5K89A

Crystal structure of human calcium-bound s100a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
85
Chain Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title X-ray crystal structure of human calcium-bound S100A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 31
structure length 85
sequence length 90
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2016-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5k89A00
2L2EA 2LMVA 4FTGA 2I94A 1MUXA 3DF0A 1CB1A 3OB1B 4M2PA 3CR4X 4DIRA 1AK8A 1N65A 1SY9A 5CSJA 2LP2A 1G33A 2JXCA 3ICBA 3VRNA 1K96A 1YR5A 4MVFA 1SK6D 2JT8A 3LK0A 2KGBC 1XK4A 1BR4B 2JPTA 4NDCA 1CKKA 2L0PA 5CSIA 5CSFA 1B9AA 1CM4A 2M1UA 2OPOA 4A4BA 4HRGA 2FJUB 2HQWA 4GGFA 1TCFA 1WLZA 4TNCA 1D1OA 1KK8B 5GQQC 2BECA 1FBVA 5IBWA 4GGNA 1QX7A 4HREE 2LUCA 1TNQA 2PMYA 1NWDA 1X02A 1Y1UA 1AJ5A 1KK7Y 1CMGA 2ZN8A 4YGAA 5I8NA 1BMOA 5AANA 1KFXL 1KCYA 1ODBA 2KYFA 3BUXB 2JRFA 1EG3A 3LL8B 2MBXA 4PE0A 4CIDA 1NIWA 2AUCA 2WCEA 4GFTA 2WORA 2H61A 1XFUO 2M7NA 1DJIA 4CFRA 4YRUA 1DJYA 1F4OA 3KEVA 1WRLA 1QV0A 4BY4A 1LXFC 4ICBA 1TTXA 3SJSA 3DVJA 3PSRA 2K2FA 3BOWB 4MZJA 3C1VA 1UHJA 4P5OE 5BPJA 4YGBB 2M8UA 1QLSA 1Y1AA 1V1FA 2LNKA 3TDZA 1RJVA 4PE4A 1JFJA 1PALA 1JSAA 1KK8C 1NCZA 1YTZC 1YUSA 2WOSA 1A29A 2Y5IA 3F45A 3GK2A 4YI9A 1CLBA 1QASA 2BBMA 3RM1A 4NDBA 5HKWA 3I5HC 1M46A 4MLWA 1PULA 5AEQA 1TIZA 2D8NA 2ZN9A 3M0WA 2JWWA 2KFFA 5I2QA 2JZIA 1QLKA 4MRYA 2NXQA 1OE9B 1CFCA 1FW4A 1RECA 3FS7A 1IQ5A 1WLMA 1ZUZA 2BCBA 1S26D 3SIAA 1F70A 1CDNA 2F2OA 1QV1A 3CTNA 2ISDA 2BCAA 2LVKA 4PALA 2MJWB 5J3XA 2MAZA 4XJKA 1ZMZA 1MXLC 1SCMB 1KWOC 1MF8B 2KOTA 3TUYB 1NX1A 1EJ3A 3OB2B 4MBEA 4C0LA 5PALA 4GNKB 3JVTB 1DT7B 5HKZA 3SG6A 1CFPA 2WCBA 4M2OA 1K94A 1NSHA 2DOQA 4I5KA 1JC2A 3E3RA 1S6JA 2EC6B 2ZRSA 1DJHA 3OX6A 1YURA 3BXKA 1W7JB 1IWQA 2LVIA 4CFQA 2ZKMX 3GK4X 3D0YB 1OZSA 4GUKA 3NSKA 4C0KA 4YGDB 2KGRA 3EK4A 4MSPA 1W7IB 2NZ0A 1LA0A 1A03A 1FI5A 1KFUL 2HPSA 4WQ2A 4D1EA 4ETOA 5ER4X 1UURA 1NX0A 1ZACA 1DJGA 1SCMC 4E68A 3QRXA 1J7RA 3TZ1A 3TUYC 2IS9A 4DRWA 1S5GZ 2KI6D 2L4IA 2MHHA 3BUNB 1NX3A 3FWCA 3JVTC 4ORAB 1XYDA 2O60A 3RLZA 3ZNIA 1QS7A 3CR2A 1S3PA 2EC6C 1CNPA 1PSRA 1H4BA 3PN7C 3SG4A 1DJXA 4AOMA 1TN4A 3ZWHA 1MXEA 4OKHA 2OTGB 1QVIY 1XFWO 1QIWA 2PSRA 1OZOA 1RFJA 1XFZO 4OV2A 5HLOA 2LCPA 3KPXA 1H8BA 2F2PA 2NLNA 1XFVO 1BU3A 1Y0VH 2TN4A 2QPTA 2PRUA 4OCIA 2E30A 4NQGA 3I5GB 3I5HB 4U8DA 1SCVA 3PATA 4C0JA 2KYCA 1CFFA 2H2KA 2KBMA 2Q91A 1OQPA 1ALVA 2L51A 2L50A 2EGDA 1NYAA 1IJ6A 2AMIA 3H4SE 2LP3A 2JULA 1ZOTB 3CR5X 1IH0A 1LA3A 5DKQA 4CPVA 1EH2A 1Y1XA 2LE9B 5DKNA 4Q04A 4MRXA 2KQYA 3KHEA 3EVVA 2JOJA 2LM5A 1KQVA 2BCXA 1YVLA 1R6PA 1YUTA 2BKIB 4PE1A 1KWOB 1IQ3A 2MA2A 3HCMA 4OVNF 2ZFDA 4I5NB 2M29A 1RTP1 4IL1A 1AVSA 2KAYA 1K8UA 1TNWA 2MLEC 2I7AA 2OTGC 3LK1A 2E6WA 2PASA 4JPZB 4M2QA 1XO5A 1N2DA 2CXJA 2LAPA 5CSNA 3A4UB 2K7CA 1B8RA 1JWDA 1K93D 4I5LB 2MLFC 4PHMA 3BOWA 1PRWA 2Y1MA 1JFKA 1LINA 1YX7A 2ZRTA 5JJGA 1K95A 4WRIA 1KSOA 1NUBA 2FOTA 1YRTB 5CPVA 1TRFA 3I5GC 2LHIA 1MHOA 2SASA 5AXIA 1B7TZ 2RGIA 1BLQA 1SYMA 2SCPA 5HKYA 2F3YA 2KQ6A 2M97A 3SG2A 2LMUA 1IRJA 1Y6WA 1A75B 3LCPC 1SKTA 3AKBA 1A2XA 2VRGA 3KO0A 1QATA 4HSZA 2G9BA 1C7WA 3NSIA 3PALA 4PE7A 3TDUA 1GQMA 2K0JA 3NSLA 5K89A 2KDHA 1CDLA 4UPGA 1XVJA 2L5XB 1OMVA 2LANA 4N1GA 2M49B 1A75A 2WCFA 3GOFA 2Y1NA 4ORBB 3O2PA 1AJ4A 5JOLA 1B1GA 3IQOA 1B8CA 2LV7A 3CWGA 1J7OA 1BF5A 1F8HA 1OMRA 3BYAA 3D10A 1LKJA 2HETA 2KI6C 3JTDB 1HT9A 1F55A 1R2UA 1F54A 1QX2A 1DF0B 1DTLA 3OHMB 1IJ5A 3PN7B 4QJ5B 1IKUA 3BUWB 2LC5A 3IQQA 1UHKA 1WRZA 4PDZA 1WDCB 1BOCA 1WY9A 1J55A 1ZFSA 1DF0A 2KFGA 2KI4B 1AP4A 1NX2A 2CCMA 2BKHB 4A4CA 3DVEA 2A4JA 2Y4QA 1JUOA 1NPQA 3D0YA 2CNPA 2GGMA 1TOPA 2MRDA 1EXRA 1XFYO 1LVCD 3I5FC 2LLTA 4JQ0D 1OOJA 4FQOA 1B47A 1JF0A 1J7PA 4ZCUA 2KBIA 4DS7A 2JXLA 4QJ3B 2JTTA 1CMFA 5KU1A 4HRHA 2KSPA 5AERA 1B8LA 3SG3A 1JBAA 2AAOA 5I2LA 1QTXA 1U5IB 1WRKA 1C07A 3JTDC 1N0YA 3DF0B 3WXAA 4PHKA 4GBAA 1BODA 4PHJA 1DGUA 1J7QA 2G2BA 4WQ3A 1BR1B 1FPWA 3FIAA 1PK0D 1S36A 2JT0A 1J1DA 1PVAA 3I5IC 1MR8A 3FWBA 3EKJA 2K61A 2KFHA 1U5IA 4OR9B 2K7DA 1OSAA 1WDCC 4PCWA 3OP0A 5B8IB 1MQ1A 5KSZA 2KI4C 2B1UA 1UP5A 5FYXA 3AKAA 2JTZA 3PLFB 1CTRA 2EHBA 2JNXA 3AAKA 3LLEA 3SG5A 3TS5B 5KTYA 1YVHA 1S5GY 1DJZA 5I2OA 2Q4UA 1J1EA 1L2OB 4MZLA 1SNLA 1SR6B 4I5JA 4BY5A 1S1EA 3O4YA 2COLB 2M3WA 1KFUS 3CS1A 4PHNA 2M9GA 1MWNA 5TNCA 3BUMB 2QACA 2R2IA 1SL9A 1PVBA 5HLVA 3K21A 2CT9A 1K9KA 1UHNA 4GAOA 3PM8A 1KQMB 2LUXA 4DCKA 4YGCB 1C7VA 1YUUA 1NCXA 1SW8A 3KF9A 3DVMA 2KNEA 4L9MA 1BT6A 1E8AA 3DD4A 1EG4A 3WNXB 2NCPA 2K2AA 1DJWA 1M45A 2F8PA 1G4YR 2I2RE 1GGWA 1XK4C 1OMDA 1CLMA 1DMOA 3CZTX 1QIVA 2M7LA 1NCYA 1SBJA 3GK1A 4NDDA 2PVBA 3OX5A 2JNFA 3TS5C 4GGFC 5DKRA 3WHTB 4F0ZB 1M63B 1QX5B 1A4PA 2K7BA 4YBHB 1TNXA 2I18A 3EVRA 1CDPA 4XYNA 1SPYA 1L2OC 2BE6A 1UWOA 1KSMA 1SR6C 4N1FA 1AUIB 3SG7A 3PFVA 2HQ8A 2M1KB 3CGAA 4N5XA 5HYDA 1DVIA 1XA5A 2P6BB 1ALWA 1KFXS 1SL8A 1K9UA 2JC2A 2H61C 3EKHA 1KQMC 3EVUA 3I5FB 2O5GA 1M31A 1UUSA 2OS8B 4MEWA 1UHHA 3VROA 1K90D 5F6TA 2BL0B 3VGOA 2FCDA 3EK8A 5ER5A 3VRRA 1RROA 4XJKB 4QJ4B 3CLNA 2K7OA 1L7ZA 1QJTA 2LMTA 4MZKA 4AQJA 1CLLA 3VRPA 1DGVA 2JT3A 4ZCVA 3MSEB 5G08A 1CM1A 2CBLA 1G8IA 3BUOB 1JF2A 2CTNA 3A8RA 1B7TY 2KAXA 4YI8A 2LHLA 1YRUB 3HX4A 1FF1A 1HQVA 3I5IB 1GJYA 1NP8A 3IF7A 2WC8A 1CDMA 2GGZA 3BQ3A 1S6CA 5D7FA 3EK7A 2FCEA 3SIBA 1B4CA 1RK9A 2M0RA 3TDIA 1TNPA 1S6IA 1TCOB 1PSBA 2WNDA 4USLA 4YGEB 2LLUA 5AFPA 1BG1A 1K2HA 1SL7A 1IG5A 2K8MB 2HF5A 1SMGA 2F3ZA 2GV5A 3O6BA 1CFDA 3NXAA 2OS8C 4P2YB 1IGVA 4JWQA 1BJFA 2ZNEA 3AAJA 1AHRA 2BL0C 2V53A 1V1GA 2F33A 4CLNA 1EL4A 2KHNA 2L4HA 2ZNDA 2LVJA 2NCOA 1FI6A 3O78A 4ORCB 1K9PA 3NSOA 1QVIZ 3DVKA 4GPLB 4DUQA 2LLSA 2PALA 2KAVA 5D69A 2BE4A 1GGZA 2BBNA 3WHUB 2JQ6A 3VRQA 1UHIA 1XFXO 4MN0A 4R1EA 4AQIA 1RWYA 2JU0A 1F71A 1KK7Z 1M39A 1QXPA 1SRAA 1YX8A 1VRKA 2LVVA 1Q80A 1F4QA 2L98A
