ZWHA 1CFCA 1QS7A 2WOSA 1BMOA 2KFFA 4P5OE 4ETOA 1DJHA 4A4BA 2KAYA 3LL8B 1WRKA 3LCPC 1M39A 1YX7A 3M0WA 1YX8A 2OPOA 4P2YB 3MSEB 3SIAA 2L98A 2JPTA 3CR5X 1DJXA 1S5GZ 3EK7A 1YUUA 4PDZA 4BY5A 1SMGA 1AJ4A 2MLFC 4GFTA 3EVRA 2LV7A 2BKHB 2TN4A 4PE1A 1F71A 4DIRA 1GJYA 2L4HA 2WCEA 4YGDB 2PRUA 3FIAA 1CLMA 2JNXA 3EKHA 5ER4X 5AFPA 1CLBA 2V53A 4M2OA 1KQVA 5F6TA 2M29A 4GPLB 1S36A 2DOQA 2BBNA 2COLB 1QASA 1JF0A 1UHNA 5PALA 4YGCB 2I2RE 4JWQA 2KNEA 2WC8A 2KQYA 1DGVA 1N0YA 2JNFA 3CTNA 1J55A 3DVKA 3GK4X 2L2EA 2KYFA 3KEVA 2CTNA 1ZMZA 1QLKA 1B9AA 2M1KB 1J7QA 2L0PA 3SG5A 3D10A 1PVAA 1IQ3A 2BCAA 2H61C 1E8AA 1TCOB 1S3PA 1X02A 5CSFA 3OX5A 4PE4A 3VROA 2LVVA 4M2PA 2JU0A 2LANA 1JUOA 2G9BA 4DRWA 4USLA 1FF1A 2VRGA 1F4OA 1QJTA 1NPQA 4GUKA 4ORAB 1LA3A 1SCMB 2JXLA 1QVIZ 1SCMC 2K7DA 1JC2A 3FWCA 4DUQA 1QXPA 3DVEA 5HLVA 3CS1A 5I2OA 1TCFA 4MN0A 1TNXA 2JC2A 3AKAA 2LAPA 3TDIA 4GAOA 4MBEA 4MZJA 3SG6A 5KU1A 1JFKA 1IKUA 1S26D 2Q91A 1XFXO 1B8LA 1IGVA 1RECA 1AP4A 2K8MB 1EJ3A 1WY9A 1JF2A 3BUNB 3CLNA 3ZNIA 1L2OB 1OZOA 2BECA 1L2OC 3O6BA 1L7ZA 1SBJA 3TUYB 2MRDA 1CLLA 3TUYC 4ORBB 2BBMA 2G2BA 1K9UA 4I5LB 3D0YB 4R1EA 1S6CA 1C7WA 1DF0B 2LHLA 1PULA 2LMTA 1F4QA 1YR5A 1UHJA 1XFWO 1LXFC 1OOJA 4HREE 4M2QA 4NDDA 3LLEA 4YRUA 1G33A 3PM8A 1SNLA 2EGDA 3KF9A 4PHKA 1MR8A 3TS5B 1H4BA 2D8NA 4N5XA 3TS5C 1G8IA 2L5XB 2KHNA 3C1VA 4C0KA 1XK4A 2KYCA 2PMYA 1TRFA 2O60A 1ZOTB 1B8CA 1Q80A 1KSMA 4BY4A 2KGRA 4DCKA 1OMRA 3NSKA 1MXLC 3QRXA 2ZKMX 4AOMA 1OMDA 2JTTA 1F8HA 2E30A 2LC5A 1V1GA 1IQ5A 1QTXA 2KAXA 1UHKA 1KFUS 1PVBA 1YUSA 3SG2A 2KSPA 4FQOA 1CFFA 4JPZB 2LVIA 1BR4B 4I5KA 2JWWA 1SCVA 1CDPA 4PCWA 1V1FA 5HKYA 4JQ0D 3H4SE 1U5IA 3EVUA 1EG3A 1B7TZ 1BR1B 1BODA 2K2FA 5AANA 2CNPA 2F2OA 2HQ8A 3BUWB 1RJVA 3OB2B 4N1FA 5AEQA 1XO5A 1SY9A 2MLEC 1WLZA 4PE7A 1MWNA 2KI4B 2KFGA 2KI4C 1K9KA 4GGFA 4GNKB 4FTGA 1ODBA 3DD4A 3I5FB 4GGNA 3I5FC 1OMVA 4ORCB 1S6JA 1SR6B 3A4UB 4NDBA 1SR6C 1GGZA 4MLWA 1SYMA 4PHMA 4MVFA 2LE9B 2E6WA 1WLMA 2ZN8A 2K7BA 3RLZA 1NUBA 2IS9A 2JZIA 1Y6WA 2LLUA 1PK0D 1K2HA 4PHNA 1JSAA 1KCYA 1YURA 2KOTA 2BKIB 1CNPA 4WQ2A 2Y1MA 4IL1A 4C0JA 1SW8A 2FCDA 1CFPA 3WNXB 1QIVA 5DKRA 1A75A 1BJFA 4XJKB 4UPGA 2WCBA 3AAKA 1EG4A 2KBMA 5JOLA 3TZ1A 1CMFA 1QX7A 2K7CA 4CLNA 4Q04A 2WNDA 1S5GY 2MAZA 3F45A 3ICBA 2K2AA 4I5NB 3EK8A 1IG5A 2NZ0A 2JXCA 2L4IA 4NQGA 1K8UA 3KO0A 4PE0A 2CXJA 1A29A 4OR9B 2LUXA 2M0RA 5KTYA 4YGAA 1SPYA 1M31A 1AUIB 1KK7Z 4YI8A 1EH2A 1KFXS 2PASA 1YRTB 4WRIA 3RM1A 1QV0A 3SJSA 3NSLA 2PALA 2ISDA 2PSRA 1BU3A 3FS7A 1CM4A 3PLFB 3K21A 2QPTA 3CR4X 1XA5A 1PSBA 2KI6D 3KHEA 1RROA 4DS7A 1A03A 1CDNA 2PVBA 2SASA 3I5IB 3I5IC 2M7LA 1J7OA 1XFVO 1J1DA 1K93D 2JULA 3VRQA 1CDLA 1XK4C 2M9GA 1UP5A 4MEWA 4TNCA 5HKWA 3GOFA 4AQIA 3VRNA 1W7JB 5DKQA 5K89A 3DF0B 1M63B 2P6BB 2JT3A 2NCOA 3CR2A 3I5HB 1G4YR 4N1GA 3I5HC 1IJ5A 1YVHA 2LLTA 4CPVA 4YBHB 4YGBB 2Q4UA 1C07A 2H61A 3DVJA 4OCIA 1FBVA 2OS8B 5HYDA 2OS8C 4F0ZB 5HKZA 3O4YA 1TNPA 3IF7A 4C0LA 1WRLA 2FOTA 1CB1A 1QIWA 1ZFSA 1QVIY 1D1OA 5AXIA 1SRAA 1NCZA 1IWQA 2EC6B 2EC6C 2LLSA 2K7OA 1TOPA 1DJZA 3KPXA 1IJ6A 1U5IB 4QJ5B 1NX0A 2LCPA 2M1UA 1ALWA 3CWGA 3PFVA 4YGEB 4ZCVA 2RGIA 1N65A 2BL0B 2Y1NA 1BLQA 1KFUL 2BL0C 1N2DA 2GGZA 2Y4QA 2K61A 1NIWA 1OZSA 2ZFDA 4GBAA 4HRHA 5ER5A 3IQOA 1AJ5A 1ALVA 1UUSA 1RK9A 2FCEA 1AHRA 1PALA 5TNCA 2HETA 1XYDA 2GGMA 1A2XA 2JTZA 2ZRSA 3WHUB 3WXAA 1SL9A 2HPSA 2JT8A 2KFHA 3SG4A 4CFQA 2SCPA 4OKHA 1FI6A 1LA0A 3BYAA 1K90D 1CKKA 4E68A 1MXEA 3JVTB 5DKNA 1YTZC 3JVTC 1W7IB 1CTRA 1NP8A 3D0YA 1NX3A 1DF0A 1TIZA 3EKJA 1C7VA 4MZLA 4MSPA 1HQVA 1WDCB 3BQ3A 1WDCC 3EK4A 1EXRA 1Y0VH 1TTXA 1A75B 2WORA 4WQ3A 5D69A 2Y5IA 3TDUA 3OX6A 3BXKA 1BF5A 2BCXA 3VRPA 1FPWA 1B1GA 4OVNF 3NSOA 1JFJA 3O2PA 3LK0A 1DJGA 2I7AA 3VRRA 1GGWA 1PRWA 2ZNEA 2M8UA 3I5GB 2NXQA 2FJUB 1PSRA 3I5GC 1QX5B 1F55A 2HF5A 3BOWA 1Y1AA 2M3WA 2O5GA 1XFZO 2LP3A 4PALA 4HRGA 5CSJA 2R2IA 3NSIA 1M45A 1CFDA 2NLNA 3BUMB 1NWDA 1WRZA 3FWBA 1RWYA 3PATA 2CT9A 4I5JA 2MJWB 2EHBA 2LVKA 1F54A 1CMGA 5CSIA 1NCXA 1H8BA 1R6PA 1DGUA 1BT6A 3SG3A 1B7TY 5KSZA 2F3ZA 2M97A 2CBLA 5BPJA 1F70A 1B47A 1FI5A 4ZCUA 2KGBC 1MUXA 5CPVA 1DJIA 1KFXL 3NXAA 1NX1A 1AVSA 2ZNDA 2MBXA 1NSHA 2L50A 2M49B 3HX4A 1J1EA 1SK6D 3DVMA 2L51A 1KWOB 3IQQA 1DJYA 1KWOC 3HCMA 2KQ6A 3A8RA 1SKTA 2JOJA 1NYAA 1Y1UA 3PALA 4HSZA 1AK8A 4NDCA 1QATA 2K0JA 1CDMA 4AQJA 5IBWA 1J7RA 2CCMA 1DVIA 1MF8B 3JTDB 1HT9A 1XFUO 3JTDC 1KQMB 2WCFA 1TNQA 3PN7C 1KQMC 3PN7B 3SIBA 3CGAA 2KDHA 2GV5A 1NCYA 1S6IA 2AMIA 5J3XA 4MZKA 3AKBA 2KBIA 1BOCA 1LINA 3PSRA 3OB1B 1BG1A 2LHIA 2QACA 1LKJA 1DMOA 1QV1A 2JQ6A 1OSAA 4L9MA 4QJ3B 1R2UA 4CFRA 3GK2A 2OTGB 2BE6A 2LM5A 2OTGC 1GQMA 2KI6C 1TNWA 1Y1XA 3TDZA 1IH0A 1KK8B 4XJKA 1KK8C 2F8PA 3VGOA 1QX2A 1ZACA 3EVVA 1J7PA 1UWOA 5D7FA 3GK1A 1MQ1A 3AAJA 2BE4A 2JRFA 2JT0A 5B8IB 1YUTA 1M46A 2F33A 2LMUA 3WHTB 3OP0A 5GQQC 4MRYA 5I2QA 1DT7B 2NCPA 5AERA 1FW4A 1KK7Y 1JWDA 1B8RA 5CSNA 4U8DA 3SG7A 4OV2A 2ZN9A 1XFYO 5G08A 1VRKA 4MRXA 1SL7A 2LP2A 2M7NA 1DTLA 3BUOB 1OE9B 1EL4A 1XVJA 3CZTX 2AAOA 4A4CA 4CIDA 1CM1A 3O78A 1NX2A 3OHMB 1SL8A 1DJWA 3BUXB
chains in the Genus database with same CATH superfamily
