4HSZA

Structure of truncated (delta8c) s100a4
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
CPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A4
publication title Structure of truncated (delta8C) S100A4
rcsb
source organism Homo sapiens
total genus 33
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hszA00
4OR9B 4YRUA 2KI4B 2LUXA 3AKBA 1J7RA 4M2OA 1A29A 1CLBA 1YUTA 2OTGC 1CB1A 1IRJA 3DVKA 1DF0B 1CFFA 3LK0A 4P5OE 5HLOA 1KK8C 1QXPA 2KAXA 3SG7A 1YTZC 2I94A 1FBVA 1Y1UA 2LMUA 4WQ2A 2KI6C 2BBMA 1G33A 3BQ3A 1V1GA 4JPZB 4R1EA 1RFJA 1KK7Z 3DVJA 4NQGA 2G9BA 2LMTA 4PHMA 2JT3A 2KGRA 1PK0D 1NX0A 2MLEC 2F3ZA 3TUYC 3DD4A 1MXLC 1JSAA 2AAOA 4PHJA 1F4QA 4XYNA 4YGDB 1QLSA 5CSIA 3SIAA 1S6JA 2PSRA 4PE4A 2K7DA 1F4OA 3GK2A 2FCEA 1DGVA 5AERA 4PCWA 1G4YR 1SRAA 2WOSA 1S1EA 1FI5A 1JUOA 5D69A 1NCXA 1NPQA 3VGOA 4NDDA 1AJ5A 1IJ5A 4TNCA 1XFWO 1UWOA 2E6WA 2PRUA 2O5GA 4OV2A 3EK4A 3JTDC 4PE1A 3SJSA 2LLSA 2F33A 2VRGA 1QX7A 5CSNA 1ALWA 2M0RA 2ZN9A 4AOMA 1B8CA 1KWOB 1HQVA 3PFVA 1OE9B 4ICBA 3M0WA 5CSJA 1MXEA 1DJHA 2QACA 1QIWA 4CLNA 3TDUA 1SL9A 2KFGA 3O4YA 4CPVA 3WHTB 3BUOB 2L50A 4AQIA 4E68A 1B7TY 1KQMC 2NCPA 3VROA 2IS9A 2LM5A 1BJFA 1BU3A 3KEVA 2JQ6A 2KAYA 4HRHA 2MBXA 1NP8A 1D1OA 3LLEA 1N0YA 4M2QA 3PN7C 1B8RA 2AUCA 2ZKMX 2BKHB 3O6BA 4YGBB 4OKHA 1GGWA 3BOWA 1SR6B 1XA5A 4C0KA 1BF5A 3KPXA 2JNXA 1FW4A 1TNPA 1K94A 2LANA 1BMOA 1B1GA 1WDCC 1RROA 2EGDA 4PE0A 2SASA 3SG2A 2I2RE 1K93D 1AJ4A 5ER5A 1YURA 1J55A 1LXFC 1BG1A 1QX2A 1WRKA 3IQQA 1FI6A 3SG6A 4QJ3B 1S6IA 1IQ3A 1GJYA 5ER4X 4MZLA 2HF5A 2MAZA 3CR5X 2L4HA 1K90D 3D10A 3LCPC 2JXCA 1EXRA 2KI4C 2V53A 4GUKA 1S26D 1WLZA 3EVRA 3VRQA 3VRPA 2KQ6A 1IQ5A 1SBJA 1UP5A 1QX5B 1H4BA 1LINA 2M1KB 3OX6A 3DVEA 4MVFA 3SG3A 1XFYO 1CTRA 1L2OB 3EVVA 1TTXA 1KSMA 5J3XA 4DIRA 1A75A 1OMVA 2BCXA 3OHMB 2JNFA 1YR5A 1CDMA 2HQWA 5KU1A 2JT8A 2BKIB 1KFXL 1IG5A 4HRGA 1QS7A 4YBHB 2Y5IA 1CDLA 5JOLA 1YUSA 3OP0A 2NZ0A 1QV1A 2MA2A 3ZNIA 1S5GZ 1X02A 2LE9B 1QJTA 2I7AA 4N5XA 1BR1B 4JWQA 3CS1A 3FWCA 1SMGA 1YVHA 2BE6A 4N1GA 1OZOA 2LC5A 3RM1A 2LMVA 5IBWA 1AUIB 4BY4A 3NSKA 1TNXA 4HSZA 1AVSA 3BUWB 3EVUA 1A2XA 1C7VA 1SCMB 1TOPA 3ZWHA 4A4CA 1IH0A 3BXKA 1ZACA 3AAKA 1V1FA 1CFCA 2KOTA 1WY9A 1GQMA 3BYAA 2TN4A 1M39A 1A75B 3EK8A 2DOQA 1K2HA 1KWOC 2ZRTA 4WRIA 1NCYA 4ORCB 5B8IB 4DRWA 1CFDA 2GGMA 4A4BA 1XK4A 2D8NA 2ISDA 1UHJA 1LA3A 4PDZA 1M63B 1NX1A 4DCKA 2LHLA 3E3RA 2LAPA 4QJ5B 1EH2A 1UHHA 1M31A 1NCZA 1XYDA 3MSEB 2FCDA 4MZJA 4Q04A 4PALA 1DTLA 1UHKA 2LV7A 2FJUB 2NXQA 1BT6A 1CM1A 1SR6C 1K9UA 