chains in the Genus database with same CATH superfamily
2L2EA 2LMVA 4FTGA 2I94A 1MUXA 3DF0A 1CB1A 3OB1B 4M2PA 3CR4X 4DIRA 1AK8A 1N65A 1SY9A 2L5YA 5CSJA 2LP2A 1G33A 2JXCA 3ICBA 3VRNA 1K96A 1YR5A 3BJHA 4MVFA 1SK6D 3L47A 2JT8A 3LK0A 2KGBC 1XK4A 1BR4B 2JPTA 4NDCA 1CKKA 2L0PA 5CSIA 5CSFA 1B9AA 1CM4A 2M1UA 3EG5B 2OPOA 4A4BA 4HRGA 4JKTA 2FJUB 2HQWA 4GGFA 1TCFA 1WLZA 4TNCA 1D1OA 1KK8B 5GQQC 2BECA 1FBVA 5IBWA 4GGNA 1QX7A 5FI6A 4HREE 2LUCA 1TNQA 2PMYA 1NWDA 1X02A 1Y1UA 1AJ5A 1KK7Y 4JD9A 1CMGA 2ZN8A 4YGAA 5I8NA 1BMOA 5AANA 1KFXL 1KCYA 1ODBA 2KYFA 2WCHA 2JRFA 1EG3A 3BUXB 3LL8B 3O4XA 2MBXA 3VB1A 4PE0A 4CIDA 1NIWA 2AUCA 2WCEA 3N7HA 2WORA 4GFTA 1P28A 2H61A 1XFUO 3B88A 2M7NA 1DJIA 4CFRA 3L4LA 1DJYA 4YRUA 1F4OA 3KEVA 1WRLA 1DELA 1QV0A 4BY4A 1LXFC 4ICBA 1TTXA 3SJSA 3DVJA 3PSRA 2WCKA 2K2FA 3BOWB 4MZJA 3C1VA 1UHJA 2H8VA 4P5OE 1Z2CB 5BPJA 4YGBB 2M8UA 4F7FA 1QLSA 1Y1AA 3CABA 1V1FA 2LNKA 2P70A 3TDZA 3D77A 1RJVA 4PE4A 1JFJA 1PALA 1XFRA 3SS5A 1JSAA 1KK8C 1NCZA 1YTZC 1YUSA 2WOSA 1A29A 2Y5IA 3F45A 3GK2A 2KLEA 4YI9A 1CLBA 1QASA 2BBMA 3RM1A 4NDBA 5HKWA 3I5HC 1M46A 4MLWA 1PULA 5AEQA 1TIZA 2D8NA 2ZN9A 3M0WA 2JWWA 2KFFA 5I2QA 2JZIA 1QLKA 4MRYA 2NXQA 1OE9B 3S0BA 1CFCA 1FW4A 4INWA 1RECA 3FS7A 1IQ5A 1WLMA 1ZUZA 2BCBA 1S26D 3SIAA 1F70A 1CDNA 2F2OA 1QV1A 3CTNA 2ISDA 2BCAA 2LVKA 4PALA 2MJWB 5J3XA 2MAZA 4XJKA 1ZMZA 1MXLC 3IVTA 1SCMB 3NGVA 1KWOC 1MF8B 2KOTA 4INXA 3TUYB 3K1EA 1NX1A 1EJ3A 3OB2B 4MBEA 4C0LA 3R72A 5PALA 3FE9A 4GNKB 3JVTB 1DT7B 5HKZA 3SG6A 1CFPA 2WCBA 4M2OA 1K94A 1NSHA 2DOQA 4I5KA 1JC2A 3E3RA 3S0AA 1S6JA 3SS4A 2EC6B 2ZRSA 1DJHA 3OX6A 1YURA 3BXKA 1W7JB 1IWQA 2QEOA 2LVIA 4CFQA 2ZKMX 3GK4X 3D0YB 5HL1A 1OZSA 3B86A 3NSKA 3DYEA 4GUKA 4YGDB 2KGRA 4C0KA 1TUJA 3EK4A 2JPOA 4MSPA 1W7IB 3FE6A 2NZ0A 2BNXA 1LA0A 1A03A 1FI5A 1KFUL 2HPSA 4WQ2A 4D1EA 4ETOA 1LS8A 5ER4X 1UURA 1NX0A 1ZACA 1DJGA 1SCMC 4E68A 3QRXA 1J7RA 3S0DA 3TZ1A 3TUYC 1IIOA 2IS9A 4DRWA 4IJ7A 1S5GZ 2KI6D 2L4IA 2MHHA 2YGUA 3BUNB 1NX3A 3FWCA 3JVTC 4ORAB 1XYDA 2O60A 3RLZA 1TWOA 1QS7A 3ZNIA 3CR2A 1S3PA 2QEHA 2EC6C 1CNPA 1PSRA 1H4BA 3OGNA 3DY9A 3PN7C 1Z4HA 1DJXA 3SG4A 4AOMA 1TN4A 3ZWHA 1MXEA 3D76A 4OKHA 2OTGB 1QVIY 1XFWO 1QIWA 5EL2A 2PSRA 1OZOA 1RFJA 1XFZO 2QEVA 4OV2A 5HLOA 1GM0A 2LCPA 3KPXA 1H8BA 2F2PA 2NLNA 1XFVO 1BU3A 1Y0VH 2TN4A 2QPTA 2PRUA 4OCIA 2E30A 4NQGA 3I5GB 3I5HB 4U8DA 1SCVA 3PATA 4C0JA 2KYCA 1CFFA 3B7AA 1W9ZA 2H2KA 5I94A 2KBMA 2Q91A 1OQPA 1ALVA 3DZTA 2L51A 2L50A 2EGDA 1NYAA 1IJ6A 2AMIA 3H4SE 2LP3A 2JULA 1ZOTB 3CR5X 1IH0A 1TUZA 1LA3A 5DKQA 2GTEA 4CPVA 1EH2A 1Y1XA 2LE9B 5DKNA 4Q04A 4MRXA 2KQYA 3KHEA 3EVVA 2JOJA 2LM5A 1KQVA 2BCXA 1YVLA 1R6PA 1YUTA 2BKIB 4PE1A 1KWOB 1IQ3A 2MA2A 3HCMA 4OVNF 3CZ1A 3D73A 3PJIA 2ZFDA 2BAPA 4I5NB 2M29A 1RTP1 4IL1A 1AVSA 2KAYA 1K8UA 1TNWA 2MLEC 2I7AA 2OTGC 3LK1A 2E6WA 2PASA 3CDNA 4JPZB 1XO5A 1N2DA 2CXJA 2LAPA 4M2QA 3A4UB 2K7CA 5CSNA 1B8RA 1JWDA 1K93D 4I5LB 2MLFC 4PHMA 3BOWA 5D3OA 1PRWA 2Y1MA 1JFKA 1LINA 1YX7A 2ZRTA 5JJGA 1K95A 5DICA 4WRIA 1KSOA 1NUBA 2FOTA 1YRTB 5CPVA 3L4AA 1TRFA 3I5GC 3B6XA 2LHIA 1DEKA 1MHOA 2SASA 5AXIA 1B7TZ 3D74A 2RGIA 1BLQA 1SYMA 2SCPA 5HKYA 2F3YA 2KQ6A 2M97A 3SG2A 2LMUA 1IRJA 1Y6WA 1A75B 3LCPC 1SSEB 1SKTA 3AKBA 1A2XA 2VRGA 3KO0A 1QATA 4HSZA 3R1PA 2G9BA 2WC6A 1C7WA 3NSIA 3PALA 4PE7A 3TDUA 1GQMA 2K0JA 3NSLA 5K89A 2KDHA 1CDLA 3BFHA 3S0EA 4UPGA 1XVJA 2L5XB 3R1OA 1OMVA 2LANA 4N1GA 2M49B 1A75A 2PQLA 2WCFA 3GOFA 3PM2A 3BFBA 3B87A 2Y1NA 4ORBB 3O2PA 1AJ4A 5JOLA 1B1GA 3FE8A 3IQOA 1OW4A 1B8CA 2LV7A 3CWGA 1J7OA 1BF5A 1F8HA 1OMRA 3BYAA 3D10A 1LKJA 2HETA 2KI6C 3JTDB 5FI2A 1HT9A 1F55A 1R2UA 1F54A 1QX2A 1DF0B 1DTLA 3OHMB 1IJ5A 3PN7B 4QJ5B 2WCJA 1IKUA 3BUWB 3D78A 2LC5A 3IQQA 1UHKA 1WRZA 3RZSA 4PDZA 1WDCB 1OOHA 1BOCA 1WY9A 1J55A 1ZFSA 1DF0A 2KFGA 2KI4B 1AP4A 1NX2A 2CCMA 2BKHB 4A4CA 3DVEA 2L2CA 2A4JA 2Y4QA 3UO9A 1JUOA 1NPQA 3D0YA 2CNPA 2GGMA 1TOPA 2MRDA 1EXRA 1XFYO 1LVCD 3I5FC 2LLTA 4JQ0D 1OOJA 4FQOA 1B47A 1JF0A 1J7PA 4ZCUA 2KBIA 1QWVA 4DS7A 2JXLA 4QJ3B 2FJYA 2JTTA 1CMFA 5KU1A 4HRHA 2KSPA 5AERA 1B8LA 3SG3A 1JBAA 2AAOA 5I2LA 1U5IB 1QTXA 1WRKA 1C07A 5FI7A 3JTDC 1N0YA 3DF0B 3OBVA 3WXAA 4PHKA 4GBAA 1BODA 4PHJA 1DGUA 1J7QA 2G2BA 4WQ3A 1BR1B 1FPWA 3FIAA 1PK0D 1S36A 2JT0A 1J1DA 1PVAA 3I5IC 2KPHA 2P71A 1MR8A 3FWBA 3EKJA 2K61A 2KFHA 1U5IA 4OR9B 2K7DA 3NHIA 3UNWA 1OSAA 1WDCC 4PCWA 3OP0A 5B8IB 1MQ1A 5KSZA 2KI4C 2B1UA 1UP5A 5FYXA 3AKAA 2JTZA 3PLFB 1CTRA 3SS3A 2EHBA 2JNXA 3AAKA 3LLEA 2ERBA 3SG5A 3TS5B 4FQTA 1YVHA 5KTYA 1S5GY 1DJZA 5I2OA 2Q4UA 1J1EA 1L2OB 4MZLA 1SNLA 1SR6B 4I5JA 4BY5A 1S1EA 3O4YA 2COLB 2M3WA 1KFUS 3CS1A 4PHNA 2M9GA 1MWNA 3S0GA 5TNCA 3BUMB 2QACA 2R2IA 1SL9A 1PVBA 5HLVA 3K21A 1K9KA 1UHNA 2CT9A 4GAOA 3PM8A 1C3YA 1KQMB 2LUXA 4DCKA 4YGCB 1C7VA 1YUUA 1NCXA 2QEBA 1SW8A 3CYZA 3KF9A 3DVMA 2KNEA 2WCMA 3D75A 4L9MA 1T14A 1BT6A 1E8AA 3DD4A 1EG4A 3WNXB 2NCPA 2K2AA 1DJWA 1M45A 2F8PA 1G4YR 2I2RE 1GGWA 1XK4C 1OMDA 1CLMA 3DXLA 1DMOA 3CZTX 1QIVA 3CZ0A 2M7LA 1NCYA 4KYNA 1SBJA 3GK1A 1OOFA 4NDDA 