2BCBA 3CZ1A 5JJGA 2B1UA 3K1EA 1MHOA 1UHHA 3D73A 1DC1A 1S1EA 1K9PA 4GGFC 1YRUB 1YVLA 3CZ0A 3N7HA 1RTP1 1UHIA 1UURA 1K95A 2F3YA 3DY9A 4ICBA 3E3RA 4PT1A 2LVJA 2LNKA 4QJ4B 2MA2A 4D1EA 5FYXA 2AUCA 1KSOA 1JBAA 5I2LA 1OQPA 1RFJA 3BOWB 2LUCA 2MHHA 2F2PA 1QLSA 4PHJA 4XYNA 1A4PA 3DF0A 5HLOA 2A4JA 2HQWA 4YI9A 1IRJA 1ZUZA 3LK1A 3B7AA 2I94A 2ZRTA 5I8NA 2H2KA 1K96A 1B4CA 2LMVA 1GM0A 2I18A 1TN4A 1K94A 1LVCD 2KAVA 3ZWHA 1CFCA 1QS7A 2WOSA 1BMOA 2KFFA 4P5OE 5FI6A 4ETOA 1DJHA 4A4BA 2KAYA 3LL8B 1WRKA 3LCPC 1M39A 1YX7A 3M0WA 1YX8A 2OPOA 4P2YB 3MSEB 3SIAA 2L98A 2JPTA 3CR5X 1DJXA 1S5GZ 3EK7A 3FE6A 4JD9A 1YUUA 4PDZA 4BY5A 1SMGA 2H8VA 3R1PA 1AJ4A 2MLFC 4GFTA 3EVRA 2LV7A 2BKHB 2TN4A 4PE1A 1F71A 4DIRA 1GJYA 2L4HA 2WCEA 4YGDB 2PRUA 3FIAA 3S0FA 1CLMA 2JNXA 3EKHA 5ER4X 5AFPA 3L47A 1CLBA 2V53A 2PQLA 4M2OA 1KQVA 1C3ZA 5F6TA 1P28A 2M29A 4GPLB 1S36A 2DOQA 2BBNA 2COLB 1QASA 1JF0A 1UHNA 5PALA 4YGCB 2I2RE 4JWQA 2KNEA 2WC8A 2KQYA 3PJIA 1DGVA 1N0YA 2JNFA 3CTNA 1J55A 3DVKA 3GK4X 2L2EA 2KYFA 1TUJA 3KEVA 2CTNA 1ZMZA 1QLKA 1B9AA 2M1KB 3EG5B 1J7QA 2L0PA 3SG5A 3D10A 1PVAA 1IQ3A 2BCAA 2H61C 1E8AA 1TCOB 1S3PA 1X02A 5CSFA 3PM2A 3OX5A 4PE4A 3VROA 2LVVA 4M2PA 2JU0A 3S0GA 2LANA 1JUOA 2G9BA 3FE9A 4DRWA 4USLA 1FF1A 2VRGA 1F4OA 1QJTA 3R1VA 1NPQA 4GUKA 4ORAB 1LA3A 1QWVA 3BJHA 3SS3A 1SCMB 3UNWA 2JXLA 1QVIZ 1SCMC 2K7DA 1JC2A 3FWCA 4DUQA 1QXPA 3DVEA 5HLVA 3CS1A 5I2OA 1TCFA 4MN0A 1TNXA 2JC2A 3AKAA 2LAPA 3TDIA 4GAOA 4MBEA 4MZJA 3SG6A 5KU1A 1JFKA 1IKUA 1S26D 1W9ZA 2Q91A 1XFXO 1B8LA 1IGVA 1RECA 1AP4A 2K8MB 1EJ3A 1WY9A 1JF2A 3BUNB 3CLNA 3S0EA 1L2OB 1OZOA 2BECA 3SS5A 1L2OC 3ZNIA 3O6BA 1L7ZA 1SBJA 3TUYB 2MRDA 1CLLA 3TUYC 4ORBB 2BBMA 3UO9A 2G2BA 1K9UA 4I5LB 3D0YB 5FI7A 4R1EA 1S6CA 1C7WA 1DF0B 4IJ7A 2LHLA 1PULA 3DZTA 3CABA 2LMTA 1F4QA 1YR5A 1UHJA 1XFWO 1LXFC 1OOJA 4HREE 4M2QA 4NDDA 3LLEA 4YRUA 1G33A 3PM8A 1SNLA 3B88A 1ORGA 1DQEA 2EGDA 3KF9A 4PHKA 1MR8A 3TS5B 1H4BA 2D8NA 4N5XA 3TS5C 2ERBA 1G8IA 2L5XB 2QDIA 2KHNA 3C1VA 4C0KA 1XK4A 2KYCA 2PMYA 1TRFA 2O60A 1ZOTB 2BNXA 1B8CA 1Q80A 1KSMA 3IVTA 4BY4A 2KGRA 4DCKA 1OMRA 3S0AA 3NSKA 1MXLC 3FE8A 3QRXA 2ZKMX 4AOMA 1OMDA 2K60A 2JTTA 2WCJA 1Z2CB 3R72A 2E30A 2LC5A 1F8HA 3BFHA 1V1GA 1IQ5A 1QTXA 2KAXA 1UHKA 1KFUS 1PVBA 1YUSA 3OGNA 3SG2A 2KSPA 4FQOA 1CFFA 3RZSA 2KLEA 4JPZB 2LVIA 1BR4B 4I5KA 2JWWA 4JKTA 1SCVA 1CDPA 4PCWA 3BFBA 1V1FA 5HKYA 4JQ0D 3H4SE 1U5IA 3EVUA 2WCLA 1EG3A 1B7TZ 1BR1B 1BODA 3L4AA 3CZ2A 2K2FA 3V2LA 5AANA 2CNPA 2F2OA 2WC6A 2HQ8A 3BUWB 1RJVA 2P70A 3OB2B 4N1FA 5AEQA 1XO5A 1SY9A 2MLEC 1WLZA 4PE7A 1MWNA 2KI4B 2KFGA 2KI4C 1K9KA 3NHIA 4GGFA 5HL1A 3CYZA 4GNKB 4FTGA 1ODBA 3DD4A 3I5FB 2FJYA 4GGNA 3I5FC 1OMVA 1DELA 4ORCB 1S6JA 1SR6B 3A4UB 4NDBA 3D78A 1SR6C 1GGZA 4MLWA 1SYMA 4PHMA 4MVFA 2LE9B 2E6WA 1WLMA 2ZN8A 2K7BA 3RLZA 1NUBA 1SSEB 2IS9A 1Y6WA 2JZIA 1PK0D 2LLUA 3QMEA 4PHNA 1JSAA 1KCYA 1YURA 2KOTA 2BKIB 1OOGA 3D76A 1CNPA 4WQ2A 2Y1MA 4IL1A 4C0JA 1C3YA 1SW8A 3OBVA 2FCDA 1CFPA 3WNXB 1QIVA 5DKRA 1A75A 1BJFA 4F7FA 2KLDA 4XJKB 4UPGA 2WCBA 1OOIX 3AAKA 1EG4A 2KBMA 2KPHA 5JOLA 3TZ1A 1QX7A 2K7CA 4CLNA 2WC5A 1CMFA 4Q04A 2WNDA 1S5GY 2MAZA 3F45A 3ICBA 2K2AA 4I5NB 3L4LA 3EK8A 1IG5A 2NZ0A 2JXCA 2L4IA 4NQGA 1K8UA 3KO0A 4PE0A 3DXLA 2CXJA 1A29A 4OR9B 2LUXA 2M0RA 2PYQA 3CDNA 1SPYA 4YGAA 5KTYA 1M31A 1AUIB 1KK7Z 4YI8A 1EH2A 1KFXS 2PASA 1YRTB 4WRIA 3RM1A 1QV0A 3SJSA 3NSLA 2PALA 1T14A 2ISDA 2PSRA 1BU3A 3FS7A 1CM4A 3PLFB 3K21A 2QPTA 3CR4X 1XA5A 1PSBA 5D3OA 5I94A 2WCKA 2KI6D 3KHEA 1RROA 4DS7A 1A03A 1CDNA 2PVBA 2SASA 3I5IB 3I5IC 2M7LA 1J7OA 1XFVO 1J1DA 1K93D 2JULA 3VRQA 1CDLA 1XK4C 2M9GA 1UP5A 4MEWA 4TNCA 5HKWA 3GOFA 4AQIA 3D77A 3VRNA 2L5YA 1W7JB 5DKQA 5K89A 3DF0B 1M63B 2P6BB 2JT3A 2NCOA 3CR2A 3I5HB 1G4YR 4N1GA 3I5HC 1IJ5A 1TWOA 1YVHA 2LLTA 4CPVA 4YBHB 4YGBB 1BLQA 2Q4UA 1C07A 2H61A 3DVJA 2QEBA 4OCIA 1FBVA 2OS8B 5HYDA 2OS8C 4F0ZB 1OW4A 5HKZA 3O4YA 1TNPA 2JPOA 3IF7A 4C0LA 1WRLA 2FOTA 1CB1A 1QIWA 1ZFSA 3NGVA 1QVIY 2QEHA 1D1OA 5AXIA 1SRAA 1NCZA 1IWQA 2EC6B 2EC6C 2LLSA 2K7OA 1TOPA 1DJZA 3KPXA 1IJ6A 1U5IB 5EL2A 4QJ5B 1NX0A 2LCPA 2M1UA 1ALWA 2P71A 3CWGA 3PFVA 4YGEB 2RGIA 1N65A 2BL0B 2Y1NA 4ZCVA 1KFUL 2BL0C 1N2DA 2QEOA 2GGZA 2Y4QA 2K61A 5DICA 1NIWA 1OZSA 2ZFDA 4GBAA 4HRHA 5ER5A 3IQOA 1TUZA 1AJ5A 1ALVA 1UUSA 1RK9A 2FCEA 1AHRA 1PALA 5TNCA 2HETA 1XYDA 2GGMA 1A2XA 2JTZA 2ZRSA 3WHUB 3WXAA 1SL9A 2HPSA 2JT8A 2KFHA 2QEVA 3SG4A 2SCPA 4CFQA 4OKHA 1FI6A 1LA0A 3BYAA 1K90D 1CKKA 4E68A 1MXEA 3JVTB 5DKNA 1YTZC 3JVTC 1W7IB 1CTRA 1NP8A 3D0YA 3S0BA 1NX3A 1DF0A 1TIZA 3EKJA 5FI2A 1C7VA 4MZLA 4MSPA 1HQVA 1WDCB 2YGUA 3BQ3A 1WDCC 1OOHA 3EK4A 2L2CA 1EXRA 3DYEA 1Y0VH 1TTXA 1A75B 2WORA 4WQ3A 5D69A 2Y5IA 3TDUA 3OX6A 3BXKA 1XFRA 4INWA 1BF5A 2BCXA 3VRPA 1FPWA 1B1GA 4OVNF 3NSOA 1JFJA 3O2PA 3LK0A 1DJGA 2I7AA 3VRRA 1GGWA 1PRWA 2ZNEA 2M8UA 3I5GB 2NXQA 2FJUB 1PSRA 3I5GC 1QX5B 1F55A 2HF5A 3BOWA 1Y1AA 3O4XA 2M3WA 2O5GA 1XFZO 2LP3A 4PALA 4HRGA 5CSJA 2R2IA 3NSIA 1M45A 1CFDA 2NLNA 3BUMB 1NWDA 1WRZA 3FWBA 1RWYA 3PATA 2CT9A 4I5JA 2MJWB 2EHBA 2LVKA 1F54A 2BAPA 5CSIA 1CMGA 1NCXA 2WCMA 1R6PA 1DGUA 3B86A 1H8BA 1BT6A 3SG3A 1B7TY 5KSZA 2F3ZA 2M97A 2CBLA 5BPJA 1F70A 1B47A 1FI5A 3NHTA 2KGBC 4ZCUA 1MUXA 5CPVA 1DJIA 1KFXL 3NXAA 1NX1A 1AVSA 2ZNDA 2MBXA 1NSHA 4OZDA 2L50A 2M49B 3HX4A 1J1EA 1SK6D 3DVMA 1OOFA 1KWOB 2L51A 1DJYA 3B87A 1KWOC 3IQQA 3HCMA 3S0DA 2KQ6A 3A8RA 1SKTA 2JOJA 1NYAA 1Y1UA 3BFAA 3PALA 4HSZA 4NDCA 1QATA 2K0JA 1CDMA 4AQJA 5IBWA 1AK8A 1J7RA 2CCMA 1DVIA 1MF8B 3JTDB 1HT9A 1XFUO 3JTDC 1KQMB 2WCFA 1TNQA 3PN7C 1KQMC 3PN7B 3SIBA 1LS8A 1Z4HA 3CGAA 2KDHA 2GV5A 1NCYA 1S6IA 2AMIA 5J3XA 4MZKA 3AKBA 2KBIA 1BOCA 1LINA 3PSRA 3SS4A 3D74A 4FQTA 3OB1B 1BG1A 2LHIA 3Q8IA 2QACA 1LKJA 1DMOA 1QV1A 2JQ6A 1OSAA 4L9MA 4QJ3B 1K2HA 3R1OA 3VB1A 1DEKA 1R2UA 4CFRA 3GK2A 2OTGB 2BE6A 2LM5A 2OTGC 1GQMA 2KI6C 1IIOA 1TNWA 1Y1XA 3TDZA 1IH0A 1KK8B 4XJKA 1KK8C 2F8PA 3B6XA 3VGOA 1QX2A 1ZACA 3EVVA 4KYNA 1J7PA 1UWOA 5D7FA 2GTEA 1MQ1A 3AAJA 3GK1A 2BE4A 2JRFA 2JT0A 5B8IB 1YUTA 1M46A 2F33A 2LMUA 3WHTB 3OP0A 5GQQC 4MRYA 5I2QA 1DT7B 2NCPA 5AERA 1FW4A 1KK7Y 3D75A 1B8RA 1JWDA 5CSNA 4INXA 4U8DA 3SG7A 4OV2A 2WCHA 1XFYO 2ZN9A 5G08A 1VRKA 4MRXA 1SL7A 2LP2A 2M7NA 1DTLA 3BUOB 1OE9B 1EL4A 1XVJA 3CZTX 2AAOA 4A4CA 4CIDA 1CM1A 3O78A 1NX2A 3OHMB 1SL8A 1DJWA 3BUXB