2B1UA 1FF1A 1UUSA 2BECA 1SYMA 1H8BA 1S6CA 4PHKA 3FIAA 1F8HA 2L5XB 2WORA 1DVIA 1YVLA 2LP3A 3I5HB 2PASA 4GPLB 2K2FA 1CFPA 1CDPA 1J1DA 1QV0A 1NSHA 4OCIA 4C0LA 1NX3A 1EL4A 2CCMA 2KNEA 1KSOA 1U5IA 4FTGA 2ZRSA 2M97A 3VRNA 1NWDA 2M7NA 2L98A 1DJYA 1HT9A 3BUXB 1CNPA 1W7IB 1B9AA 2CBLA 1MF8B 2JTZA 1QIVA 1OZSA 2JPTA 2KFFA 3CTNA 1J7OA 1DJIA 5FYXA 4PHNA 2BL0B 3GK1A 1BR4B 1L2OC 5HYDA 5CSFA 1EJ3A 1G8IA 2GV5A 1XO5A 2Y1NA 4GFTA 4MZKA 1KK7Y 1CMGA 3PLFB 2G2BA 1JBAA 1JF0A 3A4UB 5DKNA 1SCVA 2LCPA 1KK8B 1YUUA 2H2KA 1MQ1A 2OS8B 1SPYA 1DJWA 1QLKA 2KFHA 1YX8A 3OB2B 2CXJA 2LVIA 1BOCA 2KAVA 3TDIA 1WRZA 1YRTB 3C1VA 1U5IB 2K61A 3VRRA 2R2IA 1IKUA 1PVAA 2KYCA 1XFXO 3NSLA 3PM8A 1KFUL 2LLUA 2RGIA 1R6PA 3KO0A 3D0YA 1W7JB 4JQ0D 1A03A 1SCMC 4MBEA 2LVVA 5HKZA 2NLNA 2JTTA 4YI8A 1NIWA 1MHOA 1NYAA 5AXIA 1QASA 1QATA 1N2DA 3DVMA 3I5FB 5PALA 1CLLA 1TIZA 3I5GB 3OB1B 2ZN8A 1S36A 4PE7A 1J7QA 4I5NB 5I2QA 1Y6WA 2M1UA 1VRKA 1B8LA 1IWQA 2E30A 2HPSA 4IL1A 2OPOA 2F2OA 2KBIA 2GGZA 1TNWA 5G08A 2M3WA 1J7PA 3TS5B 1A4PA 3EKJA 1DJXA 2K8MB 3PALA 2K7BA 1R2UA 3CR2A 4P2YB 3GOFA 3QRXA 1JC2A 1AK8A 2JOJA 5HKYA 1IJ6A 1QVIZ 3D0YB 1TCFA 3JVTB 5I2LA 1L7ZA 1MWNA 1RJVA 4MRYA 1EG3A 1TN4A 4YI9A 2JC2A 3RLZA 5D7FA 1PRWA 1UURA 1Y1AA 1LKJA 3O2PA 1UHNA 2JWWA 2A4JA 1CKKA 3TDZA 3I5IB 2F3YA 5JJGA 3ICBA 2M49B 1F71A 3SG4A 4FQOA 4I5JA 3WHUB 1RWYA 2WCFA 4ORAB 3CLNA 1BODA 4CFRA 5F6TA 1XK4C 2PMYA 2WCBA 4CFQA 2LLTA 4BY5A 5DKRA 2JRFA 2L4IA 2M29A 1SK6D 1N65A 4MN0A 2K7CA 3PATA 2LVKA 2SCPA 1OMDA 1KFXS 1TCOB 2BL0C 1C07A 1QTXA 4XJKB 1ZMZA 2H61A 4OVNF 3AAJA 3EK7A 2ZFDA 4N1FA 3CZTX 1JFKA 4ORBB 2L0PA 3HX4A 3DF0A 3K21A 4ZCVA 4I5LB 1F70A 1B7TZ 1LA0A 1K95A 2OS8C 1PALA 2F2PA 2LUCA 1SW8A 1S5GY 3NSIA 1DGUA 1YRUB 2KGBC 3EKHA 1NX2A 3NSOA 1KCYA 1OQPA 1EG4A 5BPJA 1QVIY 4MRXA 2K2AA 4DUQA 4HREE 1KQVA 4DS7A 3GK4X 3F45A 2JZIA 1MUXA 3NXAA 2LHIA 4C0JA 1SNLA 3A8RA 2MLFC 1ZUZA 3PSRA 3IF7A 1CMFA 1DMOA 1GGZA 2WCEA 3BUNB 1PSBA 1ZOTB 1XFUO 1OSAA 2LNKA 4D1EA 1DJZA 1PVBA 2KSPA 1YX7A 5AFPA 2PALA 3WXAA 2BCBA 3BUMB 4GBAA 1SL7A 2EC6B 5GQQC 3I5FC 1E8AA 1K8UA 3LK1A 5HKWA 3DF0B 3TZ1A 1FPWA 3I5GC 2CTNA 3KHEA 2OTGB 3FS7A 2HETA 1WLMA 1Q80A 1XVJA 4GGFC 5K89A 4MSPA 2K0JA 2BBNA 4UPGA 3AKAA 1B4CA 4AQJA 1TRFA 3TS5C 1M46A 4GGFA 2HQ8A 4GNKB 1ALVA 4I5KA 4ETOA 2WC8A 2KBMA 2NCOA 2ZNEA 2K7OA 4MEWA 2JULA 4NDCA 4YGAA 5KTYA 1RECA 1OMRA 1PULA 2JU0A 3JVTC 2I18A 3SIBA 3TUYB 2EHBA 3H4SE 1AHRA 1XFVO 1LVCD 2L2EA 1CDNA 5TNCA 2M9GA 2WNDA 1SKTA 1OOJA 4USLA 3KF9A 4U8DA 5DKQA 2COLB 4QJ4B 2M8UA 2CNPA 2Q4UA 