2PVBA 3OX5A 2JNFA 3QMEA 4GGFC 5DKRA 3TS5C 3WHTB 4F0ZB 1DQEA 1M63B 1QX5B 1A4PA 2K7BA 4YBHB 1TNXA 2I18A 2K60A 1CDPA 1C3ZA 1SPYA 1L2OC 2BE6A 3EVRA 4XYNA 1UWOA 1KSMA 1SR6C 4N1FA 1AUIB 2KLDA 3CZ2A 3SG7A 3PFVA 2HQ8A 2M1KB 3CGAA 4N5XA 5HYDA 1DVIA 1XA5A 2P6BB 1ALWA 1KFXS 1SL8A 1K9UA 2JC2A 3Q8IA 2H61C 3EKHA 1KQMC 3EVUA 3I5FB 2O5GA 1M31A 1UUSA 2OS8B 4MEWA 1UHHA 3VROA 4PT1A 1K90D 5F6TA 2BL0B 3VGOA 2FCDA 3EK8A 5ER5A 3VRRA 1RROA 2WCLA 2WC5A 4XJKB 3V2LA 3CLNA 4QJ4B 2K7OA 1L7ZA 1QJTA 2LMTA 4MZKA 4AQJA 1CLLA 3VRPA 1DGVA 2JT3A 4ZCVA 3MSEB 5G08A 1CM1A 2CBLA 1G8IA 2PYQA 3BUOB 1JF2A 2CTNA 3A8RA 1ORGA 1B7TY 2KAXA 4YI8A 2LHLA 1YRUB 3HX4A 1FF1A 1HQVA 3S0FA 3I5IB 1GJYA 1NP8A 3IF7A 1OOIX 1CDMA 2WC8A 2GGZA 3BQ3A 4OZDA 1S6CA 5D7FA 2QDIA 3EK7A 2FCEA 3SIBA 1B4CA 1RK9A 2M0RA 3NHTA 3TDIA 1TNPA 1S6IA 1TCOB 1PSBA 2WNDA 3R1VA 4USLA 2LLUA 4YGEB 5AFPA 1BG1A 1K2HA 1SL7A 1IG5A 2K8MB 1OOGA 2HF5A 1SMGA 2F3ZA 1DC1A 3BFAA 2GV5A 3O6BA 1CFDA 3NXAA 2OS8C 4P2YB 1IGVA 4JWQA 1BJFA 2ZNEA 3AAJA 1AHRA 2BL0C 2V53A 1V1GA 2F33A 4CLNA 1EL4A 2KHNA 2L4HA 2ZNDA 2LVJA 2NCOA 1FI6A 3O78A 4ORCB 1K9PA 3NSOA 1QVIZ 3DVKA 4GPLB 4DUQA 2LLSA 2PALA 2KAVA 5D69A 2BE4A 1GGZA 2BBNA 3WHUB 2JQ6A 3VRQA 1UHIA 1XFXO 4MN0A 4R1EA 4AQIA 1RWYA 2JU0A 1F71A 1KK7Z 1M39A 1QXPA 1SRAA 1YX8A 1VRKA 2LVVA 1Q80A 1F4QA 2L98A
chains in the Genus database with same CATH topology
2L2EA 2LMVA 4FTGA 2I94A 1MUXA 3DF0A 1CB1A 3OB1B 4M2PA 3CR4X 4DIRA 1AK8A 1N65A 1SY9A 5CSJA 2LP2A 1G33A 2JXCA 3ICBA 3VRNA 1K96A 1YR5A 4MVFA 1SK6D 2JT8A 3LK0A 2KGBC 1XK4A 1BR4B 2JPTA 4NDCA 1CKKA 2L0PA 5CSIA 5CSFA 1B9AA 1CM4A 2M1UA 2OPOA 4A4BA 4HRGA 2FJUB 2HQWA 4GGFA 1TCFA 1WLZA 4TNCA 1D1OA 1KK8B 5GQQC 2BECA 1FBVA 5IBWA 4GGNA 1QX7A 4HREE 2LUCA 1TNQA 2PMYA 1NWDA 1X02A 1Y1UA 1AJ5A 1KK7Y 1CMGA 2ZN8A 4YGAA 5I8NA 1BMOA 5AANA 1KFXL 1KCYA 1ODBA 2KYFA 3BUXB 2JRFA 1EG3A 3LL8B 2MBXA 4PE0A 4CIDA 1NIWA 2AUCA 2WCEA 4GFTA 2WORA 2H61A 1XFUO 2M7NA 1DJIA 4CFRA 4YRUA 1DJYA 1F4OA 3KEVA 1WRLA 1QV0A 4BY4A 1LXFC 4ICBA 1TTXA 3SJSA 3DVJA 3PSRA 2K2FA 3BOWB 4MZJA 3C1VA 1UHJA 4P5OE 5BPJA 4YGBB 2M8UA 1QLSA 1Y1AA 1V1FA 2LNKA 3TDZA 1RJVA 4PE4A 1JFJA 1PALA 1JSAA 1KK8C 1NCZA 1YTZC 1YUSA 2WOSA 1A29A 2Y5IA 3F45A 3GK2A 4YI9A 1CLBA 1QASA 2BBMA 3RM1A 4NDBA 5HKWA 3I5HC 1M46A 4MLWA 1PULA 5AEQA 1TIZA 2D8NA 2ZN9A 3M0WA 2JWWA 2KFFA 5I2QA 2JZIA 1QLKA 4MRYA 2NXQA 1OE9B 1CFCA 1FW4A 1RECA 3FS7A 1IQ5A 1WLMA 1ZUZA 2BCBA 1S26D 3SIAA 1F70A 1CDNA 2F2OA 1QV1A 3CTNA 2ISDA 2BCAA 2LVKA 4PALA 2MJWB 5J3XA 2MAZA 4XJKA 1ZMZA 1MXLC 1SCMB 1KWOC 1MF8B 2KOTA 3TUYB 1NX1A 1EJ3A 3OB2B 4MBEA 4C0LA 5PALA 4GNKB 3JVTB 1DT7B 5HKZA 3SG6A 1CFPA 2WCBA 4M2OA 1K94A 1NSHA 2DOQA 4I5KA 1JC2A 3E3RA 1S6JA 2EC6B 2ZRSA 1DJHA 3OX6A 1YURA 3BXKA 1W7JB 1IWQA 2LVIA 4CFQA 2ZKMX 3GK4X 3D0YB 1OZSA 4GUKA 3NSKA 4C0KA 4YGDB 2KGRA 3EK4A 4MSPA 1W7IB 2NZ0A 1LA0A 1A03A 1FI5A 1KFUL 2HPSA 4WQ2A 4D1EA 4ETOA 5ER4X 1UURA 1NX0A 1ZACA 1DJGA 1SCMC 4E68A 3QRXA 1J7RA 3TZ1A 3TUYC 2IS9A 4DRWA 1S5GZ 2KI6D 2L4IA 2MHHA 3BUNB 1NX3A 3FWCA 3JVTC 4ORAB 1XYDA 2O60A 3RLZA 3ZNIA 1QS7A 3CR2A 1S3PA 2EC6C 1CNPA 1PSRA 1H4BA 3PN7C 3SG4A 1DJXA 4AOMA 1TN4A 3ZWHA 1MXEA 4OKHA 2OTGB 1QVIY 1XFWO 1QIWA 2PSRA 1OZOA 1RFJA 1XFZO 4OV2A 5HLOA 2LCPA 3KPXA 1H8BA 2F2PA 2NLNA 1XFVO 1BU3A 1Y0VH 2TN4A 2QPTA 2PRUA 4OCIA 2E30A 4NQGA 3I5GB 3I5HB 4U8DA 1SCVA 3PATA 4C0JA 2KYCA 1CFFA 2H2KA 2KBMA 2Q91A 1OQPA 1ALVA 2L51A 2L50A 2EGDA 1NYAA 1IJ6A 2AMIA 3H4SE 2LP3A 2JULA 1ZOTB 3CR5X 1IH0A 1LA3A 5DKQA 4CPVA 1EH2A 1Y1XA 2LE9B 5DKNA 4Q04A 4MRXA 2KQYA 3KHEA 3EVVA 2JOJA 2LM5A 1KQVA 2BCXA 1YVLA 1R6PA 1YUTA 2BKIB 4PE1A 1KWOB 1IQ3A 2MA2A 3HCMA 4OVNF 2ZFDA 4I5NB 2M29A 1RTP1 4IL1A 1AVSA 2KAYA 1K8UA 1TNWA 2MLEC 2I7AA 2OTGC 3LK1A 2E6WA 2PASA 4JPZB 4M2QA 1XO5A 1N2DA 2CXJA 2LAPA 5CSNA 3A4UB 2K7CA 1B8RA 1JWDA 1K93D 4I5LB 2MLFC 4PHMA 3BOWA 1PRWA 2Y1MA 1JFKA 1LINA 1YX7A 2ZRTA 5JJGA 1K95A 4WRIA 1KSOA 1NUBA 2FOTA 1YRTB 5CPVA 1TRFA 3I5GC 2LHIA 1MHOA 2SASA 5AXIA 1B7TZ 2RGIA 1BLQA 1SYMA 2SCPA 5HKYA 2F3YA 2KQ6A 2M97A 3SG2A 2LMUA 1IRJA 1Y6WA 1A75B 3LCPC 1SKTA 3AKBA 1A2XA 2VRGA 3KO0A 1QATA 4HSZA 2G9BA 1C7WA 3NSIA 3PALA 4PE7A 3TDUA 1GQMA 2K0JA 3NSLA 5K89A 2KDHA 1CDLA 4UPGA 1XVJA 2L5XB 1OMVA 2LANA 4N1GA 2M49B 1A75A 2WCFA 3GOFA 2Y1NA 4ORBB 3O2PA 1AJ4A 5JOLA 1B1GA 3IQOA 1B8CA 2LV7A 3CWGA 1J7OA 1BF5A 1F8HA 1OMRA 3BYAA 3D10A 1LKJA 2HETA 2KI6C 3JTDB 1HT9A 1F55A 1R2UA 1F54A 1QX2A 1DF0B 1DTLA 3OHMB 1IJ5A 3PN7B 4QJ5B 1IKUA 3BUWB 2LC5A 3IQQA 1UHKA 1WRZA 4PDZA 1WDCB 1BOCA 1WY9A 1J55A 1ZFSA 1DF0A 2KFGA 2KI4B 1AP4A 1NX2A 2CCMA 2BKHB 4A4CA 3DVEA 2A4JA 2Y4QA 1JUOA 1NPQA 3D0YA 2CNPA 2GGMA 1TOPA 2MRDA 1EXRA 1XFYO 1LVCD 3I5FC 2LLTA 4JQ0D 1OOJA 4FQOA 1B47A 1JF0A 1J7PA 4ZCUA 2KBIA 4DS7A 2JXLA 4QJ3B 2JTTA 1CMFA 5KU1A 4HRHA 2KSPA 5AERA 1B8LA 3SG3A 1JBAA 2AAOA 5I2LA 1QTXA 1U5IB 1WRKA 1C07A 3JTDC 1N0YA 3DF0B 3WXAA 4PHKA 4GBAA 1BODA 4PHJA 1DGUA 1J7QA 2G2BA 4WQ3A 1BR1B 1FPWA 3FIAA 1PK0D 1S36A 2JT0A 1J1DA 1PVAA 3I5IC 1MR8A 3FWBA 3EKJA 2K61A 2KFHA 1U5IA 4OR9B 2K7DA 1OSAA 1WDCC 4PCWA 3OP0A 5B8IB 1MQ1A 5KSZA 2KI4C 2B1UA 1UP5A 5FYXA 3AKAA 2JTZA 3PLFB 1CTRA 2EHBA 2JNXA 3AAKA 3LLEA 3SG5A 3TS5B 5KTYA 1YVHA 1S5GY 1DJZA 5I2OA 2Q4UA 1J1EA 1L2OB 4MZLA 1SNLA 1SR6B 4I5JA 4BY5A 1S1EA 3O4YA 2COLB 2M3WA 1KFUS 3CS1A 4PHNA 2M9GA 1MWNA 5TNCA 3BUMB 2QACA 2R2IA 1SL9A 1PVBA 5HLVA 3K21A 2CT9A 1K9KA 1UHNA 4GAOA 3PM8A 1KQMB 2LUXA 4DCKA 4YGCB 1C7VA 1YUUA 1NCXA 1SW8A 3KF9A 3DVMA 2KNEA 