chains in the Genus database with same CATH topology
2BCBA 5JJGA 2B1UA 1MHOA 1UHHA 1S1EA 1K9PA 4GGFC 1YRUB 1YVLA 1RTP1 1UHIA 1UURA 1K95A 2F3YA 4ICBA 3E3RA 2LVJA 2LNKA 4QJ4B 2MA2A 4D1EA 5FYXA 2AUCA 1KSOA 1JBAA 5I2LA 1OQPA 1RFJA 3BOWB 2LUCA 2MHHA 2F2PA 1QLSA 4PHJA 4XYNA 1A4PA 3DF0A 5HLOA 2A4JA 2HQWA 4YI9A 1IRJA 1ZUZA 3LK1A 2I94A 2ZRTA 5I8NA 2H2KA 1K96A 1B4CA 2LMVA 2I18A 1TN4A 1K94A 1LVCD 2KAVA 3ZWHA 1CFCA 1QS7A 2WOSA 1BMOA 2KFFA 4P5OE 4ETOA 1DJHA 4A4BA 2KAYA 3LL8B 1WRKA 3LCPC 1M39A 1YX7A 3M0WA 1YX8A 2OPOA 4P2YB 3MSEB 3SIAA 2L98A 2JPTA 3CR5X 1DJXA 1S5GZ 3EK7A 1YUUA 4PDZA 4BY5A 1SMGA 1AJ4A 2MLFC 4GFTA 3EVRA 2LV7A 2BKHB 2TN4A 4PE1A 1F71A 4DIRA 1GJYA 2L4HA 2WCEA 4YGDB 2PRUA 3FIAA 1CLMA 2JNXA 3EKHA 5ER4X 5AFPA 1CLBA 2V53A 4M2OA 1KQVA 5F6TA 2M29A 4GPLB 1S36A 2DOQA 2BBNA 2COLB 1QASA 1JF0A 1UHNA 5PALA 4YGCB 2I2RE 4JWQA 2KNEA 2WC8A 2KQYA 1DGVA 1N0YA 2JNFA 3CTNA 1J55A 3DVKA 3GK4X 2L2EA 2KYFA 3KEVA 2CTNA 1ZMZA 1QLKA 1B9AA 2M1KB 1J7QA 2L0PA 3SG5A 3D10A 1PVAA 1IQ3A 2BCAA 2H61C 1E8AA 1TCOB 1S3PA 1X02A 5CSFA 3OX5A 4PE4A 3VROA 2LVVA 4M2PA 2JU0A 2LANA 1JUOA 2G9BA 4DRWA 4USLA 1FF1A 2VRGA 1F4OA 1QJTA 1NPQA 4GUKA 4ORAB 1LA3A 1SCMB 2JXLA 1QVIZ 1SCMC 2K7DA 1JC2A 3FWCA 4DUQA 1QXPA 3DVEA 5HLVA 3CS1A 5I2OA 1TCFA 4MN0A 1TNXA 2JC2A 3AKAA 2LAPA 3TDIA 4GAOA 4MBEA 4MZJA 3SG6A 5KU1A 1JFKA 1IKUA 1S26D 2Q91A 1XFXO 1B8LA 1IGVA 1RECA 1AP4A 2K8MB 1EJ3A 1WY9A 1JF2A 3BUNB 3CLNA 3ZNIA 1L2OB 1OZOA 2BECA 1L2OC 3O6BA 1L7ZA 1SBJA 3TUYB 2MRDA 1CLLA 3TUYC 4ORBB 2BBMA 2G2BA 1K9UA 4I5LB 3D0YB 4R1EA 1S6CA 1C7WA 1DF0B 2LHLA 1PULA 2LMTA 1F4QA 1YR5A 1UHJA 1XFWO 1LXFC 1OOJA 4HREE 4M2QA 4NDDA 3LLEA 4YRUA 1G33A 3PM8A 1SNLA 2EGDA 3KF9A 4PHKA 1MR8A 3TS5B 1H4BA 2D8NA 4N5XA 3TS5C 1G8IA 2L5XB 2KHNA 3C1VA 4C0KA 1XK4A 2KYCA 2PMYA 1TRFA 2O60A 1ZOTB 1B8CA 1Q80A 1KSMA 4BY4A 2KGRA 4DCKA 1OMRA 3NSKA 1MXLC 3QRXA 2ZKMX 4AOMA 1OMDA 2JTTA 1F8HA 2E30A 2LC5A 1V1GA 1IQ5A 1QTXA 2KAXA 1UHKA 1KFUS 1PVBA 1YUSA 3SG2A 2KSPA 4FQOA 1CFFA 4JPZB 2LVIA 1BR4B 4I5KA 2JWWA 1SCVA 1CDPA 4PCWA 1V1FA 5HKYA 4JQ0D 3H4SE 1U5IA 3EVUA 1EG3A 1B7TZ 1BR1B 1BODA 2K2FA 5AANA 2CNPA 2F2OA 2HQ8A 3BUWB 1RJVA 3OB2B 4N1FA 5AEQA 1XO5A 1SY9A 2MLEC 1WLZA 4PE7A 1MWNA 2KI4B 2KFGA 2KI4C 1K9KA 4GGFA 4GNKB 4FTGA 1ODBA 3DD4A 3I5FB 4GGNA 3I5FC 1OMVA 4ORCB 1S6JA 1SR6B 3A4UB 4NDBA 1SR6C 1GGZA 4MLWA 1SYMA 4PHMA 4MVFA 2LE9B 2E6WA 1WLMA 2ZN8A 2K7BA 3RLZA 1NUBA 2IS9A 2JZIA 1Y6WA 2LLUA 1PK0D 1K2HA 4PHNA 1JSAA 1KCYA 1YURA 2KOTA 2BKIB 1CNPA 4WQ2A 2Y1MA 4IL1A 4C0JA 1SW8A 2FCDA 1CFPA 3WNXB 1QIVA 5DKRA 1A75A 1BJFA 4XJKB 4UPGA 2WCBA 3AAKA 1EG4A 2KBMA 5JOLA 3TZ1A 1CMFA 1QX7A 2K7CA 4CLNA 4Q04A 2WNDA 1S5GY 2MAZA 3F45A 3ICBA 2K2AA 4I5NB 3EK8A 1IG5A 2NZ0A 2JXCA 2L4IA 4NQGA 1K8UA 3KO0A 4PE0A 2CXJA 1A29A 4OR9B 2LUXA 2M0RA 5KTYA 4YGAA 1SPYA 1M31A 1AUIB 1KK7Z 4YI8A 1EH2A 1KFXS 2PASA 1YRTB 4WRIA 3RM1A 1QV0A 3SJSA 3NSLA 2PALA 2ISDA 2PSRA 1BU3A 3FS7A 1CM4A 3PLFB 3K21A 2QPTA 3CR4X 1XA5A 1PSBA 2KI6D 3KHEA 1RROA 4DS7A 1A03A 1CDNA 2PVBA 2SASA 3I5IB 3I5IC 2M7LA 1J7OA 1XFVO 1J1DA 1K93D 2JULA 3VRQA 1CDLA 1XK4C 2M9GA 1UP5A 4MEWA 4TNCA 5HKWA 3GOFA 4AQIA 3VRNA 1W7JB 5DKQA 5K89A 3DF0B 1M63B 2P6BB 2JT3A 2NCOA 3CR2A 3I5HB 1G4YR 4N1GA 3I5HC 1IJ5A 1YVHA 2LLTA 4CPVA 4YBHB 4YGBB 2Q4UA 1C07A 2H61A 3DVJA 4OCIA 1FBVA 2OS8B 5HYDA 2OS8C 4F0ZB 5HKZA 3O4YA 1TNPA 3IF7A 4C0LA 1WRLA 2FOTA 1CB1A 1QIWA 1ZFSA 1QVIY 1D1OA 5AXIA 1SRAA 1NCZA 1IWQA 2EC6B 2EC6C 2LLSA 2K7OA 1TOPA 1DJZA 3KPXA 1IJ6A 1U5IB 4QJ5B 1NX0A 2LCPA 2M1UA 1ALWA 3CWGA 3PFVA 4YGEB 4ZCVA 2RGIA 1N65A 2BL0B 2Y1NA 1BLQA 1KFUL 2BL0C 1N2DA 2GGZA 2Y4QA 2K61A 1NIWA 1OZSA 2ZFDA 4GBAA 4HRHA 5ER5A 3IQOA 1AJ5A 1ALVA 1UUSA 1RK9A 2FCEA 1AHRA 1PALA 5TNCA 2HETA 1XYDA 2GGMA 1A2XA 2JTZA 2ZRSA 3WHUB 3WXAA 1SL9A 2HPSA 2JT8A 2KFHA 3SG4A 4CFQA 2SCPA 4OKHA 1FI6A 1LA0A 3BYAA 1K90D 1CKKA 4E68A 1MXEA 3JVTB 5DKNA 1YTZC 3JVTC 1W7IB 1CTRA 1NP8A 3D0YA 1NX3A 1DF0A 1TIZA 3EKJA 1C7VA 4MZLA 4MSPA 1HQVA 1WDCB 3BQ3A 1WDCC 3EK4A 1EXRA 1Y0VH 1TTXA 1A75B 2WORA 4WQ3A 5D69A 2Y5IA 3TDUA 3OX6A 3BXKA 1BF5A 2BCXA 3VRPA 1FPWA 1B1GA 4OVNF 3NSOA 1JFJA 3O2PA 3LK0A 1DJGA 2I7AA 3VRRA 1GGWA 1PRWA 2ZNEA 2M8UA 3I5GB 2NXQA 2FJUB 1PSRA 3I5GC 1QX5B 1F55A 2HF5A 3BOWA 1Y1AA 2M3WA 2O5GA 1XFZO 2LP3A 4PALA 4HRGA 5CSJA 2R2IA 3NSIA 1M45A 1CFDA 2NLNA 3BUMB 1NWDA 1WRZA 3FWBA 1RWYA 3PATA 2CT9A 4I5JA 2MJWB 2EHBA 2LVKA 1F54A 1CMGA 5CSIA 1NCXA 1H8BA 1R6PA 1DGUA 1BT6A 3SG3A 1B7TY 5KSZA 2F3ZA 2M97A 2CBLA 5BPJA 1F70A 1B47A 1FI5A 4ZCUA 2KGBC 1MUXA 5CPVA 1DJIA 1KFXL 3NXAA 1NX1A 1AVSA 2ZNDA 2MBXA 1NSHA 2L50A 2M49B 3HX4A 1J1EA 1SK6D 3DVMA 2L51A 1KWOB 3IQQA 1DJYA 1KWOC 