1NP8A

18-k c-terminally trunucated small subunit of calpain
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
149
structure length
149
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A second binding site revealed by C-terminal truncation of calpain small subunit, a penta-EF-hand protein
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 58
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1np8A00
1HQVA 1BOCA 2LMUA 2V53A 1KFXS 1TNWA 3I5GC 2WNDA 1DF0B 2M1KB 4OV2A 3SIAA 3JTDB 1OOJA 2JT0A 3GK1A 1TNXA 4WRIA 1OSAA 2KQ6A 2PALA 4Q04A 1CLMA 4MN0A 2KAYA 1OZOA 1J1DA 2KYFA 2Q4UA 3FWCA 4OR9B 3TS5B 4DIRA 1SMGA 1QVIY 2KNEA 2LC5A 3AAKA 1SY9A 1B1GA 2E30A 1UHJA 1NWDA 2JNXA 2CTNA 2MJWB 2K7DA 1KQMC 1R6PA 2I18A 3BOWA 4C0KA 1N2DA 2K7CA 2K8MB 1KWOB 1JF0A 3TDUA 1GQMA 1NUBA 1MWNA 1PRWA 2CXJA 2F3YA 1B8CA 2CT9A 5AFPA 3DVJA 3FWBA 2KBIA 2JT8A 1UP5A 2AAOA 1F70A 1KK7Y 1SL8A 2MHHA 3TDZA 3DVKA 1SYMA 3RM1A 3SG5A 1FBVA 5DKQA 1GJYA 1SW8A 1CDPA 2KI4B 1UHNA 1V1GA 4L9MA 3SJSA 2CCMA 4PE7A 5F6TA 3MSEB 1WDCC 2BBMA 2LLTA 2H61C 3F45A 1J55A 1GGZA 1SK6D 4HSZA 1XK4A 2KFHA 2AMIA 4MVFA 2K2FA 1CDMA 1IJ6A 1NPQA 5KSZA 3ZWHA 3PALA 3BUOB 4DRWA 4N1FA 2LP2A 3LL8B 1BF5A 1F8HA 1M46A 1DJHA 1OE9B 2EHBA 2L0PA 3EK4A 4CLNA 5HLOA 1QASA 3ZNIA 4GBAA 1BR4B 2F2PA 2LNKA 4PCWA 1CM4A 2K7BA 3BUMB 1QV1A 1YURA 5DKNA 2EC6C 2JZIA 1F4OA 1G33A 1AJ5A 1S6JA 2Y5IA 1QJTA 3FS7A 1CMGA 1Y1UA 4I5JA 2LLUA 2F2OA 2RGIA 4YGBB 1TN4A 3O4YA 1SRAA 1YRTB 1CDNA 3OP0A 1PVAA 4A4CA 1DGVA 3LLEA 1UUSA 2F33A 4OVNF 2BECA 2LM5A 1SR6B 1EG3A 1AP4A 2L98A 3C1VA 1MUXA 4YBHB 1MF8B 1KFUL 2ZRSA 4CIDA 2F8PA 4XJKB 5ER4X 3EVVA 2O5GA 1OMDA 5DKRA 1A75B 1AUIB 1XFUO 4MEWA 4OKHA 1BODA 3O78A 1B4CA 5HKZA 1J1EA 1CLBA 2BL0C 3AAJA 2JNFA 5ER5A 1BLQA 3OX5A 4YGCB 3PN7B 1S5GZ 4PHJA 2ZNEA 1EXRA 1LINA 1F71A 4PHMA 2KFFA 4M2QA 1SCVA 2KBMA 1B9AA 2JQ6A 2JXCA 3I5GB 3JVTC 4N5XA 4PE4A 1Q80A 1BMOA 2LMVA 1RJVA 1SCMC 3TDIA 3VRQA 4PE1A 2PVBA 5I2LA 3CS1A 4MZJA 1GGWA 1A4PA 1AVSA 3OX6A 5CSIA 1CNPA 4E68A 4PE0A 4AQIA 4ZCUA 1YVHA 2MRDA 1U5IB 1QX2A 5IBWA 1AHRA 2FJUB 1YVLA 1NCXA 5JJGA 3IF7A 1QIVA 1F55A 4ZCVA 1Y1AA 2M29A 1M39A 1XFXO 2GGZA 1DTLA 3BUXB 1KQMB 2BKHB 3KHEA 1UWOA 1DJIA 2KHNA 3SG6A 4WQ3A 5HKWA 1X02A 3DVEA 3WHUB 1TTXA 1FF1A 3BYAA 3KEVA 4TNCA 5CPVA 5CSJA 5I8NA 3D10A 3O6BA 3KO0A 4GGNA 1JFJA 1NSHA 1K90D 3LK1A 2BCAA 2BE6A 4ORCB 4QJ4B 4HRHA 2OS8C 2LUCA 4PHNA 1EL4A 1QX7A 4USLA 2WORA 3EKJA 2D8NA 1TRFA 1YR5A 3BUWB 2H2KA 1CFDA 2JULA 2O60A 2OPOA 2Y1MA 4FQOA 1AK8A 1CFFA 1DJYA 2LHIA 4R1EA 1DF0A 2B1UA 1A2XA 1S6IA 4YGAA 2E6WA 1QX5B 1WDCB 2BCXA 2KYCA 2M1UA 1J7OA 2BE4A 1PK0D 2M7NA 1S36A 1CFPA 3PFVA 1KSOA 1CDLA 3SIBA 4F0ZB 5PALA 4YRUA 4GGFA 3SG3A 1Y6WA 3VRRA 1HT9A 1NX1A 2L50A 4ORBB 2FOTA 1J7QA 1EG4A 3I5IC 3KF9A 1F54A 1H8BA 1XVJA 1QS7A 2M49B 4YGDB 1IH0A 1MR8A 1DJXA 5HKYA 3EK8A 2Y1NA 3LK0A 1ZUZA 2SASA 1XYDA 3OB2B 4BY4A 2NXQA 1K9PA 3SG2A 1SPYA 1QV0A 1RFJA 2JWWA 2L51A 4CPVA 4ETOA 1BU3A 2EC6B 2KOTA 1PALA 3WNXB 4AQJA 1PSRA 1G8IA 4MZLA 2I2RE 4XYNA 1XA5A 4MRYA 1YX8A 1H4BA 2WOSA 1J7PA 1XK4C 2JTTA 1DT7B 4C0JA 4P5OE 1IWQA 4CFRA 1FPWA 2LVJA 2WCFA 2NLNA 4YI8A 1ZACA 1WLZA 4U8DA 1DJGA 2M3WA 1YRUB 1RK9A 1LXFC 3DF0B 1NX2A 2LP3A 3TUYB 2KI6C 2NCPA 2CNPA 1TNQA 1NX0A 2BL0B 4I5NB 1YUSA 2JOJA 1K9UA 3NSOA 2PRUA 3AKAA 1V1FA 1IJ5A 1MXEA 2CBLA 2I7AA 2M9GA 2JU0A 1E8AA 1NIWA 3OB1B 2KDHA 1EH2A 1KK8C 2VRGA 4C0LA 2KAVA 1JF2A 3JVTB 1M45A 1XFZO 4I5LB 2G9BA 2L4HA 3NSKA 2GV5A 3TUYC 1SCMB 1SL9A 1UHHA 2LVKA 3I5FC 2KGRA 5J3XA 1UHIA 3K21A 1KFXL 3IQQA 2IS9A 1DVIA 4BY5A 1F4QA 2FCDA 1JUOA 3E3RA 1OZSA 4ICBA 3ICBA 1TNPA 1IG5A 4GNKB 1XFVO 1BT6A 1RROA 2K7OA 1KQVA 2P6BB 4OCIA 4DUQA 1QVIZ 1XFWO 2PMYA 3D0YB 2JPTA 4DCKA 1QLSA 1S26D 1CB1A 1JC2A 1FW4A 1K9KA 1UURA 3CR2A 5TNCA 1S6CA 1A29A 3EKHA 1B7TY 4XJKA 1BJFA 4JPZB 4YI9A 1A75A 2K2AA 4GPLB 1D1OA 5KTYA 1JSAA 2BKIB 2OTGC 3VRPA 2OS8B 1IGVA 3DD4A 2M8UA 5B8IB 4QJ3B 2GGMA 1PVBA 1KK7Z 1CFCA 1YUUA 1B47A 3CWGA 3LCPC 1S3PA 1PULA 1ALWA 1TCOB 1QLKA 3O2PA 1N0YA 1R2UA 1CMFA 1QTXA 1Y0VH 1C7VA 3NSIA 3BQ3A 1JFKA 3I5HC 5I2OA 2QACA 1KFUS 1LA0A 5GQQC 2LE9B 1L2OC 1SL7A 1U5IA 3FIAA 1B8RA 2JTZA 3BOWB 1SNLA 2MAZA 3I5IB 3PATA 2I94A 3PM8A 2JRFA 1MQ1A 1TCFA 3VRNA 1L7ZA 3IQOA 1NP8A 3CZTX 1K96A 5I2QA 1S5GY 4HRGA 1SKTA 2MBXA 2SCPA 1NCZA 1NCYA 3GK2A 3VGOA 1XFYO 3NXAA 1RTP1 3CGAA 4N1GA 1CLLA 1JWDA 1WRLA 1B8LA 2A4JA 2TN4A 3GK4X 5K89A 5FYXA 3BXKA 2AUCA 2BBNA 3JTDC 1DJZA 2LHLA 1LVCD 4YGEB 2COLB 1IRJA 5D69A 3CTNA 5HYDA 1M31A 4DS7A 1TIZA 2MA2A 3AKBA 3TS5C 4GGFC 5CSNA 4NQGA 2H61A 2EGDA 1K94A 2BCBA 5AXIA 2LV7A 3CR4X 4ORAB 4CFQA 4I5KA 2JXLA 1JBAA 1LKJA 1SBJA 1J7RA 1Y1XA 5JOLA 1KWOC 1WLMA 1DGUA 1OMRA 3SG4A 1AJ4A 1WY9A 2LVIA 2LUXA 3OHMB 4GAOA 4MZKA 1WRZA 2JT3A 1KK8B 1PSBA 1FI6A 2MLFC 4WQ2A 2L5XB 1A03A 1QATA 4MLWA 3TZ1A 3WXAA 1BR1B 3A8RA 1ZOTB 1RWYA 2FCEA 4QJ5B 2PASA 2KAXA 3I5FB 1RECA 1B7TZ 1N65A 1WRKA 1W7JB 3CR5X 2ZN8A 2KI4C 4JQ0D 2DOQA 3BUNB 1C7WA 1C07A 1OMVA 1ZFSA 1LA3A 2HPSA 4GUKA 5G08A 4NDDA 3H4SE 1K8UA 2M7LA 3VROA 1KCYA 4A4BA 1QIWA 1IQ3A 4FTGA 4UPGA 2Q91A 1DMOA 2K0JA 2KFGA 2L4IA 3SG7A 2HQWA 2LMTA 3DVMA 5AERA 2PSRA 1ODBA 4JWQA 5HLVA 1CKKA 3KPXA 2NCOA 3RLZA 3EK7A 2NZ0A 3DF0A 4HREE 4MRXA 2KI6D 1CM1A 2LLSA 1EJ3A 2ZRTA 1QXPA 2OTGB 2G2BA 1K2HA 1TOPA 4P2YB 2ZFDA 3CLNA 2WCBA 2LCPA 1KSMA 3WHTB 2LVVA 2QPTA 3NSLA 4M2OA 4NDBA 2K61A 2KQYA 3M0WA 1MXLC 2LANA 3A4UB 2WCEA 1YX7A 1XO5A 4D1EA 2ISDA 2KSPA 1OQPA 2HQ8A 5D7FA 4M2PA 1ALVA 1YTZC 3HCMA 4PHKA 1UHKA 4MBEA 4PDZA 5AEQA 5KU1A 1NYAA 3I5HB 1MHOA 2L2EA 2M97A 2ZKMX 5AANA 1FI5A 4NDCA 2ZN9A 2WC8A 4IL1A 1L2OB 1VRKA 1SR6C 3GOFA 1NX3A 2F3ZA 1K93D 5BPJA 3EVUA 2MLEC 1M63B 3D0YA 1IKUA 3PSRA 4AOMA 4GFTA 2HF5A 1CTRA 2KGBC 2R2IA 4MSPA 1BG1A 1ZMZA 2LAPA 3QRXA 2Y4QA 1S1EA 2M0RA 1YUTA 1K95A 3EVRA 1G4YR 5CSFA 1IQ5A 1DJWA 3PN7C 1W7IB 2ZNDA 2JC2A 4PALA 3PLFB 2HETA 3HX4A