3O78A 3I5IC 2M7LA 1AP4A 4NDBA 1F54A 1Y1XA 2ZNDA 3CWGA 1IGVA 1M45A 4F0ZB 1SL8A 1WRLA 3JTDB 1B47A 1PSRA 1ZFSA 5AEQA 2P6BB 5KSZA 1DJGA 2LVJA 2KHNA 1MR8A 1DT7B 4M2PA 2MHHA 1JF2A 5I2OA 2CT9A 5AANA 2Q91A 2KQYA 5I8NA 1XFZO 1CM4A 3LL8B 1S3PA 2AMIA 2BE4A 4GGNA 1JWDA 2PVBA 2F8PA 1KQMB 1ODBA 1NUBA 4XJKA 5HLVA 2KDHA 5CPVA 1SY9A 3OX5A 2Y1MA 3BOWB 1KFUS 1DF0A 4YGEB 2Y4QA 4L9MA 3WNXB 2LP2A 1RK9A 3PN7B 1C7WA 2O60A 2JT0A 1K9PA 3I5HC 1F55A 1K9KA 3IQOA 1Y0VH 3CGAA 1JFJA 3SG5A 1K96A 1WDCB 4WQ3A 2KI6D 1TNQA 1RTP1 3FWBA 1CLMA 3CR4X 2BCAA 2QPTA 1J1EA 4CIDA 4YGCB 4GAOA 2KYFA 2L51A 2MJWB 2FOTA 2H61C 4MLWA 3HCMA 2MRDA 2EC6C 1UHIA 4ZCUA 1BLQA 2JXLA
chains in the Genus database with same CATH superfamily
1Z4HA 4OR9B 4YRUA 2KI4B 3D77A 2LUXA 3AKBA 1J7RA 4M2OA 1A29A 1CLBA 1YUTA 2OTGC 3R1OA 1CB1A 1IRJA 3DVKA 1DF0B 3PJIA 3UNWA 1CFFA 3LK0A 4P5OE 5HLOA 1OW4A 1KK8C 1QXPA 2KAXA 3SG7A 1YTZC 2I94A 1FBVA 1Y1UA 2LMUA 4WQ2A 2KI6C 3B88A 2BBMA 1G33A 3BQ3A 1V1GA 4JPZB 4R1EA 1RFJA 1KK7Z 3DVJA 4NQGA 2G9BA 2LMTA 4PHMA 2JT3A 2KGRA 1PK0D 1NX0A 2MLEC 2F3ZA 3TUYC 3DD4A 1MXLC 1JSAA 3B7AA 2AAOA 4PHJA 1F4QA 4XYNA 4YGDB 1QLSA 5CSIA 3SIAA 1S6JA 1ORGA 2PSRA 4PE4A 2K7DA 1F4OA 3GK2A 2FCEA 1DGVA 5AERA 4PCWA 2KLDA 1G4YR 1SRAA 2WOSA 1S1EA 1FI5A 1JUOA 5D69A 1NCXA 1NPQA 3R72A 3NHTA 3VGOA 4NDDA 1AJ5A 1IJ5A 5FI7A 4TNCA 1XFWO 1UWOA 3D78A 2E6WA 2PRUA 2O5GA 4IJ7A 3V2LA 3B87A 4OV2A 3EK4A 3JTDC 4PE1A 3SJSA 2LLSA 2F33A 2VRGA 1QX7A 5CSNA 4INXA 3B6XA 1ALWA 2M0RA 2QEBA 2ZN9A 4INWA 1B8CA 1TWOA 4AOMA 1KWOB 1HQVA 3PFVA 1OE9B 4ICBA 3M0WA 5CSJA 1MXEA 1DJHA 2QACA 1QIWA 4JKTA 4CLNA 3TDUA 1SL9A 2KFGA 3O4YA 4CPVA 3WHTB 3BUOB 2L50A 4AQIA 4E68A 1B7TY 1KQMC 2NCPA 3VROA 2IS9A 3D75A 2LM5A 1BJFA 1BU3A 3KEVA 2JQ6A 2KAYA 4KYNA 4HRHA 2MBXA 1NP8A 1D1OA 3LLEA 1N0YA 3R1VA 4M2QA 3PN7C 1B8RA 2AUCA 2ZKMX 2BKHB 3O6BA 4YGBB 4OKHA 1GGWA 3BOWA 2KLEA 1SR6B 1XA5A 4C0KA 1BF5A 3KPXA 2JNXA 1FW4A 1TNPA 1K94A 2LANA 1BMOA 3N7HA 1WDCC 3FE6A 1RROA 4FQTA 2EGDA 3S0EA 4PE0A 1B1GA 2SASA 2WCJA 3SG2A 2I2RE 1K93D 1AJ4A 5ER5A 1YURA 1J55A 1LXFC 1BG1A 1QX2A 3S0FA 1WRKA 3IQQA 1FI6A 3SG6A 4QJ3B 1S6IA 1IQ3A 1GJYA 5ER4X 4MZLA 2HF5A 2MAZA 3D74A 3CR5X 4PT1A 2L4HA 1K90D 3D10A 3LCPC 2JXCA 1EXRA 2KI4C 2V53A 3L4LA 1S26D 1WLZA 3EVRA 4GUKA 5FI2A 3VRQA 3VRPA 3S0GA 2KQ6A 1IQ5A 1SBJA 1UP5A 1QX5B 3RZSA 1H4BA 1LINA 2M1KB 3OX6A 3DVEA 4MVFA 3SS4A 3SG3A 1XFYO 1CTRA 1L2OB 1OOFA 2QEVA 1TTXA 3EVVA 1KSMA 5J3XA 2QDIA 4DIRA 3BJHA 1A75A 1OMVA 2BCXA 3OHMB 2JNFA 1YR5A 1CDMA 2HQWA 5KU1A 4F7FA 2JT8A 