4L9MA 1BT6A 1E8AA 3DD4A 1EG4A 3WNXB 2NCPA 2K2AA 1DJWA 1M45A 2F8PA 1G4YR 2I2RE 1GGWA 1XK4C 1OMDA 1CLMA 1DMOA 3CZTX 1QIVA 2M7LA 1NCYA 1SBJA 3GK1A 4NDDA 2PVBA 3OX5A 2JNFA 3TS5C 4GGFC 5DKRA 3WHTB 4F0ZB 1M63B 1QX5B 1A4PA 2K7BA 4YBHB 1TNXA 2I18A 3EVRA 1CDPA 4XYNA 1SPYA 1L2OC 2BE6A 1UWOA 1KSMA 1SR6C 4N1FA 1AUIB 3SG7A 3PFVA 2HQ8A 2M1KB 3CGAA 4N5XA 5HYDA 1DVIA 1XA5A 2P6BB 1ALWA 1KFXS 1SL8A 1K9UA 2JC2A 2H61C 3EKHA 1KQMC 3EVUA 3I5FB 2O5GA 1M31A 1UUSA 2OS8B 4MEWA 1UHHA 3VROA 1K90D 5F6TA 2BL0B 3VGOA 2FCDA 3EK8A 5ER5A 3VRRA 1RROA 4XJKB 4QJ4B 3CLNA 2K7OA 1L7ZA 1QJTA 2LMTA 4MZKA 4AQJA 1CLLA 3VRPA 1DGVA 2JT3A 4ZCVA 3MSEB 5G08A 1CM1A 2CBLA 1G8IA 3BUOB 1JF2A 2CTNA 3A8RA 1B7TY 2KAXA 4YI8A 2LHLA 1YRUB 3HX4A 1FF1A 1HQVA 3I5IB 1GJYA 1NP8A 3IF7A 2WC8A 1CDMA 2GGZA 3BQ3A 1S6CA 5D7FA 3EK7A 2FCEA 3SIBA 1B4CA 1RK9A 2M0RA 3TDIA 1TNPA 1S6IA 1TCOB 1PSBA 2WNDA 4USLA 4YGEB 2LLUA 5AFPA 1BG1A 1K2HA 1SL7A 1IG5A 2K8MB 2HF5A 1SMGA 2F3ZA 2GV5A 3O6BA 1CFDA 3NXAA 2OS8C 4P2YB 1IGVA 4JWQA 1BJFA 2ZNEA 3AAJA 1AHRA 2BL0C 2V53A 1V1GA 2F33A 4CLNA 1EL4A 2KHNA 2L4HA 2ZNDA 2LVJA 2NCOA 1FI6A 3O78A 4ORCB 1K9PA 3NSOA 1QVIZ 3DVKA 4GPLB 4DUQA 2LLSA 2PALA 2KAVA 5D69A 2BE4A 1GGZA 2BBNA 3WHUB 2JQ6A 3VRQA 1UHIA 1XFXO 4MN0A 4R1EA 4AQIA 1RWYA 2JU0A 1F71A 1KK7Z 1M39A 1QXPA 1SRAA 1YX8A 1VRKA 2LVVA 1Q80A 1F4QA 2L98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2E A;  2LMV A;  4FTG A;  2I94 A;  1MUX A;  3DF0 A;  1CB1 A;  3OB1 B;  4M2P A;  3CR4 X;  4DIR A;  1AK8 A;  1N65 A;  1SY9 A;  5CSJ A;  2LP2 A;  1G33 A;  2JXC A;  3ICB A;  3VRN A;  1K96 A;  1YR5 A;  4MVF A;  1SK6 D;  2JT8 A;  3LK0 A;  2KGB C;  1XK4 A;  1BR4 B;  2JPT A;  4NDC A;  1CKK A;  2L0P A;  5CSI A;  5CSF A;  1B9A A;  1CM4 A;  2M1U A;  2OPO A;  4A4B A;  4HRG A;  2FJU B;  2HQW A;  4GGF A;  1TCF A;  1WLZ A;  4TNC A;  1D1O A;  1KK8 B;  5GQQ C;  2BEC A;  1FBV A;  5IBW A;  4GGN A;  1QX7 A;  4HRE E;  2LUC A;  1TNQ A;  2PMY A;  1NWD A;  1X02 A;  1Y1U A;  1AJ5 A;  1KK7 Y;  1CMG A;  2ZN8 A;  4YGA A;  5I8N A;  1BMO A;  5AAN A;  1KFX L;  1KCY A;  1ODB A;  2KYF A;  3BUX B;  2JRF A;  1EG3 A;  3LL8 B;  2MBX A;  4PE0 A;  4CID A;  1NIW A;  2AUC A;  2WCE A;  4GFT A;  2WOR A;  2H61 A;  1XFU O;  2M7N A;  1DJI A;  4CFR A;  4YRU A;  1DJY A;  1F4O A;  3KEV A;  1WRL A;  1QV0 A;  4BY4 A;  1LXF C;  4ICB A;  1TTX A;  3SJS A;  3DVJ A;  3PSR A;  2K2F A;  3BOW B;  4MZJ A;  3C1V A;  1UHJ A;  4P5O E;  5BPJ A;  4YGB B;  2M8U A;  1QLS A;  1Y1A A;  1V1F A;  2LNK A;  3TDZ A;  1RJV A;  4PE4 A;  1JFJ A;  1PAL A;  1JSA A;  1KK8 C;  1NCZ A;  1YTZ C;  1YUS A;  2WOS A;  1A29 A;  2Y5I A;  3F45 A;  3GK2 A;  4YI9 A;  1CLB A;  1QAS A;  2BBM A;  3RM1 A;  4NDB A;  5HKW A;  3I5H C;  1M46 A;  4MLW A;  1PUL A;  5AEQ A;  1TIZ A;  2D8N A;  2ZN9 A;  3M0W A;  2JWW A;  2KFF A;  5I2Q A;  2JZI A;  1QLK A;  4MRY A;  2NXQ A;  1OE9 B;  1CFC A;  1FW4 A;  1REC A;  3FS7 A;  1IQ5 A;  1WLM A;  1ZUZ A;  2BCB A;  1S26 D;  3SIA A;  1F70 A;  1CDN A;  2F2O A;  1QV1 A;  3CTN A;  2ISD A;  2BCA A;  2LVK A;  4PAL A;  2MJW B;  5J3X A;  2MAZ A;  4XJK A;  1ZMZ A;  1MXL C;  1SCM B;  1KWO C;  1MF8 B;  2KOT A;  3TUY B;  1NX1 A;  1EJ3 A;  3OB2 B;  4MBE A;  4C0L A;  5PAL A;  4GNK B;  3JVT B;  1DT7 B;  5HKZ A;  3SG6 A;  1CFP A;  2WCB A;  4M2O A;  1K94 A;  1NSH A;  2DOQ A;  4I5K A;  1JC2 A;  3E3R A;  1S6J A;  2EC6 B;  2ZRS A;  1DJH A;  3OX6 A;  1YUR A;  3BXK A;  1W7J B;  1IWQ A;  2LVI A;  4CFQ A;  2ZKM X;  3GK4 X;  3D0Y B;  1OZS A;  4GUK A;  3NSK A;  4C0K A;  4YGD B;  2KGR A;  3EK4 A;  4MSP A;  1W7I B;  2NZ0 A;  1LA0 A;  1A03 A;  1FI5 A;  1KFU L;  2HPS A;  4WQ2 A;  4D1E A;  4ETO A;  5ER4 X;  1UUR A;  1NX0 A;  1ZAC A;  1DJG A;  1SCM C;  4E68 A;  3QRX A;  1J7R A;  3TZ1 A;  3TUY C;  2IS9 A;  4DRW A;  1S5G Z;  2KI6 D;  2L4I A;  2MHH A;  3BUN B;  1NX3 A;  3FWC A;  3JVT C;  4ORA B;  1XYD A;  2O60 A;  3RLZ A;  3ZNI A;  1QS7 A;  3CR2 A;  1S3P A;  2EC6 C;  1CNP A;  1PSR A;  1H4B A;  3PN7 C;  3SG4 A;  1DJX A;  4AOM A;  1TN4 A;  3ZWH A;  1MXE A;  4OKH A;  2OTG B;  1QVI Y;  1XFW O;  1QIW A;  2PSR A;  1OZO A;  1RFJ A;  1XFZ O;  4OV2 A;  5HLO A;  2LCP A;  3KPX A;  1H8B A;  2F2P A;  2NLN A;  1XFV O;  1BU3 A;  1Y0V H;  2TN4 A;  2QPT A;  2PRU A;  4OCI A;  2E30 A;  4NQG A;  3I5G B;  3I5H B;  4U8D A;  1SCV A;  3PAT A;  4C0J A;  2KYC A;  1CFF A;  2H2K A;  2KBM A;  2Q91 A;  1OQP A;  1ALV A;  2L51 A;  2L50 A;  2EGD A;  1NYA A;  1IJ6 A;  2AMI A;  3H4S E;  2LP3 A;  2JUL A;  1ZOT B;  3CR5 X;  1IH0 A;  1LA3 A;  5DKQ A;  4CPV A;  1EH2 A;  1Y1X A;  2LE9 B;  5DKN A;  4Q04 A;  4MRX A;  2KQY A;  3KHE A;  3EVV A;  2JOJ A;  2LM5 A;  1KQV A;  2BCX A;  1YVL A;  1R6P A;  1YUT A;  2BKI B;  4PE1 A;  1KWO B;  1IQ3 A;  2MA2 A;  3HCM A;  4OVN F;  2ZFD A;  4I5N B;  2M29 A;  1RTP 1;  4IL1 A;  1AVS A;  2KAY A;  1K8U A;  1TNW A;  2MLE C;  2I7A A;  2OTG C;  3LK1 A;  2E6W A;  2PAS A;  4JPZ B;  4M2Q A;  1XO5 A;  1N2D A;  2CXJ A;  2LAP A;  5CSN A;  3A4U B;  2K7C A;  1B8R A;  1JWD A;  1K93 D;  4I5L B;  2MLF C;  4PHM A;  3BOW A;  1PRW A;  2Y1M A;  1JFK A;  1LIN A;  1YX7 A;  2ZRT A;  5JJG A;  1K95 A;  4WRI A;  1KSO A;  1NUB A;  2FOT A;  1YRT B;  5CPV A;  1TRF A;  3I5G C;  2LHI A;  1MHO A;  2SAS A;  5AXI A;  1B7T Z;  2RGI A;  1BLQ A;  1SYM A;  2SCP A;  5HKY A;  2F3Y A;  2KQ6 A;  2M97 A;  3SG2 A;  2LMU A;  1IRJ A;  1Y6W A;  1A75 B;  3LCP C;  1SKT A;  3AKB A;  1A2X A;  