5K89A

Crystal structure of human calcium-bound s100a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
85
Chain Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A1
publication title X-ray crystal structure of human calcium-bound S100A1.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 85
sequence length 90
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2016-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5k89A00
3KEVA 1NCYA 1TNQA 3AKBA 2ZN8A 1SMGA 2FCDA 1XVJA 2KSPA 1M39A 3FWCA 1NX3A 2JC2A 1N0YA 2ZNEA 1TNWA 2JT8A 1IJ5A 2O60A 2R2IA 4GPLB 4WQ2A 5ER4X 1L7ZA 1QXPA 4OCIA 2L2EA 2JZIA 4U8DA 5TNCA 1S6JA 4F0ZB 3IF7A 1KFUL 2BE4A 4IL1A 1XFWO 4Q04A 5I2QA 2LVIA 1S6IA 1SBJA 3NSKA 3BOWA 1AK8A 1FPWA 2IS9A 2ISDA 2LAPA 4XJKB 3CR2A 1CM4A 1V1FA 1NIWA 5CSIA 2OPOA 3KPXA 1DJHA 2KQYA 1NP8A 1RFJA 1CDMA 1S1EA 2H61A 3C1VA 3OX5A 3TDZA 4L9MA 1QTXA 3O78A 1F54A 1N2DA 4M2QA 2PMYA 5DKQA 2JQ6A 3NXAA 2F3YA 2M9GA 1QV1A 4MLWA 2L50A 1MQ1A 1WY9A 1XYDA 2L51A 2LHIA 2NCOA 5HKYA 3SG2A 5HYDA 3LK1A 2L98A 2LMUA 1C07A 1G8IA 1QJTA 3CR5X 2I7AA 2KFHA 3BUXB 4MN0A 5AERA 2D8NA 1CFDA 1R6PA 2HQWA 2JTTA 2LVKA 3DVMA 3PN7B 1UHIA 1UHKA 2MLEC 1CNPA 3PALA 2MRDA 2KAXA 1GGZA 3GK4X 3O4YA 1SW8A 1S3PA 4I5LB 4N1FA 1H4BA 1BT6A 2F8PA 3LCPC 2FCEA 2BBMA 2COLB 2FJUB 1B8LA 2ZN9A 4MZLA 1RROA 4AQIA 3DVJA 4ICBA 2AUCA 3ZWHA 2LE9B 3DD4A 4PALA 5D69A 4AQJA 1F55A 1SPYA 4QJ5B 2ZNDA 1QIVA 1XK4A 2B1UA 2M1KB 2Y1MA 3I5GC 1QX5B 1XFYO 2K2AA 1CB1A 2KI4C 1B8CA 2P6BB 3QRXA 4PE1A 1J7QA 1DJIA 1K93D 1J55A 1NX2A 1YVLA 4MVFA 3I5GB 2KI4B 4XJKA 3WHUB 4CLNA 1HQVA 1ZUZA 2BKIB 1V1GA 1C7WA 1NYAA 1E8AA 1KFUS 1WLMA 1YX7A 1G4YR 2CTNA 2ZRTA 1DTLA 1EL4A 1ZMZA 3PSRA 4MEWA 4MBEA 4M2PA 2NLNA 1K8UA 1K2HA 4NDDA 2K2FA 3BUMB 2G9BA 3K21A 2M3WA 1PK0D 1MR8A 1DJZA 3FS7A 2M0RA 1UHNA 2WNDA 1YTZC 4MRYA 1W7JB 3AAKA 1A29A 1L2OB 2I94A 2PALA 4OVNF 1F8HA 2CNPA 1SCMC 2EC6C 3A4UB 4DIRA 1AHRA 1YUUA 1GQMA 3VRRA 3JVTB 4YRUA 1CDNA 2K7BA 1S5GZ 2JULA 3CWGA 5CSJA 1DJGA 1J1DA 1LA0A 1SNLA 1IGVA 2BKHB 2EC6B 2F3ZA 2K0JA 2ZFDA 5DKRA 1TCOB 1CMFA 1XFUO 4XYNA 4ORCB 3AAJA 1EXRA 2JT0A 4DUQA 2AAOA 1SYMA 2LMVA 4HSZA 1DGUA 2DOQA 4CFQA 1RK9A 1PVBA 1BJFA 2LHLA 4NQGA 2WCBA 1S5GY 2LMTA 2WORA 3IQQA 1OZOA 1SRAA 4YBHB 2KAYA 4TNCA 4USLA 2L5XB 3LK0A 1KFXS 2I18A 2JXCA 3PFVA 2K61A 1WRKA 1G33A 4FTGA 1DF0B 2KYCA 1TTXA 1UHJA 1SL7A 1PVAA 2A4JA 3CS1A 1BLQA 2MHHA 4OR9B 4PDZA 2GV5A 2HPSA 3CLNA 2LM5A 5B8IB 2PVBA 2L0PA 2M29A 1WLZA 2LUCA 5D7FA 1XA5A 1KSOA 1J7RA 2LP2A 1S26D 2MBXA 1ZACA 1C7VA 1K9PA 3BXKA 1U5IA 1KWOC 1A75A 4R1EA 1YRTB 1KK7Z 2K7OA 1CKKA 4DCKA 5I2LA 3A8RA 1R2UA 5FYXA 1AJ4A 4I5KA 4ZCVA 4ETOA 1A03A 3BUNB 1J1EA 2LCPA 4HRGA 1KWOB 1YUTA 2NZ0A 1IQ5A 1M31A 2HETA 4YGCB 3OHMB 1ALWA 1KSMA 4PCWA 1IWQA 1MXEA 2K8MB 1B8RA 5AEQA 3EK7A 3I5FC 1JC2A 4PHJA 1BG1A 1PSRA 1YR5A 5G08A 1KK7Y 4MZJA 3VRPA 1BR1B 3EVVA 2KQ6A 1FBVA 2CT9A 5AFPA 1SCVA 3FWBA 3KO0A 4I5NB 5KTYA 1IG5A 3HX4A 2MA2A 3OX6A 3O6BA 2ZRSA 3LL8B 3TS5C 1KQVA 1KFXL 3PATA 4P5OE 2LANA 2LP3A 1CFPA 1CDLA 2RGIA 1KCYA 4A4CA 2KNEA 3D10A 1FI6A 2M7LA 2F2PA 3EVRA 1SL9A 1SKTA 2M97A 3EKJA 3KHEA 1GGWA 1M46A 4DS7A 1IH0A 3CZTX 1OMVA 2KBIA 1OMDA 1JBAA 1DF0A 1IJ6A 2BBNA 1ZFSA 2BCBA 2JNFA 2BL0C 3BUWB 1QX7A 1F4QA 1LA3A 1TCFA 1TNPA 2G2BA 3OP0A 4N1GA 1DMOA 1VRKA 2Q91A 4WQ3A 3TDUA 3TUYC 5IBWA 1JF0A 2KAVA 2Y4QA 3EK4A 3NSOA 1JWDA 2KGRA 1IRJA 3MSEB 5JJGA 1J7PA 1A2XA 3GK2A 1B4CA 2JT3A 3DVKA 1GJYA 4OV2A 2JTZA 3VROA 1K94A 4JPZB 4MSPA 2KI6D 3E3RA 4CFRA 1OMRA 3RLZA 1U5IB 5I2OA 1A75B 4FQOA 3DVEA 4M2OA 4C0KA 1NX0A 1B1GA 1PALA 1QASA 4PE0A 1N65A 2E30A 1CFFA 1CMGA 1K9KA 1XO5A 1FI5A 1TNXA 2M8UA 2AMIA 1EG4A 1EH2A 1MWNA 1M45A 3VGOA 1A4PA 1YUSA 1AJ5A 2GGMA 1BOCA 2PASA 1JFKA 1AVSA 1K9UA 1B47A 1MF8B 5CPVA 2OS8C 1DJXA 2JRFA 3EVUA 1OOJA 1SCMB 1SR6C 2HQ8A 5HKZA 5PALA 1DGVA 2NXQA 4BY4A 2LVVA 2EGDA 1LINA 2OTGC 2L4IA 1JUOA 1DT7B 1B9AA 5J3XA 2WCFA 1M63B 1QVIZ 1WDCC 2KBMA 4PE7A 4C0JA 1AUIB 2QACA 2SCPA 4NDCA 2JPTA 1AP4A 1CLMA 1XFXO 3I5IC 3ZNIA 1CLBA 3OB1B 1BU3A 2KDHA 1W7IB 2LLUA 5HLOA 1WDCB 2K7CA 3DF0B 1MHOA 4GGFC 3SJSA 1K96A 3I5IB 1UWOA 2BCAA 2Q4UA 1PSBA 4HREE 4BY5A 1K95A 3WNXB 1QVIY 1OSAA 1TN4A 2JNXA 1ZOTB 4DRWA 1MXLC 1IQ3A 1CM1A 1CFCA 4N5XA 2BCXA 1BR4B 3SG5A 1KK8C 1XFVO 1S6CA 2JWWA 5GQQC 5AANA 4P2YB 1YRUB 4QJ3B 2I2RE 3BQ3A 3EK8A 1KK8B 1JF2A 1Y6WA 2F2OA 2LUXA 4OKHA 3CR4X 4ORAB 1PRWA 4YGAA 2KYFA 1UP5A 2VRGA 2CXJA 3RM1A 5CSNA 4CPVA 1ODBA 3TDIA 3VRNA 1FW4A 1DJYA 5KSZA 1TIZA 1UHHA 4YI9A 1F71A 2ZKMX 1JSAA 3VRQA 3PM8A 3F45A 2CCMA 2JXLA 2KI6C 5AXIA 3EKHA 1Y1AA 1QATA 3JTDC 4I5JA 1K90D 2KOTA 2PRUA 3D0YB 4GAOA 3H4SE 5HKWA 2BE6A 5ER5A 1CLLA 3JTDB 5DKNA 3PN7C 3I5FB 3GOFA 1NX1A 2JOJA 2E6WA 5BPJA 2L4HA 4GGNA 2H2KA 1SY9A 1X02A 2WOSA 3SG6A 2LC5A 2KFFA 1LKJA 2V53A 1IKUA 1ALVA 3SG3A 1RWYA 2M49B 4GNKB 1QLSA 3DF0A 1QIWA 4PHMA 3TS5B 3WHTB 4GBAA 3HCMA 1WRLA 1NPQA 4UPGA 4E68A 1OE9B 3FIAA 1SK6D 1Y1XA 2EHBA 5F6TA 3SIBA 5K89A 1YVHA 1WRZA 3I5HC 1TRFA 1Q80A 1QX2A 1SL8A 4GGFA 1Y1UA 3SIAA 4A4BA 4D1EA 1QV0A 2WC8A 1HT9A 1RTP1 5HLVA 4MZKA 2GGZA 3TZ1A 5KU1A 3NSIA 4JWQA 4MRXA 4YGEB 1NCZA 2M1UA 2F33A 3I5HB 3AKAA 2CBLA 3KF9A 4PHNA 2BL0B 1RECA 3ICBA 1EJ3A 2MJWB 2LV7A 3LLEA 3TUYB 4YI8A 1NSHA 2Y5IA 3GK1A 4JQ0D 4GUKA 1F70A 1J7OA 4PHKA 1KQMC 4AOMA 1QS7A 1YX8A 4WRIA 2QPTA 4CIDA 1PULA 2M7NA 3BOWB 2KFGA 1QLKA 2H61C 2JU0A 5I8NA 3CTNA 3WXAA 1MUXA 1F4OA 2BECA 1KQMB 3PLFB 1NUBA 1CDPA 4YGDB 1BMOA 1BODA 1DJWA 2LVJA 1S36A 1BF5A 4YGBB 4NDBA 3D0YA 4C0LA 3CGAA 2NCPA 4GFTA 2SASA 4ORBB 1DVIA 2LLTA 2LNKA 4QJ4B 1L2OC 3O2PA 1D1OA 1B7TZ 1NCXA 1RJVA 3M0WA 2HF5A 1NWDA 2OS8B 2MAZA 3IQOA 3JVTC 4ZCUA 1CTRA 3OB2B 1SR6B 1OZSA 2LLSA 1YURA 1UUSA 1TOPA 2MLFC 3BUOB 1UURA 4PE4A 2OTGB 2Y1NA 3SG4A 5JOLA 2K7DA 5CSFA 2TN4A 1B7TY 1EG3A 3NSLA 1JFJA 1Y0VH 1H8BA 1FF1A 1LVCD 2KGBC 1OQPA 1LXFC 2KHNA 3BYAA 4HRHA 2PSRA 2FOTA 2WCEA 3SG7A 1XFZO 1XK4C 2O5GA