chains in the Genus database with same CATH superfamily
1HQVA 1BOCA 2LMUA 2V53A 1KFXS 1TNWA 3I5GC 2WNDA 1DF0B 2M1KB 2WCMA 4OV2A 3JTDB 3SIAA 1OOJA 2JT0A 5I94A 3GK1A 1TNXA 4WRIA 1OSAA 2KQ6A 2PALA 4Q04A 1CLMA 4MN0A 2KAYA 1OZOA 1J1DA 2KYFA 2Q4UA 3FWCA 4OR9B 3NGVA 3TS5B 4DIRA 1SMGA 1QVIY 2KNEA 2LC5A 3AAKA 1SY9A 1B1GA 2E30A 1UHJA 1NWDA 2JNXA 3BFHA 2CTNA 2MJWB 2K7DA 3FE9A 1KQMC 1R6PA 2I18A 3BOWA 4C0KA 1N2DA 2K7CA 2K8MB 1KWOB 1JF0A 3TDUA 1GQMA 1NUBA 1MWNA 1PRWA 2CXJA 2F3YA 1B8CA 2CT9A 5AFPA 4KYNA 3DVJA 1GM0A 3FWBA 2KBIA 2JT8A 1UP5A 2AAOA 1F70A 1KK7Y 1SL8A 2MHHA 5HL1A 3TDZA 3DVKA 1SYMA 2ERBA 4IJ7A 3RM1A 3SG5A 1FBVA 5DKQA 1GJYA 1SW8A 1CDPA 2WCLA 2KI4B 1UHNA 1V1GA 4L9MA 4PT1A 2CCMA 3SJSA 4PE7A 5F6TA 3MSEB 1WDCC 2BBMA 2LLTA 2H61C 3F45A 1J55A 1GGZA 1SK6D 1TUZA 4HSZA 1XK4A 2KFHA 2AMIA 4MVFA 2K2FA 3DXLA 1CDMA 3IVTA 3SS4A 1IJ6A 1NPQA 5KSZA 3ZWHA 3PALA 3BUOB 4DRWA 4N1FA 1DELA 2LP2A 3LL8B 3L4AA 1BF5A 1F8HA 1M46A 1DJHA 1OE9B 2EHBA 2L0PA 3EK4A 4CLNA 5HLOA 1QASA 3ZNIA 4GBAA 2K60A 3CZ2A 1BR4B 1QWVA 2F2PA 2LNKA 4PCWA 1DEKA 1CM4A 2K7BA 3BUMB 1QV1A 1YURA 1OOFA 5DKNA 2EC6C 2JZIA 3R72A 1F4OA 1G33A 1AJ5A 1S6JA 2Y5IA 1QJTA 2GTEA 3FS7A 1Y1UA 1CMGA 4I5JA 2LLUA 2F2OA 1T14A 2RGIA 1TN4A 3O4YA 1SRAA 1YRTB 4YGBB 1CDNA 3OP0A 1PVAA 4A4CA 1DGVA 3LLEA 1UUSA 2BNXA 2F33A 4OVNF 2BECA 2LM5A 1SR6B 1EG3A 1AP4A 2L98A 3C1VA 1MUXA 4YBHB 1MF8B 1KFUL 2ZRSA 4CIDA 2F8PA 4XJKB 5ER4X 3EVVA 2O5GA 1OMDA 5DKRA 1A75B 1AUIB 1XFUO 3CDNA 4MEWA 4OKHA 3O78A 1BODA 1B4CA 5HKZA 1J1EA 1CLBA 2BL0C 3AAJA 2JNFA 5ER5A 3SS5A 3OX5A 1BLQA 4YGCB 3PN7B 1S5GZ 4PHJA 2ZNEA 1EXRA 1OOIX 1LINA 4INWA 2H8VA 3RZSA 1F71A 4PHMA 2KFFA 4M2QA 1SCVA 2KBMA 1B9AA 2JQ6A 2JXCA 3I5GB 3JVTC 4N5XA 4PE4A 1Q80A 1BMOA 2LMVA 3B88A 1RJVA 1SCMC 3TDIA 3VRQA 4PE1A 2PVBA 5I2LA 3CS1A 4MZJA 1GGWA 1A4PA 1AVSA 3OX6A 5CSIA 1XFRA 4E68A 1CNPA 4PE0A 4AQIA 3BFBA 1YVHA 2MRDA 1U5IB 4FQTA 4ZCUA 1QX2A 5IBWA 1AHRA 2FJUB 1YVLA 1NCXA 3D74A 5JJGA 3IF7A 1QIVA 1F55A 4ZCVA 1Y1AA 2M29A 1M39A 1XFXO 2GGZA 1DTLA 3BUXB 2L2CA 3S0DA 1KQMB 2BKHB 3KHEA 2WC5A 1UWOA 2QEBA 1DJIA 2KHNA 3CZ1A 4WQ3A 5HKWA 3SG6A 1X02A 3DVEA 3WHUB 1TTXA 1FF1A 3BYAA 3KEVA 4TNCA 5CPVA 5CSJA 5I8NA 3D10A 3O6BA 3KO0A 4GGNA 1JFJA 1NSHA 1K90D 3LK1A 2BCAA 2BE6A 4ORCB 3L4LA 4HRHA 4QJ4B 3FE8A 2OS8C 3NHIA 2LUCA 1OW4A 4PHNA 1EL4A 1QX7A 4USLA 2YGUA 2WORA 3EG5B 3EKJA 2D8NA 1TRFA 1YR5A 3BUWB 4OZDA 2H2KA 1CFDA 2JULA 2O60A 2OPOA 2QDIA 2Y1MA 4FQOA 1AK8A 1CFFA 1DJYA 2LHIA 4R1EA 1DF0A 2B1UA 1A2XA 1S6IA 4YGAA 2E6WA 1QX5B 1WDCB 2BCXA 2KYCA 3BFAA 2M1UA 1J7OA 1PK0D 2BE4A 2M7NA 1S36A 1CFPA 3D78A 1KSOA 3PFVA 1CDLA 3SIBA 4F0ZB 5PALA 4YRUA 4GGFA 3SG3A 1Y6WA 3VRRA 1HT9A 1NX1A 2L50A 3D75A 2FOTA 4ORBB 1EG4A 2QEOA 3I5IC 3KF9A 5DICA 1XVJA 1J7QA 1F54A 1QS7A 2M49B 4YGDB 1IH0A 1MR8A 1DJXA 2P70A 5HKYA 2QEHA 3EK8A 2Y1NA 3LK0A 1ZUZA 2SASA 2QEVA 1XYDA 3B7AA 3OB2B 3B6XA 4BY4A 2NXQA 1K9PA 3SG2A 1SPYA 1QV0A 1RFJA 2JWWA 2L51A 4CPVA 4ETOA 1BU3A 2EC6B 2KOTA 1PALA 3WNXB 3O4XA 3R1OA 1PSRA 4AQJA 1G8IA 4MZLA 3S0AA 2I2RE 4XYNA 3S0EA 1XA5A 4MRYA 1YX8A 4F7FA 1H4BA 2WOSA 1J7PA 1XK4C 2JTTA 1DT7B 4C0JA 4P5OE 1OOHA 1IWQA 4CFRA 1FPWA 2LVJA 2WCFA 2NLNA 4YI8A 1ZACA 1WLZA 3D76A 4U8DA 4INXA 1DJGA 3R1PA 2M3WA 1YRUB 1RK9A 1LXFC 3DF0B 1NX2A 3UNWA 2LP3A 3TUYB 2KI6C 2NCPA 2CNPA 1TNQA 1NX0A 2BL0B 4I5NB 3D77A 1YUSA 2JOJA 1K9UA 3NSOA 1SSEB 2PRUA 3AKAA 1V1FA 3CZ0A 1IJ5A 1MXEA 2CBLA 2I7AA 2M9GA 2JU0A 1E8AA 1NIWA 3OB1B 3FE6A 3OBVA 2KDHA 3DYEA 1KK8C 1EH2A 2VRGA 4C0LA 2KAVA 1JF2A 3JVTB 1M45A 1XFZO 5FI6A 4I5LB 2G9BA 2WCJA 3OGNA 2L4HA 3NSKA 2GV5A 3TUYC 1SCMB 1SL9A 1UHHA 2LVKA 3I5FC 2KGRA 5J3XA 1UHIA 3K21A 1KFXL 3IQQA 2IS9A 1DVIA 4BY5A 1F4QA 2FCDA 1JUOA 3E3RA 1OZSA 4ICBA 3ICBA 1TNPA 1IG5A 4GNKB 1XFVO 1BT6A 1RROA 2K7OA 1KQVA 2P6BB 4OCIA 1DC1A 4DUQA 1QVIZ 1XFWO 2PMYA 1LS8A 3D0YB 2JPTA 4DCKA 1QLSA 1S26D 1CB1A 1JC2A 1FW4A 5FI7A 1K9KA 1UURA 3BJHA 3CR2A 1IIOA 5TNCA 1S6CA 3K1EA 1A29A 3EKHA 1B7TY 4XJKA 1BJFA 4JPZB 1ORGA 4YI9A 1A75A 2K2AA 4GPLB 1D1OA 5KTYA 1JSAA 2BKIB 2WCKA 2OTGC 3VRPA 2OS8B 1IGVA 3DD4A 2M8UA 3S0GA 5B8IB 4QJ3B 2GGMA 1PVBA 1KK7Z 3PM2A 1CFCA 1YUUA 2KPHA 1B47A 3CWGA 3LCPC 1S3PA 1PULA 1ALWA 1TCOB 1QLKA 3O2PA 1N0YA 1R2UA 1CMFA 1QTXA 1Y0VH 3S0BA 1C7VA 3NSIA 3BQ3A 2JPOA 1JFKA 3B87A 3R1VA 3I5HC 5I2OA 2QACA 1KFUS 1LA0A 5GQQC 2LE9B 1L2OC 1SL7A 1U5IA 3FIAA 2PYQA 1B8RA 2JTZA 3BOWB 1SNLA 2MAZA 3I5IB 3PATA 2I94A 3PM8A 2JRFA 5EL2A 1MQ1A 4JD9A 1TCFA 3VRNA 1L7ZA 3IQOA 1NP8A 3NHTA 3CZTX 1K96A 5I2QA 1OOGA 1S5GY 4HRGA 1SKTA 1W9ZA 2MBXA 2SCPA 1NCZA 1NCYA 3GK2A 3VGOA 1XFYO 3NXAA 1RTP1 3CGAA 4N1GA 1CLLA 3SS3A 1JWDA 1WRLA 1B8LA 2A4JA 2TN4A 3GK4X 5K89A 5FYXA 3BXKA 2AUCA 2BBNA 3JTDC 1DJZA 3Q8IA 2LHLA 1LVCD 4YGEB 3V2LA 5D3OA 2COLB 1IRJA 3DY9A 5D69A 3CTNA 5HYDA 1M31A 4DS7A 1TIZA 2MA2A 3AKBA 3TS5C 4GGFC 5CSNA 4NQGA 2H61A 2EGDA 2PQLA 1K94A 2BCBA 5AXIA 2LV7A 3CR4X 4ORAB 4CFQA 4I5KA 1C3YA 2JXLA 1JBAA 1LKJA 1SBJA 3CYZA 3VB1A 1J7RA 1Y1XA 5JOLA 1KWOC 1WLMA 3PJIA 1DGUA 1OMRA 3DZTA 1AJ4A 1WY9A 3SG4A 2LVIA 2LUXA 