2BKIB 1KFXL 1IG5A 4HRGA 1QS7A 4YBHB 2K60A 1CDLA 2Y5IA 5JOLA 1YUSA 3OP0A 2NZ0A 1QV1A 2MA2A 3VB1A 3ZNIA 1S5GZ 1X02A 2LE9B 1QJTA 2I7AA 4N5XA 1BR1B 4JWQA 3CS1A 3FWCA 1SMGA 1YVHA 2BE6A 4N1GA 1OZOA 2LC5A 3RM1A 2QEOA 2LMVA 5IBWA 1AUIB 4BY4A 3NSKA 1QWVA 1TNXA 4HSZA 2QEHA 1AVSA 3BUWB 3EVUA 1A2XA 1C7VA 1SCMB 1TOPA 3ZWHA 4A4CA 1IH0A 3BXKA 1ZACA 3AAKA 1TUJA 1V1FA 1CFCA 2KOTA 1WY9A 1GQMA 5EL2A 3BYAA 2TN4A 1M39A 1A75B 3EK8A 2DOQA 1K2HA 3BFBA 1KWOC 2ZRTA 4WRIA 1NCYA 1GM0A 4ORCB 5B8IB 3OGNA 4DRWA 1CFDA 2GGMA 4A4BA 1XK4A 2D8NA 2ISDA 1UHJA 1LA3A 1OOGA 4PDZA 1M63B 1NX1A 4DCKA 2LHLA 3E3RA 2LAPA 4QJ5B 1EH2A 1UHHA 1M31A 1NCZA 1XYDA 3MSEB 2FCDA 4MZJA 4Q04A 4PALA 1DTLA 1UHKA 2LV7A 2H8VA 2FJUB 3CZ1A 2NXQA 1BT6A 1CM1A 1SR6C 1K9UA 2B1UA 1FF1A 1UUSA 2BECA 1SYMA 1H8BA 3OBVA 1S6CA 5D3OA 4PHKA 3FIAA 1F8HA 2L5XB 3S0BA 2WORA 1DVIA 1YVLA 2LP3A 3I5HB 2PASA 4GPLB 2K2FA 1CFPA 1CDPA 1J1DA 1QV0A 1NSHA 4OCIA 4C0LA 1NX3A 1EL4A 2CCMA 3L47A 5I94A 2KNEA 1KSOA 1U5IA 5HL1A 4FTGA 2KPHA 2L5YA 2ZRSA 3B86A 3FE8A 2M97A 3VRNA 1NWDA 1P28A 2L98A 1DJYA 2M7NA 1HT9A 2WCMA 3BUXB 1CNPA 1W7IB 1B9AA 2CBLA 1MF8B 2JTZA 1QIVA 1OZSA 2JPTA 2KFFA 3CTNA 1J7OA 1DJIA 5FYXA 4PHNA 2BL0B 3GK1A 1BR4B 1L2OC 5HYDA 5CSFA 1EJ3A 1G8IA 2GV5A 1XO5A 2Y1NA 4GFTA 4MZKA 1KK7Y 1CMGA 3PLFB 2G2BA 1JBAA 1JF0A 4OZDA 3A4UB 5DKNA 1SCVA 2LCPA 2YGUA 1KK8B 1YUUA 2H2KA 1MQ1A 2OS8B 3FE9A 1SPYA 1DJWA 1QLKA 2KFHA 1YX8A 3OB2B 2CXJA 2LVIA 1BOCA 2KAVA 3TDIA 1WRZA 1YRTB 3C1VA 1U5IB 2K61A 3L4AA 2R2IA 3VRRA 1IKUA 1PVAA 2KYCA 1XFXO 3NSLA 3PM8A 1KFUL 2LLUA 2RGIA 1R6PA 3KO0A 3K1EA 3D0YA 1W7JB 4JQ0D 1A03A 1SCMC 4MBEA 2LVVA 5HKZA 1LS8A 2NLNA 2JTTA 4YI8A 2WC6A 1NIWA 1MHOA 1NYAA 5AXIA 1QASA 1QATA 1N2DA 3DVMA 3I5FB 5PALA 2WCLA 1CLLA 1TIZA 3I5GB 3OB1B 2ZN8A 1S36A 4PE7A 1J7QA 4I5NB 5I2QA 1Y6WA 2M1UA 1VRKA 1B8LA 1IWQA 2E30A 2HPSA 1XFRA 3BFAA 4IL1A 2OPOA 2F2OA 2KBIA 2GGZA 1TNWA 5G08A 2M3WA 1OOIX 2PYQA 1J7PA 3TS5B 1A4PA 3EKJA 1DJXA 2K8MB 3PALA 2K7BA 1R2UA 3CR2A 4P2YB 3GOFA 3QRXA 1JC2A 1AK8A 2JOJA 3DY9A 5HKYA 1IJ6A 1QVIZ 3D0YB 1TCFA 3JVTB 5I2LA 3UO9A 1L7ZA 1C3ZA 1MWNA 3Q8IA 1RJVA 3BFHA 4MRYA 1EG3A 1TN4A 4YI9A 2JC2A 3RLZA 5D7FA 1PRWA 1UURA 1Y1AA 1LKJA 3O2PA 1UHNA 2JWWA 2A4JA 3NHIA 1CKKA 3TDZA 3I5IB 2F3YA 5JJGA 3ICBA 2M49B 2WCKA 1F71A 3SG4A 4FQOA 4I5JA 3WHUB 1RWYA 2WCFA 4ORAB 3CLNA 1BODA 4CFRA 5F6TA 1XK4C 2PMYA 2WCBA 4CFQA 2LLTA 4BY5A 5DKRA 2JRFA 2L4IA 2M29A 1C3YA 1SK6D 1N65A 4MN0A 3R1PA 2K7CA 3PATA 2LVKA 2SCPA 1OMDA 1KFXS 1TCOB 2BL0C 1C07A 1QTXA 4XJKB 1ZMZA 2H61A 3EG5B 