chains in the Genus database with same CATH superfamily
1OOHA 3KEVA 1NCYA 1TNQA 3AKBA 2ZN8A 1SMGA 3D77A 2FCDA 1XVJA 2KSPA 1M39A 3FWCA 1NX3A 2JC2A 1N0YA 2ZNEA 1TNWA 2JT8A 1IJ5A 2O60A 2R2IA 3NHIA 4GPLB 4WQ2A 1L7ZA 1QXPA 5ER4X 4OCIA 2L2EA 2JZIA 4U8DA 5TNCA 2WCHA 3VB1A 1S6JA 4F0ZB 3IF7A 1KFUL 2BE4A 4IL1A 1XFWO 4Q04A 5I2QA 2LVIA 2QEBA 1S6IA 1SBJA 1C3ZA 3NSKA 3BOWA 1AK8A 1FPWA 2IS9A 2ISDA 2LAPA 4XJKB 5FI6A 3CR2A 4INXA 1CM4A 1V1FA 3CZ2A 1NIWA 5CSIA 2OPOA 3KPXA 1DJHA 2KQYA 1NP8A 1RFJA 1CDMA 1S1EA 2H61A 3C1VA 3OX5A 3TDZA 4L9MA 1QTXA 3O78A 3Q8IA 3S0BA 1N2DA 4M2QA 2PMYA 5DKQA 2JQ6A 1F54A 3NXAA 2F3YA 2M9GA 1QV1A 4MLWA 2L50A 1MQ1A 1WY9A 1XYDA 2KLEA 2L51A 2LHIA 2NCOA 5HKYA 3SG2A 5HYDA 3LK1A 2L98A 2LMUA 1C07A 1G8IA 1QJTA 1DEKA 3CR5X 2I7AA 2KFHA 3BUXB 4MN0A 5AERA 2D8NA 1CFDA 1R6PA 2HQWA 1T14A 2JTTA 2LVKA 3DVMA 3PN7B 1UHIA 1UHKA 2MLEC 1CNPA 3PALA 2MRDA 2KAXA 1GGZA 3GK4X 3O4YA 1SW8A 1S3PA 4I5LB 4N1FA 1H4BA 1BT6A 2F8PA 3LCPC 2FCEA 2BBMA 2COLB 2FJUB 1B8LA 2ZN9A 4MZLA 1RROA 4AQIA 3DVJA 5HL1A 4ICBA 4PT1A 2AUCA 3ZWHA 1TWOA 2LE9B 3DD4A 4PALA 5D69A 4AQJA 1F55A 1SPYA 3S0EA 4QJ5B 5FI7A 2ZNDA 1QIVA 1XK4A 2B1UA 2M1KB 2Y1MA 3I5GC 3R1PA 1QX5B 1XFYO 2K2AA 1CB1A 2KI4C 1B8CA 2P6BB 3QRXA 4PE1A 3PM2A 1J7QA 1DJIA 1K93D 1J55A 1NX2A 1YVLA 2L2CA 4MVFA 3I5GB 1XFRA 2WCLA 3UNWA 2KI4B 4XJKA 1P28A 3WHUB 2O5GA 4CLNA 3D78A 1HQVA 1ZUZA 1C7WA 1NYAA 1E8AA 1KFUS 1V1GA 1WLMA 1YX7A 2BKIB 1G4YR 2CTNA 2ZRTA 1DTLA 1EL4A 1ZMZA 3PSRA 4MEWA 3BFBA 4MBEA 4M2PA 2NLNA 1C3YA 1K8UA 1K2HA 4NDDA 2K2FA 2PYQA 2G9BA 3BUMB 3K21A 2M3WA 3DZTA 1PK0D 1MR8A 1DJZA 3O4XA 3FS7A 2M0RA 1UHNA 2WNDA 1YTZC 4MRYA 1W7JB 3AAKA 1A29A 3B86A 1L2OB 2I94A 2PALA 4OVNF 1F8HA 2CNPA 2K60A 1SCMC 2EC6C 3A4UB 4DIRA 1AHRA 1YUUA 1GQMA 3VRRA 3JVTB 4YRUA 1CDNA 2K7BA 1S5GZ 2JULA 3CWGA 5CSJA 1DJGA 1J1DA 1LA0A 1SNLA 1IGVA 2BKHB 2EC6B 2F3ZA 2K0JA 2ZFDA 5DKRA 1TCOB 3BFHA 1CMFA 1XFUO 4XYNA 4ORCB 3AAJA 1EXRA 2JT0A 2WCKA 4DUQA 2AAOA 1SYMA 2LMVA 4HSZA 1DGUA 2DOQA 4CFQA 1RK9A 1PVBA 1BJFA 2LHLA 4NQGA 2WCBA 1S5GY 2LMTA 2WORA 3IQQA 1OZOA 1SRAA 4YBHB 2KAYA 1DC1A 4TNCA 1LS8A 3B88A 4USLA 4IJ7A 2L5XB 4KYNA 3LK0A 1KFXS 2I18A 2JXCA 3PFVA 2K61A 1WRKA 2BNXA 3B7AA 1G33A 2H8VA 4FTGA 1DF0B 2KYCA 1TTXA 1UHJA 1SL7A 1PVAA 2A4JA 3CS1A 1BLQA 2MHHA 4OR9B 4PDZA 2GV5A 2HPSA 2KLDA 3CLNA 2LM5A 5B8IB 2PVBA 2L0PA 2M29A 1WLZA 2LUCA 5D7FA 1XA5A 1KSOA 1J7RA 3CYZA 2LP2A 1S26D 3RZSA 2FJYA 2MBXA 1ZACA 3SS4A 1K9PA 3BXKA 1U5IA 1KWOC 1A75A 1C7VA 4R1EA 1YRTB 1KK7Z 2K7OA 1CKKA 4DCKA 5I2LA 3A8RA 1R2UA 1TUZA 5FYXA 1AJ4A 4I5KA 4ZCVA 4ETOA 1A03A 3BUNB 1J1EA 2LCPA 3NHTA 4HRGA 3SS3A 1KWOB 1YUTA 2NZ0A 1IQ5A 1M31A 2HETA 4YGCB 3OHMB 1ALWA 1KSMA 3R1OA 4PCWA 1IWQA 3K1EA 3QMEA 2WC6A 1MXEA 2K8MB 1B8RA 5AEQA 3EK7A 3I5FC 1JC2A 4PHJA 3R72A 1BG1A 2KPHA 1PSRA 5EL2A 1YR5A 5G08A 1KK7Y 4MZJA 3VRPA 3B87A 1BR1B 3EVVA 2KQ6A 3V2LA 1FBVA 2CT9A 5AFPA 1SCVA 3FWBA 3KO0A 4I5NB 5KTYA 1IG5A 3HX4A 2MA2A 3OX6A 3O6BA 2ZRSA 1OOIX 1OOGA 3LL8B 3TS5C 1KQVA 1KFXL 3PATA 4P5OE 2LANA 2LP3A 1CFPA 4JD9A 1CDLA 2RGIA 1KCYA 2ERBA 4A4CA 2KNEA 3D10A 1FI6A 2M7LA 2F2PA 3EVRA 1SL9A 3L47A 1SKTA 2M97A 3EKJA 3KHEA 1GGWA 1M46A 4DS7A 1IH0A 3CZTX 2GTEA 1OMVA 2KBIA 1OMDA 1JBAA 3NGVA 1DF0A 1IJ6A 2BBNA 1ZFSA 2BCBA 2JNFA 3BJHA 2BL0C 3BUWB 1QX7A 1F4QA 1LA3A 1TCFA 1OOFA 1TNPA 2G2BA 3OP0A 4N1GA 1VRKA 1DMOA 2Q91A 4WQ3A 3TDUA 3TUYC 3IVTA 4INWA 5IBWA 1OW4A 1JF0A 2KAVA 2Y4QA 3EK4A 3L4AA 3NSOA 2WCMA 1JWDA 2KGRA 1IRJA 3MSEB 5JJGA 1J7PA 1A2XA 3GK2A 1B4CA 2JT3A 3DVKA 1GJYA 4OV2A 2JTZA 3VROA 1QWVA 1K94A 4JPZB 4MSPA 2KI6D 2QEVA 3E3RA 4CFRA 2BAPA 1OMRA 3RLZA 1U5IB 5I2OA 1A75B 4FQOA 3DVEA 4M2OA 4C0KA 1NX0A 3SS5A 1PALA 1QASA 1B1GA 4PE0A 1N65A 2E30A 2YGUA 3UO9A 1CFFA 1Z2CB 1CMGA 1K9KA 1XO5A 3D76A 3DY9A 1FI5A 1TNXA 2M8UA 2AMIA 1EG4A 1IIOA 1EH2A 1MWNA 1M45A 3VGOA 1A4PA 1YUSA 1AJ5A 2GGMA 1BOCA 2PASA 1JFKA 3CZ0A 1AVSA 1K9UA 1ORGA 1B47A 1MF8B 5CPVA 2OS8C 1DJXA 2JRFA 1SSEB 3EVUA 1OOJA 1SCMB 1SR6C 2HQ8A 5HKZA 5PALA 1DGVA 2NXQA 4BY4A 2LVVA 2EGDA 1LINA 2OTGC 2L4IA 1JUOA 1DT7B 1B9AA 5J3XA 2WCFA 1M63B 1QVIZ 1WDCC 2KBMA 2P70A 4PE7A 4C0JA 1AUIB 2QACA 2SCPA 4NDCA 2JPTA 1AP4A 1CLMA 1XFXO 3I5IC 3DXLA 3ZNIA 3BFAA 1CLBA 3OB1B 1BU3A 2KDHA 1W7IB 2LLUA 3D75A 5HLOA 1WDCB 2K7CA 3DF0B 1MHOA 4OZDA 4GGFC 3SJSA 1K96A 3I5IB 1UWOA 2BCAA 2Q4UA 1PSBA 4HREE 4BY5A 1K95A 2QEOA 1QVIY 1OSAA 1TN4A 3WNXB 2JNXA 1ZOTB 4DRWA 1MXLC 1IQ3A 1CM1A 1CFCA 1DQEA 4N5XA 2BCXA 1BR4B 3SG5A 1KK8C 1XFVO 1S6CA 1W9ZA 3EG5B 2JWWA 3DYEA 5D3OA 3OBVA 5GQQC 5AANA 4P2YB 1YRUB 4QJ3B 2I2RE 3BQ3A 3EK8A 1KK8B 1JF2A 1Y6WA 2F2OA 2LUXA 4OKHA 3CR4X 4ORAB 1PRWA 4YGAA 2KYFA 1UP5A 2VRGA 2CXJA 3RM1A 5CSNA 4CPVA 1ODBA 3TDIA 3VRNA 1FW4A 1DJYA 5KSZA 1TIZA 4F7FA 1UHHA 4YI9A 1F71A 2ZKMX 1JSAA 3VRQA 3PM8A 3F45A 2CCMA 2JXLA 2KI6C 5AXIA 3EKHA 1Y1AA 1QATA 3JTDC 4I5JA 1K90D 2KOTA 3S0DA 3FE9A 2PRUA 3D0YB 5FI2A 4GAOA 3H4SE 5HKWA 2BE6A 5ER5A 1CLLA 3JTDB 5DKNA 3PN7C 3I5FB 3GOFA 1NX1A 1DELA 2JOJA 2E6WA 5BPJA 2L4HA 4GGNA 2H2KA 1SY9A 1X02A 2WOSA 3SG6A 