3HCMA 2KQ6A 3A8RA 1SKTA 2JOJA 1NYAA 1Y1UA 3PALA 4HSZA 1AK8A 4NDCA 1QATA 2K0JA 1CDMA 4AQJA 5IBWA 1J7RA 2CCMA 1DVIA 1MF8B 3JTDB 1HT9A 1XFUO 3JTDC 1KQMB 2WCFA 1TNQA 3PN7C 1KQMC 3PN7B 3SIBA 3CGAA 2KDHA 2GV5A 1NCYA 1S6IA 2AMIA 5J3XA 4MZKA 3AKBA 2KBIA 1BOCA 1LINA 3PSRA 3OB1B 1BG1A 2LHIA 2QACA 1LKJA 1DMOA 1QV1A 2JQ6A 1OSAA 4L9MA 4QJ3B 1R2UA 4CFRA 3GK2A 2OTGB 2BE6A 2LM5A 2OTGC 1GQMA 2KI6C 1TNWA 1Y1XA 3TDZA 1IH0A 1KK8B 4XJKA 1KK8C 2F8PA 3VGOA 1QX2A 1ZACA 3EVVA 1J7PA 1UWOA 5D7FA 3GK1A 1MQ1A 3AAJA 2BE4A 2JRFA 2JT0A 5B8IB 1YUTA 1M46A 2F33A 2LMUA 3WHTB 3OP0A 5GQQC 4MRYA 5I2QA 1DT7B 2NCPA 5AERA 1FW4A 1KK7Y 1JWDA 1B8RA 5CSNA 4U8DA 3SG7A 4OV2A 2ZN9A 1XFYO 5G08A 1VRKA 4MRXA 1SL7A 2LP2A 2M7NA 1DTLA 3BUOB 1OE9B 1EL4A 1XVJA 3CZTX 2AAOA 4A4CA 4CIDA 1CM1A 3O78A 1NX2A 3OHMB 1SL8A 1DJWA 3BUXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCB A;  5JJG A;  2B1U A;  1MHO A;  1UHH A;  1S1E A;  1K9P A;  4GGF C;  1YRU B;  1YVL A;  1RTP 1;  1UHI A;  1UUR A;  1K95 A;  2F3Y A;  4ICB A;  3E3R A;  2LVJ A;  2LNK A;  4QJ4 B;  2MA2 A;  4D1E A;  5FYX A;  2AUC A;  1KSO A;  1JBA A;  5I2L A;  1OQP A;  1RFJ A;  3BOW B;  2LUC A;  2MHH A;  2F2P A;  1QLS A;  4PHJ A;  4XYN A;  1A4P A;  3DF0 A;  5HLO A;  2A4J A;  2HQW A;  4YI9 A;  1IRJ A;  1ZUZ A;  3LK1 A;  2I94 A;  2ZRT A;  5I8N A;  2H2K A;  1K96 A;  1B4C A;  2LMV A;  2I18 A;  1TN4 A;  1K94 A;  1LVC D;  2KAV A;  3ZWH A;  1CFC A;  1QS7 A;  2WOS A;  1BMO A;  2KFF A;  4P5O E;  4ETO A;  1DJH A;  4A4B A;  2KAY A;  3LL8 B;  1WRK A;  3LCP C;  1M39 A;  1YX7 A;  3M0W A;  1YX8 A;  2OPO A;  4P2Y B;  3MSE B;  3SIA A;  2L98 A;  2JPT A;  3CR5 X;  1DJX A;  1S5G Z;  3EK7 A;  1YUU A;  4PDZ A;  4BY5 A;  1SMG A;  1AJ4 A;  2MLF C;  4GFT A;  3EVR A;  2LV7 A;  2BKH B;  2TN4 A;  4PE1 A;  1F71 A;  4DIR A;  1GJY A;  2L4H A;  2WCE A;  4YGD B;  2PRU A;  3FIA A;  1CLM A;  2JNX A;  3EKH A;  5ER4 X;  5AFP A;  1CLB A;  2V53 A;  4M2O A;  1KQV A;  5F6T A;  2M29 A;  4GPL B;  1S36 A;  2DOQ A;  2BBN A;  2COL B;  1QAS A;  1JF0 A;  1UHN A;  5PAL A;  4YGC B;  2I2R E;  4JWQ A;  2KNE A;  2WC8 A;  2KQY A;  1DGV A;  1N0Y A;  2JNF A;  3CTN A;  1J55 A;  3DVK A;  3GK4 X;  2L2E A;  2KYF A;  3KEV A;  2CTN A;  1ZMZ A;  1QLK A;  1B9A A;  2M1K B;  1J7Q A;  2L0P A;  3SG5 A;  3D10 A;  1PVA A;  1IQ3 A;  2BCA A;  2H61 C;  1E8A A;  1TCO B;  1S3P A;  1X02 A;  5CSF A;  3OX5 A;  4PE4 A;  3VRO A;  2LVV A;  4M2P A;  2JU0 A;  2LAN A;  1JUO A;  2G9B A;  4DRW A;  4USL A;  1FF1 A;  2VRG A;  1F4O A;  1QJT A;  1NPQ A;  4GUK A;  4ORA B;  1LA3 A;  1SCM B;  2JXL A;  1QVI Z;  1SCM C;  2K7D A;  1JC2 A;  3FWC A;  4DUQ A;  1QXP A;  3DVE A;  5HLV A;  3CS1 A;  5I2O A;  1TCF A;  4MN0 A;  1TNX A;  2JC2 A;  3AKA A;  2LAP A;  3TDI A;  4GAO A;  4MBE A;  4MZJ A;  3SG6 A;  5KU1 A;  1JFK A;  1IKU A;  1S26 D;  2Q91 A;  1XFX O;  1B8L A;  1IGV A;  1REC A;  1AP4 A;  2K8M B;  1EJ3 A;  1WY9 A;  1JF2 A;  3BUN B;  3CLN A;  3ZNI A;  1L2O B;  1OZO A;  2BEC A;  1L2O C;  3O6B A;  1L7Z A;  1SBJ A;  3TUY B;  2MRD A;  1CLL A;  3TUY C;  4ORB B;  2BBM A;  2G2B A;  1K9U A;  4I5L B;  3D0Y B;  4R1E A;  1S6C A;  1C7W A;  1DF0 B;  2LHL A;  1PUL A;  2LMT A;  1F4Q A;  1YR5 A;  1UHJ A;  1XFW O;  1LXF C;  1OOJ A;  4HRE E;  4M2Q A;  4NDD A;  3LLE A;  4YRU A;  1G33 A;  3PM8 A;  1SNL A;  2EGD A;  3KF9 A;  4PHK A;  1MR8 A;  3TS5 B;  1H4B A;  2D8N A;  4N5X A;  3TS5 C;  1G8I A;  2L5X B;  2KHN A;  3C1V A;  4C0K A;  1XK4 A;  2KYC A;  2PMY A;  1TRF A;  2O60 A;  1ZOT B;  1B8C A;  1Q80 A;  1KSM A;  4BY4 A;  2KGR A;  4DCK A;  1OMR A;  3NSK A;  1MXL C;  3QRX A;  2ZKM X;  4AOM A;  1OMD A;  2JTT A;  1F8H A;  2E30 A;  2LC5 A;  1V1G A;  1IQ5 A;  1QTX A;  2KAX A;  1UHK A;  1KFU S;  1PVB A;  1YUS A;  3SG2 A;  2KSP A;  4FQO A;  1CFF A;  4JPZ B;  2LVI A;  1BR4 B;  4I5K A;  2JWW A;  1SCV A;  1CDP A;  4PCW A;  1V1F A;  5HKY A;  4JQ0 D;  3H4S E;  1U5I A;  3EVU A;  1EG3 A;  1B7T Z;  1BR1 B;  1BOD A;  2K2F A;  5AAN A;  2CNP A;  2F2O A;  2HQ8 A;  3BUW B;  1RJV A;  3OB2 B;  4N1F A;  5AEQ A;  1XO5 A;  1SY9 A;  2MLE C;  1WLZ A;  4PE7 A;  1MWN A;  2KI4 B;  2KFG A;  2KI4 C;  1K9K A;  4GGF A;  4GNK B;  4FTG A;  1ODB A;  3DD4 A;  3I5F B;  4GGN A;  3I5F C;  1OMV A;  4ORC B;  1S6J A;  1SR6 B;  3A4U B;  4NDB A;  1SR6 C;  1GGZ A;  4MLW A;  1SYM A;  4PHM A;  4MVF A;  2LE9 B;  2E6W A;  1WLM A;  2ZN8 A;  2K7B A;  3RLZ A;  1NUB A;  2IS9 A;  2JZI A;  1Y6W A;  2LLU A;  1PK0 D;  1K2H A;  4PHN A;  1JSA A;  1KCY A;  1YUR A;  2KOT A;  2BKI B;  1CNP A;  4WQ2 A;  2Y1M A;  4IL1 A;  4C0J A;  1SW8 A;  2FCD A;  1CFP A;  3WNX B;  1QIV A;  5DKR A;  1A75 A;  1BJF A;  4XJK B;  4UPG A;  2WCB A;  3AAK A;  1EG4 A;  2KBM A;  5JOL A;  3TZ1 A;  1CMF A;  1QX7 A;  2K7C A;  4CLN A;  4Q04 A;  2WND A;  1S5G Y;  2MAZ A;  3F45 A;  3ICB A;  2K2A A;  4I5N B;  3EK8 A;  1IG5 A;  2NZ0 A;  2JXC A;  2L4I A;  4NQG A;  1K8U A;  3KO0 A;  4PE0 A;  2CXJ A;  1A29 A;  4OR9 B;  2LUX A;  2M0R A;  5KTY A;  4YGA A;  1SPY A;  1M31 A;  1AUI B;  1KK7 Z;  4YI8 A;  1EH2 A;  1KFX S;  2PAS A;  1YRT B;  4WRI A;  3RM1 A;  1QV0 A;  3SJS A;  3NSL A;  2PAL A;  2ISD A;  2PSR A;  1BU3 A;  3FS7 A;  1CM4 A;  3PLF B;  3K21 A;  2QPT A;  3CR4 X;  1XA5 A;  1PSB A;  2KI6 D;  3KHE A;  1RRO A;  4DS7 A;  1A03 A;  1CDN A;  2PVB A;  2SAS A;  3I5I