4OVNF 3AAJA 2WCHA 3EK7A 2ZFDA 4N1FA 3CZTX 1JFKA 4ORBB 2L0PA 3HX4A 3DF0A 3D76A 3K21A 2ERBA 4I5LB 4ZCVA 1F70A 1B7TZ 1LA0A 1K95A 2OS8C 1PALA 2F2PA 2LUCA 1SW8A 1S5GY 3CZ0A 3NSIA 1DGUA 1YRUB 2KGBC 3EKHA 1NX2A 3NSOA 1KCYA 1OQPA 1EG4A 5BPJA 1QVIY 1DC1A 4MRXA 2K2AA 4DUQA 4HREE 1KQVA 4DS7A 2P70A 3GK4X 3F45A 2JZIA 1MUXA 3NXAA 2LHIA 4C0JA 1SNLA 3A8RA 1DQEA 1TUZA 3DYEA 2MLFC 1ZUZA 5DICA 3PSRA 3IF7A 3SS3A 1CMFA 1DMOA 1GGZA 2WCEA 3BUNB 1DELA 1PSBA 1ZOTB 1XFUO 1OSAA 2LNKA 4D1EA 1DJZA 1PVBA 2KSPA 1YX7A 5AFPA 2PALA 3WXAA 2BCBA 3BUMB 4GBAA 1SL7A 2EC6B 5GQQC 3I5FC 1E8AA 1K8UA 3LK1A 5HKWA 3DF0B 3TZ1A 1FPWA 3I5GC 2CTNA 3KHEA 2OTGB 3FS7A 2HETA 1WLMA 1Q80A 1XVJA 4GGFC 3CABA 5K89A 4MSPA 3PM2A 2K0JA 2BBNA 4UPGA 3SS5A 3AKAA 1B4CA 4AQJA 1TRFA 3TS5C 1M46A 4GGFA 2HQ8A 4GNKB 1ALVA 4I5KA 3D73A 4ETOA 2WC8A 2KBMA 2NCOA 2ZNEA 2K7OA 3DZTA 2JULA 4MEWA 4NDCA 4YGAA 5KTYA 1RECA 3CDNA 1OMRA 1PULA 1SSEB 2JU0A 1OOHA 3JVTC 2I18A 3SIBA 3TUYB 2EHBA 3QMEA 3H4SE 1AHRA 1XFVO 1LVCD 2L2EA 1CDNA 5TNCA 2M9GA 2WNDA 3IVTA 1SKTA 2JPOA 1OOJA 4USLA 3KF9A 4U8DA 5DKQA 1Z2CB 2COLB 4QJ4B 2M8UA 2CNPA 2Q4UA 3O78A 3I5IC 2M7LA 2PQLA 4NDBA 1AP4A 1F54A 1Y1XA 2ZNDA 3CWGA 1IGVA 1M45A 4F0ZB 2FJYA 1SL8A 1WRLA 3JTDB 1B47A 1PSRA 1ZFSA 5AEQA 2P6BB 5KSZA 2GTEA 1DJGA 2LVJA 2KHNA 1MR8A 1DEKA 1DT7B 4M2PA 1IIOA 2MHHA 1JF2A 2P71A 5I2OA 2CT9A 5AANA 2Q91A 2KQYA 5I8NA 1XFZO 1CM4A 3NGVA 3LL8B 1S3PA 2AMIA 2BE4A 4GGNA 1JWDA 2PVBA 4JD9A 2F8PA 1KQMB 1ODBA 1NUBA 4XJKA 5HLVA 2KDHA 5CPVA 1SY9A 3OX5A 2Y1MA 3BOWB 3CYZA 1KFUS 1DF0A 4YGEB 2Y4QA 4L9MA 3WNXB 2LP2A 1RK9A 2WC5A 3PN7B 1C7WA 2BAPA 2O60A 2JT0A 1K9PA 1T14A 3CZ2A 3O4XA 3I5HC 1F55A 2L2CA 1K9KA 3DXLA 1Y0VH 3IQOA 3CGAA 5FI6A 1JFJA 3SG5A 1K96A 1WDCB 4WQ3A 3S0AA 2KI6D 1TNQA 1RTP1 3FWBA 1W9ZA 1CLMA 3CR4X 2BCAA 2QPTA 3S0DA 1J1EA 4CIDA 4YGCB 4GAOA 2BNXA 2KYFA 2L51A 2MJWB 2FOTA 2H61C 4MLWA 3HCMA 2MRDA 2EC6C 1UHIA 4ZCUA 1BLQA 2JXLA
chains in the Genus database with same CATH topology
4OR9B 4YRUA 2KI4B 2LUXA 3AKBA 1J7RA 4M2OA 1A29A 1CLBA 1YUTA 2OTGC 1CB1A 1IRJA 3DVKA 1DF0B 1CFFA 3LK0A 4P5OE 5HLOA 1KK8C 1QXPA 2KAXA 3SG7A 1YTZC 2I94A 1FBVA 1Y1UA 2LMUA 4WQ2A 2KI6C 2BBMA 1G33A 3BQ3A 1V1GA 4JPZB 4R1EA 1RFJA 1KK7Z 3DVJA 4NQGA 2G9BA 2LMTA 4PHMA 2JT3A 2KGRA 1PK0D 1NX0A 2MLEC 2F3ZA 3TUYC 3DD4A 1MXLC 1JSAA 2AAOA 4PHJA 1F4QA 4XYNA 4YGDB 1QLSA 5CSIA 3SIAA 1S6JA 2PSRA 4PE4A 2K7DA 1F4OA 3GK2A 2FCEA 1DGVA 5AERA 4PCWA 1G4YR 1SRAA 2WOSA 1S1EA 1FI5A 1JUOA 5D69A 1NCXA 1NPQA 3VGOA 4NDDA 1AJ5A 1IJ5A 4TNCA 1XFWO 1UWOA 