2VRG A;  3KO0 A;  1QAT A;  4HSZ A;  2G9B A;  1C7W A;  3NSI A;  3PAL A;  4PE7 A;  3TDU A;  1GQM A;  2K0J A;  3NSL A;  5K89 A;  2KDH A;  1CDL A;  4UPG A;  1XVJ A;  2L5X B;  1OMV A;  2LAN A;  4N1G A;  2M49 B;  1A75 A;  2WCF A;  3GOF A;  2Y1N A;  4ORB B;  3O2P A;  1AJ4 A;  5JOL A;  1B1G A;  3IQO A;  1B8C A;  2LV7 A;  3CWG A;  1J7O A;  1BF5 A;  1F8H A;  1OMR A;  3BYA A;  3D10 A;  1LKJ A;  2HET A;  2KI6 C;  3JTD B;  1HT9 A;  1F55 A;  1R2U A;  1F54 A;  1QX2 A;  1DF0 B;  1DTL A;  3OHM B;  1IJ5 A;  3PN7 B;  4QJ5 B;  1IKU A;  3BUW B;  2LC5 A;  3IQQ A;  1UHK A;  1WRZ A;  4PDZ A;  1WDC B;  1BOC A;  1WY9 A;  1J55 A;  1ZFS A;  1DF0 A;  2KFG A;  2KI4 B;  1AP4 A;  1NX2 A;  2CCM A;  2BKH B;  4A4C A;  3DVE A;  2A4J A;  2Y4Q A;  1JUO A;  1NPQ A;  3D0Y A;  2CNP A;  2GGM A;  1TOP A;  2MRD A;  1EXR A;  1XFY O;  1LVC D;  3I5F C;  2LLT A;  4JQ0 D;  1OOJ A;  4FQO A;  1B47 A;  1JF0 A;  1J7P A;  4ZCU A;  2KBI A;  4DS7 A;  2JXL A;  4QJ3 B;  2JTT A;  1CMF A;  5KU1 A;  4HRH A;  2KSP A;  5AER A;  1B8L A;  3SG3 A;  1JBA A;  2AAO A;  5I2L A;  1QTX A;  1U5I B;  1WRK A;  1C07 A;  3JTD C;  1N0Y A;  3DF0 B;  3WXA A;  4PHK A;  4GBA A;  1BOD A;  4PHJ A;  1DGU A;  1J7Q A;  2G2B A;  4WQ3 A;  1BR1 B;  1FPW A;  3FIA A;  1PK0 D;  1S36 A;  2JT0 A;  1J1D A;  1PVA A;  3I5I C;  1MR8 A;  3FWB A;  3EKJ A;  2K61 A;  2KFH A;  1U5I A;  4OR9 B;  2K7D A;  1OSA A;  1WDC C;  4PCW A;  3OP0 A;  5B8I B;  1MQ1 A;  5KSZ A;  2KI4 C;  2B1U A;  1UP5 A;  5FYX A;  3AKA A;  2JTZ A;  3PLF B;  1CTR A;  2EHB A;  2JNX A;  3AAK A;  3LLE A;  3SG5 A;  3TS5 B;  5KTY A;  1YVH A;  1S5G Y;  1DJZ A;  5I2O A;  2Q4U A;  1J1E A;  1L2O B;  4MZL A;  1SNL A;  1SR6 B;  4I5J A;  4BY5 A;  1S1E A;  3O4Y A;  2COL B;  2M3W A;  1KFU S;  3CS1 A;  4PHN A;  2M9G A;  1MWN A;  5TNC A;  3BUM B;  2QAC A;  2R2I A;  1SL9 A;  1PVB A;  5HLV A;  3K21 A;  2CT9 A;  1K9K A;  1UHN A;  4GAO A;  3PM8 A;  1KQM B;  2LUX A;  4DCK A;  4YGC B;  1C7V A;  1YUU A;  1NCX A;  1SW8 A;  3KF9 A;  3DVM A;  2KNE A;  4L9M A;  1BT6 A;  1E8A A;  3DD4 A;  1EG4 A;  3WNX B;  2NCP A;  2K2A A;  1DJW A;  1M45 A;  2F8P A;  1G4Y R;  2I2R E;  1GGW A;  1XK4 C;  1OMD A;  1CLM A;  1DMO A;  3CZT X;  1QIV A;  2M7L A;  1NCY A;  1SBJ A;  3GK1 A;  4NDD A;  2PVB A;  3OX5 A;  2JNF A;  3TS5 C;  4GGF C;  5DKR A;  3WHT B;  4F0Z B;  1M63 B;  1QX5 B;  1A4P A;  2K7B A;  4YBH B;  1TNX A;  2I18 A;  3EVR A;  1CDP A;  4XYN A;  1SPY A;  1L2O C;  2BE6 A;  1UWO A;  1KSM A;  1SR6 C;  4N1F A;  1AUI B;  3SG7 A;  3PFV A;  2HQ8 A;  2M1K B;  3CGA A;  4N5X A;  5HYD A;  1DVI A;  1XA5 A;  2P6B B;  1ALW A;  1KFX S;  1SL8 A;  1K9U A;  2JC2 A;  2H61 C;  3EKH A;  1KQM C;  3EVU A;  3I5F B;  2O5G A;  1M31 A;  1UUS A;  2OS8 B;  4MEW A;  1UHH A;  3VRO A;  1K90 D;  5F6T A;  2BL0 B;  3VGO A;  2FCD A;  3EK8 A;  5ER5 A;  3VRR A;  1RRO A;  4XJK B;  4QJ4 B;  3CLN A;  2K7O A;  1L7Z A;  1QJT A;  2LMT A;  4MZK A;  4AQJ A;  1CLL A;  3VRP A;  1DGV A;  2JT3 A;  4ZCV A;  3MSE B;  5G08 A;  1CM1 A;  2CBL A;  1G8I A;  3BUO B;  1JF2 A;  2CTN A;  3A8R A;  1B7T Y;  2KAX A;  4YI8 A;  2LHL A;  1YRU B;  3HX4 A;  1FF1 A;  1HQV A;  3I5I B;  1GJY A;  1NP8 A;  3IF7 A;  2WC8 A;  1CDM A;  2GGZ A;  3BQ3 A;  1S6C A;  5D7F A;  3EK7 A;  2FCE A;  3SIB A;  1B4C A;  1RK9 A;  2M0R A;  3TDI A;  1TNP A;  1S6I A;  1TCO B;  1PSB A;  2WND A;  4USL A;  4YGE B;  2LLU A;  5AFP A;  1BG1 A;  1K2H A;  1SL7 A;  1IG5 A;  2K8M B;  2HF5 A;  1SMG A;  2F3Z A;  2GV5 A;  3O6B A;  1CFD A;  3NXA A;  2OS8 C;  4P2Y B;  1IGV A;  4JWQ A;  1BJF A;  2ZNE A;  3AAJ A;  1AHR A;  2BL0 C;  2V53 A;  1V1G A;  2F33 A;  4CLN A;  1EL4 A;  2KHN A;  2L4H A;  2ZND A;  2LVJ A;  2NCO A;  1FI6 A;  3O78 A;  4ORC B;  1K9P A;  3NSO A;  1QVI Z;  3DVK A;  4GPL B;  4DUQ A;  2LLS A;  2PAL A;  2KAV A;  5D69 A;  2BE4 A;  1GGZ A;  2BBN A;  3WHU B;  2JQ6 A;  3VRQ A;  1UHI A;  1XFX O;  4MN0 A;  4R1E A;  4AQI A;  1RWY A;  2JU0 A;  1F71 A;  1KK7 Z;  1M39 A;  1QXP A;  1SRA A;  1YX8 A;  1VRK A;  2LVV A;  1Q80 A;  1F4Q A;  2L98 A; 
#chains in the Genus database with same CATH topology
 2L2E A;  2LMV A;  4FTG A;  2I94 A;  1MUX A;  3DF0 A;  1CB1 A;  3OB1 B;  4M2P A;  3CR4 X;  4DIR A;  1AK8 A;  1N65 A;  1SY9 A;  2L5Y A;  5CSJ A;  2LP2 A;  1G33 A;  2JXC A;  3ICB A;  3VRN A;  1K96 A;  1YR5 A;  3BJH A;  4MVF A;  1SK6 D;  3L47 A;  2JT8 A;  3LK0 A;  2KGB C;  1XK4 A;  1BR4 B;  2JPT A;  4NDC A;  1CKK A;  2L0P A;  5CSI A;  5CSF A;  1B9A A;  1CM4 A;  2M1U A;  3EG5 B;  2OPO A;  4A4B A;  4HRG A;  4JKT A;  2FJU B;  2HQW A;  4GGF A;  1TCF A;  1WLZ A;  4TNC A;  1D1O A;  1KK8 B;  5GQQ C;  2BEC A;  1FBV A;  5IBW A;  4GGN A;  1QX7 A;  5FI6 A;  4HRE E;  2LUC A;  1TNQ A;  2PMY A;  1NWD A;  1X02 A;  1Y1U A;  1AJ5 A;  1KK7 Y;  4JD9 A;  1CMG A;  2ZN8 A;  4YGA A;  5I8N A;  1BMO A;  5AAN A;  1KFX L;  1KCY A;  1ODB A;  2KYF A;  2WCH A;  2JRF A;  1EG3 A;  3BUX B;  3LL8 B;  3O4X A;  2MBX A;  3VB1 A;  4PE0 A;  4CID A;  1NIW A;  2AUC A;  2WCE A;  3N7H A;  2WOR A;  4GFT A;  1P28 A;  2H61 A;  1XFU O;  3B88 A;  2M7N A;  1DJI A;  4CFR A;  3L4L A;  1DJY A;  4YRU A;  1F4O A;  3KEV A;  1WRL A;  1DEL A;  1QV0 A;  4BY4 A;  1LXF C;  4ICB A;  1TTX A;  3SJS A;  3DVJ A;  3PSR A;  2WCK A;  2K2F A;  3BOW B;  4MZJ A;  3C1V A;  1UHJ A;  2H8V A;  4P5O E;  1Z2C B;  5BPJ A;  4YGB B;  2M8U A;  4F7F A;  1QLS A;  1Y1A A;  3CAB A;  1V1F A;  2LNK A;  2P70 