B;  3I5I C;  2M7L A;  1J7O A;  1XFV O;  1J1D A;  1K93 D;  2JUL A;  3VRQ A;  1CDL A;  1XK4 C;  2M9G A;  1UP5 A;  4MEW A;  4TNC A;  5HKW A;  3GOF A;  4AQI A;  3VRN A;  1W7J B;  5DKQ A;  5K89 A;  3DF0 B;  1M63 B;  2P6B B;  2JT3 A;  2NCO A;  3CR2 A;  3I5H B;  1G4Y R;  4N1G A;  3I5H C;  1IJ5 A;  1YVH A;  2LLT A;  4CPV A;  4YBH B;  4YGB B;  2Q4U A;  1C07 A;  2H61 A;  3DVJ A;  4OCI A;  1FBV A;  2OS8 B;  5HYD A;  2OS8 C;  4F0Z B;  5HKZ A;  3O4Y A;  1TNP A;  3IF7 A;  4C0L A;  1WRL A;  2FOT A;  1CB1 A;  1QIW A;  1ZFS A;  1QVI Y;  1D1O A;  5AXI A;  1SRA A;  1NCZ A;  1IWQ A;  2EC6 B;  2EC6 C;  2LLS A;  2K7O A;  1TOP A;  1DJZ A;  3KPX A;  1IJ6 A;  1U5I B;  4QJ5 B;  1NX0 A;  2LCP A;  2M1U A;  1ALW A;  3CWG A;  3PFV A;  4YGE B;  4ZCV A;  2RGI A;  1N65 A;  2BL0 B;  2Y1N A;  1BLQ A;  1KFU L;  2BL0 C;  1N2D A;  2GGZ A;  2Y4Q A;  2K61 A;  1NIW A;  1OZS A;  2ZFD A;  4GBA A;  4HRH A;  5ER5 A;  3IQO A;  1AJ5 A;  1ALV A;  1UUS A;  1RK9 A;  2FCE A;  1AHR A;  1PAL A;  5TNC A;  2HET A;  1XYD A;  2GGM A;  1A2X A;  2JTZ A;  2ZRS A;  3WHU B;  3WXA A;  1SL9 A;  2HPS A;  2JT8 A;  2KFH A;  3SG4 A;  4CFQ A;  2SCP A;  4OKH A;  1FI6 A;  1LA0 A;  3BYA A;  1K90 D;  1CKK A;  4E68 A;  1MXE A;  3JVT B;  5DKN A;  1YTZ C;  3JVT C;  1W7I B;  1CTR A;  1NP8 A;  3D0Y A;  1NX3 A;  1DF0 A;  1TIZ A;  3EKJ A;  1C7V A;  4MZL A;  4MSP A;  1HQV A;  1WDC B;  3BQ3 A;  1WDC C;  3EK4 A;  1EXR A;  1Y0V H;  1TTX A;  1A75 B;  2WOR A;  4WQ3 A;  5D69 A;  2Y5I A;  3TDU A;  3OX6 A;  3BXK A;  1BF5 A;  2BCX A;  3VRP A;  1FPW A;  1B1G A;  4OVN F;  3NSO A;  1JFJ A;  3O2P A;  3LK0 A;  1DJG A;  2I7A A;  3VRR A;  1GGW A;  1PRW A;  2ZNE A;  2M8U A;  3I5G B;  2NXQ A;  2FJU B;  1PSR A;  3I5G C;  1QX5 B;  1F55 A;  2HF5 A;  3BOW A;  1Y1A A;  2M3W A;  2O5G A;  1XFZ O;  2LP3 A;  4PAL A;  4HRG A;  5CSJ A;  2R2I A;  3NSI A;  1M45 A;  1CFD A;  2NLN A;  3BUM B;  1NWD A;  1WRZ A;  3FWB A;  1RWY A;  3PAT A;  2CT9 A;  4I5J A;  2MJW B;  2EHB A;  2LVK A;  1F54 A;  1CMG A;  5CSI A;  1NCX A;  1H8B A;  1R6P A;  1DGU A;  1BT6 A;  3SG3 A;  1B7T Y;  5KSZ A;  2F3Z A;  2M97 A;  2CBL A;  5BPJ A;  1F70 A;  1B47 A;  1FI5 A;  4ZCU A;  2KGB C;  1MUX A;  5CPV A;  1DJI A;  1KFX L;  3NXA A;  1NX1 A;  1AVS A;  2ZND A;  2MBX A;  1NSH A;  2L50 A;  2M49 B;  3HX4 A;  1J1E A;  1SK6 D;  3DVM A;  2L51 A;  1KWO B;  3IQQ A;  1DJY A;  1KWO C;  3HCM A;  2KQ6 A;  3A8R A;  1SKT A;  2JOJ A;  1NYA A;  1Y1U A;  3PAL A;  4HSZ A;  1AK8 A;  4NDC A;  1QAT A;  2K0J A;  1CDM A;  4AQJ A;  5IBW A;  1J7R A;  2CCM A;  1DVI A;  1MF8 B;  3JTD B;  1HT9 A;  1XFU O;  3JTD C;  1KQM B;  2WCF A;  1TNQ A;  3PN7 C;  1KQM C;  3PN7 B;  3SIB A;  3CGA A;  2KDH A;  2GV5 A;  1NCY A;  1S6I A;  2AMI A;  5J3X A;  4MZK A;  3AKB A;  2KBI A;  1BOC A;  1LIN A;  3PSR A;  3OB1 B;  1BG1 A;  2LHI A;  2QAC A;  1LKJ A;  1DMO A;  1QV1 A;  2JQ6 A;  1OSA A;  4L9M A;  4QJ3 B;  1R2U A;  4CFR A;  3GK2 A;  2OTG B;  2BE6 A;  2LM5 A;  2OTG C;  1GQM A;  2KI6 C;  1TNW A;  1Y1X A;  3TDZ A;  1IH0 A;  1KK8 B;  4XJK A;  1KK8 C;  2F8P A;  3VGO A;  1QX2 A;  1ZAC A;  3EVV A;  1J7P A;  1UWO A;  5D7F A;  3GK1 A;  1MQ1 A;  3AAJ A;  2BE4 A;  2JRF A;  2JT0 A;  5B8I B;  1YUT A;  1M46 A;  2F33 A;  2LMU A;  3WHT B;  3OP0 A;  5GQQ C;  4MRY A;  5I2Q A;  1DT7 B;  2NCP A;  5AER A;  1FW4 A;  1KK7 Y;  1JWD A;  1B8R A;  5CSN A;  4U8D A;  3SG7 A;  4OV2 A;  2ZN9 A;  1XFY O;  5G08 A;  1VRK A;  4MRX A;  1SL7 A;  2LP2 A;  2M7N A;  1DTL A;  3BUO B;  1OE9 B;  1EL4 A;  1XVJ A;  3CZT X;  2AAO A;  4A4C A;  4CID A;  1CM1 A;  3O78 A;  1NX2 A;  3OHM B;  1SL8 A;  1DJW A;  3BUX B; 
#chains in the Genus database with same CATH topology
 2BCB A;  3CZ1 A;  5JJG A;  2B1U A;  3K1E A;  1MHO A;  1UHH A;  3D73 A;  1DC1 A;  1S1E A;  1K9P A;  4GGF C;  1YRU B;  1YVL A;  3CZ0 A;  3N7H A;  1RTP 1;  1UHI A;  1UUR A;  1K95 A;  2F3Y A;  3DY9 A;  4ICB A;  3E3R A;  4PT1 A;  2LVJ A;  2LNK A;  4QJ4 B;  2MA2 A;  4D1E A;  5FYX A;  2AUC A;  1KSO A;  1JBA A;  5I2L A;  1OQP A;  1RFJ A;  3BOW B;  2LUC A;  2MHH A;  2F2P A;  1QLS A;  4PHJ A;  4XYN A;  1A4P A;  3DF0 A;  5HLO A;  2A4J A;  2HQW A;  4YI9 A;  1IRJ A;  1ZUZ A;  3LK1 A;  3B7A A;  2I94 A;  2ZRT A;  5I8N A;  2H2K A;  1K96 A;  1B4C A;  2LMV A;  1GM0 A;  2I18 A;  1TN4 A;  1K94 A;  1LVC D;  2KAV A;  3ZWH A;  1CFC A;  1QS7 A;  2WOS A;  1BMO A;  2KFF A;  4P5O E;  5FI6 A;  4ETO A;  1DJH A;  4A4B A;  2KAY A;  3LL8 B;  1WRK A;  3LCP C;  1M39 A;  1YX7 A;  3M0W A;  1YX8 A;  2OPO A;  4P2Y B;  3MSE B;  3SIA A;  2L98 A;  2JPT A;  3CR5 X;  1DJX A;  1S5G Z;  3EK7 A;  3FE6 A;  4JD9 A;  1YUU A;  4PDZ A;  4BY5 A;  1SMG A;  2H8V A;  3R1P A;  1AJ4 A;  2MLF C;  4GFT A;  3EVR A;  2LV7 A;  2BKH B;  2TN4 A;  4PE1 A;  1F71 A;  4DIR A;  1GJY A;  2L4H A;  2WCE A;  4YGD B;  2PRU A;  3FIA A;  3S0F A;  1CLM A;  2JNX A;  3EKH A;  5ER4 X;  5AFP A;  3L47 A;  1CLB A;  2V53 A;  2PQL A;  4M2O A;  1KQV A;  1C3Z A;  5F6T A;  1P28 A;  2M29 A;  4GPL B;  1S36 A;  2DOQ A;  2BBN A;  2COL B;  1QAS A;  1JF0 A;  1UHN A;  5PAL A;  4YGC B;  2I2R E;  4JWQ A;  2KNE A;  2WC8 A;  2KQY A;  3PJI A;  1DGV A;  1N0Y A;  2JNF A;  3CTN A;  1J55 A;  3DVK A;  3GK4 X;  2L2E A;  2KYF A;  1TUJ A;  3KEV A;  2CTN A;  1ZMZ A;  1QLK A;  1B9A A;  2M1K B;  3EG5 B;  1J7Q A;  