2LC5A 2JPOA 3R1VA 2KFFA 1LKJA 2V53A 1IKUA 1ALVA 3SG3A 1RWYA 2M49B 4GNKB 1QLSA 3DF0A 1QIWA 4PHMA 3TS5B 3WHTB 5DICA 4GBAA 3HCMA 1WRLA 1NPQA 3CABA 3L4LA 4UPGA 3S0GA 4E68A 1OE9B 2WC5A 1SK6D 3FIAA 1Y1XA 2EHBA 5F6TA 3SIBA 5K89A 1YVHA 1WRZA 3I5HC 5I94A 1TRFA 1Z4HA 1Q80A 1QX2A 1SL8A 4GGFA 1Y1UA 3SIAA 4A4BA 4D1EA 1QV0A 2WC8A 1HT9A 1RTP1 5HLVA 4MZKA 2GGZA 3TZ1A 5KU1A 3S0FA 3NSIA 4JWQA 4MRXA 4YGEB 1NCZA 2M1UA 2F33A 3I5HB 3AKAA 2CBLA 2QEHA 3KF9A 4PHNA 3S0AA 2BL0B 1RECA 3ICBA 3D73A 3PJIA 1EJ3A 2MJWB 2LV7A 3LLEA 3TUYB 4YI8A 1NSHA 2Y5IA 3GK1A 4JQ0D 4GUKA 1F70A 3OGNA 1J7OA 4PHKA 1KQMC 4AOMA 1GM0A 1QS7A 1YX8A 4WRIA 2QPTA 4CIDA 1PULA 2M7NA 3BOWB 2KFGA 1QLKA 2H61C 2JU0A 5I8NA 3CTNA 3CDNA 3WXAA 1MUXA 1F4OA 2BECA 1KQMB 2P71A 2PQLA 3B6XA 1NUBA 1CDPA 3PLFB 4YGDB 3FE8A 1TUJA 1BMOA 1BODA 1DJWA 2LVJA 1S36A 1BF5A 4YGBB 4NDBA 3D0YA 4C0LA 4FQTA 3CGAA 2NCPA 4GFTA 2SASA 4ORBB 1DVIA 2LLTA 2LNKA 4QJ4B 1L2OC 3O2PA 1D1OA 1B7TZ 1NCXA 3FE6A 1RJVA 3M0WA 2HF5A 2WCJA 1NWDA 2OS8B 2MAZA 3IQOA 3JVTC 4ZCUA 1CTRA 3OB2B 1SR6B 4JKTA 1OZSA 2LLSA 1YURA 1UUSA 1TOPA 2MLFC 3BUOB 1UURA 4PE4A 2OTGB 2Y1NA 3SG4A 5JOLA 2K7DA 5CSFA 2TN4A 2QDIA 1B7TY 1EG3A 3CZ1A 3NSLA 1JFJA 1Y0VH 1H8BA 1FF1A 1LVCD 2KGBC 1OQPA 1LXFC 2KHNA 3BYAA 4HRHA 2PSRA 2FOTA 2WCEA 3N7HA 3SG7A 3D74A 1XFZO 1XK4C 2L5YA
chains in the Genus database with same CATH topology
3KEVA 1NCYA 1TNQA 3AKBA 2ZN8A 1SMGA 2FCDA 1XVJA 2KSPA 1M39A 3FWCA 1NX3A 2JC2A 1N0YA 2ZNEA 1TNWA 2JT8A 1IJ5A 2O60A 2R2IA 4GPLB 4WQ2A 5ER4X 1L7ZA 1QXPA 4OCIA 2L2EA 2JZIA 4U8DA 5TNCA 1S6JA 4F0ZB 3IF7A 1KFUL 2BE4A 4IL1A 1XFWO 4Q04A 5I2QA 2LVIA 1S6IA 1SBJA 3NSKA 3BOWA 1AK8A 1FPWA 2IS9A 2ISDA 2LAPA 4XJKB 3CR2A 1CM4A 1V1FA 1NIWA 5CSIA 2OPOA 3KPXA 1DJHA 2KQYA 1NP8A 1RFJA 1CDMA 1S1EA 2H61A 3C1VA 3OX5A 3TDZA 4L9MA 1QTXA 3O78A 1F54A 1N2DA 4M2QA 2PMYA 5DKQA 2JQ6A 3NXAA 2F3YA 2M9GA 1QV1A 4MLWA 2L50A 1MQ1A 1WY9A 1XYDA 2L51A 2LHIA 2NCOA 5HKYA 3SG2A 5HYDA 3LK1A 2L98A 2LMUA 1C07A 1G8IA 1QJTA 3CR5X 2I7AA 2KFHA 3BUXB 4MN0A 5AERA 2D8NA 1CFDA 1R6PA 2HQWA 2JTTA 2LVKA 3DVMA 3PN7B 1UHIA 1UHKA 2MLEC 1CNPA 3PALA 2MRDA 2KAXA 1GGZA 3GK4X 3O4YA 1SW8A 1S3PA 4I5LB 4N1FA 1H4BA 1BT6A 2F8PA 3LCPC 2FCEA 2BBMA 2COLB 2FJUB 1B8LA 2ZN9A 4MZLA 1RROA 4AQIA 3DVJA 4ICBA 2AUCA 3ZWHA 2LE9B 3DD4A 4PALA 5D69A 4AQJA 1F55A 1SPYA 4QJ5B 2ZNDA 1QIVA 1XK4A 2B1UA 2M1KB 2Y1MA 3I5GC 1QX5B 1XFYO 2K2AA 1CB1A 2KI4C 1B8CA 2P6BB 3QRXA 4PE1A 1J7QA 1DJIA 1K93D 1J55A 1NX2A 1YVLA 4MVFA 3I5GB 2KI4B 4XJKA 3WHUB 4CLNA 1HQVA 1ZUZA 2BKIB 1V1GA 1C7WA 1NYAA 1E8AA 1KFUS 1WLMA 1YX7A 1G4YR 2CTNA 2ZRTA 1DTLA 1EL4A 1ZMZA 3PSRA 4MEWA 4MBEA 4M2PA 2NLNA 1K8UA 1K2HA 4NDDA 2K2FA 3BUMB 2G9BA 3K21A 2M3WA 1PK0D 1MR8A 1DJZA 3FS7A 2M0RA 1UHNA 2WNDA 1YTZC 4MRYA 1W7JB 3AAKA 1A29A 1L2OB 2I94A 2PALA 4OVNF 1F8HA 2CNPA 1SCMC 2EC6C 3A4UB 4DIRA 1AHRA 1YUUA 1GQMA 3VRRA 3JVTB 4YRUA 1CDNA 2K7BA 1S5GZ 2JULA 3CWGA 5CSJA 1DJGA 1J1DA 1LA0A 1SNLA 1IGVA 2BKHB 2EC6B 2F3ZA 2K0JA 2ZFDA 5DKRA 1TCOB 1CMFA 1XFUO 4XYNA 4ORCB 3AAJA 1EXRA 2JT0A 4DUQA 2AAOA 1SYMA 2LMVA 4HSZA 1DGUA 2DOQA 4CFQA 1RK9A 1PVBA 1BJFA 2LHLA 4NQGA 2WCBA 1S5GY 2LMTA 2WORA 3IQQA 1OZOA 1SRAA 4YBHB 2KAYA 4TNCA 4USLA 2L5XB 3LK0A 1KFXS 2I18A 2JXCA 3PFVA 2K61A 1WRKA 1G33A 4FTGA 1DF0B 2KYCA 1TTXA 1UHJA 1SL7A 1PVAA 2A4JA 3CS1A 1BLQA 2MHHA 4OR9B 4PDZA 2GV5A 2HPSA 3CLNA 2LM5A 5B8IB 2PVBA 2L0PA 2M29A 1WLZA 2LUCA 5D7FA 1XA5A 1KSOA 1J7RA 2LP2A 1S26D 2MBXA 1ZACA 1C7VA 1K9PA 3BXKA 1U5IA 1KWOC 1A75A 4R1EA 1YRTB 1KK7Z 2K7OA 1CKKA 4DCKA 5I2LA 3A8RA 1R2UA 5FYXA 1AJ4A 4I5KA 4ZCVA 4ETOA 1A03A 3BUNB 1J1EA 2LCPA 4HRGA 1KWOB 1YUTA 2NZ0A 1IQ5A 1M31A 2HETA 4YGCB 3OHMB 1ALWA 1KSMA 4PCWA 1IWQA 1MXEA 2K8MB 1B8RA 5AEQA 3EK7A 3I5FC 1JC2A 4PHJA 1BG1A 1PSRA 1YR5A 5G08A 1KK7Y 4MZJA 3VRPA 1BR1B 3EVVA 2KQ6A 1FBVA 2CT9A 5AFPA 1SCVA 3FWBA 3KO0A 4I5NB 5KTYA 1IG5A 3HX4A 2MA2A 3OX6A 3O6BA 2ZRSA 3LL8B 3TS5C 1KQVA 1KFXL 3PATA 4P5OE 2LANA 2LP3A 1CFPA 1CDLA 2RGIA 1KCYA 4A4CA 2KNEA 3D10A 1FI6A 2M7LA 2F2PA 3EVRA 1SL9A 1SKTA 2M97A 3EKJA 3KHEA 1GGWA 1M46A 4DS7A 1IH0A 3CZTX 1OMVA 2KBIA 1OMDA 1JBAA 1DF0A 1IJ6A 2BBNA 1ZFSA 2BCBA 2JNFA 2BL0C 3BUWB 1QX7A 1F4QA 1LA3A 1TCFA 1TNPA 2G2BA 3OP0A 4N1GA 1DMOA 1VRKA 2Q91A 4WQ3A 3TDUA 3TUYC 5IBWA 1JF0A 2KAVA 2Y4QA 3EK4A 3NSOA 1JWDA 2KGRA 1IRJA 3MSEB 5JJGA 1J7PA 1A2XA 3GK2A 1B4CA 2JT3A 3DVKA 1GJYA 4OV2A 2JTZA 3VROA 1K94A 4JPZB 4MSPA 2KI6D 3E3RA 4CFRA 1OMRA 3RLZA 1U5IB 5I2OA 1A75B 4FQOA 3DVEA 4M2OA 4C0KA 1NX0A 1B1GA 1PALA 1QASA 4PE0A 1N65A 2E30A 1CFFA 1CMGA 1K9KA 1XO5A 1FI5A 1TNXA 2M8UA 2AMIA 1EG4A 1EH2A 1MWNA 1M45A 3VGOA 1A4PA 1YUSA 1AJ5A 2GGMA 1BOCA 2PASA 1JFKA 1AVSA 1K9UA 1B47A 1MF8B 5CPVA 2OS8C 1DJXA 2JRFA 3EVUA 1OOJA 1SCMB 1SR6C 2HQ8A 5HKZA 5PALA 1DGVA 2NXQA 4BY4A 2LVVA 2EGDA 1LINA 2OTGC 2L4IA 1JUOA 1DT7B 1B9AA 5J3XA 2WCFA 1M63B 1QVIZ 1WDCC 2KBMA 4PE7A 4C0JA 1AUIB 2QACA 2SCPA 4NDCA 2JPTA 1AP4A 1CLMA 1XFXO 3I5IC 3ZNIA 1CLBA 3OB1B 1BU3A 2KDHA 1W7IB 2LLUA 5HLOA 1WDCB 2K7CA 3DF0B 1MHOA 4GGFC 3SJSA 1K96A 3I5IB 1UWOA 2BCAA 2Q4UA 1PSBA 4HREE 4BY5A 1K95A 3WNXB 1QVIY 1OSAA 1TN4A 2JNXA 1ZOTB 4DRWA 1MXLC 1IQ3A 1CM1A 1CFCA 4N5XA 2BCXA 1BR4B 3SG5A 1KK8C 1XFVO 1S6CA 2JWWA 5GQQC 5AANA 4P2YB 1YRUB 4QJ3B 2I2RE 3BQ3A 3EK8A 1KK8B 1JF2A 1Y6WA 2F2OA 2LUXA 4OKHA 3CR4X 4ORAB 1PRWA 4YGAA 2KYFA 1UP5A 2VRGA 2CXJA 3RM1A 5CSNA 4CPVA 1ODBA 3TDIA 3VRNA 1FW4A 1DJYA 5KSZA 1TIZA 1UHHA 4YI9A 1F71A 2ZKMX 1JSAA 3VRQA 3PM8A 3F45A 2CCMA 