A;  3TDZ A;  3D77 A;  1RJV A;  4PE4 A;  1JFJ A;  1PAL A;  1XFR A;  3SS5 A;  1JSA A;  1KK8 C;  1NCZ A;  1YTZ C;  1YUS A;  2WOS A;  1A29 A;  2Y5I A;  3F45 A;  3GK2 A;  2KLE A;  4YI9 A;  1CLB A;  1QAS A;  2BBM A;  3RM1 A;  4NDB A;  5HKW A;  3I5H C;  1M46 A;  4MLW A;  1PUL A;  5AEQ A;  1TIZ A;  2D8N A;  2ZN9 A;  3M0W A;  2JWW A;  2KFF A;  5I2Q A;  2JZI A;  1QLK A;  4MRY A;  2NXQ A;  1OE9 B;  3S0B A;  1CFC A;  1FW4 A;  4INW A;  1REC A;  3FS7 A;  1IQ5 A;  1WLM A;  1ZUZ A;  2BCB A;  1S26 D;  3SIA A;  1F70 A;  1CDN A;  2F2O A;  1QV1 A;  3CTN A;  2ISD A;  2BCA A;  2LVK A;  4PAL A;  2MJW B;  5J3X A;  2MAZ A;  4XJK A;  1ZMZ A;  1MXL C;  3IVT A;  1SCM B;  3NGV A;  1KWO C;  1MF8 B;  2KOT A;  4INX A;  3TUY B;  3K1E A;  1NX1 A;  1EJ3 A;  3OB2 B;  4MBE A;  4C0L A;  3R72 A;  5PAL A;  3FE9 A;  4GNK B;  3JVT B;  1DT7 B;  5HKZ A;  3SG6 A;  1CFP A;  2WCB A;  4M2O A;  1K94 A;  1NSH A;  2DOQ A;  4I5K A;  1JC2 A;  3E3R A;  3S0A A;  1S6J A;  3SS4 A;  2EC6 B;  2ZRS A;  1DJH A;  3OX6 A;  1YUR A;  3BXK A;  1W7J B;  1IWQ A;  2QEO A;  2LVI A;  4CFQ A;  2ZKM X;  3GK4 X;  3D0Y B;  5HL1 A;  1OZS A;  3B86 A;  3NSK A;  3DYE A;  4GUK A;  4YGD B;  2KGR A;  4C0K A;  1TUJ A;  3EK4 A;  2JPO A;  4MSP A;  1W7I B;  3FE6 A;  2NZ0 A;  2BNX A;  1LA0 A;  1A03 A;  1FI5 A;  1KFU L;  2HPS A;  4WQ2 A;  4D1E A;  4ETO A;  1LS8 A;  5ER4 X;  1UUR A;  1NX0 A;  1ZAC A;  1DJG A;  1SCM C;  4E68 A;  3QRX A;  1J7R A;  3S0D A;  3TZ1 A;  3TUY C;  1IIO A;  2IS9 A;  4DRW A;  4IJ7 A;  1S5G Z;  2KI6 D;  2L4I A;  2MHH A;  2YGU A;  3BUN B;  1NX3 A;  3FWC A;  3JVT C;  4ORA B;  1XYD A;  2O60 A;  3RLZ A;  1TWO A;  1QS7 A;  3ZNI A;  3CR2 A;  1S3P A;  2QEH A;  2EC6 C;  1CNP A;  1PSR A;  1H4B A;  3OGN A;  3DY9 A;  3PN7 C;  1Z4H A;  1DJX A;  3SG4 A;  4AOM A;  1TN4 A;  3ZWH A;  1MXE A;  3D76 A;  4OKH A;  2OTG B;  1QVI Y;  1XFW O;  1QIW A;  5EL2 A;  2PSR A;  1OZO A;  1RFJ A;  1XFZ O;  2QEV A;  4OV2 A;  5HLO A;  1GM0 A;  2LCP A;  3KPX A;  1H8B A;  2F2P A;  2NLN A;  1XFV O;  1BU3 A;  1Y0V H;  2TN4 A;  2QPT A;  2PRU A;  4OCI A;  2E30 A;  4NQG A;  3I5G B;  3I5H B;  4U8D A;  1SCV A;  3PAT A;  4C0J A;  2KYC A;  1CFF A;  3B7A A;  1W9Z A;  2H2K A;  5I94 A;  2KBM A;  2Q91 A;  1OQP A;  1ALV A;  3DZT A;  2L51 A;  2L50 A;  2EGD A;  1NYA A;  1IJ6 A;  2AMI A;  3H4S E;  2LP3 A;  2JUL A;  1ZOT B;  3CR5 X;  1IH0 A;  1TUZ A;  1LA3 A;  5DKQ A;  2GTE A;  4CPV A;  1EH2 A;  1Y1X A;  2LE9 B;  5DKN A;  4Q04 A;  4MRX A;  2KQY A;  3KHE A;  3EVV A;  2JOJ A;  2LM5 A;  1KQV A;  2BCX A;  1YVL A;  1R6P A;  1YUT A;  2BKI B;  4PE1 A;  1KWO B;  1IQ3 A;  2MA2 A;  3HCM A;  4OVN F;  3CZ1 A;  3D73 A;  3PJI A;  2ZFD A;  2BAP A;  4I5N B;  2M29 A;  1RTP 1;  4IL1 A;  1AVS A;  2KAY A;  1K8U A;  1TNW A;  2MLE C;  2I7A A;  2OTG C;  3LK1 A;  2E6W A;  2PAS A;  3CDN A;  4JPZ B;  1XO5 A;  1N2D A;  2CXJ A;  2LAP A;  4M2Q A;  3A4U B;  2K7C A;  5CSN A;  1B8R A;  1JWD A;  1K93 D;  4I5L B;  2MLF C;  4PHM A;  3BOW A;  5D3O A;  1PRW A;  2Y1M A;  1JFK A;  1LIN A;  1YX7 A;  2ZRT A;  5JJG A;  1K95 A;  5DIC A;  4WRI A;  1KSO A;  1NUB A;  2FOT A;  1YRT B;  5CPV A;  3L4A A;  1TRF A;  3I5G C;  3B6X A;  2LHI A;  1DEK A;  1MHO A;  2SAS A;  5AXI A;  1B7T Z;  3D74 A;  2RGI A;  1BLQ A;  1SYM A;  2SCP A;  5HKY A;  2F3Y A;  2KQ6 A;  2M97 A;  3SG2 A;  2LMU A;  1IRJ A;  1Y6W A;  1A75 B;  3LCP C;  1SSE B;  1SKT A;  3AKB A;  1A2X A;  2VRG A;  3KO0 A;  1QAT A;  4HSZ A;  3R1P A;  2G9B A;  2WC6 A;  1C7W A;  3NSI A;  3PAL A;  4PE7 A;  3TDU A;  1GQM A;  2K0J A;  3NSL A;  5K89 A;  2KDH A;  1CDL A;  3BFH A;  3S0E A;  4UPG A;  1XVJ A;  2L5X B;  3R1O A;  1OMV A;  2LAN A;  4N1G A;  2M49 B;  1A75 A;  2PQL A;  2WCF A;  3GOF A;  3PM2 A;  3BFB A;  3B87 A;  2Y1N A;  4ORB B;  3O2P A;  1AJ4 A;  5JOL A;  1B1G A;  3FE8 A;  3IQO A;  1OW4 A;  1B8C A;  2LV7 A;  3CWG A;  1J7O A;  1BF5 A;  1F8H A;  1OMR A;  3BYA A;  3D10 A;  1LKJ A;  2HET A;  2KI6 C;  3JTD B;  5FI2 A;  1HT9 A;  1F55 A;  1R2U A;  1F54 A;  1QX2 A;  1DF0 B;  1DTL A;  3OHM B;  1IJ5 A;  3PN7 B;  4QJ5 B;  2WCJ A;  1IKU A;  3BUW B;  3D78 A;  2LC5 A;  3IQQ A;  1UHK A;  1WRZ A;  3RZS A;  4PDZ A;  1WDC B;  1OOH A;  1BOC A;  1WY9 A;  1J55 A;  1ZFS A;  1DF0 A;  2KFG A;  2KI4 B;  1AP4 A;  1NX2 A;  2CCM A;  2BKH B;  4A4C A;  3DVE A;  2L2C A;  2A4J A;  2Y4Q A;  3UO9 A;  1JUO A;  1NPQ A;  3D0Y A;  2CNP A;  2GGM A;  1TOP A;  2MRD A;  1EXR A;  1XFY O;  1LVC D;  3I5F C;  2LLT A;  4JQ0 D;  1OOJ A;  4FQO A;  1B47 A;  1JF0 A;  1J7P A;  4ZCU A;  2KBI A;  1QWV A;  4DS7 A;  2JXL A;  4QJ3 B;  2FJY A;  2JTT A;  1CMF A;  5KU1 A;  4HRH A;  2KSP A;  5AER A;  1B8L A;  3SG3 A;  1JBA A;  2AAO A;  5I2L A;  1U5I B;  1QTX A;  1WRK A;  1C07 A;  5FI7 A;  3JTD C;  1N0Y A;  3DF0 B;  3OBV A;  3WXA A;  4PHK A;  4GBA A;  1BOD A;  4PHJ A;  1DGU A;  1J7Q A;  2G2B A;  4WQ3 A;  1BR1 B;  1FPW A;  3FIA A;  1PK0 D;  1S36 A;  2JT0 A;  1J1D A;  1PVA A;  3I5I C;  2KPH A;  2P71 A;  1MR8 A;  3FWB A;  3EKJ A;  2K61 A;  2KFH A;  1U5I A;  4OR9 B;  2K7D A;  3NHI A;  3UNW A;  1OSA A;  1WDC C;  4PCW A;  3OP0 A;  5B8I B;  1MQ1 A;  5KSZ A;  2KI4 C;  2B1U A;  1UP5 A;  5FYX A;  3AKA A;  2JTZ A;  3PLF B;  1CTR A;  3SS3 A;  2EHB A;  2JNX A;  3AAK A;  3LLE A;  2ERB A;  3SG5 A;  3TS5 B;  4FQT A;  1YVH A;  5KTY A;  1S5G Y;  1DJZ A;  5I2O A;  2Q4U A;  1J1E A;  1L2O B;  4MZL A;  1SNL A;  1SR6 B;  4I5J A;  4BY5 