3OHMB 4GAOA 4MZKA 1WRZA 2JT3A 1KK8B 1PSBA 1FI6A 2MLFC 1DQEA 2L5XB 4WQ2A 1QATA 1Z4HA 4JKTA 4MLWA 1A03A 1TWOA 3TZ1A 3WXAA 1BR1B 3A8RA 1ZOTB 1RWYA 2WC6A 2FCEA 4QJ5B 2PASA 2KAXA 3D73A 3I5FB 5FI2A 3CABA 1RECA 1B7TZ 1N65A 1C3ZA 1WRKA 1W7JB 3CR5X 2ZN8A 2KI4C 4JQ0D 2DOQA 3BUNB 1C7WA 1C07A 1OMVA 1ZFSA 1LA3A 2HPSA 4GUKA 5G08A 4NDDA 2KLDA 3H4SE 1K8UA 2M7LA 3VROA 1KCYA 4A4BA 1QIWA 2BAPA 3B86A 2FJYA 4FTGA 4UPGA 2Q91A 1IQ3A 1DMOA 2K0JA 2KFGA 2L4IA 3SG7A 2HQWA 2LMTA 3DVMA 5AERA 2PSRA 1ODBA 4JWQA 5HLVA 1CKKA 3KPXA 2NCOA 3RLZA 3EK7A 2NZ0A 3DF0A 4HREE 4MRXA 2KI6D 1CM1A 3L47A 2LLSA 3UO9A 1EJ3A 2ZRTA 1QXPA 2OTGB 2G2BA 2WCHA 1K2HA 1TOPA 4P2YB 2ZFDA 3CLNA 2WCBA 2LCPA 1KSMA 3WHTB 2LVVA 2QPTA 3NSLA 4M2OA 4NDBA 2K61A 1P28A 3QMEA 2KQYA 1TUJA 2L5YA 3M0WA 1MXLC 2LANA 1Z2CB 2WCEA 1YX7A 1XO5A 3A4UB 4D1EA 3S0FA 2ISDA 2KSPA 1OQPA 2HQ8A 5D7FA 4M2PA 1ALVA 1YTZC 3HCMA 4PHKA 1UHKA 4MBEA 4PDZA 5AEQA 5KU1A 1NYAA 3I5HB 1MHOA 2L2EA 2M97A 2ZKMX 5AANA 1FI5A 4NDCA 2ZN9A 2WC8A 4IL1A 1L2OB 1VRKA 1SR6C 3GOFA 1NX3A 2F3ZA 1K93D 5BPJA 3EVUA 2MLEC 1M63B 3D0YA 1IKUA 3PSRA 4AOMA 4GFTA 2HF5A 1CTRA 2KGBC 2R2IA 4MSPA 1BG1A 1H8BA 1ZMZA 2LAPA 3QRXA 2Y4QA 1S1EA 2M0RA 1YUTA 1K95A 3EVRA 1G4YR 3N7HA 5CSFA 1IQ5A 1DJWA 2P71A 2KLEA 1W7IB 3PN7C 2ZNDA 2JC2A 4PALA 3PLFB 2HETA 3HX4A
chains in the Genus database with same CATH topology
1HQVA 1BOCA 2LMUA 2V53A 1KFXS 1TNWA 3I5GC 2WNDA 1DF0B 2M1KB 4OV2A 3SIAA 3JTDB 1OOJA 2JT0A 3GK1A 1TNXA 4WRIA 1OSAA 2KQ6A 2PALA 4Q04A 1CLMA 4MN0A 2KAYA 1OZOA 1J1DA 2KYFA 2Q4UA 3FWCA 4OR9B 3TS5B 4DIRA 1SMGA 1QVIY 2KNEA 2LC5A 3AAKA 1SY9A 1B1GA 2E30A 1UHJA 1NWDA 2JNXA 2CTNA 2MJWB 2K7DA 1KQMC 1R6PA 2I18A 3BOWA 4C0KA 1N2DA 2K7CA 2K8MB 1KWOB 1JF0A 3TDUA 1GQMA 1NUBA 1MWNA 1PRWA 2CXJA 2F3YA 1B8CA 2CT9A 5AFPA 3DVJA 3FWBA 2KBIA 2JT8A 1UP5A 2AAOA 1F70A 1KK7Y 1SL8A 2MHHA 3TDZA 3DVKA 1SYMA 3RM1A 3SG5A 1FBVA 5DKQA 1GJYA 1SW8A 1CDPA 2KI4B 1UHNA 1V1GA 4L9MA 3SJSA 2CCMA 4PE7A 5F6TA 3MSEB 1WDCC 2BBMA 2LLTA 2H61C 3F45A 1J55A 1GGZA 1SK6D 4HSZA 1XK4A 2KFHA 2AMIA 4MVFA 2K2FA 1CDMA 1IJ6A 1NPQA 5KSZA 3ZWHA 3PALA 3BUOB 4DRWA 4N1FA 2LP2A 3LL8B 1BF5A 1F8HA 1M46A 1DJHA 1OE9B 2EHBA 2L0PA 3EK4A 4CLNA 5HLOA 1QASA 3ZNIA 4GBAA 1BR4B 2F2PA 2LNKA 4PCWA 1CM4A 2K7BA 3BUMB 1QV1A 1YURA 5DKNA 2EC6C 2JZIA 1F4OA 1G33A 1AJ5A 1S6JA 2Y5IA 1QJTA 3FS7A 1CMGA 1Y1UA 4I5JA 2LLUA 2F2OA 2RGIA 4YGBB 1TN4A 3O4YA 1SRAA 1YRTB 1CDNA 3OP0A 1PVAA 4A4CA 1DGVA 3LLEA 1UUSA 2F33A 4OVNF 2BECA 2LM5A 1SR6B 1EG3A 1AP4A 2L98A 3C1VA 1MUXA 4YBHB 1MF8B 1KFUL 2ZRSA 4CIDA 2F8PA 4XJKB 5ER4X 3EVVA 2O5GA 1OMDA 5DKRA 1A75B 1AUIB 1XFUO 4MEWA 4OKHA 1BODA 3O78A 1B4CA 5HKZA 1J1EA 1CLBA 2BL0C 3AAJA 2JNFA 5ER5A 1BLQA 3OX5A 4YGCB 3PN7B 1S5GZ 4PHJA 2ZNEA 1EXRA 1LINA 1F71A 4PHMA 2KFFA 4M2QA 1SCVA 2KBMA 1B9AA 2JQ6A 2JXCA 3I5GB 3JVTC 4N5XA 4PE4A 1Q80A 1BMOA 2LMVA 1RJVA 1SCMC 3TDIA 3VRQA 4PE1A 2PVBA 5I2LA 3CS1A 4MZJA 1GGWA 1A4PA 1AVSA 3OX6A 5CSIA 1CNPA 4E68A 4PE0A 4AQIA 4ZCUA 1YVHA 2MRDA 1U5IB 1QX2A 5IBWA 1AHRA 2FJUB 1YVLA 1NCXA 5JJGA 3IF7A 1QIVA 1F55A 4ZCVA 1Y1AA 2M29A 1M39A 1XFXO 2GGZA 1DTLA 3BUXB 1KQMB 2BKHB 3KHEA 1UWOA 1DJIA 2KHNA 3SG6A 4WQ3A 5HKWA 1X02A 3DVEA 3WHUB 1TTXA 1FF1A 3BYAA 3KEVA 4TNCA 5CPVA 5CSJA 5I8NA 3D10A 3O6BA 3KO0A 4GGNA 1JFJA 1NSHA 1K90D 3LK1A 2BCAA 2BE6A 4ORCB 4QJ4B 4HRHA 2OS8C 2LUCA 4PHNA 1EL4A 1QX7A 4USLA 2WORA 3EKJA 2D8NA 1TRFA 1YR5A 3BUWB 2H2KA 1CFDA 2JULA 2O60A 2OPOA 2Y1MA 4FQOA 1AK8A 1CFFA 1DJYA 2LHIA 4R1EA 1DF0A 2B1UA 1A2XA 1S6IA 4YGAA 2E6WA 1QX5B 1WDCB 2BCXA 2KYCA 2M1UA 1J7OA 2BE4A 1PK0D 2M7NA 1S36A 1CFPA 3PFVA 1KSOA 1CDLA 3SIBA 4F0ZB 5PALA 4YRUA 4GGFA 3SG3A 1Y6WA 3VRRA 1HT9A 1NX1A 2L50A 4ORBB 2FOTA 1J7QA 1EG4A 3I5IC 3KF9A 1F54A 1H8BA 1XVJA 1QS7A 2M49B 4YGDB 1IH0A 1MR8A 1DJXA 5HKYA 3EK8A 2Y1NA 3LK0A 1ZUZA 2SASA 1XYDA 3OB2B 4BY4A 2NXQA 1K9PA 3SG2A 1SPYA 1QV0A 1RFJA 2JWWA 2L51A 4CPVA 4ETOA 1BU3A 2EC6B 2KOTA 1PALA 3WNXB 4AQJA 1PSRA 1G8IA 4MZLA 2I2RE 4XYNA 1XA5A 4MRYA 1YX8A 1H4BA 2WOSA 1J7PA 1XK4C 2JTTA 1DT7B 4C0JA 4P5OE 1IWQA 4CFRA 1FPWA 2LVJA 2WCFA 2NLNA 4YI8A 1ZACA 1WLZA 4U8DA 1DJGA 2M3WA 1YRUB 1RK9A 1LXFC 3DF0B 1NX2A 2LP3A 3TUYB 2KI6C 2NCPA 2CNPA 1TNQA 1NX0A 2BL0B 4I5NB 1YUSA 2JOJA 1K9UA 3NSOA 2PRUA 3AKAA 1V1FA 1IJ5A 1MXEA 2CBLA 2I7AA 2M9GA 2JU0A 1E8AA 1NIWA 3OB1B 2KDHA 1EH2A 1KK8C 2VRGA 4C0LA 2KAVA 1JF2A 3JVTB 1M45A 1XFZO 4I5LB 2G9BA 2L4HA 3NSKA 2GV5A 3TUYC 1SCMB 1SL9A 1UHHA 2LVKA 3I5FC 2KGRA 5J3XA 1UHIA 3K21A 1KFXL 3IQQA 2IS9A 1DVIA 4BY5A 1F4QA 2FCDA 1JUOA 3E3RA 1OZSA 4ICBA 3ICBA 1TNPA 1IG5A 4GNKB 1XFVO 1BT6A 1RROA 2K7OA 1KQVA 2P6BB 4OCIA 4DUQA 1QVIZ 1XFWO 2PMYA 3D0YB 2JPTA 4DCKA 1QLSA 1S26D 1CB1A 1JC2A 1FW4A 1K9KA 1UURA 3CR2A 5TNCA 1S6CA 1A29A 3EKHA 1B7TY 4XJKA 1BJFA 4JPZB 4YI9A 1A75A 2K2AA 4GPLB 1D1OA 5KTYA 1JSAA 2BKIB 2OTGC 3VRPA 2OS8B 1IGVA 3DD4A 2M8UA 5B8IB 4QJ3B 2GGMA 1PVBA 1KK7Z 1CFCA 1YUUA 1B47A 3CWGA 3LCPC 1S3PA 1PULA 1ALWA 1TCOB 1QLKA 3O2PA 1N0YA 1R2UA 1CMFA 1QTXA 1Y0VH 1C7VA 3NSIA 3BQ3A 1JFKA 3I5HC 5I2OA 2QACA 1KFUS 1LA0A 5GQQC 2LE9B 1L2OC 1SL7A 1U5IA 3FIAA 1B8RA 2JTZA 3BOWB 1SNLA 2MAZA 3I5IB 3PATA 2I94A 3PM8A 2JRFA 1MQ1A 1TCFA 3VRNA 1L7ZA 3IQOA 1NP8A 3CZTX 1K96A 5I2QA 1S5GY 4HRGA 1SKTA 2MBXA 2SCPA 1NCZA 1NCYA 3GK2A 3VGOA 1XFYO 3NXAA 1RTP1 3CGAA 4N1GA 1CLLA 1JWDA 1WRLA 1B8LA 2A4JA 2TN4A 3GK4X 5K89A 5FYXA 3BXKA 2AUCA 2BBNA 3JTDC 1DJZA 2LHLA 1LVCD 4YGEB 2COLB 1IRJA 5D69A 3CTNA 5HYDA 1M31A 4DS7A 1TIZA 2MA2A 3AKBA 