2L0P A;  3SG5 A;  3D10 A;  1PVA A;  1IQ3 A;  2BCA A;  2H61 C;  1E8A A;  1TCO B;  1S3P A;  1X02 A;  5CSF A;  3PM2 A;  3OX5 A;  4PE4 A;  3VRO A;  2LVV A;  4M2P A;  2JU0 A;  3S0G A;  2LAN A;  1JUO A;  2G9B A;  3FE9 A;  4DRW A;  4USL A;  1FF1 A;  2VRG A;  1F4O A;  1QJT A;  3R1V A;  1NPQ A;  4GUK A;  4ORA B;  1LA3 A;  1QWV A;  3BJH A;  3SS3 A;  1SCM B;  3UNW A;  2JXL A;  1QVI Z;  1SCM C;  2K7D A;  1JC2 A;  3FWC A;  4DUQ A;  1QXP A;  3DVE A;  5HLV A;  3CS1 A;  5I2O A;  1TCF A;  4MN0 A;  1TNX A;  2JC2 A;  3AKA A;  2LAP A;  3TDI A;  4GAO A;  4MBE A;  4MZJ A;  3SG6 A;  5KU1 A;  1JFK A;  1IKU A;  1S26 D;  1W9Z A;  2Q91 A;  1XFX O;  1B8L A;  1IGV A;  1REC A;  1AP4 A;  2K8M B;  1EJ3 A;  1WY9 A;  1JF2 A;  3BUN B;  3CLN A;  3S0E A;  1L2O B;  1OZO A;  2BEC A;  3SS5 A;  1L2O C;  3ZNI A;  3O6B A;  1L7Z A;  1SBJ A;  3TUY B;  2MRD A;  1CLL A;  3TUY C;  4ORB B;  2BBM A;  3UO9 A;  2G2B A;  1K9U A;  4I5L B;  3D0Y B;  5FI7 A;  4R1E A;  1S6C A;  1C7W A;  1DF0 B;  4IJ7 A;  2LHL A;  1PUL A;  3DZT A;  3CAB A;  2LMT A;  1F4Q A;  1YR5 A;  1UHJ A;  1XFW O;  1LXF C;  1OOJ A;  4HRE E;  4M2Q A;  4NDD A;  3LLE A;  4YRU A;  1G33 A;  3PM8 A;  1SNL A;  3B88 A;  1ORG A;  1DQE A;  2EGD A;  3KF9 A;  4PHK A;  1MR8 A;  3TS5 B;  1H4B A;  2D8N A;  4N5X A;  3TS5 C;  2ERB A;  1G8I A;  2L5X B;  2QDI A;  2KHN A;  3C1V A;  4C0K A;  1XK4 A;  2KYC A;  2PMY A;  1TRF A;  2O60 A;  1ZOT B;  2BNX A;  1B8C A;  1Q80 A;  1KSM A;  3IVT A;  4BY4 A;  2KGR A;  4DCK A;  1OMR A;  3S0A A;  3NSK A;  1MXL C;  3FE8 A;  3QRX A;  2ZKM X;  4AOM A;  1OMD A;  2K60 A;  2JTT A;  2WCJ A;  1Z2C B;  3R72 A;  2E30 A;  2LC5 A;  1F8H A;  3BFH A;  1V1G A;  1IQ5 A;  1QTX A;  2KAX A;  1UHK A;  1KFU S;  1PVB A;  1YUS A;  3OGN A;  3SG2 A;  2KSP A;  4FQO A;  1CFF A;  3RZS A;  2KLE A;  4JPZ B;  2LVI A;  1BR4 B;  4I5K A;  2JWW A;  4JKT A;  1SCV A;  1CDP A;  4PCW A;  3BFB A;  1V1F A;  5HKY A;  4JQ0 D;  3H4S E;  1U5I A;  3EVU A;  2WCL A;  1EG3 A;  1B7T Z;  1BR1 B;  1BOD A;  3L4A A;  3CZ2 A;  2K2F A;  3V2L A;  5AAN A;  2CNP A;  2F2O A;  2WC6 A;  2HQ8 A;  3BUW B;  1RJV A;  2P70 A;  3OB2 B;  4N1F A;  5AEQ A;  1XO5 A;  1SY9 A;  2MLE C;  1WLZ A;  4PE7 A;  1MWN A;  2KI4 B;  2KFG A;  2KI4 C;  1K9K A;  3NHI A;  4GGF A;  5HL1 A;  3CYZ A;  4GNK B;  4FTG A;  1ODB A;  3DD4 A;  3I5F B;  2FJY A;  4GGN A;  3I5F C;  1OMV A;  1DEL A;  4ORC B;  1S6J A;  1SR6 B;  3A4U B;  4NDB A;  3D78 A;  1SR6 C;  1GGZ A;  4MLW A;  1SYM A;  4PHM A;  4MVF A;  2LE9 B;  2E6W A;  1WLM A;  2ZN8 A;  2K7B A;  3RLZ A;  1NUB A;  1SSE B;  2IS9 A;  1Y6W A;  2JZI A;  1PK0 D;  2LLU A;  3QME A;  4PHN A;  1JSA A;  1KCY A;  1YUR A;  2KOT A;  2BKI B;  1OOG A;  3D76 A;  1CNP A;  4WQ2 A;  2Y1M A;  4IL1 A;  4C0J A;  1C3Y A;  1SW8 A;  3OBV A;  2FCD A;  1CFP A;  3WNX B;  1QIV A;  5DKR A;  1A75 A;  1BJF A;  4F7F A;  2KLD A;  4XJK B;  4UPG A;  2WCB A;  1OOI X;  3AAK A;  1EG4 A;  2KBM A;  2KPH A;  5JOL A;  3TZ1 A;  1QX7 A;  2K7C A;  4CLN A;  2WC5 A;  1CMF A;  4Q04 A;  2WND A;  1S5G Y;  2MAZ A;  3F45 A;  3ICB A;  2K2A A;  4I5N B;  3L4L A;  3EK8 A;  1IG5 A;  2NZ0 A;  2JXC A;  2L4I A;  4NQG A;  1K8U A;  3KO0 A;  4PE0 A;  3DXL A;  2CXJ A;  1A29 A;  4OR9 B;  2LUX A;  2M0R A;  2PYQ A;  3CDN A;  1SPY A;  4YGA A;  5KTY A;  1M31 A;  1AUI B;  1KK7 Z;  4YI8 A;  1EH2 A;  1KFX S;  2PAS A;  1YRT B;  4WRI A;  3RM1 A;  1QV0 A;  3SJS A;  3NSL A;  2PAL A;  1T14 A;  2ISD A;  2PSR A;  1BU3 A;  3FS7 A;  1CM4 A;  3PLF B;  3K21 A;  2QPT A;  3CR4 X;  1XA5 A;  1PSB A;  5D3O A;  5I94 A;  2WCK A;  2KI6 D;  3KHE A;  1RRO A;  4DS7 A;  1A03 A;  1CDN A;  2PVB A;  2SAS A;  3I5I B;  3I5I C;  2M7L A;  1J7O A;  1XFV O;  1J1D A;  1K93 D;  2JUL A;  3VRQ A;  1CDL A;  1XK4 C;  2M9G A;  1UP5 A;  4MEW A;  4TNC A;  5HKW A;  3GOF A;  4AQI A;  3D77 A;  3VRN A;  2L5Y A;  1W7J B;  5DKQ A;  5K89 A;  3DF0 B;  1M63 B;  2P6B B;  2JT3 A;  2NCO A;  3CR2 A;  3I5H B;  1G4Y R;  4N1G A;  3I5H C;  1IJ5 A;  1TWO A;  1YVH A;  2LLT A;  4CPV A;  4YBH B;  4YGB B;  1BLQ A;  2Q4U A;  1C07 A;  2H61 A;  3DVJ A;  2QEB A;  4OCI A;  1FBV A;  2OS8 B;  5HYD A;  2OS8 C;  4F0Z B;  1OW4 A;  5HKZ A;  3O4Y A;  1TNP A;  2JPO A;  3IF7 A;  4C0L A;  1WRL A;  2FOT A;  1CB1 A;  1QIW A;  1ZFS A;  3NGV A;  1QVI Y;  2QEH A;  1D1O A;  5AXI A;  1SRA A;  1NCZ A;  1IWQ A;  2EC6 B;  2EC6 C;  2LLS A;  2K7O A;  1TOP A;  1DJZ A;  3KPX A;  1IJ6 A;  1U5I B;  5EL2 A;  4QJ5 B;  1NX0 A;  2LCP A;  2M1U A;  1ALW A;  2P71 A;  3CWG A;  3PFV A;  4YGE B;  2RGI A;  1N65 A;  2BL0 B;  2Y1N A;  4ZCV A;  1KFU L;  2BL0 C;  1N2D A;  2QEO A;  2GGZ A;  2Y4Q A;  2K61 A;  5DIC A;  1NIW A;  1OZS A;  2ZFD A;  4GBA A;  4HRH A;  5ER5 A;  3IQO A;  1TUZ A;  1AJ5 A;  1ALV A;  1UUS A;  1RK9 A;  2FCE A;  1AHR A;  1PAL A;  5TNC A;  2HET A;  1XYD A;  2GGM A;  1A2X A;  2JTZ A;  2ZRS A;  3WHU B;  3WXA A;  1SL9 A;  2HPS A;  2JT8 A;  2KFH A;  2QEV A;  3SG4 A;  2SCP A;  4CFQ A;  4OKH A;  1FI6 A;  1LA0 A;  3BYA A;  1K90 D;  1CKK A;  4E68 A;  1MXE A;  3JVT B;  5DKN A;  1YTZ C;  3JVT C;  1W7I B;  1CTR A;  1NP8 A;  3D0Y A;  3S0B A;  1NX3 A;  1DF0 A;  1TIZ A;  3EKJ A;  5FI2 A;  1C7V A;  4MZL A;  4MSP A;  1HQV A;  1WDC B;  2YGU A;  3BQ3 A;  1WDC C;  1OOH A;  3EK4 A;  2L2C A;  1EXR A;  3DYE A;  1Y0V H;  1TTX A;  1A75 B;  