A;  1S1E A;  3O4Y A;  2COL B;  2M3W A;  1KFU S;  3CS1 A;  4PHN A;  2M9G A;  1MWN A;  3S0G A;  5TNC A;  3BUM B;  2QAC A;  2R2I A;  1SL9 A;  1PVB A;  5HLV A;  3K21 A;  1K9K A;  1UHN A;  2CT9 A;  4GAO A;  3PM8 A;  1C3Y A;  1KQM B;  2LUX A;  4DCK A;  4YGC B;  1C7V A;  1YUU A;  1NCX A;  2QEB A;  1SW8 A;  3CYZ A;  3KF9 A;  3DVM A;  2KNE A;  2WCM A;  3D75 A;  4L9M A;  1T14 A;  1BT6 A;  1E8A A;  3DD4 A;  1EG4 A;  3WNX B;  2NCP A;  2K2A A;  1DJW A;  1M45 A;  2F8P A;  1G4Y R;  2I2R E;  1GGW A;  1XK4 C;  1OMD A;  1CLM A;  3DXL A;  1DMO A;  3CZT X;  1QIV A;  3CZ0 A;  2M7L A;  1NCY A;  4KYN A;  1SBJ A;  3GK1 A;  1OOF A;  4NDD A;  2PVB A;  3OX5 A;  2JNF A;  3QME A;  4GGF C;  5DKR A;  3TS5 C;  3WHT B;  4F0Z B;  1DQE A;  1M63 B;  1QX5 B;  1A4P A;  2K7B A;  4YBH B;  1TNX A;  2I18 A;  2K60 A;  1CDP A;  1C3Z A;  1SPY A;  1L2O C;  2BE6 A;  3EVR A;  4XYN A;  1UWO A;  1KSM A;  1SR6 C;  4N1F A;  1AUI B;  2KLD A;  3CZ2 A;  3SG7 A;  3PFV A;  2HQ8 A;  2M1K B;  3CGA A;  4N5X A;  5HYD A;  1DVI A;  1XA5 A;  2P6B B;  1ALW A;  1KFX S;  1SL8 A;  1K9U A;  2JC2 A;  3Q8I A;  2H61 C;  3EKH A;  1KQM C;  3EVU A;  3I5F B;  2O5G A;  1M31 A;  1UUS A;  2OS8 B;  4MEW A;  1UHH A;  3VRO A;  4PT1 A;  1K90 D;  5F6T A;  2BL0 B;  3VGO A;  2FCD A;  3EK8 A;  5ER5 A;  3VRR A;  1RRO A;  2WCL A;  2WC5 A;  4XJK B;  3V2L A;  3CLN A;  4QJ4 B;  2K7O A;  1L7Z A;  1QJT A;  2LMT A;  4MZK A;  4AQJ A;  1CLL A;  3VRP A;  1DGV A;  2JT3 A;  4ZCV A;  3MSE B;  5G08 A;  1CM1 A;  2CBL A;  1G8I A;  2PYQ A;  3BUO B;  1JF2 A;  2CTN A;  3A8R A;  1ORG A;  1B7T Y;  2KAX A;  4YI8 A;  2LHL A;  1YRU B;  3HX4 A;  1FF1 A;  1HQV A;  3S0F A;  3I5I B;  1GJY A;  1NP8 A;  3IF7 A;  1OOI X;  1CDM A;  2WC8 A;  2GGZ A;  3BQ3 A;  4OZD A;  1S6C A;  5D7F A;  2QDI A;  3EK7 A;  2FCE A;  3SIB A;  1B4C A;  1RK9 A;  2M0R A;  3NHT A;  3TDI A;  1TNP A;  1S6I A;  1TCO B;  1PSB A;  2WND A;  3R1V A;  4USL A;  2LLU A;  4YGE B;  5AFP A;  1BG1 A;  1K2H A;  1SL7 A;  1IG5 A;  2K8M B;  1OOG A;  2HF5 A;  1SMG A;  2F3Z A;  1DC1 A;  3BFA A;  2GV5 A;  3O6B A;  1CFD A;  3NXA A;  2OS8 C;  4P2Y B;  1IGV A;  4JWQ A;  1BJF A;  2ZNE A;  3AAJ A;  1AHR A;  2BL0 C;  2V53 A;  1V1G A;  2F33 A;  4CLN A;  1EL4 A;  2KHN A;  2L4H A;  2ZND A;  2LVJ A;  2NCO A;  1FI6 A;  3O78 A;  4ORC B;  1K9P A;  3NSO A;  1QVI Z;  3DVK A;  4GPL B;  4DUQ A;  2LLS A;  2PAL A;  2KAV A;  5D69 A;  2BE4 A;  1GGZ A;  2BBN A;  3WHU B;  2JQ6 A;  3VRQ A;  1UHI A;  1XFX O;  4MN0 A;  4R1E A;  4AQI A;  1RWY A;  2JU0 A;  1F71 A;  1KK7 Z;  1M39 A;  1QXP A;  1SRA A;  1YX8 A;  1VRK A;  2LVV A;  1Q80 A;  1F4Q A;  2L98 A; 
#chains in the Genus database with same CATH homology
 2L2E A;  2LMV A;  4FTG A;  2I94 A;  1MUX A;  3DF0 A;  1CB1 A;  3OB1 B;  4M2P A;  3CR4 X;  4DIR A;  1AK8 A;  1N65 A;  1SY9 A;  5CSJ A;  2LP2 A;  1G33 A;  2JXC A;  3ICB A;  3VRN A;  1K96 A;  1YR5 A;  4MVF A;  1SK6 D;  2JT8 A;  3LK0 A;  2KGB C;  1XK4 A;  1BR4 B;  2JPT A;  4NDC A;  1CKK A;  2L0P A;  5CSI A;  5CSF A;  1B9A A;  1CM4 A;  2M1U A;  2OPO A;  4A4B A;  4HRG A;  2FJU B;  2HQW A;  4GGF A;  1TCF A;  1WLZ A;  4TNC A;  1D1O A;  1KK8 B;  5GQQ C;  2BEC A;  1FBV A;  5IBW A;  4GGN A;  1QX7 A;  4HRE E;  2LUC A;  1TNQ A;  2PMY A;  1NWD A;  1X02 A;  1Y1U A;  1AJ5 A;  1KK7 Y;  1CMG A;  2ZN8 A;  4YGA A;  5I8N A;  1BMO A;  5AAN A;  1KFX L;  1KCY A;  1ODB A;  2KYF A;  3BUX B;  2JRF A;  1EG3 A;  3LL8 B;  2MBX A;  4PE0 A;  4CID A;  1NIW A;  2AUC A;  2WCE A;  4GFT A;  2WOR A;  2H61 A;  1XFU O;  2M7N A;  1DJI A;  4CFR A;  4YRU A;  1DJY A;  1F4O A;  3KEV A;  1WRL A;  1QV0 A;  4BY4 A;  1LXF C;  4ICB A;  1TTX A;  3SJS A;  3DVJ A;  3PSR A;  2K2F A;  3BOW B;  4MZJ A;  3C1V A;  1UHJ A;  4P5O E;  5BPJ A;  4YGB B;  2M8U A;  1QLS A;  1Y1A A;  1V1F A;  2LNK A;  3TDZ A;  1RJV A;  4PE4 A;  1JFJ A;  1PAL A;  1JSA A;  1KK8 C;  1NCZ A;  1YTZ C;  1YUS A;  2WOS A;  1A29 A;  2Y5I A;  3F45 A;  3GK2 A;  4YI9 A;  1CLB A;  1QAS A;  2BBM A;  3RM1 A;  4NDB A;  5HKW A;  3I5H C;  1M46 A;  4MLW A;  1PUL A;  5AEQ A;  1TIZ A;  2D8N A;  2ZN9 A;  3M0W A;  2JWW A;  2KFF A;  5I2Q A;  2JZI A;  1QLK A;  4MRY A;  2NXQ A;  1OE9 B;  1CFC A;  1FW4 A;  1REC A;  3FS7 A;  1IQ5 A;  1WLM A;  1ZUZ A;  2BCB A;  1S26 D;  3SIA A;  1F70 A;  1CDN A;  2F2O A;  1QV1 A;  3CTN A;  2ISD A;  2BCA A;  2LVK A;  4PAL A;  2MJW B;  5J3X A;  2MAZ A;  4XJK A;  1ZMZ A;  1MXL C;  1SCM B;  1KWO C;  1MF8 B;  2KOT A;  3TUY B;  1NX1 A;  1EJ3 A;  3OB2 B;  4MBE A;  4C0L A;  5PAL A;  4GNK B;  3JVT B;  1DT7 B;  5HKZ A;  3SG6 A;  1CFP A;  2WCB A;  4M2O A;  1K94 A;  1NSH A;  2DOQ A;  4I5K A;  1JC2 A;  3E3R A;  1S6J A;  2EC6 B;  2ZRS A;  1DJH A;  3OX6 A;  1YUR A;  3BXK A;  1W7J B;  1IWQ A;  2LVI A;  4CFQ A;  2ZKM X;  3GK4 X;  3D0Y B;  1OZS A;  4GUK A;  3NSK A;  4C0K A;  4YGD B;  2KGR A;  3EK4 A;  4MSP A;  1W7I B;  2NZ0 A;  1LA0 A;  1A03 A;  1FI5 A;  1KFU L;  2HPS A;  4WQ2 A;  4D1E A;  4ETO A;  5ER4 X;  1UUR A;  1NX0 A;  1ZAC A;  1DJG A;  1SCM C;  4E68 A;  3QRX A;  1J7R A;  3TZ1 A;  3TUY C;  2IS9 A;  4DRW A;  1S5G Z;  2KI6 D;  2L4I A;  2MHH A;  3BUN B;  1NX3 A;  3FWC A;  3JVT C;  4ORA B;  1XYD A;  2O60 A;  3RLZ A;  3ZNI A;  1QS7 A;  3CR2 A;  1S3P A;  2EC6 C;  1CNP A;  1PSR A;  1H4B A;  3PN7 C;  3SG4 A;  1DJX A;  4AOM A;  1TN4 A;  3ZWH A;  1MXE A;  4OKH A;  2OTG B;  1QVI Y;  1XFW O;  1QIW A;  2PSR A;  1OZO A;  