2E6WA 2PRUA 2O5GA 4OV2A 3EK4A 3JTDC 4PE1A 3SJSA 2LLSA 2F33A 2VRGA 1QX7A 5CSNA 1ALWA 2M0RA 2ZN9A 4AOMA 1B8CA 1KWOB 1HQVA 3PFVA 1OE9B 4ICBA 3M0WA 5CSJA 1MXEA 1DJHA 2QACA 1QIWA 4CLNA 3TDUA 1SL9A 2KFGA 3O4YA 4CPVA 3WHTB 3BUOB 2L50A 4AQIA 4E68A 1B7TY 1KQMC 2NCPA 3VROA 2IS9A 2LM5A 1BJFA 1BU3A 3KEVA 2JQ6A 2KAYA 4HRHA 2MBXA 1NP8A 1D1OA 3LLEA 1N0YA 4M2QA 3PN7C 1B8RA 2AUCA 2ZKMX 2BKHB 3O6BA 4YGBB 4OKHA 1GGWA 3BOWA 1SR6B 1XA5A 4C0KA 1BF5A 3KPXA 2JNXA 1FW4A 1TNPA 1K94A 2LANA 1BMOA 1B1GA 1WDCC 1RROA 2EGDA 4PE0A 2SASA 3SG2A 2I2RE 1K93D 1AJ4A 5ER5A 1YURA 1J55A 1LXFC 1BG1A 1QX2A 1WRKA 3IQQA 1FI6A 3SG6A 4QJ3B 1S6IA 1IQ3A 1GJYA 5ER4X 4MZLA 2HF5A 2MAZA 3CR5X 2L4HA 1K90D 3D10A 3LCPC 2JXCA 1EXRA 2KI4C 2V53A 4GUKA 1S26D 1WLZA 3EVRA 3VRQA 3VRPA 2KQ6A 1IQ5A 1SBJA 1UP5A 1QX5B 1H4BA 1LINA 2M1KB 3OX6A 3DVEA 4MVFA 3SG3A 1XFYO 1CTRA 1L2OB 3EVVA 1TTXA 1KSMA 5J3XA 4DIRA 1A75A 1OMVA 2BCXA 3OHMB 2JNFA 1YR5A 1CDMA 2HQWA 5KU1A 2JT8A 2BKIB 1KFXL 1IG5A 4HRGA 1QS7A 4YBHB 2Y5IA 1CDLA 5JOLA 1YUSA 3OP0A 2NZ0A 1QV1A 2MA2A 3ZNIA 1S5GZ 1X02A 2LE9B 1QJTA 2I7AA 4N5XA 1BR1B 4JWQA 3CS1A 3FWCA 1SMGA 1YVHA 2BE6A 4N1GA 1OZOA 2LC5A 3RM1A 2LMVA 5IBWA 1AUIB 4BY4A 3NSKA 1TNXA 4HSZA 1AVSA 3BUWB 3EVUA 1A2XA 1C7VA 1SCMB 1TOPA 3ZWHA 4A4CA 1IH0A 3BXKA 1ZACA 3AAKA 1V1FA 1CFCA 2KOTA 1WY9A 1GQMA 3BYAA 2TN4A 1M39A 1A75B 3EK8A 2DOQA 1K2HA 1KWOC 2ZRTA 4WRIA 1NCYA 4ORCB 5B8IB 4DRWA 1CFDA 2GGMA 4A4BA 1XK4A 2D8NA 2ISDA 1UHJA 1LA3A 4PDZA 1M63B 1NX1A 4DCKA 2LHLA 3E3RA 2LAPA 4QJ5B 1EH2A 1UHHA 1M31A 1NCZA 1XYDA 3MSEB 2FCDA 4MZJA 4Q04A 4PALA 1DTLA 1UHKA 2LV7A 2FJUB 2NXQA 1BT6A 1CM1A 1SR6C 1K9UA 2B1UA 1FF1A 1UUSA 2BECA 1SYMA 1H8BA 1S6CA 4PHKA 3FIAA 1F8HA 2L5XB 2WORA 1DVIA 1YVLA 2LP3A 3I5HB 2PASA 4GPLB 2K2FA 1CFPA 1CDPA 1J1DA 1QV0A 1NSHA 4OCIA 4C0LA 1NX3A 1EL4A 2CCMA 2KNEA 1KSOA 1U5IA 4FTGA 2ZRSA 2M97A 3VRNA 1NWDA 2M7NA 2L98A 1DJYA 1HT9A 3BUXB 1CNPA 1W7IB 1B9AA 2CBLA 1MF8B 2JTZA 1QIVA 1OZSA 2JPTA 2KFFA 3CTNA 1J7OA 1DJIA 5FYXA 4PHNA 2BL0B 3GK1A 1BR4B 1L2OC 5HYDA 5CSFA 1EJ3A 1G8IA 2GV5A 1XO5A 2Y1NA 4GFTA 4MZKA 1KK7Y 1CMGA 3PLFB 2G2BA 1JBAA 1JF0A 3A4UB 5DKNA 1SCVA 2LCPA 1KK8B 1YUUA 2H2KA 1MQ1A 2OS8B 1SPYA 1DJWA 1QLKA 2KFHA 1YX8A 3OB2B 2CXJA 2LVIA 1BOCA 2KAVA 3TDIA 1WRZA 1YRTB 3C1VA 1U5IB 2K61A 3VRRA 2R2IA 1IKUA 1PVAA 2KYCA 1XFXO 3NSLA 3PM8A 1KFUL 2LLUA 2RGIA 1R6PA 3KO0A 3D0YA 1W7JB 4JQ0D 1A03A 1SCMC 4MBEA 2LVVA 5HKZA 2NLNA 2JTTA 4YI8A 1NIWA 1MHOA 1NYAA 5AXIA 1QASA 1QATA 1N2DA 3DVMA 3I5FB 5PALA 1CLLA 1TIZA 3I5GB 3OB1B 2ZN8A 1S36A 