2WOR A;  4WQ3 A;  5D69 A;  2Y5I A;  3TDU A;  3OX6 A;  3BXK A;  1XFR A;  4INW A;  1BF5 A;  2BCX A;  3VRP A;  1FPW A;  1B1G A;  4OVN F;  3NSO A;  1JFJ A;  3O2P A;  3LK0 A;  1DJG A;  2I7A A;  3VRR A;  1GGW A;  1PRW A;  2ZNE A;  2M8U A;  3I5G B;  2NXQ A;  2FJU B;  1PSR A;  3I5G C;  1QX5 B;  1F55 A;  2HF5 A;  3BOW A;  1Y1A A;  3O4X A;  2M3W A;  2O5G A;  1XFZ O;  2LP3 A;  4PAL A;  4HRG A;  5CSJ A;  2R2I A;  3NSI A;  1M45 A;  1CFD A;  2NLN A;  3BUM B;  1NWD A;  1WRZ A;  3FWB A;  1RWY A;  3PAT A;  2CT9 A;  4I5J A;  2MJW B;  2EHB A;  2LVK A;  1F54 A;  2BAP A;  5CSI A;  1CMG A;  1NCX A;  2WCM A;  1R6P A;  1DGU A;  3B86 A;  1H8B A;  1BT6 A;  3SG3 A;  1B7T Y;  5KSZ A;  2F3Z A;  2M97 A;  2CBL A;  5BPJ A;  1F70 A;  1B47 A;  1FI5 A;  3NHT A;  2KGB C;  4ZCU A;  1MUX A;  5CPV A;  1DJI A;  1KFX L;  3NXA A;  1NX1 A;  1AVS A;  2ZND A;  2MBX A;  1NSH A;  4OZD A;  2L50 A;  2M49 B;  3HX4 A;  1J1E A;  1SK6 D;  3DVM A;  1OOF A;  1KWO B;  2L51 A;  1DJY A;  3B87 A;  1KWO C;  3IQQ A;  3HCM A;  3S0D A;  2KQ6 A;  3A8R A;  1SKT A;  2JOJ A;  1NYA A;  1Y1U A;  3BFA A;  3PAL A;  4HSZ A;  4NDC A;  1QAT A;  2K0J A;  1CDM A;  4AQJ A;  5IBW A;  1AK8 A;  1J7R A;  2CCM A;  1DVI A;  1MF8 B;  3JTD B;  1HT9 A;  1XFU O;  3JTD C;  1KQM B;  2WCF A;  1TNQ A;  3PN7 C;  1KQM C;  3PN7 B;  3SIB A;  1LS8 A;  1Z4H A;  3CGA A;  2KDH A;  2GV5 A;  1NCY A;  1S6I A;  2AMI A;  5J3X A;  4MZK A;  3AKB A;  2KBI A;  1BOC A;  1LIN A;  3PSR A;  3SS4 A;  3D74 A;  4FQT A;  3OB1 B;  1BG1 A;  2LHI A;  3Q8I A;  2QAC A;  1LKJ A;  1DMO A;  1QV1 A;  2JQ6 A;  1OSA A;  4L9M A;  4QJ3 B;  1K2H A;  3R1O A;  3VB1 A;  1DEK A;  1R2U A;  4CFR A;  3GK2 A;  2OTG B;  2BE6 A;  2LM5 A;  2OTG C;  1GQM A;  2KI6 C;  1IIO A;  1TNW A;  1Y1X A;  3TDZ A;  1IH0 A;  1KK8 B;  4XJK A;  1KK8 C;  2F8P A;  3B6X A;  3VGO A;  1QX2 A;  1ZAC A;  3EVV A;  4KYN A;  1J7P A;  1UWO A;  5D7F A;  2GTE A;  1MQ1 A;  3AAJ A;  3GK1 A;  2BE4 A;  2JRF A;  2JT0 A;  5B8I B;  1YUT A;  1M46 A;  2F33 A;  2LMU A;  3WHT B;  3OP0 A;  5GQQ C;  4MRY A;  5I2Q A;  1DT7 B;  2NCP A;  5AER A;  1FW4 A;  1KK7 Y;  3D75 A;  1B8R A;  1JWD A;  5CSN A;  4INX A;  4U8D A;  3SG7 A;  4OV2 A;  2WCH A;  1XFY O;  2ZN9 A;  5G08 A;  1VRK A;  4MRX A;  1SL7 A;  2LP2 A;  2M7N A;  1DTL A;  3BUO B;  1OE9 B;  1EL4 A;  1XVJ A;  3CZT X;  2AAO A;  4A4C A;  4CID A;  1CM1 A;  3O78 A;  1NX2 A;  3OHM B;  1SL8 A;  1DJW A;  3BUX B; 
#chains in the Genus database with same CATH homology
 2BCB A;  5JJG A;  2B1U A;  1MHO A;  1UHH A;  1S1E A;  1K9P A;  4GGF C;  1YRU B;  1YVL A;  1RTP 1;  1UHI A;  1UUR A;  1K95 A;  2F3Y A;  4ICB A;  3E3R A;  2LVJ A;  2LNK A;  4QJ4 B;  2MA2 A;  4D1E A;  5FYX A;  2AUC A;  1KSO A;  1JBA A;  5I2L A;  1OQP A;  1RFJ A;  3BOW B;  2LUC A;  2MHH A;  2F2P A;  1QLS A;  4PHJ A;  4XYN A;  1A4P A;  3DF0 A;  5HLO A;  2A4J A;  2HQW A;  4YI9 A;  1IRJ A;  1ZUZ A;  3LK1 A;  2I94 A;  2ZRT A;  5I8N A;  2H2K A;  1K96 A;  1B4C A;  2LMV A;  2I18 A;  1TN4 A;  1K94 A;  1LVC D;  2KAV A;  3ZWH A;  1CFC A;  1QS7 A;  2WOS A;  1BMO A;  2KFF A;  4P5O E;  4ETO A;  1DJH A;  4A4B A;  2KAY A;  3LL8 B;  1WRK A;  3LCP C;  1M39 A;  1YX7 A;  3M0W A;  1YX8 A;  2OPO A;  4P2Y B;  3MSE B;  3SIA A;  2L98 A;  2JPT A;  3CR5 X;  1DJX A;  1S5G Z;  3EK7 A;  1YUU A;  4PDZ A;  4BY5 A;  1SMG A;  1AJ4 A;  2MLF C;  4GFT A;  3EVR A;  2LV7 A;  2BKH B;  2TN4 A;  4PE1 A;  1F71 A;  4DIR A;  1GJY A;  2L4H A;  2WCE A;  4YGD B;  2PRU A;  3FIA A;  1CLM A;  2JNX A;  3EKH A;  5ER4 X;  5AFP A;  1CLB A;  2V53 A;  4M2O A;  1KQV A;  5F6T A;  2M29 A;  4GPL B;  1S36 A;  2DOQ A;  2BBN A;  2COL B;  1QAS A;  1JF0 A;  1UHN A;  5PAL A;  4YGC B;  2I2R E;  4JWQ A;  2KNE A;  2WC8 A;  2KQY A;  1DGV A;  1N0Y A;  2JNF A;  3CTN A;  1J55 A;  3DVK A;  3GK4 X;  2L2E A;  2KYF A;  3KEV A;  2CTN A;  1ZMZ A;  1QLK A;  1B9A A;  2M1K B;  1J7Q A;  2L0P A;  3SG5 A;  3D10 A;  1PVA A;  1IQ3 A;  2BCA A;  2H61 C;  1E8A A;  1TCO B;  1S3P A;  1X02 A;  5CSF A;  3OX5 A;  4PE4 A;  3VRO A;  2LVV A;  4M2P A;  2JU0 A;  2LAN A;  1JUO A;  2G9B A;  4DRW A;  4USL A;  1FF1 A;  2VRG A;  1F4O A;  1QJT A;  1NPQ A;  4GUK A;  4ORA B;  1LA3 A;  1SCM B;  2JXL A;  1QVI Z;  1SCM C;  2K7D A;  1JC2 A;  3FWC A;  4DUQ A;  1QXP A;  3DVE A;  5HLV A;  3CS1 A;  5I2O A;  1TCF A;  4MN0 A;  1TNX A;  2JC2 A;  3AKA A;  2LAP A;  3TDI A;  4GAO A;  4MBE A;  4MZJ A;  3SG6 A;  5KU1 A;  1JFK A;  1IKU A;  1S26 D;  2Q91 A;  1XFX O;  1B8L A;  1IGV A;  1REC A;  1AP4 A;  2K8M B;  1EJ3 A;  1WY9 A;  1JF2 A;  3BUN B;  3CLN A;  3ZNI A;  1L2O B;  1OZO A;  2BEC A;  1L2O C;  3O6B A;  1L7Z A;  1SBJ A;  3TUY B;  2MRD A;  1CLL A;  3TUY C;  4ORB B;  2BBM A;  2G2B A;  1K9U A;  4I5L B;  3D0Y B;  4R1E A;  1S6C A;  1C7W A;  1DF0 B;  2LHL A;  1PUL A;  2LMT A;  1F4Q A;  1YR5 A;  1UHJ A;  1XFW O;  1LXF C;  1OOJ A;  4HRE E;  4M2Q A;  4NDD A;  3LLE A;  4YRU A;  1G33 A;  3PM8 A;  1SNL A;  2EGD A;  3KF9 A;  4PHK A;  1MR8 A;  3TS5 B;  1H4B A;  2D8N A;  4N5X A;  3TS5 C;  1G8I A;  2L5X B;  2KHN A;  3C1V A;  4C0K A;  1XK4 A;  2KYC A;  2PMY A;  1TRF A;  2O60 A;  1ZOT B;  1B8C A;  1Q80 A;  1KSM A;  4BY4 A;  2KGR A;  4DCK A;  1OMR A;  3NSK A;  1MXL C;  3QRX A;  2ZKM X;  4AOM A;  1OMD A;  2JTT A;  1F8H A;  2E30 A;  2LC5 A;  1V1G A;  1IQ5 A;  