2JXLA 2KI6C 5AXIA 3EKHA 1Y1AA 1QATA 3JTDC 4I5JA 1K90D 2KOTA 2PRUA 3D0YB 4GAOA 3H4SE 5HKWA 2BE6A 5ER5A 1CLLA 3JTDB 5DKNA 3PN7C 3I5FB 3GOFA 1NX1A 2JOJA 2E6WA 5BPJA 2L4HA 4GGNA 2H2KA 1SY9A 1X02A 2WOSA 3SG6A 2LC5A 2KFFA 1LKJA 2V53A 1IKUA 1ALVA 3SG3A 1RWYA 2M49B 4GNKB 1QLSA 3DF0A 1QIWA 4PHMA 3TS5B 3WHTB 4GBAA 3HCMA 1WRLA 1NPQA 4UPGA 4E68A 1OE9B 3FIAA 1SK6D 1Y1XA 2EHBA 5F6TA 3SIBA 5K89A 1YVHA 1WRZA 3I5HC 1TRFA 1Q80A 1QX2A 1SL8A 4GGFA 1Y1UA 3SIAA 4A4BA 4D1EA 1QV0A 2WC8A 1HT9A 1RTP1 5HLVA 4MZKA 2GGZA 3TZ1A 5KU1A 3NSIA 4JWQA 4MRXA 4YGEB 1NCZA 2M1UA 2F33A 3I5HB 3AKAA 2CBLA 3KF9A 4PHNA 2BL0B 1RECA 3ICBA 1EJ3A 2MJWB 2LV7A 3LLEA 3TUYB 4YI8A 1NSHA 2Y5IA 3GK1A 4JQ0D 4GUKA 1F70A 1J7OA 4PHKA 1KQMC 4AOMA 1QS7A 1YX8A 4WRIA 2QPTA 4CIDA 1PULA 2M7NA 3BOWB 2KFGA 1QLKA 2H61C 2JU0A 5I8NA 3CTNA 3WXAA 1MUXA 1F4OA 2BECA 1KQMB 3PLFB 1NUBA 1CDPA 4YGDB 1BMOA 1BODA 1DJWA 2LVJA 1S36A 1BF5A 4YGBB 4NDBA 3D0YA 4C0LA 3CGAA 2NCPA 4GFTA 2SASA 4ORBB 1DVIA 2LLTA 2LNKA 4QJ4B 1L2OC 3O2PA 1D1OA 1B7TZ 1NCXA 1RJVA 3M0WA 2HF5A 1NWDA 2OS8B 2MAZA 3IQOA 3JVTC 4ZCUA 1CTRA 3OB2B 1SR6B 1OZSA 2LLSA 1YURA 1UUSA 1TOPA 2MLFC 3BUOB 1UURA 4PE4A 2OTGB 2Y1NA 3SG4A 5JOLA 2K7DA 5CSFA 2TN4A 1B7TY 1EG3A 3NSLA 1JFJA 1Y0VH 1H8BA 1FF1A 1LVCD 2KGBC 1OQPA 1LXFC 2KHNA 3BYAA 4HRHA 2PSRA 2FOTA 2WCEA 3SG7A 1XFZO 1XK4C 2O5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEV A;  1NCY A;  1TNQ A;  3AKB A;  2ZN8 A;  1SMG A;  2FCD A;  1XVJ A;  2KSP A;  1M39 A;  3FWC A;  1NX3 A;  2JC2 A;  1N0Y A;  2ZNE A;  1TNW A;  2JT8 A;  1IJ5 A;  2O60 A;  2R2I A;  4GPL B;  4WQ2 A;  5ER4 X;  1L7Z A;  1QXP A;  4OCI A;  2L2E A;  2JZI A;  4U8D A;  5TNC A;  1S6J A;  4F0Z B;  3IF7 A;  1KFU L;  2BE4 A;  4IL1 A;  1XFW O;  4Q04 A;  5I2Q A;  2LVI A;  1S6I A;  1SBJ A;  3NSK A;  3BOW A;  1AK8 A;  1FPW A;  2IS9 A;  2ISD A;  2LAP A;  4XJK B;  3CR2 A;  1CM4 A;  1V1F A;  1NIW A;  5CSI A;  2OPO A;  3KPX A;  1DJH A;  2KQY A;  1NP8 A;  1RFJ A;  1CDM A;  1S1E A;  2H61 A;  3C1V A;  3OX5 A;  3TDZ A;  4L9M A;  1QTX A;  3O78 A;  1F54 A;  1N2D A;  4M2Q A;  2PMY A;  5DKQ A;  2JQ6 A;  3NXA A;  2F3Y A;  2M9G A;  1QV1 A;  4MLW A;  2L50 A;  1MQ1 A;  1WY9 A;  1XYD A;  2L51 A;  2LHI A;  2NCO A;  5HKY A;  3SG2 A;  5HYD A;  3LK1 A;  2L98 A;  2LMU A;  1C07 A;  1G8I A;  1QJT A;  3CR5 X;  2I7A A;  2KFH A;  3BUX B;  4MN0 A;  5AER A;  2D8N A;  1CFD A;  1R6P A;  2HQW A;  2JTT A;  2LVK A;  3DVM A;  3PN7 B;  1UHI A;  1UHK A;  2MLE C;  1CNP A;  3PAL A;  2MRD A;  2KAX A;  1GGZ A;  3GK4 X;  3O4Y A;  1SW8 A;  1S3P A;  4I5L B;  4N1F A;  1H4B A;  1BT6 A;  2F8P A;  3LCP C;  2FCE A;  2BBM A;  2COL B;  2FJU B;  1B8L A;  2ZN9 A;  4MZL A;  1RRO A;  4AQI A;  3DVJ A;  4ICB A;  2AUC A;  3ZWH A;  2LE9 B;  3DD4 A;  4PAL A;  5D69 A;  4AQJ A;  1F55 A;  1SPY A;  4QJ5 B;  2ZND A;  1QIV A;  1XK4 A;  2B1U A;  2M1K B;  2Y1M A;  3I5G C;  1QX5 B;  1XFY O;  2K2A A;  1CB1 A;  2KI4 C;  1B8C A;  2P6B B;  3QRX A;  4PE1 A;  1J7Q A;  1DJI A;  1K93 D;  1J55 A;  1NX2 A;  1YVL A;  4MVF A;  3I5G B;  2KI4 B;  4XJK A;  3WHU B;  4CLN A;  1HQV A;  1ZUZ A;  2BKI B;  1V1G A;  1C7W A;  1NYA A;  1E8A A;  1KFU S;  1WLM A;  1YX7 A;  1G4Y R;  2CTN A;  2ZRT A;  1DTL A;  1EL4 A;  1ZMZ A;  3PSR A;  4MEW A;  4MBE A;  4M2P A;  2NLN A;  1K8U A;  1K2H A;  4NDD A;  2K2F A;  3BUM B;  2G9B A;  3K21 A;  2M3W A;  1PK0 D;  1MR8 A;  1DJZ A;  3FS7 A;  2M0R A;  1UHN A;  2WND A;  1YTZ C;  4MRY A;  1W7J B;  3AAK A;  1A29 A;  1L2O B;  2I94 A;  2PAL A;  4OVN F;  1F8H A;  2CNP A;  1SCM C;  2EC6 C;  3A4U B;  4DIR A;  1AHR A;  1YUU A;  1GQM A;  3VRR A;  3JVT B;  4YRU A;  1CDN A;  2K7B A;  1S5G Z;  2JUL A;  3CWG A;  5CSJ A;  1DJG A;  1J1D A;  1LA0 A;  1SNL A;  1IGV A;  2BKH B;  2EC6 B;  2F3Z A;  2K0J A;  2ZFD A;  5DKR A;  1TCO B;  1CMF A;  1XFU O;  4XYN A;  4ORC B;  3AAJ A;  1EXR A;  2JT0 A;  4DUQ A;  2AAO A;  1SYM A;  2LMV A;  4HSZ A;  1DGU A;  2DOQ A;  4CFQ A;  1RK9 A;  1PVB A;  1BJF A;  2LHL A;  4NQG A;  2WCB A;  1S5G Y;  2LMT A;  2WOR A;  3IQQ A;  1OZO A;  1SRA A;  4YBH B;  2KAY A;  4TNC A;  4USL A;  2L5X B;  3LK0 A;  1KFX S;  2I18 A;  2JXC A;  3PFV A;  2K61 A;  1WRK A;  1G33 A;  4FTG A;  1DF0 B;  2KYC A;  1TTX A;  1UHJ A;  1SL7 A;  1PVA A;  2A4J A;  3CS1 A;  1BLQ A;  2MHH A;  4OR9 B;  4PDZ A;  2GV5 A;  2HPS A;  3CLN A;  2LM5 A;  5B8I B;  2PVB A;  2L0P A;  2M29 A;  1WLZ A;  2LUC A;  5D7F A;  1XA5 A;  1KSO A;  1J7R A;  2LP2 A;  1S26 D;  2MBX A;  1ZAC A;  1C7V A;  1K9P A;  3BXK A;  1U5I A;  1KWO C;  1A75 A;  4R1E A;  1YRT B;  1KK7 Z;  2K7O A;  1CKK A;  4DCK A;  5I2L A;  3A8R A;  1R2U A;  5FYX A;  1AJ4 A;  4I5K A;  4ZCV A;  4ETO A;  1A03 A;  3BUN B;  1J1E A;  2LCP A;  4HRG A;  1KWO B;  1YUT A;  2NZ0 A;  1IQ5 A;  1M31 A;  2HET A;  4YGC B;  3OHM B;  1ALW A;  1KSM A;  4PCW A;  1IWQ A;  1MXE A;  2K8M B;  1B8R A;  5AEQ A;  3EK7 A;  3I5F C;  1JC2 A;  4PHJ A;  1BG1 A;  1PSR A;  1YR5 A;  5G08 A;  1KK7 Y;  4MZJ A;  3VRP A;  1BR1 B;  3EVV A;  2KQ6 A;  1FBV A;  2CT9 A;  5AFP A;  1SCV A;  3FWB A;  3KO0 A;  4I5N B;  5KTY A;  1IG5 A;  3HX4 A;  2MA2 A;  3OX6 A;  3O6B A;  2ZRS A;  3LL8 B;  3TS5 C;  1KQV A;  1KFX L;  3PAT A;  4P5O E;  2LAN A;  2LP3 A;  1CFP A;  1CDL A;  2RGI A;  1KCY A;  4A4C A;  2KNE A;  3D10 A;  1FI6 A;  2M7L A;  2F2P A;  3EVR A;  1SL9 A;  1SKT A;  2M97 A;  3EKJ A;  3KHE A;  1GGW A;  1M46 A;  4DS7 A;  1IH0 A;  3CZT X;  1OMV A;  