3TS5C 4GGFC 5CSNA 4NQGA 2H61A 2EGDA 1K94A 2BCBA 5AXIA 2LV7A 3CR4X 4ORAB 4CFQA 4I5KA 2JXLA 1JBAA 1LKJA 1SBJA 1J7RA 1Y1XA 5JOLA 1KWOC 1WLMA 1DGUA 1OMRA 3SG4A 1AJ4A 1WY9A 2LVIA 2LUXA 3OHMB 4GAOA 4MZKA 1WRZA 2JT3A 1KK8B 1PSBA 1FI6A 2MLFC 4WQ2A 2L5XB 1A03A 1QATA 4MLWA 3TZ1A 3WXAA 1BR1B 3A8RA 1ZOTB 1RWYA 2FCEA 4QJ5B 2PASA 2KAXA 3I5FB 1RECA 1B7TZ 1N65A 1WRKA 1W7JB 3CR5X 2ZN8A 2KI4C 4JQ0D 2DOQA 3BUNB 1C7WA 1C07A 1OMVA 1ZFSA 1LA3A 2HPSA 4GUKA 5G08A 4NDDA 3H4SE 1K8UA 2M7LA 3VROA 1KCYA 4A4BA 1QIWA 1IQ3A 4FTGA 4UPGA 2Q91A 1DMOA 2K0JA 2KFGA 2L4IA 3SG7A 2HQWA 2LMTA 3DVMA 5AERA 2PSRA 1ODBA 4JWQA 5HLVA 1CKKA 3KPXA 2NCOA 3RLZA 3EK7A 2NZ0A 3DF0A 4HREE 4MRXA 2KI6D 1CM1A 2LLSA 1EJ3A 2ZRTA 1QXPA 2OTGB 2G2BA 1K2HA 1TOPA 4P2YB 2ZFDA 3CLNA 2WCBA 2LCPA 1KSMA 3WHTB 2LVVA 2QPTA 3NSLA 4M2OA 4NDBA 2K61A 2KQYA 3M0WA 1MXLC 2LANA 3A4UB 2WCEA 1YX7A 1XO5A 4D1EA 2ISDA 2KSPA 1OQPA 2HQ8A 5D7FA 4M2PA 1ALVA 1YTZC 3HCMA 4PHKA 1UHKA 4MBEA 4PDZA 5AEQA 5KU1A 1NYAA 3I5HB 1MHOA 2L2EA 2M97A 2ZKMX 5AANA 1FI5A 4NDCA 2ZN9A 2WC8A 4IL1A 1L2OB 1VRKA 1SR6C 3GOFA 1NX3A 2F3ZA 1K93D 5BPJA 3EVUA 2MLEC 1M63B 3D0YA 1IKUA 3PSRA 4AOMA 4GFTA 2HF5A 1CTRA 2KGBC 2R2IA 4MSPA 1BG1A 1ZMZA 2LAPA 3QRXA 2Y4QA 1S1EA 2M0RA 1YUTA 1K95A 3EVRA 1G4YR 5CSFA 1IQ5A 1DJWA 3PN7C 1W7IB 2ZNDA 2JC2A 4PALA 3PLFB 2HETA 3HX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQV A;  1BOC A;  2LMU A;  2V53 A;  1KFX S;  1TNW A;  3I5G C;  2WND A;  1DF0 B;  2M1K B;  4OV2 A;  3SIA A;  3JTD B;  1OOJ A;  2JT0 A;  3GK1 A;  1TNX A;  4WRI A;  1OSA A;  2KQ6 A;  2PAL A;  4Q04 A;  1CLM A;  4MN0 A;  2KAY A;  1OZO A;  1J1D A;  2KYF A;  2Q4U A;  3FWC A;  4OR9 B;  3TS5 B;  4DIR A;  1SMG A;  1QVI Y;  2KNE A;  2LC5 A;  3AAK A;  1SY9 A;  1B1G A;  2E30 A;  1UHJ A;  1NWD A;  2JNX A;  2CTN A;  2MJW B;  2K7D A;  1KQM C;  1R6P A;  2I18 A;  3BOW A;  4C0K A;  1N2D A;  2K7C A;  2K8M B;  1KWO B;  1JF0 A;  3TDU A;  1GQM A;  1NUB A;  1MWN A;  1PRW A;  2CXJ A;  2F3Y A;  1B8C A;  2CT9 A;  5AFP A;  3DVJ A;  3FWB A;  2KBI A;  2JT8 A;  1UP5 A;  2AAO A;  1F70 A;  1KK7 Y;  1SL8 A;  2MHH A;  3TDZ A;  3DVK A;  1SYM A;  3RM1 A;  3SG5 A;  1FBV A;  5DKQ A;  1GJY A;  1SW8 A;  1CDP A;  2KI4 B;  1UHN A;  1V1G A;  4L9M A;  3SJS A;  2CCM A;  4PE7 A;  5F6T A;  3MSE B;  1WDC C;  2BBM A;  2LLT A;  2H61 C;  3F45 A;  1J55 A;  1GGZ A;  1SK6 D;  4HSZ A;  1XK4 A;  2KFH A;  2AMI A;  4MVF A;  2K2F A;  1CDM A;  1IJ6 A;  1NPQ A;  5KSZ A;  3ZWH A;  3PAL A;  3BUO B;  4DRW A;  4N1F A;  2LP2 A;  3LL8 B;  1BF5 A;  1F8H A;  1M46 A;  1DJH A;  1OE9 B;  2EHB A;  2L0P A;  3EK4 A;  4CLN A;  5HLO A;  1QAS A;  3ZNI A;  4GBA A;  1BR4 B;  2F2P A;  2LNK A;  4PCW A;  1CM4 A;  2K7B A;  3BUM B;  1QV1 A;  1YUR A;  5DKN A;  2EC6 C;  2JZI A;  1F4O A;  1G33 A;  1AJ5 A;  1S6J A;  2Y5I A;  1QJT A;  3FS7 A;  1CMG A;  1Y1U A;  4I5J A;  2LLU A;  2F2O A;  2RGI A;  4YGB B;  1TN4 A;  3O4Y A;  1SRA A;  1YRT B;  1CDN A;  3OP0 A;  1PVA A;  4A4C A;  1DGV A;  3LLE A;  1UUS A;  2F33 A;  4OVN F;  2BEC A;  2LM5 A;  1SR6 B;  1EG3 A;  1AP4 A;  2L98 A;  3C1V A;  1MUX A;  4YBH B;  1MF8 B;  1KFU L;  2ZRS A;  4CID A;  2F8P A;  4XJK B;  5ER4 X;  3EVV A;  2O5G A;  1OMD A;  5DKR A;  1A75 B;  1AUI B;  1XFU O;  4MEW A;  4OKH A;  1BOD A;  3O78 A;  1B4C A;  5HKZ A;  1J1E A;  1CLB A;  2BL0 C;  3AAJ A;  2JNF A;  5ER5 A;  1BLQ A;  3OX5 A;  4YGC B;  3PN7 B;  1S5G Z;  4PHJ A;  2ZNE A;  1EXR A;  1LIN A;  1F71 A;  4PHM A;  2KFF A;  4M2Q A;  1SCV A;  2KBM A;  1B9A A;  2JQ6 A;  2JXC A;  3I5G B;  3JVT C;  4N5X A;  4PE4 A;  1Q80 A;  1BMO A;  2LMV A;  1RJV A;  1SCM C;  3TDI A;  3VRQ A;  4PE1 A;  2PVB A;  5I2L A;  3CS1 A;  4MZJ A;  1GGW A;  1A4P A;  1AVS A;  3OX6 A;  5CSI A;  1CNP A;  4E68 A;  4PE0 A;  4AQI A;  4ZCU A;  1YVH A;  2MRD A;  1U5I B;  1QX2 A;  5IBW A;  1AHR A;  2FJU B;  1YVL A;  1NCX A;  5JJG A;  3IF7 A;  1QIV A;  1F55 A;  4ZCV A;  1Y1A A;  2M29 A;  1M39 A;  1XFX O;  2GGZ A;  1DTL A;  3BUX B;  1KQM B;  2BKH B;  3KHE A;  1UWO A;  1DJI A;  2KHN A;  3SG6 A;  4WQ3 A;  5HKW A;  1X02 A;  3DVE A;  3WHU B;  1TTX A;  1FF1 A;  3BYA A;  3KEV A;  4TNC A;  5CPV A;  5CSJ A;  5I8N A;  3D10 A;  3O6B A;  3KO0 A;  4GGN A;  1JFJ A;  1NSH A;  1K90 D;  3LK1 A;  2BCA A;  2BE6 A;  4ORC B;  4QJ4 B;  4HRH A;  2OS8 C;  2LUC A;  4PHN A;  1EL4 A;  1QX7 A;  4USL A;  2WOR A;  3EKJ A;  2D8N A;  1TRF A;  1YR5 A;  3BUW B;  2H2K A;  1CFD A;  2JUL A;  2O60 A;  2OPO A;  2Y1M A;  4FQO A;  1AK8 A;  1CFF A;  1DJY A;  2LHI A;  4R1E A;  1DF0 A;  2B1U A;  1A2X A;  1S6I A;  4YGA A;  2E6W A;  1QX5 B;  1WDC B;  2BCX A;  2KYC A;  2M1U A;  1J7O A;  2BE4 A;  1PK0 D;  2M7N A;  1S36 A;  1CFP A;  3PFV A;  1KSO A;  1CDL A;  3SIB A;  4F0Z B;  5PAL A;  4YRU A;  4GGF A;  3SG3 A;  1Y6W A;  3VRR A;  1HT9 A;  1NX1 A;  2L50 A;  4ORB B;  2FOT A;  1J7Q A;  1EG4 A;  3I5I C;  3KF9 A;  1F54 A;  1H8B A;  1XVJ A;  1QS7 A;  2M49 B;  4YGD B;  1IH0 A;  1MR8 A;  1DJX A;  5HKY A;  3EK8 A;  2Y1N A;  3LK0 A;  1ZUZ A;  2SAS A;  1XYD A;  3OB2 B;  4BY4 A;  2NXQ A;  1K9P A;  3SG2 A;  1SPY A;  1QV0 A;  1RFJ A;  2JWW A;  2L51 A;  4CPV A;  4ETO A;  1BU3 A;  2EC6 B;  2KOT A;  1PAL A;  3WNX B;  4AQJ A;  1PSR A;  1G8I A;  4MZL A;  2I2R E;  4XYN A;  1XA5 A;  4MRY A;  1YX8 A;  1H4B A;  2WOS A;  1J7P A;  1XK4 C;  2JTT A;  1DT7 B;  4C0J A;  4P5O E;  1IWQ A;  4CFR A;  1FPW A;  2LVJ A;  2WCF A;  2NLN A;  4YI8 A;  1ZAC