1QTX A;  2KAX A;  1UHK A;  1KFU S;  1PVB A;  1YUS A;  3SG2 A;  2KSP A;  4FQO A;  1CFF A;  4JPZ B;  2LVI A;  1BR4 B;  4I5K A;  2JWW A;  1SCV A;  1CDP A;  4PCW A;  1V1F A;  5HKY A;  4JQ0 D;  3H4S E;  1U5I A;  3EVU A;  1EG3 A;  1B7T Z;  1BR1 B;  1BOD A;  2K2F A;  5AAN A;  2CNP A;  2F2O A;  2HQ8 A;  3BUW B;  1RJV A;  3OB2 B;  4N1F A;  5AEQ A;  1XO5 A;  1SY9 A;  2MLE C;  1WLZ A;  4PE7 A;  1MWN A;  2KI4 B;  2KFG A;  2KI4 C;  1K9K A;  4GGF A;  4GNK B;  4FTG A;  1ODB A;  3DD4 A;  3I5F B;  4GGN A;  3I5F C;  1OMV A;  4ORC B;  1S6J A;  1SR6 B;  3A4U B;  4NDB A;  1SR6 C;  1GGZ A;  4MLW A;  1SYM A;  4PHM A;  4MVF A;  2LE9 B;  2E6W A;  1WLM A;  2ZN8 A;  2K7B A;  3RLZ A;  1NUB A;  2IS9 A;  2JZI A;  1Y6W A;  2LLU A;  1PK0 D;  1K2H A;  4PHN A;  1JSA A;  1KCY A;  1YUR A;  2KOT A;  2BKI B;  1CNP A;  4WQ2 A;  2Y1M A;  4IL1 A;  4C0J A;  1SW8 A;  2FCD A;  1CFP A;  3WNX B;  1QIV A;  5DKR A;  1A75 A;  1BJF A;  4XJK B;  4UPG A;  2WCB A;  3AAK A;  1EG4 A;  2KBM A;  5JOL A;  3TZ1 A;  1CMF A;  1QX7 A;  2K7C A;  4CLN A;  4Q04 A;  2WND A;  1S5G Y;  2MAZ A;  3F45 A;  3ICB A;  2K2A A;  4I5N B;  3EK8 A;  1IG5 A;  2NZ0 A;  2JXC A;  2L4I A;  4NQG A;  1K8U A;  3KO0 A;  4PE0 A;  2CXJ A;  1A29 A;  4OR9 B;  2LUX A;  2M0R A;  5KTY A;  4YGA A;  1SPY A;  1M31 A;  1AUI B;  1KK7 Z;  4YI8 A;  1EH2 A;  1KFX S;  2PAS A;  1YRT B;  4WRI A;  3RM1 A;  1QV0 A;  3SJS A;  3NSL A;  2PAL A;  2ISD A;  2PSR A;  1BU3 A;  3FS7 A;  1CM4 A;  3PLF B;  3K21 A;  2QPT A;  3CR4 X;  1XA5 A;  1PSB A;  2KI6 D;  3KHE A;  1RRO A;  4DS7 A;  1A03 A;  1CDN A;  2PVB A;  2SAS A;  3I5I B;  3I5I C;  2M7L A;  1J7O A;  1XFV O;  1J1D A;  1K93 D;  2JUL A;  3VRQ A;  1CDL A;  1XK4 C;  2M9G A;  1UP5 A;  4MEW A;  4TNC A;  5HKW A;  3GOF A;  4AQI A;  3VRN A;  1W7J B;  5DKQ A;  5K89 A;  3DF0 B;  1M63 B;  2P6B B;  2JT3 A;  2NCO A;  3CR2 A;  3I5H B;  1G4Y R;  4N1G A;  3I5H C;  1IJ5 A;  1YVH A;  2LLT A;  4CPV A;  4YBH B;  4YGB B;  2Q4U A;  1C07 A;  2H61 A;  3DVJ A;  4OCI A;  1FBV A;  2OS8 B;  5HYD A;  2OS8 C;  4F0Z B;  5HKZ A;  3O4Y A;  1TNP A;  3IF7 A;  4C0L A;  1WRL A;  2FOT A;  1CB1 A;  1QIW A;  1ZFS A;  1QVI Y;  1D1O A;  5AXI A;  1SRA A;  1NCZ A;  1IWQ A;  2EC6 B;  2EC6 C;  2LLS A;  2K7O A;  1TOP A;  1DJZ A;  3KPX A;  1IJ6 A;  1U5I B;  4QJ5 B;  1NX0 A;  2LCP A;  2M1U A;  1ALW A;  3CWG A;  3PFV A;  4YGE B;  4ZCV A;  2RGI A;  1N65 A;  2BL0 B;  2Y1N A;  1BLQ A;  1KFU L;  2BL0 C;  1N2D A;  2GGZ A;  2Y4Q A;  2K61 A;  1NIW A;  1OZS A;  2ZFD A;  4GBA A;  4HRH A;  5ER5 A;  3IQO A;  1AJ5 A;  1ALV A;  1UUS A;  1RK9 A;  2FCE A;  1AHR A;  1PAL A;  5TNC A;  2HET A;  1XYD A;  2GGM A;  1A2X A;  2JTZ A;  2ZRS A;  3WHU B;  3WXA A;  1SL9 A;  2HPS A;  2JT8 A;  2KFH A;  3SG4 A;  4CFQ A;  2SCP A;  4OKH A;  1FI6 A;  1LA0 A;  3BYA A;  1K90 D;  1CKK A;  4E68 A;  1MXE A;  3JVT B;  5DKN A;  1YTZ C;  3JVT C;  1W7I B;  1CTR A;  1NP8 A;  3D0Y A;  1NX3 A;  1DF0 A;  1TIZ A;  3EKJ A;  1C7V A;  4MZL A;  4MSP A;  1HQV A;  1WDC B;  3BQ3 A;  1WDC C;  3EK4 A;  1EXR A;  1Y0V H;  1TTX A;  1A75 B;  2WOR A;  4WQ3 A;  5D69 A;  2Y5I A;  3TDU A;  3OX6 A;  3BXK A;  1BF5 A;  2BCX A;  3VRP A;  1FPW A;  1B1G A;  4OVN F;  3NSO A;  1JFJ A;  3O2P A;  3LK0 A;  1DJG A;  2I7A A;  3VRR A;  1GGW A;  1PRW A;  2ZNE A;  2M8U A;  3I5G B;  2NXQ A;  2FJU B;  1PSR A;  3I5G C;  1QX5 B;  1F55 A;  2HF5 A;  3BOW A;  1Y1A A;  2M3W A;  2O5G A;  1XFZ O;  2LP3 A;  4PAL A;  4HRG A;  5CSJ A;  2R2I A;  3NSI A;  1M45 A;  1CFD A;  2NLN A;  3BUM B;  1NWD A;  1WRZ A;  3FWB A;  1RWY A;  3PAT A;  2CT9 A;  4I5J A;  2MJW B;  2EHB A;  2LVK A;  1F54 A;  1CMG A;  5CSI A;  1NCX A;  1H8B A;  1R6P A;  1DGU A;  1BT6 A;  3SG3 A;  1B7T Y;  5KSZ A;  2F3Z A;  2M97 A;  2CBL A;  5BPJ A;  1F70 A;  1B47 A;  1FI5 A;  4ZCU A;  2KGB C;  1MUX A;  5CPV A;  1DJI A;  1KFX L;  3NXA A;  1NX1 A;  1AVS A;  2ZND A;  2MBX A;  1NSH A;  2L50 A;  2M49 B;  3HX4 A;  1J1E A;  1SK6 D;  3DVM A;  2L51 A;  1KWO B;  3IQQ A;  1DJY A;  1KWO C;  3HCM A;  2KQ6 A;  3A8R A;  1SKT A;  2JOJ A;  1NYA A;  1Y1U A;  3PAL A;  4HSZ A;  1AK8 A;  4NDC A;  1QAT A;  2K0J A;  1CDM A;  4AQJ A;  5IBW A;  1J7R A;  2CCM A;  1DVI A;  1MF8 B;  3JTD B;  1HT9 A;  1XFU O;  3JTD C;  1KQM B;  2WCF A;  1TNQ A;  3PN7 C;  1KQM C;  3PN7 B;  3SIB A;  3CGA A;  2KDH A;  2GV5 A;  1NCY A;  1S6I A;  2AMI A;  5J3X A;  4MZK A;  3AKB A;  2KBI A;  1BOC A;  1LIN A;  3PSR A;  3OB1 B;  1BG1 A;  2LHI A;  2QAC A;  1LKJ A;  1DMO A;  1QV1 A;  2JQ6 A;  1OSA A;  4L9M A;  4QJ3 B;  1R2U A;  4CFR A;  3GK2 A;  2OTG B;  2BE6 A;  2LM5 A;  2OTG C;  1GQM A;  2KI6 C;  1TNW A;  1Y1X A;  3TDZ A;  1IH0 A;  1KK8 B;  4XJK A;  1KK8 C;  2F8P A;  3VGO A;  1QX2 A;  1ZAC A;  3EVV A;  1J7P A;  1UWO A;  5D7F A;  3GK1 A;  1MQ1 A;  3AAJ A;  2BE4 A;  2JRF A;  2JT0 A;  5B8I B;  1YUT A;  1M46 A;  2F33 A;  2LMU A;  3WHT B;  3OP0 A;  5GQQ C;  4MRY A;  5I2Q A;  1DT7 B;  2NCP A;  5AER A;  1FW4 A;  1KK7 Y;  1JWD A;  1B8R A;  5CSN A;  4U8D A;  3SG7 A;  4OV2 A;  2ZN9 A;  1XFY O;  5G08 A;  1VRK A;  4MRX A;  1SL7 A;  2LP2 A;  2M7N A;  1DTL A;  3BUO B;  1OE9 B;  1EL4 A;  1XVJ A;  3CZT X;  2AAO A;  4A4C A;  4CID A;  1CM1 A;  3O78 A;  1NX2 A;  3OHM B;  1SL8 A;  1DJW A;  3BUX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...