2KBI A;  1OMD A;  1JBA A;  1DF0 A;  1IJ6 A;  2BBN A;  1ZFS A;  2BCB A;  2JNF A;  2BL0 C;  3BUW B;  1QX7 A;  1F4Q A;  1LA3 A;  1TCF A;  1TNP A;  2G2B A;  3OP0 A;  4N1G A;  1DMO A;  1VRK A;  2Q91 A;  4WQ3 A;  3TDU A;  3TUY C;  5IBW A;  1JF0 A;  2KAV A;  2Y4Q A;  3EK4 A;  3NSO A;  1JWD A;  2KGR A;  1IRJ A;  3MSE B;  5JJG A;  1J7P A;  1A2X A;  3GK2 A;  1B4C A;  2JT3 A;  3DVK A;  1GJY A;  4OV2 A;  2JTZ A;  3VRO A;  1K94 A;  4JPZ B;  4MSP A;  2KI6 D;  3E3R A;  4CFR A;  1OMR A;  3RLZ A;  1U5I B;  5I2O A;  1A75 B;  4FQO A;  3DVE A;  4M2O A;  4C0K A;  1NX0 A;  1B1G A;  1PAL A;  1QAS A;  4PE0 A;  1N65 A;  2E30 A;  1CFF A;  1CMG A;  1K9K A;  1XO5 A;  1FI5 A;  1TNX A;  2M8U A;  2AMI A;  1EG4 A;  1EH2 A;  1MWN A;  1M45 A;  3VGO A;  1A4P A;  1YUS A;  1AJ5 A;  2GGM A;  1BOC A;  2PAS A;  1JFK A;  1AVS A;  1K9U A;  1B47 A;  1MF8 B;  5CPV A;  2OS8 C;  1DJX A;  2JRF A;  3EVU A;  1OOJ A;  1SCM B;  1SR6 C;  2HQ8 A;  5HKZ A;  5PAL A;  1DGV A;  2NXQ A;  4BY4 A;  2LVV A;  2EGD A;  1LIN A;  2OTG C;  2L4I A;  1JUO A;  1DT7 B;  1B9A A;  5J3X A;  2WCF A;  1M63 B;  1QVI Z;  1WDC C;  2KBM A;  4PE7 A;  4C0J A;  1AUI B;  2QAC A;  2SCP A;  4NDC A;  2JPT A;  1AP4 A;  1CLM A;  1XFX O;  3I5I C;  3ZNI A;  1CLB A;  3OB1 B;  1BU3 A;  2KDH A;  1W7I B;  2LLU A;  5HLO A;  1WDC B;  2K7C A;  3DF0 B;  1MHO A;  4GGF C;  3SJS A;  1K96 A;  3I5I B;  1UWO A;  2BCA A;  2Q4U A;  1PSB A;  4HRE E;  4BY5 A;  1K95 A;  3WNX B;  1QVI Y;  1OSA A;  1TN4 A;  2JNX A;  1ZOT B;  4DRW A;  1MXL C;  1IQ3 A;  1CM1 A;  1CFC A;  4N5X A;  2BCX A;  1BR4 B;  3SG5 A;  1KK8 C;  1XFV O;  1S6C A;  2JWW A;  5GQQ C;  5AAN A;  4P2Y B;  1YRU B;  4QJ3 B;  2I2R E;  3BQ3 A;  3EK8 A;  1KK8 B;  1JF2 A;  1Y6W A;  2F2O A;  2LUX A;  4OKH A;  3CR4 X;  4ORA B;  1PRW A;  4YGA A;  2KYF A;  1UP5 A;  2VRG A;  2CXJ A;  3RM1 A;  5CSN A;  4CPV A;  1ODB A;  3TDI A;  3VRN A;  1FW4 A;  1DJY A;  5KSZ A;  1TIZ A;  1UHH A;  4YI9 A;  1F71 A;  2ZKM X;  1JSA A;  3VRQ A;  3PM8 A;  3F45 A;  2CCM A;  2JXL A;  2KI6 C;  5AXI A;  3EKH A;  1Y1A A;  1QAT A;  3JTD C;  4I5J A;  1K90 D;  2KOT A;  2PRU A;  3D0Y B;  4GAO A;  3H4S E;  5HKW A;  2BE6 A;  5ER5 A;  1CLL A;  3JTD B;  5DKN A;  3PN7 C;  3I5F B;  3GOF A;  1NX1 A;  2JOJ A;  2E6W A;  5BPJ A;  2L4H A;  4GGN A;  2H2K A;  1SY9 A;  1X02 A;  2WOS A;  3SG6 A;  2LC5 A;  2KFF A;  1LKJ A;  2V53 A;  1IKU A;  1ALV A;  3SG3 A;  1RWY A;  2M49 B;  4GNK B;  1QLS A;  3DF0 A;  1QIW A;  4PHM A;  3TS5 B;  3WHT B;  4GBA A;  3HCM A;  1WRL A;  1NPQ A;  4UPG A;  4E68 A;  1OE9 B;  3FIA A;  1SK6 D;  1Y1X A;  2EHB A;  5F6T A;  3SIB A;  5K89 A;  1YVH A;  1WRZ A;  3I5H C;  1TRF A;  1Q80 A;  1QX2 A;  1SL8 A;  4GGF A;  1Y1U A;  3SIA A;  4A4B A;  4D1E A;  1QV0 A;  2WC8 A;  1HT9 A;  1RTP 1;  5HLV A;  4MZK A;  2GGZ A;  3TZ1 A;  5KU1 A;  3NSI A;  4JWQ A;  4MRX A;  4YGE B;  1NCZ A;  2M1U A;  2F33 A;  3I5H B;  3AKA A;  2CBL A;  3KF9 A;  4PHN A;  2BL0 B;  1REC A;  3ICB A;  1EJ3 A;  2MJW B;  2LV7 A;  3LLE A;  3TUY B;  4YI8 A;  1NSH A;  2Y5I A;  3GK1 A;  4JQ0 D;  4GUK A;  1F70 A;  1J7O A;  4PHK A;  1KQM C;  4AOM A;  1QS7 A;  1YX8 A;  4WRI A;  2QPT A;  4CID A;  1PUL A;  2M7N A;  3BOW B;  2KFG A;  1QLK A;  2H61 C;  2JU0 A;  5I8N A;  3CTN A;  3WXA A;  1MUX A;  1F4O A;  2BEC A;  1KQM B;  3PLF B;  1NUB A;  1CDP A;  4YGD B;  1BMO A;  1BOD A;  1DJW A;  2LVJ A;  1S36 A;  1BF5 A;  4YGB B;  4NDB A;  3D0Y A;  4C0L A;  3CGA A;  2NCP A;  4GFT A;  2SAS A;  4ORB B;  1DVI A;  2LLT A;  2LNK A;  4QJ4 B;  1L2O C;  3O2P A;  1D1O A;  1B7T Z;  1NCX A;  1RJV A;  3M0W A;  2HF5 A;  1NWD A;  2OS8 B;  2MAZ A;  3IQO A;  3JVT C;  4ZCU A;  1CTR A;  3OB2 B;  1SR6 B;  1OZS A;  2LLS A;  1YUR A;  1UUS A;  1TOP A;  2MLF C;  3BUO B;  1UUR A;  4PE4 A;  2OTG B;  2Y1N A;  3SG4 A;  5JOL A;  2K7D A;  5CSF A;  2TN4 A;  1B7T Y;  1EG3 A;  3NSL A;  1JFJ A;  1Y0V H;  1H8B A;  1FF1 A;  1LVC D;  2KGB C;  1OQP A;  1LXF C;  2KHN A;  3BYA A;  4HRH A;  2PSR A;  2FOT A;  2WCE A;  3SG7 A;  1XFZ O;  1XK4 C;  2O5G A; 
#chains in the Genus database with same CATH topology
 1OOH A;  3KEV A;  1NCY A;  1TNQ A;  3AKB A;  2ZN8 A;  1SMG A;  3D77 A;  2FCD A;  1XVJ A;  2KSP A;  1M39 A;  3FWC A;  1NX3 A;  2JC2 A;  1N0Y A;  2ZNE A;  1TNW A;  2JT8 A;  1IJ5 A;  2O60 A;  2R2I A;  3NHI A;  4GPL B;  4WQ2 A;  1L7Z A;  1QXP A;  5ER4 X;  4OCI A;  2L2E A;  2JZI A;  4U8D A;  5TNC A;  2WCH A;  3VB1 A;  1S6J A;  4F0Z B;  3IF7 A;  1KFU L;  2BE4 A;  4IL1 A;  1XFW O;  4Q04 A;  5I2Q A;  2LVI A;  2QEB A;  1S6I A;  1SBJ A;  1C3Z A;  3NSK A;  3BOW A;  1AK8 A;  1FPW A;  2IS9 A;  2ISD A;  2LAP A;  4XJK B;  5FI6 A;  3CR2 A;  4INX A;  1CM4 A;  1V1F A;  3CZ2 A;  1NIW A;  5CSI A;  2OPO A;  3KPX A;  1DJH A;  2KQY A;  1NP8 A;  1RFJ A;  1CDM A;  1S1E A;  2H61 A;  3C1V A;  3OX5 A;  3TDZ A;  4L9M A;  1QTX A;  3O78 A;  3Q8I A;  3S0B A;  1N2D A;  4M2Q A;  2PMY A;  5DKQ A;  2JQ6 A;  1F54 A;  3NXA A;  2F3Y A;  2M9G A;  1QV1 A;  4MLW A;  2L50 A;  1MQ1 A;  1WY9 A;  1XYD A;  2KLE A;  2L51 A;  2LHI A;  2NCO A;  5HKY A;  3SG2 A;  5HYD A;  3LK1 A;  2L98 A;  2LMU A;  1C07 A;  1G8I A;  1QJT A;  1DEK A;  3CR5 X;  2I7A A;  2KFH A;  3BUX B;  4MN0 A;  5AER A;  2D8N A;  1CFD A;  1R6P A;  2HQW A;  1T14 A;  2JTT A;  2LVK A;  3DVM A;  3PN7 B;  1UHI A;  1UHK A;  2MLE C;  1CNP A;  3PAL A;  2MRD A;  2KAX A;  1GGZ A;  3GK4 X;  3O4Y A;  1SW8 A;  1S3P