A;  1WLZ A;  4U8D A;  1DJG A;  2M3W A;  1YRU B;  1RK9 A;  1LXF C;  3DF0 B;  1NX2 A;  2LP3 A;  3TUY B;  2KI6 C;  2NCP A;  2CNP A;  1TNQ A;  1NX0 A;  2BL0 B;  4I5N B;  1YUS A;  2JOJ A;  1K9U A;  3NSO A;  2PRU A;  3AKA A;  1V1F A;  1IJ5 A;  1MXE A;  2CBL A;  2I7A A;  2M9G A;  2JU0 A;  1E8A A;  1NIW A;  3OB1 B;  2KDH A;  1EH2 A;  1KK8 C;  2VRG A;  4C0L A;  2KAV A;  1JF2 A;  3JVT B;  1M45 A;  1XFZ O;  4I5L B;  2G9B A;  2L4H A;  3NSK A;  2GV5 A;  3TUY C;  1SCM B;  1SL9 A;  1UHH A;  2LVK A;  3I5F C;  2KGR A;  5J3X A;  1UHI A;  3K21 A;  1KFX L;  3IQQ A;  2IS9 A;  1DVI A;  4BY5 A;  1F4Q A;  2FCD A;  1JUO A;  3E3R A;  1OZS A;  4ICB A;  3ICB A;  1TNP A;  1IG5 A;  4GNK B;  1XFV O;  1BT6 A;  1RRO A;  2K7O A;  1KQV A;  2P6B B;  4OCI A;  4DUQ A;  1QVI Z;  1XFW O;  2PMY A;  3D0Y B;  2JPT A;  4DCK A;  1QLS A;  1S26 D;  1CB1 A;  1JC2 A;  1FW4 A;  1K9K A;  1UUR A;  3CR2 A;  5TNC A;  1S6C A;  1A29 A;  3EKH A;  1B7T Y;  4XJK A;  1BJF A;  4JPZ B;  4YI9 A;  1A75 A;  2K2A A;  4GPL B;  1D1O A;  5KTY A;  1JSA A;  2BKI B;  2OTG C;  3VRP A;  2OS8 B;  1IGV A;  3DD4 A;  2M8U A;  5B8I B;  4QJ3 B;  2GGM A;  1PVB A;  1KK7 Z;  1CFC A;  1YUU A;  1B47 A;  3CWG A;  3LCP C;  1S3P A;  1PUL A;  1ALW A;  1TCO B;  1QLK A;  3O2P A;  1N0Y A;  1R2U A;  1CMF A;  1QTX A;  1Y0V H;  1C7V A;  3NSI A;  3BQ3 A;  1JFK A;  3I5H C;  5I2O A;  2QAC A;  1KFU S;  1LA0 A;  5GQQ C;  2LE9 B;  1L2O C;  1SL7 A;  1U5I A;  3FIA A;  1B8R A;  2JTZ A;  3BOW B;  1SNL A;  2MAZ A;  3I5I B;  3PAT A;  2I94 A;  3PM8 A;  2JRF A;  1MQ1 A;  1TCF A;  3VRN A;  1L7Z A;  3IQO A;  1NP8 A;  3CZT X;  1K96 A;  5I2Q A;  1S5G Y;  4HRG A;  1SKT A;  2MBX A;  2SCP A;  1NCZ A;  1NCY A;  3GK2 A;  3VGO A;  1XFY O;  3NXA A;  1RTP 1;  3CGA A;  4N1G A;  1CLL A;  1JWD A;  1WRL A;  1B8L A;  2A4J A;  2TN4 A;  3GK4 X;  5K89 A;  5FYX A;  3BXK A;  2AUC A;  2BBN A;  3JTD C;  1DJZ A;  2LHL A;  1LVC D;  4YGE B;  2COL B;  1IRJ A;  5D69 A;  3CTN A;  5HYD A;  1M31 A;  4DS7 A;  1TIZ A;  2MA2 A;  3AKB A;  3TS5 C;  4GGF C;  5CSN A;  4NQG A;  2H61 A;  2EGD A;  1K94 A;  2BCB A;  5AXI A;  2LV7 A;  3CR4 X;  4ORA B;  4CFQ A;  4I5K A;  2JXL A;  1JBA A;  1LKJ A;  1SBJ A;  1J7R A;  1Y1X A;  5JOL A;  1KWO C;  1WLM A;  1DGU A;  1OMR A;  3SG4 A;  1AJ4 A;  1WY9 A;  2LVI A;  2LUX A;  3OHM B;  4GAO A;  4MZK A;  1WRZ A;  2JT3 A;  1KK8 B;  1PSB A;  1FI6 A;  2MLF C;  4WQ2 A;  2L5X B;  1A03 A;  1QAT A;  4MLW A;  3TZ1 A;  3WXA A;  1BR1 B;  3A8R A;  1ZOT B;  1RWY A;  2FCE A;  4QJ5 B;  2PAS A;  2KAX A;  3I5F B;  1REC A;  1B7T Z;  1N65 A;  1WRK A;  1W7J B;  3CR5 X;  2ZN8 A;  2KI4 C;  4JQ0 D;  2DOQ A;  3BUN B;  1C7W A;  1C07 A;  1OMV A;  1ZFS A;  1LA3 A;  2HPS A;  4GUK A;  5G08 A;  4NDD A;  3H4S E;  1K8U A;  2M7L A;  3VRO A;  1KCY A;  4A4B A;  1QIW A;  1IQ3 A;  4FTG A;  4UPG A;  2Q91 A;  1DMO A;  2K0J A;  2KFG A;  2L4I A;  3SG7 A;  2HQW A;  2LMT A;  3DVM A;  5AER A;  2PSR A;  1ODB A;  4JWQ A;  5HLV A;  1CKK A;  3KPX A;  2NCO A;  3RLZ A;  3EK7 A;  2NZ0 A;  3DF0 A;  4HRE E;  4MRX A;  2KI6 D;  1CM1 A;  2LLS A;  1EJ3 A;  2ZRT A;  1QXP A;  2OTG B;  2G2B A;  1K2H A;  1TOP A;  4P2Y B;  2ZFD A;  3CLN A;  2WCB A;  2LCP A;  1KSM A;  3WHT B;  2LVV A;  2QPT A;  3NSL A;  4M2O A;  4NDB A;  2K61 A;  2KQY A;  3M0W A;  1MXL C;  2LAN A;  3A4U B;  2WCE A;  1YX7 A;  1XO5 A;  4D1E A;  2ISD A;  2KSP A;  1OQP A;  2HQ8 A;  5D7F A;  4M2P A;  1ALV A;  1YTZ C;  3HCM A;  4PHK A;  1UHK A;  4MBE A;  4PDZ A;  5AEQ A;  5KU1 A;  1NYA A;  3I5H B;  1MHO A;  2L2E A;  2M97 A;  2ZKM X;  5AAN A;  1FI5 A;  4NDC A;  2ZN9 A;  2WC8 A;  4IL1 A;  1L2O B;  1VRK A;  1SR6 C;  3GOF A;  1NX3 A;  2F3Z A;  1K93 D;  5BPJ A;  3EVU A;  2MLE C;  1M63 B;  3D0Y A;  1IKU A;  3PSR A;  4AOM A;  4GFT A;  2HF5 A;  1CTR A;  2KGB C;  2R2I A;  4MSP A;  1BG1 A;  1ZMZ A;  2LAP A;  3QRX A;  2Y4Q A;  1S1E A;  2M0R A;  1YUT A;  1K95 A;  3EVR A;  1G4Y R;  5CSF A;  1IQ5 A;  1DJW A;  3PN7 C;  1W7I B;  2ZND A;  2JC2 A;  4PAL A;  3PLF B;  2HET A;  3HX4 A; 
#chains in the Genus database with same CATH topology
 1HQV A;  1BOC A;  2LMU A;  2V53 A;  1KFX S;  1TNW A;  3I5G C;  2WND A;  1DF0 B;  2M1K B;  2WCM A;  4OV2 A;  3JTD B;  3SIA A;  1OOJ A;  2JT0 A;  5I94 A;  3GK1 A;  1TNX A;  4WRI A;  1OSA A;  2KQ6 A;  2PAL A;  4Q04 A;  1CLM A;  4MN0 A;  2KAY A;  1OZO A;  1J1D A;  2KYF A;  2Q4U A;  3FWC A;  4OR9 B;  3NGV A;  3TS5 B;  4DIR A;  1SMG A;  1QVI Y;  2KNE A;  2LC5 A;  3AAK A;  1SY9 A;  1B1G A;  2E30 A;  1UHJ A;  1NWD A;  2JNX A;  3BFH A;  2CTN A;  2MJW B;  2K7D A;  3FE9 A;  1KQM C;  1R6P A;  2I18 A;  3BOW A;  4C0K A;  1N2D A;  2K7C A;  2K8M B;  1KWO B;  1JF0 A;  3TDU A;  1GQM A;  1NUB A;  1MWN A;  1PRW A;  2CXJ A;  2F3Y A;  1B8C A;  2CT9 A;  5AFP A;  4KYN A;  3DVJ A;  1GM0 A;  3FWB A;  2KBI A;  2JT8 A;  1UP5 A;  2AAO A;  1F70 A;  1KK7 Y;  1SL8 A;  2MHH A;  5HL1 A;  3TDZ A;  3DVK A;  1SYM A;  2ERB A;  4IJ7 A;  3RM1 A;  3SG5 A;  1FBV A;  5DKQ A;  1GJY A;  1SW8 A;  1CDP A;  2WCL A;  2KI4 B;  1UHN A;  1V1G A;  4L9M A;  4PT1 A;  2CCM A;  3SJS A;  4PE7 A;  5F6T A;  3MSE B;  1WDC C;  2BBM A;  2LLT A;  2H61 C;  3F45 A;  1J55 A;  1GGZ A;  1SK6 D;  1TUZ A;  4HSZ A;  1XK4 A;  2KFH A;  2AMI A;  4MVF A;  2K2F A;  3DXL A;  1CDM A;  3IVT A;  3SS4 A;  1IJ6 A;  1NPQ A;  5KSZ A;  3ZWH A;  3PAL A;  3BUO B;  4DRW A;  4N1F A;  1DEL A;  2LP2 A;  3LL8 B;  3L4A