4PE7A 1J7QA 4I5NB 5I2QA 1Y6WA 2M1UA 1VRKA 1B8LA 1IWQA 2E30A 2HPSA 4IL1A 2OPOA 2F2OA 2KBIA 2GGZA 1TNWA 5G08A 2M3WA 1J7PA 3TS5B 1A4PA 3EKJA 1DJXA 2K8MB 3PALA 2K7BA 1R2UA 3CR2A 4P2YB 3GOFA 3QRXA 1JC2A 1AK8A 2JOJA 5HKYA 1IJ6A 1QVIZ 3D0YB 1TCFA 3JVTB 5I2LA 1L7ZA 1MWNA 1RJVA 4MRYA 1EG3A 1TN4A 4YI9A 2JC2A 3RLZA 5D7FA 1PRWA 1UURA 1Y1AA 1LKJA 3O2PA 1UHNA 2JWWA 2A4JA 1CKKA 3TDZA 3I5IB 2F3YA 5JJGA 3ICBA 2M49B 1F71A 3SG4A 4FQOA 4I5JA 3WHUB 1RWYA 2WCFA 4ORAB 3CLNA 1BODA 4CFRA 5F6TA 1XK4C 2PMYA 2WCBA 4CFQA 2LLTA 4BY5A 5DKRA 2JRFA 2L4IA 2M29A 1SK6D 1N65A 4MN0A 2K7CA 3PATA 2LVKA 2SCPA 1OMDA 1KFXS 1TCOB 2BL0C 1C07A 1QTXA 4XJKB 1ZMZA 2H61A 4OVNF 3AAJA 3EK7A 2ZFDA 4N1FA 3CZTX 1JFKA 4ORBB 2L0PA 3HX4A 3DF0A 3K21A 4ZCVA 4I5LB 1F70A 1B7TZ 1LA0A 1K95A 2OS8C 1PALA 2F2PA 2LUCA 1SW8A 1S5GY 3NSIA 1DGUA 1YRUB 2KGBC 3EKHA 1NX2A 3NSOA 1KCYA 1OQPA 1EG4A 5BPJA 1QVIY 4MRXA 2K2AA 4DUQA 4HREE 1KQVA 4DS7A 3GK4X 3F45A 2JZIA 1MUXA 3NXAA 2LHIA 4C0JA 1SNLA 3A8RA 2MLFC 1ZUZA 3PSRA 3IF7A 1CMFA 1DMOA 1GGZA 2WCEA 3BUNB 1PSBA 1ZOTB 1XFUO 1OSAA 2LNKA 4D1EA 1DJZA 1PVBA 2KSPA 1YX7A 5AFPA 2PALA 3WXAA 2BCBA 3BUMB 4GBAA 1SL7A 2EC6B 5GQQC 3I5FC 1E8AA 1K8UA 3LK1A 5HKWA 3DF0B 3TZ1A 1FPWA 3I5GC 2CTNA 3KHEA 2OTGB 3FS7A 2HETA 1WLMA 1Q80A 1XVJA 4GGFC 5K89A 4MSPA 2K0JA 2BBNA 4UPGA 3AKAA 1B4CA 4AQJA 1TRFA 3TS5C 1M46A 4GGFA 2HQ8A 4GNKB 1ALVA 4I5KA 4ETOA 2WC8A 2KBMA 2NCOA 2ZNEA 2K7OA 4MEWA 2JULA 4NDCA 4YGAA 5KTYA 1RECA 1OMRA 1PULA 2JU0A 3JVTC 2I18A 3SIBA 3TUYB 2EHBA 3H4SE 1AHRA 1XFVO 1LVCD 2L2EA 1CDNA 5TNCA 2M9GA 2WNDA 1SKTA 1OOJA 4USLA 3KF9A 4U8DA 5DKQA 2COLB 4QJ4B 2M8UA 2CNPA 2Q4UA 3O78A 3I5IC 2M7LA 1AP4A 4NDBA 1F54A 1Y1XA 2ZNDA 3CWGA 1IGVA 1M45A 4F0ZB 1SL8A 1WRLA 3JTDB 1B47A 1PSRA 1ZFSA 5AEQA 2P6BB 5KSZA 1DJGA 2LVJA 2KHNA 1MR8A 1DT7B 4M2PA 2MHHA 1JF2A 5I2OA 2CT9A 5AANA 2Q91A 2KQYA 5I8NA 1XFZO 1CM4A 3LL8B 1S3PA 2AMIA 2BE4A 4GGNA 1JWDA 2PVBA 2F8PA 1KQMB 1ODBA 1NUBA 4XJKA 5HLVA 2KDHA 5CPVA 1SY9A 3OX5A 2Y1MA 3BOWB 1KFUS 1DF0A 4YGEB 2Y4QA 4L9MA 3WNXB 2LP2A 1RK9A 3PN7B 1C7WA 2O60A 2JT0A 1K9PA 3I5HC 1F55A 1K9KA 3IQOA 1Y0VH 3CGAA 1JFJA 3SG5A 1K96A 1WDCB 4WQ3A 2KI6D 1TNQA 1RTP1 3FWBA 1CLMA 3CR4X 2BCAA 2QPTA 1J1EA 4CIDA 4YGCB 4GAOA 2KYFA 2L51A 2MJWB 2FOTA 2H61C 4MLWA 3HCMA 2MRDA 2EC6C 1UHIA 4ZCUA 1BLQA 2JXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 B;  4YRU A;  2KI4 B;  2LUX A;  3AKB A;  1J7R A;  4M2O A;  1A29 A;  1CLB A;  1YUT A;  2OTG C;  1CB1 A;  1IRJ A;  3DVK A;  1DF0 B;  1CFF A;  3LK0 A;  4P5O E;  5HLO A;  