A;  4I5L B;  4N1F A;  1H4B A;  1BT6 A;  2F8P A;  3LCP C;  2FCE A;  2BBM A;  2COL B;  2FJU B;  1B8L A;  2ZN9 A;  4MZL A;  1RRO A;  4AQI A;  3DVJ A;  5HL1 A;  4ICB A;  4PT1 A;  2AUC A;  3ZWH A;  1TWO A;  2LE9 B;  3DD4 A;  4PAL A;  5D69 A;  4AQJ A;  1F55 A;  1SPY A;  3S0E A;  4QJ5 B;  5FI7 A;  2ZND A;  1QIV A;  1XK4 A;  2B1U A;  2M1K B;  2Y1M A;  3I5G C;  3R1P A;  1QX5 B;  1XFY O;  2K2A A;  1CB1 A;  2KI4 C;  1B8C A;  2P6B B;  3QRX A;  4PE1 A;  3PM2 A;  1J7Q A;  1DJI A;  1K93 D;  1J55 A;  1NX2 A;  1YVL A;  2L2C A;  4MVF A;  3I5G B;  1XFR A;  2WCL A;  3UNW A;  2KI4 B;  4XJK A;  1P28 A;  3WHU B;  2O5G A;  4CLN A;  3D78 A;  1HQV A;  1ZUZ A;  1C7W A;  1NYA A;  1E8A A;  1KFU S;  1V1G A;  1WLM A;  1YX7 A;  2BKI B;  1G4Y R;  2CTN A;  2ZRT A;  1DTL A;  1EL4 A;  1ZMZ A;  3PSR A;  4MEW A;  3BFB A;  4MBE A;  4M2P A;  2NLN A;  1C3Y A;  1K8U A;  1K2H A;  4NDD A;  2K2F A;  2PYQ A;  2G9B A;  3BUM B;  3K21 A;  2M3W A;  3DZT A;  1PK0 D;  1MR8 A;  1DJZ A;  3O4X A;  3FS7 A;  2M0R A;  1UHN A;  2WND A;  1YTZ C;  4MRY A;  1W7J B;  3AAK A;  1A29 A;  3B86 A;  1L2O B;  2I94 A;  2PAL A;  4OVN F;  1F8H A;  2CNP A;  2K60 A;  1SCM C;  2EC6 C;  3A4U B;  4DIR A;  1AHR A;  1YUU A;  1GQM A;  3VRR A;  3JVT B;  4YRU A;  1CDN A;  2K7B A;  1S5G Z;  2JUL A;  3CWG A;  5CSJ A;  1DJG A;  1J1D A;  1LA0 A;  1SNL A;  1IGV A;  2BKH B;  2EC6 B;  2F3Z A;  2K0J A;  2ZFD A;  5DKR A;  1TCO B;  3BFH A;  1CMF A;  1XFU O;  4XYN A;  4ORC B;  3AAJ A;  1EXR A;  2JT0 A;  2WCK A;  4DUQ A;  2AAO A;  1SYM A;  2LMV A;  4HSZ A;  1DGU A;  2DOQ A;  4CFQ A;  1RK9 A;  1PVB A;  1BJF A;  2LHL A;  4NQG A;  2WCB A;  1S5G Y;  2LMT A;  2WOR A;  3IQQ A;  1OZO A;  1SRA A;  4YBH B;  2KAY A;  1DC1 A;  4TNC A;  1LS8 A;  3B88 A;  4USL A;  4IJ7 A;  2L5X B;  4KYN A;  3LK0 A;  1KFX S;  2I18 A;  2JXC A;  3PFV A;  2K61 A;  1WRK A;  2BNX A;  3B7A A;  1G33 A;  2H8V A;  4FTG A;  1DF0 B;  2KYC A;  1TTX A;  1UHJ A;  1SL7 A;  1PVA A;  2A4J A;  3CS1 A;  1BLQ A;  2MHH A;  4OR9 B;  4PDZ A;  2GV5 A;  2HPS A;  2KLD A;  3CLN A;  2LM5 A;  5B8I B;  2PVB A;  2L0P A;  2M29 A;  1WLZ A;  2LUC A;  5D7F A;  1XA5 A;  1KSO A;  1J7R A;  3CYZ A;  2LP2 A;  1S26 D;  3RZS A;  2FJY A;  2MBX A;  1ZAC A;  3SS4 A;  1K9P A;  3BXK A;  1U5I A;  1KWO C;  1A75 A;  1C7V A;  4R1E A;  1YRT B;  1KK7 Z;  2K7O A;  1CKK A;  4DCK A;  5I2L A;  3A8R A;  1R2U A;  1TUZ A;  5FYX A;  1AJ4 A;  4I5K A;  4ZCV A;  4ETO A;  1A03 A;  3BUN B;  1J1E A;  2LCP A;  3NHT A;  4HRG A;  3SS3 A;  1KWO B;  1YUT A;  2NZ0 A;  1IQ5 A;  1M31 A;  2HET A;  4YGC B;  3OHM B;  1ALW A;  1KSM A;  3R1O A;  4PCW A;  1IWQ A;  3K1E A;  3QME A;  2WC6 A;  1MXE A;  2K8M B;  1B8R A;  5AEQ A;  3EK7 A;  3I5F C;  1JC2 A;  4PHJ A;  3R72 A;  1BG1 A;  2KPH A;  1PSR A;  5EL2 A;  1YR5 A;  5G08 A;  1KK7 Y;  4MZJ A;  3VRP A;  3B87 A;  1BR1 B;  3EVV A;  2KQ6 A;  3V2L A;  1FBV A;  2CT9 A;  5AFP A;  1SCV A;  3FWB A;  3KO0 A;  4I5N B;  5KTY A;  1IG5 A;  3HX4 A;  2MA2 A;  3OX6 A;  3O6B A;  2ZRS A;  1OOI X;  1OOG A;  3LL8 B;  3TS5 C;  1KQV A;  1KFX L;  3PAT A;  4P5O E;  2LAN A;  2LP3 A;  1CFP A;  4JD9 A;  1CDL A;  2RGI A;  1KCY A;  2ERB A;  4A4C A;  2KNE A;  3D10 A;  1FI6 A;  2M7L A;  2F2P A;  3EVR A;  1SL9 A;  3L47 A;  1SKT A;  2M97 A;  3EKJ A;  3KHE A;  1GGW A;  1M46 A;  4DS7 A;  1IH0 A;  3CZT X;  2GTE A;  1OMV A;  2KBI A;  1OMD A;  1JBA A;  3NGV A;  1DF0 A;  1IJ6 A;  2BBN A;  1ZFS A;  2BCB A;  2JNF A;  3BJH A;  2BL0 C;  3BUW B;  1QX7 A;  1F4Q A;  1LA3 A;  1TCF A;  1OOF A;  1TNP A;  2G2B A;  3OP0 A;  4N1G A;  1VRK A;  1DMO A;  2Q91 A;  4WQ3 A;  3TDU A;  3TUY C;  3IVT A;  4INW A;  5IBW A;  1OW4 A;  1JF0 A;  2KAV A;  2Y4Q A;  3EK4 A;  3L4A A;  3NSO A;  2WCM A;  1JWD A;  2KGR A;  1IRJ A;  3MSE B;  5JJG A;  1J7P A;  1A2X A;  3GK2 A;  1B4C A;  2JT3 A;  3DVK A;  1GJY A;  4OV2 A;  2JTZ A;  3VRO A;  1QWV A;  1K94 A;  4JPZ B;  4MSP A;  2KI6 D;  2QEV A;  3E3R A;  4CFR A;  2BAP A;  1OMR A;  3RLZ A;  1U5I B;  5I2O A;  1A75 B;  4FQO A;  3DVE A;  4M2O A;  4C0K A;  1NX0 A;  3SS5 A;  1PAL A;  1QAS A;  1B1G A;  4PE0 A;  1N65 A;  2E30 A;  2YGU A;  3UO9 A;  1CFF A;  1Z2C B;  1CMG A;  1K9K A;  1XO5 A;  3D76 A;  3DY9 A;  1FI5 A;  1TNX A;  2M8U A;  2AMI A;  1EG4 A;  1IIO A;  1EH2 A;  1MWN A;  1M45 A;  3VGO A;  1A4P A;  1YUS A;  1AJ5 A;  2GGM A;  1BOC A;  2PAS A;  1JFK A;  3CZ0 A;  1AVS A;  1K9U A;  1ORG A;  1B47 A;  1MF8 B;  5CPV A;  2OS8 C;  1DJX A;  2JRF A;  1SSE B;  3EVU A;  1OOJ A;  1SCM B;  1SR6 C;  2HQ8 A;  5HKZ A;  5PAL A;  1DGV A;  2NXQ A;  4BY4 A;  2LVV A;  2EGD A;  1LIN A;  2OTG C;  2L4I A;  1JUO A;  1DT7 B;  1B9A A;  5J3X A;  2WCF A;  1M63 B;  1QVI Z;  1WDC C;  2KBM A;  2P70 A;  4PE7 A;  4C0J A;  1AUI B;  2QAC A;  2SCP A;  4NDC A;  2JPT A;  1AP4 A;  1CLM A;  1XFX O;  3I5I C;  3DXL A;  3ZNI A;  3BFA A;  1CLB A;  3OB1 B;  1BU3 A;  2KDH A;  1W7I B;  2LLU A;  3D75 A;  5HLO A;  1WDC B;  2K7C A;  3DF0 B;  1MHO A;  4OZD A;  4GGF C;  3SJS A;  1K96 A;  3I5I B;  1UWO A;  2BCA A;  2Q4U A;  1PSB A;  4HRE E;  4BY5 A;  1K95 A;  2QEO A;  1QVI Y;  1OSA A;  1TN4 A;  3WNX B;  2JNX A;  1ZOT B;  4DRW A;  1MXL C;  1IQ3 A;  1CM1 A;  1CFC A;  1DQE A;  4N5X A;  2BCX A;  1BR4 B;  3SG5 A;  1KK8 C;  1XFV O;  1S6C A;  1W9Z A;  3EG5 B;  2JWW A;  3DYE A;  5D3O A;  3OBV A;  5GQQ C;  5AAN A;  4P2Y B;  1YRU B;  4QJ3 B;  2I2R E;  3BQ3 A;  3EK8 A;  1KK8 B;  1JF2 