A;  1BF5 A;  1F8H A;  1M46 A;  1DJH A;  1OE9 B;  2EHB A;  2L0P A;  3EK4 A;  4CLN A;  5HLO A;  1QAS A;  3ZNI A;  4GBA A;  2K60 A;  3CZ2 A;  1BR4 B;  1QWV A;  2F2P A;  2LNK A;  4PCW A;  1DEK A;  1CM4 A;  2K7B A;  3BUM B;  1QV1 A;  1YUR A;  1OOF A;  5DKN A;  2EC6 C;  2JZI A;  3R72 A;  1F4O A;  1G33 A;  1AJ5 A;  1S6J A;  2Y5I A;  1QJT A;  2GTE A;  3FS7 A;  1Y1U A;  1CMG A;  4I5J A;  2LLU A;  2F2O A;  1T14 A;  2RGI A;  1TN4 A;  3O4Y A;  1SRA A;  1YRT B;  4YGB B;  1CDN A;  3OP0 A;  1PVA A;  4A4C A;  1DGV A;  3LLE A;  1UUS A;  2BNX A;  2F33 A;  4OVN F;  2BEC A;  2LM5 A;  1SR6 B;  1EG3 A;  1AP4 A;  2L98 A;  3C1V A;  1MUX A;  4YBH B;  1MF8 B;  1KFU L;  2ZRS A;  4CID A;  2F8P A;  4XJK B;  5ER4 X;  3EVV A;  2O5G A;  1OMD A;  5DKR A;  1A75 B;  1AUI B;  1XFU O;  3CDN A;  4MEW A;  4OKH A;  3O78 A;  1BOD A;  1B4C A;  5HKZ A;  1J1E A;  1CLB A;  2BL0 C;  3AAJ A;  2JNF A;  5ER5 A;  3SS5 A;  3OX5 A;  1BLQ A;  4YGC B;  3PN7 B;  1S5G Z;  4PHJ A;  2ZNE A;  1EXR A;  1OOI X;  1LIN A;  4INW A;  2H8V A;  3RZS A;  1F71 A;  4PHM A;  2KFF A;  4M2Q A;  1SCV A;  2KBM A;  1B9A A;  2JQ6 A;  2JXC A;  3I5G B;  3JVT C;  4N5X A;  4PE4 A;  1Q80 A;  1BMO A;  2LMV A;  3B88 A;  1RJV A;  1SCM C;  3TDI A;  3VRQ A;  4PE1 A;  2PVB A;  5I2L A;  3CS1 A;  4MZJ A;  1GGW A;  1A4P A;  1AVS A;  3OX6 A;  5CSI A;  1XFR A;  4E68 A;  1CNP A;  4PE0 A;  4AQI A;  3BFB A;  1YVH A;  2MRD A;  1U5I B;  4FQT A;  4ZCU A;  1QX2 A;  5IBW A;  1AHR A;  2FJU B;  1YVL A;  1NCX A;  3D74 A;  5JJG A;  3IF7 A;  1QIV A;  1F55 A;  4ZCV A;  1Y1A A;  2M29 A;  1M39 A;  1XFX O;  2GGZ A;  1DTL A;  3BUX B;  2L2C A;  3S0D A;  1KQM B;  2BKH B;  3KHE A;  2WC5 A;  1UWO A;  2QEB A;  1DJI A;  2KHN A;  3CZ1 A;  4WQ3 A;  5HKW A;  3SG6 A;  1X02 A;  3DVE A;  3WHU B;  1TTX A;  1FF1 A;  3BYA A;  3KEV A;  4TNC A;  5CPV A;  5CSJ A;  5I8N A;  3D10 A;  3O6B A;  3KO0 A;  4GGN A;  1JFJ A;  1NSH A;  1K90 D;  3LK1 A;  2BCA A;  2BE6 A;  4ORC B;  3L4L A;  4HRH A;  4QJ4 B;  3FE8 A;  2OS8 C;  3NHI A;  2LUC A;  1OW4 A;  4PHN A;  1EL4 A;  1QX7 A;  4USL A;  2YGU A;  2WOR A;  3EG5 B;  3EKJ A;  2D8N A;  1TRF A;  1YR5 A;  3BUW B;  4OZD A;  2H2K A;  1CFD A;  2JUL A;  2O60 A;  2OPO A;  2QDI A;  2Y1M A;  4FQO A;  1AK8 A;  1CFF A;  1DJY A;  2LHI A;  4R1E A;  1DF0 A;  2B1U A;  1A2X A;  1S6I A;  4YGA A;  2E6W A;  1QX5 B;  1WDC B;  2BCX A;  2KYC A;  3BFA A;  2M1U A;  1J7O A;  1PK0 D;  2BE4 A;  2M7N A;  1S36 A;  1CFP A;  3D78 A;  1KSO A;  3PFV A;  1CDL A;  3SIB A;  4F0Z B;  5PAL A;  4YRU A;  4GGF A;  3SG3 A;  1Y6W A;  3VRR A;  1HT9 A;  1NX1 A;  2L50 A;  3D75 A;  2FOT A;  4ORB B;  1EG4 A;  2QEO A;  3I5I C;  3KF9 A;  5DIC A;  1XVJ A;  1J7Q A;  1F54 A;  1QS7 A;  2M49 B;  4YGD B;  1IH0 A;  1MR8 A;  1DJX A;  2P70 A;  5HKY A;  2QEH A;  3EK8 A;  2Y1N A;  3LK0 A;  1ZUZ A;  2SAS A;  2QEV A;  1XYD A;  3B7A A;  3OB2 B;  3B6X A;  4BY4 A;  2NXQ A;  1K9P A;  3SG2 A;  1SPY A;  1QV0 A;  1RFJ A;  2JWW A;  2L51 A;  4CPV A;  4ETO A;  1BU3 A;  2EC6 B;  2KOT A;  1PAL A;  3WNX B;  3O4X A;  3R1O A;  1PSR A;  4AQJ A;  1G8I A;  4MZL A;  3S0A A;  2I2R E;  4XYN A;  3S0E A;  1XA5 A;  4MRY A;  1YX8 A;  4F7F A;  1H4B A;  2WOS A;  1J7P A;  1XK4 C;  2JTT A;  1DT7 B;  4C0J A;  4P5O E;  1OOH A;  1IWQ A;  4CFR A;  1FPW A;  2LVJ A;  2WCF A;  2NLN A;  4YI8 A;  1ZAC A;  1WLZ A;  3D76 A;  4U8D A;  4INX A;  1DJG A;  3R1P A;  2M3W A;  1YRU B;  1RK9 A;  1LXF C;  3DF0 B;  1NX2 A;  3UNW A;  2LP3 A;  3TUY B;  2KI6 C;  2NCP A;  2CNP A;  1TNQ A;  1NX0 A;  2BL0 B;  4I5N B;  3D77 A;  1YUS A;  2JOJ A;  1K9U A;  3NSO A;  1SSE B;  2PRU A;  3AKA A;  1V1F A;  3CZ0 A;  1IJ5 A;  1MXE A;  2CBL A;  2I7A A;  2M9G A;  2JU0 A;  1E8A A;  1NIW A;  3OB1 B;  3FE6 A;  3OBV A;  2KDH A;  3DYE A;  1KK8 C;  1EH2 A;  2VRG A;  4C0L A;  2KAV A;  1JF2 A;  3JVT B;  1M45 A;  1XFZ O;  5FI6 A;  4I5L B;  2G9B A;  2WCJ A;  3OGN A;  2L4H A;  3NSK A;  2GV5 A;  3TUY C;  1SCM B;  1SL9 A;  1UHH A;  2LVK A;  3I5F C;  2KGR A;  5J3X A;  1UHI A;  3K21 A;  1KFX L;  3IQQ A;  2IS9 A;  1DVI A;  4BY5 A;  1F4Q A;  2FCD A;  1JUO A;  3E3R A;  1OZS A;  4ICB A;  3ICB A;  1TNP A;  1IG5 A;  4GNK B;  1XFV O;  1BT6 A;  1RRO A;  2K7O A;  1KQV A;  2P6B B;  4OCI A;  1DC1 A;  4DUQ A;  1QVI Z;  1XFW O;  2PMY A;  1LS8 A;  3D0Y B;  2JPT A;  4DCK A;  1QLS A;  1S26 D;  1CB1 A;  1JC2 A;  1FW4 A;  5FI7 A;  1K9K A;  1UUR A;  3BJH A;  3CR2 A;  1IIO A;  5TNC A;  1S6C A;  3K1E A;  1A29 A;  3EKH A;  1B7T Y;  4XJK A;  1BJF A;  4JPZ B;  1ORG A;  4YI9 A;  1A75 A;  2K2A A;  4GPL B;  1D1O A;  5KTY A;  1JSA A;  2BKI B;  2WCK A;  2OTG C;  3VRP A;  2OS8 B;  1IGV A;  3DD4 A;  2M8U A;  3S0G A;  5B8I B;  4QJ3 B;  2GGM A;  1PVB A;  1KK7 Z;  3PM2 A;  1CFC A;  1YUU A;  2KPH A;  1B47 A;  3CWG A;  3LCP C;  1S3P A;  1PUL A;  1ALW A;  1TCO B;  1QLK A;  3O2P A;  1N0Y A;  1R2U A;  1CMF A;  1QTX A;  1Y0V H;  3S0B A;  1C7V A;  3NSI A;  3BQ3 A;  2JPO A;  1JFK A;  3B87 A;  3R1V A;  3I5H C;  5I2O A;  2QAC A;  1KFU S;  1LA0 A;  5GQQ C;  2LE9 B;  1L2O C;  1SL7 A;  1U5I A;  3FIA A;  2PYQ A;  1B8R A;  2JTZ A;  3BOW B;  1SNL A;  2MAZ A;  3I5I B;  3PAT A;  2I94 A;  3PM8 A;  2JRF A;  5EL2 A;  1MQ1 A;  4JD9 A;  1TCF A;  3VRN A;  1L7Z A;  3IQO A;  1NP8 A;  3NHT A;  3CZT X;  1K96 A;  5I2Q A;  1OOG A;  1S5G Y;  4HRG A;  1SKT A;  1W9Z A;  2MBX A;  2SCP A;  1NCZ A;  1NCY A;  3GK2 A;  3VGO A;  1XFY O;  