1RFJ A;  1XFZ O;  4OV2 A;  5HLO A;  2LCP A;  3KPX A;  1H8B A;  2F2P A;  2NLN A;  1XFV O;  1BU3 A;  1Y0V H;  2TN4 A;  2QPT A;  2PRU A;  4OCI A;  2E30 A;  4NQG A;  3I5G B;  3I5H B;  4U8D A;  1SCV A;  3PAT A;  4C0J A;  2KYC A;  1CFF A;  2H2K A;  2KBM A;  2Q91 A;  1OQP A;  1ALV A;  2L51 A;  2L50 A;  2EGD A;  1NYA A;  1IJ6 A;  2AMI A;  3H4S E;  2LP3 A;  2JUL A;  1ZOT B;  3CR5 X;  1IH0 A;  1LA3 A;  5DKQ A;  4CPV A;  1EH2 A;  1Y1X A;  2LE9 B;  5DKN A;  4Q04 A;  4MRX A;  2KQY A;  3KHE A;  3EVV A;  2JOJ A;  2LM5 A;  1KQV A;  2BCX A;  1YVL A;  1R6P A;  1YUT A;  2BKI B;  4PE1 A;  1KWO B;  1IQ3 A;  2MA2 A;  3HCM A;  4OVN F;  2ZFD A;  4I5N B;  2M29 A;  1RTP 1;  4IL1 A;  1AVS A;  2KAY A;  1K8U A;  1TNW A;  2MLE C;  2I7A A;  2OTG C;  3LK1 A;  2E6W A;  2PAS A;  4JPZ B;  4M2Q A;  1XO5 A;  1N2D A;  2CXJ A;  2LAP A;  5CSN A;  3A4U B;  2K7C A;  1B8R A;  1JWD A;  1K93 D;  4I5L B;  2MLF C;  4PHM A;  3BOW A;  1PRW A;  2Y1M A;  1JFK A;  1LIN A;  1YX7 A;  2ZRT A;  5JJG A;  1K95 A;  4WRI A;  1KSO A;  1NUB A;  2FOT A;  1YRT B;  5CPV A;  1TRF A;  3I5G C;  2LHI A;  1MHO A;  2SAS A;  5AXI A;  1B7T Z;  2RGI A;  1BLQ A;  1SYM A;  2SCP A;  5HKY A;  2F3Y A;  2KQ6 A;  2M97 A;  3SG2 A;  2LMU A;  1IRJ A;  1Y6W A;  1A75 B;  3LCP C;  1SKT A;  3AKB A;  1A2X A;  2VRG A;  3KO0 A;  1QAT A;  4HSZ A;  2G9B A;  1C7W A;  3NSI A;  3PAL A;  4PE7 A;  3TDU A;  1GQM A;  2K0J A;  3NSL A;  5K89 A;  2KDH A;  1CDL A;  4UPG A;  1XVJ A;  2L5X B;  1OMV A;  2LAN A;  4N1G A;  2M49 B;  1A75 A;  2WCF A;  3GOF A;  2Y1N A;  4ORB B;  3O2P A;  1AJ4 A;  5JOL A;  1B1G A;  3IQO A;  1B8C A;  2LV7 A;  3CWG A;  1J7O A;  1BF5 A;  1F8H A;  1OMR A;  3BYA A;  3D10 A;  1LKJ A;  2HET A;  2KI6 C;  3JTD B;  1HT9 A;  1F55 A;  1R2U A;  1F54 A;  1QX2 A;  1DF0 B;  1DTL A;  3OHM B;  1IJ5 A;  3PN7 B;  4QJ5 B;  1IKU A;  3BUW B;  2LC5 A;  3IQQ A;  1UHK A;  1WRZ A;  4PDZ A;  1WDC B;  1BOC A;  1WY9 A;  1J55 A;  1ZFS A;  1DF0 A;  2KFG A;  2KI4 B;  1AP4 A;  1NX2 A;  2CCM A;  2BKH B;  4A4C A;  3DVE A;  2A4J A;  2Y4Q A;  1JUO A;  1NPQ A;  3D0Y A;  2CNP A;  2GGM A;  1TOP A;  2MRD A;  1EXR A;  1XFY O;  1LVC D;  3I5F C;  2LLT A;  4JQ0 D;  1OOJ A;  4FQO A;  1B47 A;  1JF0 A;  1J7P A;  4ZCU A;  2KBI A;  4DS7 A;  2JXL A;  4QJ3 B;  2JTT A;  1CMF A;  5KU1 A;  4HRH A;  2KSP A;  5AER A;  1B8L A;  3SG3 A;  1JBA A;  2AAO A;  5I2L A;  1QTX A;  1U5I B;  1WRK A;  1C07 A;  3JTD C;  1N0Y A;  3DF0 B;  3WXA A;  4PHK A;  4GBA A;  1BOD A;  4PHJ A;  1DGU A;  1J7Q A;  2G2B A;  4WQ3 A;  1BR1 B;  1FPW A;  3FIA A;  1PK0 D;  1S36 A;  2JT0 A;  1J1D A;  1PVA A;  3I5I C;  1MR8 A;  3FWB A;  3EKJ A;  2K61 A;  2KFH A;  1U5I A;  4OR9 B;  2K7D A;  1OSA A;  1WDC C;  4PCW A;  3OP0 A;  5B8I B;  1MQ1 A;  5KSZ A;  2KI4 C;  2B1U A;  1UP5 A;  5FYX A;  3AKA A;  2JTZ A;  3PLF B;  1CTR A;  2EHB A;  2JNX A;  3AAK A;  3LLE A;  3SG5 A;  3TS5 B;  5KTY A;  1YVH A;  1S5G Y;  1DJZ A;  5I2O A;  2Q4U A;  1J1E A;  1L2O B;  4MZL A;  1SNL A;  1SR6 B;  4I5J A;  4BY5 A;  1S1E A;  3O4Y A;  2COL B;  2M3W A;  1KFU S;  3CS1 A;  4PHN A;  2M9G A;  1MWN A;  5TNC A;  3BUM B;  2QAC A;  2R2I A;  1SL9 A;  1PVB A;  5HLV A;  3K21 A;  2CT9 A;  1K9K A;  1UHN A;  4GAO A;  3PM8 A;  1KQM B;  2LUX A;  4DCK A;  4YGC B;  1C7V A;  1YUU A;  1NCX A;  1SW8 A;  3KF9 A;  3DVM A;  2KNE A;  4L9M A;  1BT6 A;  1E8A A;  3DD4 A;  1EG4 A;  3WNX B;  2NCP A;  2K2A A;  1DJW A;  1M45 A;  2F8P A;  1G4Y R;  2I2R E;  1GGW A;  1XK4 C;  1OMD A;  1CLM A;  1DMO A;  3CZT X;  1QIV A;  2M7L A;  1NCY A;  1SBJ A;  3GK1 A;  4NDD A;  2PVB A;  3OX5 A;  2JNF A;  3TS5 C;  4GGF C;  5DKR A;  3WHT B;  4F0Z B;  1M63 B;  1QX5 B;  1A4P A;  2K7B A;  4YBH B;  1TNX A;  2I18 A;  3EVR A;  1CDP A;  4XYN A;  1SPY A;  1L2O C;  2BE6 A;  1UWO A;  1KSM A;  1SR6 C;  4N1F A;  1AUI B;  3SG7 A;  3PFV A;  2HQ8 A;  2M1K B;  3CGA A;  4N5X A;  5HYD A;  1DVI A;  1XA5 A;  2P6B B;  1ALW A;  1KFX S;  1SL8 A;  1K9U A;  2JC2 A;  2H61 C;  3EKH A;  1KQM C;  3EVU A;  3I5F B;  2O5G A;  1M31 A;  1UUS A;  2OS8 B;  4MEW A;  1UHH A;  3VRO A;  1K90 D;  5F6T A;  2BL0 B;  3VGO A;  2FCD A;  3EK8 A;  5ER5 A;  3VRR A;  1RRO A;  4XJK B;  4QJ4 B;  3CLN A;  2K7O A;  1L7Z A;  1QJT A;  2LMT A;  4MZK A;  4AQJ A;  1CLL A;  3VRP A;  1DGV A;  2JT3 A;  4ZCV A;  3MSE B;  5G08 A;  1CM1 A;  2CBL A;  1G8I A;  3BUO B;  1JF2 A;  2CTN A;  3A8R A;  1B7T Y;  2KAX A;  4YI8 A;  2LHL A;  1YRU B;  3HX4 A;  1FF1 A;  1HQV A;  3I5I B;  1GJY A;  1NP8 A;  3IF7 A;  2WC8 A;  1CDM A;  2GGZ A;  3BQ3 A;  1S6C A;  5D7F A;  3EK7 A;  2FCE A;  3SIB A;  1B4C A;  1RK9 A;  2M0R A;  3TDI A;  1TNP A;  1S6I A;  1TCO B;  1PSB A;  2WND A;  4USL A;  4YGE B;  2LLU A;  5AFP A;  1BG1 A;  1K2H A;  1SL7 A;  1IG5 A;  2K8M B;  2HF5 A;  1SMG A;  2F3Z A;  2GV5 A;  3O6B A;  1CFD A;  3NXA A;  2OS8 C;  4P2Y B;  1IGV A;  4JWQ A;  1BJF A;  2ZNE A;  3AAJ A;  1AHR A;  2BL0 C;  2V53 A;  1V1G A;  2F33 A;  4CLN A;  1EL4 A;  2KHN A;  2L4H A;  2ZND A;  2LVJ A;  2NCO A;  1FI6 A;  3O78 A;  4ORC B;  1K9P A;  3NSO A;  1QVI Z;  3DVK A;  4GPL B;  4DUQ A;  2LLS A;  2PAL A;  2KAV A;  5D69 A;  2BE4 A;  1GGZ A;  2BBN A;  3WHU B;  2JQ6 A;  3VRQ A;  1UHI A;  1XFX O;  4MN0 A;  4R1E A;  4AQI A;  1RWY A;  2JU0 A;  1F71 A;  1KK7 Z;  1M39 A;  1QXP A;  1SRA A;  1YX8 A;  1VRK A;  2LVV A;  1Q80 A;  1F4Q A;  2L98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...