A;  1Y6W A;  2F2O A;  2LUX A;  4OKH A;  3CR4 X;  4ORA B;  1PRW A;  4YGA A;  2KYF A;  1UP5 A;  2VRG A;  2CXJ A;  3RM1 A;  5CSN A;  4CPV A;  1ODB A;  3TDI A;  3VRN A;  1FW4 A;  1DJY A;  5KSZ A;  1TIZ A;  4F7F A;  1UHH A;  4YI9 A;  1F71 A;  2ZKM X;  1JSA A;  3VRQ A;  3PM8 A;  3F45 A;  2CCM A;  2JXL A;  2KI6 C;  5AXI A;  3EKH A;  1Y1A A;  1QAT A;  3JTD C;  4I5J A;  1K90 D;  2KOT A;  3S0D A;  3FE9 A;  2PRU A;  3D0Y B;  5FI2 A;  4GAO A;  3H4S E;  5HKW A;  2BE6 A;  5ER5 A;  1CLL A;  3JTD B;  5DKN A;  3PN7 C;  3I5F B;  3GOF A;  1NX1 A;  1DEL A;  2JOJ A;  2E6W A;  5BPJ A;  2L4H A;  4GGN A;  2H2K A;  1SY9 A;  1X02 A;  2WOS A;  3SG6 A;  2LC5 A;  2JPO A;  3R1V A;  2KFF A;  1LKJ A;  2V53 A;  1IKU A;  1ALV A;  3SG3 A;  1RWY A;  2M49 B;  4GNK B;  1QLS A;  3DF0 A;  1QIW A;  4PHM A;  3TS5 B;  3WHT B;  5DIC A;  4GBA A;  3HCM A;  1WRL A;  1NPQ A;  3CAB A;  3L4L A;  4UPG A;  3S0G A;  4E68 A;  1OE9 B;  2WC5 A;  1SK6 D;  3FIA A;  1Y1X A;  2EHB A;  5F6T A;  3SIB A;  5K89 A;  1YVH A;  1WRZ A;  3I5H C;  5I94 A;  1TRF A;  1Z4H A;  1Q80 A;  1QX2 A;  1SL8 A;  4GGF A;  1Y1U A;  3SIA A;  4A4B A;  4D1E A;  1QV0 A;  2WC8 A;  1HT9 A;  1RTP 1;  5HLV A;  4MZK A;  2GGZ A;  3TZ1 A;  5KU1 A;  3S0F A;  3NSI A;  4JWQ A;  4MRX A;  4YGE B;  1NCZ A;  2M1U A;  2F33 A;  3I5H B;  3AKA A;  2CBL A;  2QEH A;  3KF9 A;  4PHN A;  3S0A A;  2BL0 B;  1REC A;  3ICB A;  3D73 A;  3PJI A;  1EJ3 A;  2MJW B;  2LV7 A;  3LLE A;  3TUY B;  4YI8 A;  1NSH A;  2Y5I A;  3GK1 A;  4JQ0 D;  4GUK A;  1F70 A;  3OGN A;  1J7O A;  4PHK A;  1KQM C;  4AOM A;  1GM0 A;  1QS7 A;  1YX8 A;  4WRI A;  2QPT A;  4CID A;  1PUL A;  2M7N A;  3BOW B;  2KFG A;  1QLK A;  2H61 C;  2JU0 A;  5I8N A;  3CTN A;  3CDN A;  3WXA A;  1MUX A;  1F4O A;  2BEC A;  1KQM B;  2P71 A;  2PQL A;  3B6X A;  1NUB A;  1CDP A;  3PLF B;  4YGD B;  3FE8 A;  1TUJ A;  1BMO A;  1BOD A;  1DJW A;  2LVJ A;  1S36 A;  1BF5 A;  4YGB B;  4NDB A;  3D0Y A;  4C0L A;  4FQT A;  3CGA A;  2NCP A;  4GFT A;  2SAS A;  4ORB B;  1DVI A;  2LLT A;  2LNK A;  4QJ4 B;  1L2O C;  3O2P A;  1D1O A;  1B7T Z;  1NCX A;  3FE6 A;  1RJV A;  3M0W A;  2HF5 A;  2WCJ A;  1NWD A;  2OS8 B;  2MAZ A;  3IQO A;  3JVT C;  4ZCU A;  1CTR A;  3OB2 B;  1SR6 B;  4JKT A;  1OZS A;  2LLS A;  1YUR A;  1UUS A;  1TOP A;  2MLF C;  3BUO B;  1UUR A;  4PE4 A;  2OTG B;  2Y1N A;  3SG4 A;  5JOL A;  2K7D A;  5CSF A;  2TN4 A;  2QDI A;  1B7T Y;  1EG3 A;  3CZ1 A;  3NSL A;  1JFJ A;  1Y0V H;  1H8B A;  1FF1 A;  1LVC D;  2KGB C;  1OQP A;  1LXF C;  2KHN A;  3BYA A;  4HRH A;  2PSR A;  2FOT A;  2WCE A;  3N7H A;  3SG7 A;  3D74 A;  1XFZ O;  1XK4 C;  2L5Y A; 
#chains in the Genus database with same CATH homology
 3KEV A;  1NCY A;  1TNQ A;  3AKB A;  2ZN8 A;  1SMG A;  2FCD A;  1XVJ A;  2KSP A;  1M39 A;  3FWC A;  1NX3 A;  2JC2 A;  1N0Y A;  2ZNE A;  1TNW A;  2JT8 A;  1IJ5 A;  2O60 A;  2R2I A;  4GPL B;  4WQ2 A;  5ER4 X;  1L7Z A;  1QXP A;  4OCI A;  2L2E A;  2JZI A;  4U8D A;  5TNC A;  1S6J A;  4F0Z B;  3IF7 A;  1KFU L;  2BE4 A;  4IL1 A;  1XFW O;  4Q04 A;  5I2Q A;  2LVI A;  1S6I A;  1SBJ A;  3NSK A;  3BOW A;  1AK8 A;  1FPW A;  2IS9 A;  2ISD A;  2LAP A;  4XJK B;  3CR2 A;  1CM4 A;  1V1F A;  1NIW A;  5CSI A;  2OPO A;  3KPX A;  1DJH A;  2KQY A;  1NP8 A;  1RFJ A;  1CDM A;  1S1E A;  2H61 A;  3C1V A;  3OX5 A;  3TDZ A;  4L9M A;  1QTX A;  3O78 A;  1F54 A;  1N2D A;  4M2Q A;  2PMY A;  5DKQ A;  2JQ6 A;  3NXA A;  2F3Y A;  2M9G A;  1QV1 A;  4MLW A;  2L50 A;  1MQ1 A;  1WY9 A;  1XYD A;  2L51 A;  2LHI A;  2NCO A;  5HKY A;  3SG2 A;  5HYD A;  3LK1 A;  2L98 A;  2LMU A;  1C07 A;  1G8I A;  1QJT A;  3CR5 X;  2I7A A;  2KFH A;  3BUX B;  4MN0 A;  5AER A;  2D8N A;  1CFD A;  1R6P A;  2HQW A;  2JTT A;  2LVK A;  3DVM A;  3PN7 B;  1UHI A;  1UHK A;  2MLE C;  1CNP A;  3PAL A;  2MRD A;  2KAX A;  1GGZ A;  3GK4 X;  3O4Y A;  1SW8 A;  1S3P A;  4I5L B;  4N1F A;  1H4B A;  1BT6 A;  2F8P A;  3LCP C;  2FCE A;  2BBM A;  2COL B;  2FJU B;  1B8L A;  2ZN9 A;  4MZL A;  1RRO A;  4AQI A;  3DVJ A;  4ICB A;  2AUC A;  3ZWH A;  2LE9 B;  3DD4 A;  4PAL A;  5D69 A;  4AQJ A;  1F55 A;  1SPY A;  4QJ5 B;  2ZND A;  1QIV A;  1XK4 A;  2B1U A;  2M1K B;  2Y1M A;  3I5G C;  1QX5 B;  1XFY O;  2K2A A;  1CB1 A;  2KI4 C;  1B8C A;  2P6B B;  3QRX A;  4PE1 A;  1J7Q A;  1DJI A;  1K93 D;  1J55 A;  1NX2 A;  1YVL A;  4MVF A;  3I5G B;  2KI4 B;  4XJK A;  3WHU B;  4CLN A;  1HQV A;  1ZUZ A;  2BKI B;  1V1G A;  1C7W A;  1NYA A;  1E8A A;  1KFU S;  1WLM A;  1YX7 A;  1G4Y R;  2CTN A;  2ZRT A;  1DTL A;  1EL4 A;  1ZMZ A;  3PSR A;  4MEW A;  4MBE A;  4M2P A;  2NLN A;  1K8U A;  1K2H A;  4NDD A;  2K2F A;  3BUM B;  2G9B A;  3K21 A;  2M3W A;  1PK0 D;  1MR8 A;  1DJZ A;  3FS7 A;  2M0R A;  1UHN A;  2WND A;  1YTZ C;  4MRY A;  1W7J B;  3AAK A;  1A29 A;  1L2O B;  2I94 A;  2PAL A;  4OVN F;  1F8H A;  2CNP A;  1SCM C;  2EC6 C;  3A4U B;  4DIR A;  1AHR A;  1YUU A;  1GQM A;  3VRR A;  3JVT B;  4YRU A;  1CDN A;  2K7B A;  1S5G Z;  2JUL A;  3CWG A;  5CSJ A;  1DJG A;  1J1D A;  1LA0 A;  1SNL A;  1IGV A;  2BKH B;  2EC6 B;  2F3Z A;  2K0J A;  2ZFD A;  5DKR A;  1TCO B;  1CMF A;  1XFU O;  4XYN A;  4ORC B;  3AAJ A;  1EXR A;  2JT0 A;  4DUQ A;  2AAO A;  1SYM A;  2LMV A;  4HSZ A;  1DGU A;  2DOQ A;  4CFQ A;  1RK9 A;  1PVB A;  1BJF A;  2LHL A;  4NQG A;  2WCB A;  1S5G Y;  2LMT A;  2WOR A;  3IQQ A;  1OZO A;  1SRA A;  4YBH B;  2KAY A;  4TNC A;  4USL A;  2L5X B;  