3NXA A;  1RTP 1;  3CGA A;  4N1G A;  1CLL A;  3SS3 A;  1JWD A;  1WRL A;  1B8L A;  2A4J A;  2TN4 A;  3GK4 X;  5K89 A;  5FYX A;  3BXK A;  2AUC A;  2BBN A;  3JTD C;  1DJZ A;  3Q8I A;  2LHL A;  1LVC D;  4YGE B;  3V2L A;  5D3O A;  2COL B;  1IRJ A;  3DY9 A;  5D69 A;  3CTN A;  5HYD A;  1M31 A;  4DS7 A;  1TIZ A;  2MA2 A;  3AKB A;  3TS5 C;  4GGF C;  5CSN A;  4NQG A;  2H61 A;  2EGD A;  2PQL A;  1K94 A;  2BCB A;  5AXI A;  2LV7 A;  3CR4 X;  4ORA B;  4CFQ A;  4I5K A;  1C3Y A;  2JXL A;  1JBA A;  1LKJ A;  1SBJ A;  3CYZ A;  3VB1 A;  1J7R A;  1Y1X A;  5JOL A;  1KWO C;  1WLM A;  3PJI A;  1DGU A;  1OMR A;  3DZT A;  1AJ4 A;  1WY9 A;  3SG4 A;  2LVI A;  2LUX A;  3OHM B;  4GAO A;  4MZK A;  1WRZ A;  2JT3 A;  1KK8 B;  1PSB A;  1FI6 A;  2MLF C;  1DQE A;  2L5X B;  4WQ2 A;  1QAT A;  1Z4H A;  4JKT A;  4MLW A;  1A03 A;  1TWO A;  3TZ1 A;  3WXA A;  1BR1 B;  3A8R A;  1ZOT B;  1RWY A;  2WC6 A;  2FCE A;  4QJ5 B;  2PAS A;  2KAX A;  3D73 A;  3I5F B;  5FI2 A;  3CAB A;  1REC A;  1B7T Z;  1N65 A;  1C3Z A;  1WRK A;  1W7J B;  3CR5 X;  2ZN8 A;  2KI4 C;  4JQ0 D;  2DOQ A;  3BUN B;  1C7W A;  1C07 A;  1OMV A;  1ZFS A;  1LA3 A;  2HPS A;  4GUK A;  5G08 A;  4NDD A;  2KLD A;  3H4S E;  1K8U A;  2M7L A;  3VRO A;  1KCY A;  4A4B A;  1QIW A;  2BAP A;  3B86 A;  2FJY A;  4FTG A;  4UPG A;  2Q91 A;  1IQ3 A;  1DMO A;  2K0J A;  2KFG A;  2L4I A;  3SG7 A;  2HQW A;  2LMT A;  3DVM A;  5AER A;  2PSR A;  1ODB A;  4JWQ A;  5HLV A;  1CKK A;  3KPX A;  2NCO A;  3RLZ A;  3EK7 A;  2NZ0 A;  3DF0 A;  4HRE E;  4MRX A;  2KI6 D;  1CM1 A;  3L47 A;  2LLS A;  3UO9 A;  1EJ3 A;  2ZRT A;  1QXP A;  2OTG B;  2G2B A;  2WCH A;  1K2H A;  1TOP A;  4P2Y B;  2ZFD A;  3CLN A;  2WCB A;  2LCP A;  1KSM A;  3WHT B;  2LVV A;  2QPT A;  3NSL A;  4M2O A;  4NDB A;  2K61 A;  1P28 A;  3QME A;  2KQY A;  1TUJ A;  2L5Y A;  3M0W A;  1MXL C;  2LAN A;  1Z2C B;  2WCE A;  1YX7 A;  1XO5 A;  3A4U B;  4D1E A;  3S0F A;  2ISD A;  2KSP A;  1OQP A;  2HQ8 A;  5D7F A;  4M2P A;  1ALV A;  1YTZ C;  3HCM A;  4PHK A;  1UHK A;  4MBE A;  4PDZ A;  5AEQ A;  5KU1 A;  1NYA A;  3I5H B;  1MHO A;  2L2E A;  2M97 A;  2ZKM X;  5AAN A;  1FI5 A;  4NDC A;  2ZN9 A;  2WC8 A;  4IL1 A;  1L2O B;  1VRK A;  1SR6 C;  3GOF A;  1NX3 A;  2F3Z A;  1K93 D;  5BPJ A;  3EVU A;  2MLE C;  1M63 B;  3D0Y A;  1IKU A;  3PSR A;  4AOM A;  4GFT A;  2HF5 A;  1CTR A;  2KGB C;  2R2I A;  4MSP A;  1BG1 A;  1H8B A;  1ZMZ A;  2LAP A;  3QRX A;  2Y4Q A;  1S1E A;  2M0R A;  1YUT A;  1K95 A;  3EVR A;  1G4Y R;  3N7H A;  5CSF A;  1IQ5 A;  1DJW A;  2P71 A;  2KLE A;  1W7I B;  3PN7 C;  2ZND A;  2JC2 A;  4PAL A;  3PLF B;  2HET A;  3HX4 A; 
#chains in the Genus database with same CATH homology
 1HQV A;  1BOC A;  2LMU A;  2V53 A;  1KFX S;  1TNW A;  3I5G C;  2WND A;  1DF0 B;  2M1K B;  4OV2 A;  3SIA A;  3JTD B;  1OOJ A;  2JT0 A;  3GK1 A;  1TNX A;  4WRI A;  1OSA A;  2KQ6 A;  2PAL A;  4Q04 A;  1CLM A;  4MN0 A;  2KAY A;  1OZO A;  1J1D A;  2KYF A;  2Q4U A;  3FWC A;  4OR9 B;  3TS5 B;  4DIR A;  1SMG A;  1QVI Y;  2KNE A;  2LC5 A;  3AAK A;  1SY9 A;  1B1G A;  2E30 A;  1UHJ A;  1NWD A;  2JNX A;  2CTN A;  2MJW B;  2K7D A;  1KQM C;  1R6P A;  2I18 A;  3BOW A;  4C0K A;  1N2D A;  2K7C A;  2K8M B;  1KWO B;  1JF0 A;  3TDU A;  1GQM A;  1NUB A;  1MWN A;  1PRW A;  2CXJ A;  2F3Y A;  1B8C A;  2CT9 A;  5AFP A;  3DVJ A;  3FWB A;  2KBI A;  2JT8 A;  1UP5 A;  2AAO A;  1F70 A;  1KK7 Y;  1SL8 A;  2MHH A;  3TDZ A;  3DVK A;  1SYM A;  3RM1 A;  3SG5 A;  1FBV A;  5DKQ A;  1GJY A;  1SW8 A;  1CDP A;  2KI4 B;  1UHN A;  1V1G A;  4L9M A;  3SJS A;  2CCM A;  4PE7 A;  5F6T A;  3MSE B;  1WDC C;  2BBM A;  2LLT A;  2H61 C;  3F45 A;  1J55 A;  1GGZ A;  1SK6 D;  4HSZ A;  1XK4 A;  2KFH A;  2AMI A;  4MVF A;  2K2F A;  1CDM A;  1IJ6 A;  1NPQ A;  5KSZ A;  3ZWH A;  3PAL A;  3BUO B;  4DRW A;  4N1F A;  2LP2 A;  3LL8 B;  1BF5 A;  1F8H A;  1M46 A;  1DJH A;  1OE9 B;  2EHB A;  2L0P A;  3EK4 A;  4CLN A;  5HLO A;  1QAS A;  3ZNI A;  4GBA A;  1BR4 B;  2F2P A;  2LNK A;  4PCW A;  1CM4 A;  2K7B A;  3BUM B;  1QV1 A;  1YUR A;  5DKN A;  2EC6 C;  2JZI A;  1F4O A;  1G33 A;  1AJ5 A;  1S6J A;  2Y5I A;  1QJT A;  3FS7 A;  1CMG A;  1Y1U A;  4I5J A;  2LLU A;  2F2O A;  2RGI A;  4YGB B;  1TN4 A;  3O4Y A;  1SRA A;  1YRT B;  1CDN A;  3OP0 A;  1PVA A;  4A4C A;  1DGV A;  3LLE A;  1UUS A;  2F33 A;  4OVN F;  2BEC A;  2LM5 A;  1SR6 B;  1EG3 A;  1AP4 A;  2L98 A;  3C1V A;  1MUX A;  4YBH B;  1MF8 B;  1KFU L;  2ZRS A;  4CID A;  2F8P A;  4XJK B;  5ER4 X;  3EVV A;  2O5G A;  1OMD A;  5DKR A;  1A75 B;  1AUI B;  1XFU O;  4MEW A;  4OKH A;  1BOD A;  3O78 A;  1B4C A;  5HKZ A;  1J1E A;  1CLB A;  2BL0 C;  3AAJ A;  2JNF A;  5ER5 A;  1BLQ A;  3OX5 A;  4YGC B;  3PN7 B;  1S5G Z;  4PHJ A;  2ZNE A;  1EXR A;  1LIN A;  1F71 A;  4PHM A;  2KFF A;  4M2Q A;  1SCV A;  2KBM A;  1B9A A;  2JQ6 A;  2JXC A;  3I5G B;  3JVT C;  4N5X A;  4PE4 A;  1Q80 A;  1BMO A;  2LMV A;  1RJV A;  1SCM C;  3TDI A;  3VRQ A;  4PE1 A;  2PVB A;  5I2L A;  3CS1 A;  4MZJ A;  1GGW A;  1A4P A;  1AVS A;  3OX6 A;  5CSI A;  1CNP A;  4E68 A;  4PE0 A;  4AQI A;  4ZCU A;  1YVH A;  2MRD A;  1U5I B;  1QX2 A;  5IBW A;  1AHR A;  2FJU B;  1YVL A;  1NCX A;  5JJG A;  3IF7 A;  1QIV A;  1F55 A;  4ZCV A;  1Y1A A;  2M29 A;  1M39 A;  1XFX O;  2GGZ A;  1DTL A;  3BUX B;  1KQM B;  2BKH B;  3KHE A;  1UWO A;  1DJI A;  2KHN A;  3SG6 A;  4WQ3 A;  5HKW A;  1X02 A;  3DVE A;  3WHU B;  1TTX A;  1FF1 A;  3BYA A;  3KEV A;  4TNC A;  5CPV A;  5CSJ A;  5I8N A;  3D10 A;  3O6B A;  3KO0 A;  4GGN A;  1JFJ A;  1NSH A;  1K90 D;  3LK1 A;  2BCA A;  2BE6 A;  4ORC B;  4QJ4 B;  4HRH A;  2OS8 C;  2LUC A;  4PHN A;  1EL4 A;  1QX7 A;  4USL A;  2WOR A;  3EKJ A;  2D8N A;  1TRF A;  1YR5 A;  3BUW B;  2H2K A;  1CFD A;  2JUL A;  2O60 A;  2OPO A;  2Y1M A;  4FQO A;  1AK8 A;  1CFF A;  1DJY A;  2LHI A;  4R1E A;  1DF0 A;  2B1U A;  1A2X A;  1S6I A;  4YGA A;  2E6W A;  1QX5 B;  1WDC B;  2BCX A;  2KYC A;  2M1U A;  1J7O A;  2BE4 A;  1PK0 D;  2M7N A;  1S36 A;  1CFP A;  3PFV A;  1KSO A;  1CDL A;  3SIB A;  4F0Z B;  5PAL A;  4YRU A;  4GGF A;  3SG3 A;  1Y6W A;  3VRR A;  1HT9 A;  1NX1 A;  2L50 A;  4ORB B;  2FOT A;  1J7Q A;  1EG4 A;  3I5I C;  3KF9 A;  1F54 A;  1H8B A;  1XVJ A;  1QS7 A;  2M49 B;  4YGD B;  1IH0 A;  1MR8 A;  1DJX A;  5HKY A;  3EK8 A;  2Y1N A;  3LK0 A;  1ZUZ A;  2SAS A;  1XYD A;  3OB2 B;  4BY4 A;  2NXQ A;  1K9P A;  3SG2 A;  1SPY A;  1QV0 A;  1RFJ A;  2JWW A;  2L51 A;  4CPV A;  4ETO A;  1BU3 A;  2EC6 B;  2KOT A;  1PAL A;  3WNX B;  4AQJ A;  1PSR A;  1G8I A;  4MZL A;  2I2R E;  4XYN A;  1XA5 A;  4MRY A;  1YX8 A;  1H4B A;  2WOS A;  1J7P A;  1XK4 C;  2JTT A;  1DT7 B;  4C0J A;  4P5O E;  1IWQ A;  4CFR A;  1FPW A;  2LVJ A;  2WCF A;  2NLN A;  4YI8 A;  1ZAC A;  1WLZ A;  4U8D A;  1DJG A;  2M3W A;  1YRU B;  1RK9 A;  1LXF C;  3DF0 B;  1NX2 A;  2LP3 A;  3TUY B;  2KI6 C;  2NCP A;  2CNP A;  1TNQ A;  1NX0 A;  2BL0 B;  4I5N B;  1YUS A;  2JOJ A;  1K9U A;  3NSO A;  2PRU A;  3AKA A;  1V1F A;  1IJ5 A;  1MXE A;  2CBL A;  2I7A A;  2M9G A;  2JU0 A;  1E8A A;  1NIW A;  3OB1 B;  2KDH A;  1EH2 A;  1KK8 C;  2VRG A;  4C0L A;  2KAV A;  1JF2 A;  3JVT B;  1M45 A;  1XFZ O;  4I5L B;  2G9B A;  2L4H A;  3NSK A;  2GV5 A;  3TUY C;  1SCM B;  1SL9 A;  1UHH A;  2LVK A;  3I5F C;  2KGR A;  5J3X A;  1UHI A;  3K21 A;  1KFX L;  3IQQ A;  2IS9 A;  1DVI A;  4BY5 A;  1F4Q A;  2FCD A;  1JUO A;  3E3R A;  1OZS A;  4ICB A;  3ICB A;  1TNP A;  1IG5 A;  4GNK B;  1XFV O;  1BT6 A;  1RRO A;  2K7O A;  1KQV A;  2P6B B;  4OCI A;  4DUQ A;  1QVI Z;  1XFW O;  2PMY A;  3D0Y B;  2JPT A;  4DCK A;  1QLS A;  1S26 D;  1CB1 A;  1JC2 A;  1FW4 A;  1K9K A;  1UUR A;  3CR2 A;  5TNC A;  1S6C A;  1A29 A;  3EKH A;  1B7T Y;  4XJK A;  1BJF A;  4JPZ B;  4YI9 A;  1A75 A;  2K2A A;  4GPL B;  1D1O A;  5KTY A;  1JSA A;  2BKI B;  2OTG C;  3VRP A;  2OS8 B;  1IGV A;  3DD4 A;  2M8U A;  5B8I B;  4QJ3 B;  2GGM A;  1PVB A;  1KK7 Z;  1CFC A;  1YUU A;  1B47 A;  3CWG A;  3LCP C;  1S3P A;  1PUL A;  1ALW A;  1TCO B;  1QLK A;  3O2P A;  1N0Y A;  1R2U A;  1CMF A;  1QTX A;  1Y0V H;  1C7V A;  3NSI A;  3BQ3 A;  1JFK A;  3I5H C;  5I2O A;  2QAC A;  1KFU S;  1LA0 A;  5GQQ C;  2LE9 B;  1L2O C;  1SL7 A;  1U5I A;  3FIA A;  1B8R A;  2JTZ A;  3BOW B;  1SNL A;  2MAZ A;  3I5I B;  3PAT A;  2I94 A;  3PM8 A;  2JRF A;  1MQ1 A;  1TCF A;  3VRN A;  1L7Z A;  3IQO A;  1NP8 A;  3CZT X;  1K96 A;  5I2Q A;  1S5G Y;  4HRG A;  1SKT A;  2MBX A;  2SCP A;  1NCZ A;  1NCY A;  3GK2 A;  3VGO A;  1XFY O;  3NXA A;  1RTP 1;  3CGA A;  4N1G A;  1CLL A;  1JWD A;  1WRL A;  1B8L A;  2A4J A;  2TN4 A;  3GK4 X;  5K89 A;  5FYX A;  3BXK A;  2AUC A;  2BBN A;  3JTD C;  1DJZ A;  2LHL A;  1LVC D;  4YGE B;  2COL B;  1IRJ A;  5D69 A;  3CTN A;  5HYD A;  1M31 A;  4DS7 A;  1TIZ A;  2MA2 A;  3AKB A;  3TS5 C;  4GGF C;  5CSN A;  4NQG A;  2H61 A;  2EGD A;  1K94 A;  2BCB A;  5AXI A;  2LV7 A;  3CR4 X;  4ORA B;  4CFQ A;  4I5K A;  2JXL A;  1JBA A;  1LKJ A;  1SBJ A;  1J7R A;  1Y1X A;  5JOL A;  1KWO C;  1WLM A;  1DGU A;  1OMR A;  3SG4 A;  1AJ4 A;  1WY9 A;  2LVI A;  2LUX A;  3OHM B;  4GAO A;  4MZK A;  1WRZ A;  2JT3 A;  1KK8 B;  1PSB A;  1FI6 A;  2MLF C;  4WQ2 A;  2L5X B;  1A03 A;  1QAT A;  4MLW A;  3TZ1 A;  3WXA A;  1BR1 B;  3A8R A;  1ZOT B;  1RWY A;  2FCE A;  4QJ5 B;  2PAS A;  2KAX A;  3I5F B;  1REC A;  1B7T Z;  1N65 A;  1WRK A;  1W7J B;  3CR5 X;  2ZN8 A;  2KI4 C;  4JQ0 D;  2DOQ A;  3BUN B;  1C7W A;  1C07 A;  1OMV A;  1ZFS A;  1LA3 A;  2HPS A;  4GUK A;  5G08 A;  4NDD A;  3H4S E;  1K8U A;  2M7L A;  3VRO A;  1KCY A;  4A4B A;  1QIW A;  1IQ3 A;  4FTG A;  4UPG A;  2Q91 A;  1DMO A;  2K0J A;  2KFG A;  2L4I A;  3SG7 A;  2HQW A;  2LMT A;  3DVM A;  5AER A;  2PSR A;  1ODB A;  4JWQ A;  5HLV A;  1CKK A;  3KPX A;  2NCO A;  3RLZ A;  3EK7 A;  2NZ0 A;  3DF0 A;  4HRE E;  4MRX A;  2KI6 D;  1CM1 A;  2LLS A;  1EJ3 A;  2ZRT A;  1QXP A;  2OTG B;  2G2B A;  1K2H A;  1TOP A;  4P2Y B;  2ZFD A;  3CLN A;  2WCB A;  2LCP A;  1KSM A;  3WHT B;  2LVV A;  2QPT A;  3NSL A;  4M2O A;  4NDB A;  2K61 A;  2KQY A;  3M0W A;  1MXL C;  2LAN A;  3A4U B;  2WCE A;  1YX7 A;  1XO5 A;  4D1E A;  2ISD A;  2KSP A;  1OQP A;  2HQ8 A;  5D7F A;  4M2P A;  1ALV A;  1YTZ C;  3HCM A;  4PHK A;  1UHK A;  4MBE A;  4PDZ A;  5AEQ A;  5KU1 A;  1NYA A;  3I5H B;  1MHO A;  2L2E A;  2M97 A;  2ZKM X;  5AAN A;  1FI5 A;  4NDC A;  2ZN9 A;  2WC8 A;  4IL1 A;  1L2O B;  1VRK A;  1SR6 C;  3GOF A;  1NX3 A;  2F3Z A;  1K93 D;  5BPJ A;  3EVU A;  2MLE C;  1M63 B;  3D0Y A;  1IKU A;  3PSR A;  4AOM A;  4GFT A;  2HF5 A;  1CTR A;  2KGB C;  2R2I A;  4MSP A;  1BG1 A;  1ZMZ A;  2LAP A;  3QRX A;  2Y4Q A;  1S1E A;  2M0R A;  1YUT A;  1K95 A;  3EVR A;  1G4Y R;  5CSF A;  1IQ5 A;  1DJW A;  3PN7 C;  1W7I B;  2ZND A;  2JC2 A;  4PAL A;  3PLF B;  2HET A;  3HX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...