3LK0 A;  1KFX S;  2I18 A;  2JXC A;  3PFV A;  2K61 A;  1WRK A;  1G33 A;  4FTG A;  1DF0 B;  2KYC A;  1TTX A;  1UHJ A;  1SL7 A;  1PVA A;  2A4J A;  3CS1 A;  1BLQ A;  2MHH A;  4OR9 B;  4PDZ A;  2GV5 A;  2HPS A;  3CLN A;  2LM5 A;  5B8I B;  2PVB A;  2L0P A;  2M29 A;  1WLZ A;  2LUC A;  5D7F A;  1XA5 A;  1KSO A;  1J7R A;  2LP2 A;  1S26 D;  2MBX A;  1ZAC A;  1C7V A;  1K9P A;  3BXK A;  1U5I A;  1KWO C;  1A75 A;  4R1E A;  1YRT B;  1KK7 Z;  2K7O A;  1CKK A;  4DCK A;  5I2L A;  3A8R A;  1R2U A;  5FYX A;  1AJ4 A;  4I5K A;  4ZCV A;  4ETO A;  1A03 A;  3BUN B;  1J1E A;  2LCP A;  4HRG A;  1KWO B;  1YUT A;  2NZ0 A;  1IQ5 A;  1M31 A;  2HET A;  4YGC B;  3OHM B;  1ALW A;  1KSM A;  4PCW A;  1IWQ A;  1MXE A;  2K8M B;  1B8R A;  5AEQ A;  3EK7 A;  3I5F C;  1JC2 A;  4PHJ A;  1BG1 A;  1PSR A;  1YR5 A;  5G08 A;  1KK7 Y;  4MZJ A;  3VRP A;  1BR1 B;  3EVV A;  2KQ6 A;  1FBV A;  2CT9 A;  5AFP A;  1SCV A;  3FWB A;  3KO0 A;  4I5N B;  5KTY A;  1IG5 A;  3HX4 A;  2MA2 A;  3OX6 A;  3O6B A;  2ZRS A;  3LL8 B;  3TS5 C;  1KQV A;  1KFX L;  3PAT A;  4P5O E;  2LAN A;  2LP3 A;  1CFP A;  1CDL A;  2RGI A;  1KCY A;  4A4C A;  2KNE A;  3D10 A;  1FI6 A;  2M7L A;  2F2P A;  3EVR A;  1SL9 A;  1SKT A;  2M97 A;  3EKJ A;  3KHE A;  1GGW A;  1M46 A;  4DS7 A;  1IH0 A;  3CZT X;  1OMV A;  2KBI A;  1OMD A;  1JBA A;  1DF0 A;  1IJ6 A;  2BBN A;  1ZFS A;  2BCB A;  2JNF A;  2BL0 C;  3BUW B;  1QX7 A;  1F4Q A;  1LA3 A;  1TCF A;  1TNP A;  2G2B A;  3OP0 A;  4N1G A;  1DMO A;  1VRK A;  2Q91 A;  4WQ3 A;  3TDU A;  3TUY C;  5IBW A;  1JF0 A;  2KAV A;  2Y4Q A;  3EK4 A;  3NSO A;  1JWD A;  2KGR A;  1IRJ A;  3MSE B;  5JJG A;  1J7P A;  1A2X A;  3GK2 A;  1B4C A;  2JT3 A;  3DVK A;  1GJY A;  4OV2 A;  2JTZ A;  3VRO A;  1K94 A;  4JPZ B;  4MSP A;  2KI6 D;  3E3R A;  4CFR A;  1OMR A;  3RLZ A;  1U5I B;  5I2O A;  1A75 B;  4FQO A;  3DVE A;  4M2O A;  4C0K A;  1NX0 A;  1B1G A;  1PAL A;  1QAS A;  4PE0 A;  1N65 A;  2E30 A;  1CFF A;  1CMG A;  1K9K A;  1XO5 A;  1FI5 A;  1TNX A;  2M8U A;  2AMI A;  1EG4 A;  1EH2 A;  1MWN A;  1M45 A;  3VGO A;  1A4P A;  1YUS A;  1AJ5 A;  2GGM A;  1BOC A;  2PAS A;  1JFK A;  1AVS A;  1K9U A;  1B47 A;  1MF8 B;  5CPV A;  2OS8 C;  1DJX A;  2JRF A;  3EVU A;  1OOJ A;  1SCM B;  1SR6 C;  2HQ8 A;  5HKZ A;  5PAL A;  1DGV A;  2NXQ A;  4BY4 A;  2LVV A;  2EGD A;  1LIN A;  2OTG C;  2L4I A;  1JUO A;  1DT7 B;  1B9A A;  5J3X A;  2WCF A;  1M63 B;  1QVI Z;  1WDC C;  2KBM A;  4PE7 A;  4C0J A;  1AUI B;  2QAC A;  2SCP A;  4NDC A;  2JPT A;  1AP4 A;  1CLM A;  1XFX O;  3I5I C;  3ZNI A;  1CLB A;  3OB1 B;  1BU3 A;  2KDH A;  1W7I B;  2LLU A;  5HLO A;  1WDC B;  2K7C A;  3DF0 B;  1MHO A;  4GGF C;  3SJS A;  1K96 A;  3I5I B;  1UWO A;  2BCA A;  2Q4U A;  1PSB A;  4HRE E;  4BY5 A;  1K95 A;  3WNX B;  1QVI Y;  1OSA A;  1TN4 A;  2JNX A;  1ZOT B;  4DRW A;  1MXL C;  1IQ3 A;  1CM1 A;  1CFC A;  4N5X A;  2BCX A;  1BR4 B;  3SG5 A;  1KK8 C;  1XFV O;  1S6C A;  2JWW A;  5GQQ C;  5AAN A;  4P2Y B;  1YRU B;  4QJ3 B;  2I2R E;  3BQ3 A;  3EK8 A;  1KK8 B;  1JF2 A;  1Y6W A;  2F2O A;  2LUX A;  4OKH A;  3CR4 X;  4ORA B;  1PRW A;  4YGA A;  2KYF A;  1UP5 A;  2VRG A;  2CXJ A;  3RM1 A;  5CSN A;  4CPV A;  1ODB A;  3TDI A;  3VRN A;  1FW4 A;  1DJY A;  5KSZ A;  1TIZ A;  1UHH A;  4YI9 A;  1F71 A;  2ZKM X;  1JSA A;  3VRQ A;  3PM8 A;  3F45 A;  2CCM A;  2JXL A;  2KI6 C;  5AXI A;  3EKH A;  1Y1A A;  1QAT A;  3JTD C;  4I5J A;  1K90 D;  2KOT A;  2PRU A;  3D0Y B;  4GAO A;  3H4S E;  5HKW A;  2BE6 A;  5ER5 A;  1CLL A;  3JTD B;  5DKN A;  3PN7 C;  3I5F B;  3GOF A;  1NX1 A;  2JOJ A;  2E6W A;  5BPJ A;  2L4H A;  4GGN A;  2H2K A;  1SY9 A;  1X02 A;  2WOS A;  3SG6 A;  2LC5 A;  2KFF A;  1LKJ A;  2V53 A;  1IKU A;  1ALV A;  3SG3 A;  1RWY A;  2M49 B;  4GNK B;  1QLS A;  3DF0 A;  1QIW A;  4PHM A;  3TS5 B;  3WHT B;  4GBA A;  3HCM A;  1WRL A;  1NPQ A;  4UPG A;  4E68 A;  1OE9 B;  3FIA A;  1SK6 D;  1Y1X A;  2EHB A;  5F6T A;  3SIB A;  5K89 A;  1YVH A;  1WRZ A;  3I5H C;  1TRF A;  1Q80 A;  1QX2 A;  1SL8 A;  4GGF A;  1Y1U A;  3SIA A;  4A4B A;  4D1E A;  1QV0 A;  2WC8 A;  1HT9 A;  1RTP 1;  5HLV A;  4MZK A;  2GGZ A;  3TZ1 A;  5KU1 A;  3NSI A;  4JWQ A;  4MRX A;  4YGE B;  1NCZ A;  2M1U A;  2F33 A;  3I5H B;  3AKA A;  2CBL A;  3KF9 A;  4PHN A;  2BL0 B;  1REC A;  3ICB A;  1EJ3 A;  2MJW B;  2LV7 A;  3LLE A;  3TUY B;  4YI8 A;  1NSH A;  2Y5I A;  3GK1 A;  4JQ0 D;  4GUK A;  1F70 A;  1J7O A;  4PHK A;  1KQM C;  4AOM A;  1QS7 A;  1YX8 A;  4WRI A;  2QPT A;  4CID A;  1PUL A;  2M7N A;  3BOW B;  2KFG A;  1QLK A;  2H61 C;  2JU0 A;  5I8N A;  3CTN A;  3WXA A;  1MUX A;  1F4O A;  2BEC A;  1KQM B;  3PLF B;  1NUB A;  1CDP A;  4YGD B;  1BMO A;  1BOD A;  1DJW A;  2LVJ A;  1S36 A;  1BF5 A;  4YGB B;  4NDB A;  3D0Y A;  4C0L A;  3CGA A;  2NCP A;  4GFT A;  2SAS A;  4ORB B;  1DVI A;  2LLT A;  2LNK A;  4QJ4 B;  1L2O C;  3O2P A;  1D1O A;  1B7T Z;  1NCX A;  1RJV A;  3M0W A;  2HF5 A;  1NWD A;  2OS8 B;  2MAZ A;  3IQO A;  3JVT C;  4ZCU A;  1CTR A;  3OB2 B;  1SR6 B;  1OZS A;  2LLS A;  1YUR A;  1UUS A;  1TOP A;  2MLF C;  3BUO B;  1UUR A;  4PE4 A;  2OTG B;  2Y1N A;  3SG4 A;  5JOL A;  2K7D A;  5CSF A;  2TN4 A;  1B7T Y;  1EG3 A;  3NSL A;  1JFJ A;  1Y0V H;  1H8B A;  1FF1 A;  1LVC D;  2KGB C;  1OQP A;  1LXF C;  2KHN A;  3BYA A;  4HRH A;  2PSR A;  2FOT A;  2WCE A;  3SG7 A;  1XFZ O;  1XK4 C;  2O5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...