1KK8 C;  1QXP A;  2KAX A;  3SG7 A;  1YTZ C;  2I94 A;  1FBV A;  1Y1U A;  2LMU A;  4WQ2 A;  2KI6 C;  2BBM A;  1G33 A;  3BQ3 A;  1V1G A;  4JPZ B;  4R1E A;  1RFJ A;  1KK7 Z;  3DVJ A;  4NQG A;  2G9B A;  2LMT A;  4PHM A;  2JT3 A;  2KGR A;  1PK0 D;  1NX0 A;  2MLE C;  2F3Z A;  3TUY C;  3DD4 A;  1MXL C;  1JSA A;  2AAO A;  4PHJ A;  1F4Q A;  4XYN A;  4YGD B;  1QLS A;  5CSI A;  3SIA A;  1S6J A;  2PSR A;  4PE4 A;  2K7D A;  1F4O A;  3GK2 A;  2FCE A;  1DGV A;  5AER A;  4PCW A;  1G4Y R;  1SRA A;  2WOS A;  1S1E A;  1FI5 A;  1JUO A;  5D69 A;  1NCX A;  1NPQ A;  3VGO A;  4NDD A;  1AJ5 A;  1IJ5 A;  4TNC A;  1XFW O;  1UWO A;  2E6W A;  2PRU A;  2O5G A;  4OV2 A;  3EK4 A;  3JTD C;  4PE1 A;  3SJS A;  2LLS A;  2F33 A;  2VRG A;  1QX7 A;  5CSN A;  1ALW A;  2M0R A;  2ZN9 A;  4AOM A;  1B8C A;  1KWO B;  1HQV A;  3PFV A;  1OE9 B;  4ICB A;  3M0W A;  5CSJ A;  1MXE A;  1DJH A;  2QAC A;  1QIW A;  4CLN A;  3TDU A;  1SL9 A;  2KFG A;  3O4Y A;  4CPV A;  3WHT B;  3BUO B;  2L50 A;  4AQI A;  4E68 A;  1B7T Y;  1KQM C;  2NCP A;  3VRO A;  2IS9 A;  2LM5 A;  1BJF A;  1BU3 A;  3KEV A;  2JQ6 A;  2KAY A;  4HRH A;  2MBX A;  1NP8 A;  1D1O A;  3LLE A;  1N0Y A;  4M2Q A;  3PN7 C;  1B8R A;  2AUC A;  2ZKM X;  2BKH B;  3O6B A;  4YGB B;  4OKH A;  1GGW A;  3BOW A;  1SR6 B;  1XA5 A;  4C0K A;  1BF5 A;  3KPX A;  2JNX A;  1FW4 A;  1TNP A;  1K94 A;  2LAN A;  1BMO A;  1B1G A;  1WDC C;  1RRO A;  2EGD A;  4PE0 A;  2SAS A;  3SG2 A;  2I2R E;  1K93 D;  1AJ4 A;  5ER5 A;  1YUR A;  1J55 A;  1LXF C;  1BG1 A;  1QX2 A;  1WRK A;  3IQQ A;  1FI6 A;  3SG6 A;  4QJ3 B;  1S6I A;  1IQ3 A;  1GJY A;  5ER4 X;  4MZL A;  2HF5 A;  2MAZ A;  3CR5 X;  2L4H A;  1K90 D;  3D10 A;  3LCP C;  2JXC A;  1EXR A;  2KI4 C;  2V53 A;  4GUK A;  1S26 D;  1WLZ A;  3EVR A;  3VRQ A;  3VRP A;  2KQ6 A;  1IQ5 A;  1SBJ A;  1UP5 A;  1QX5 B;  1H4B A;  1LIN A;  2M1K B;  3OX6 A;  3DVE A;  4MVF A;  3SG3 A;  1XFY O;  1CTR A;  1L2O B;  3EVV A;  1TTX A;  1KSM A;  5J3X A;  4DIR A;  1A75 A;  1OMV A;  2BCX A;  3OHM B;  2JNF A;  1YR5 A;  1CDM A;  2HQW A;  5KU1 A;  2JT8 A;  2BKI B;  1KFX L;  1IG5 A;  4HRG A;  1QS7 A;  4YBH B;  2Y5I A;  1CDL A;  5JOL A;  1YUS A;  3OP0 A;  2NZ0 A;  1QV1 A;  2MA2 A;  3ZNI A;  1S5G Z;  1X02 A;  2LE9 B;  1QJT A;  2I7A A;  4N5X A;  1BR1 B;  4JWQ A;  3CS1 A;  3FWC A;  1SMG A;  1YVH A;  2BE6 A;  4N1G A;  1OZO A;  2LC5 A;  3RM1 A;  2LMV A;  5IBW A;  1AUI B;  4BY4 A;  3NSK A;  1TNX A;  4HSZ A;  1AVS A;  3BUW B;  3EVU A;  1A2X A;  1C7V A;  1SCM B;  1TOP A;  3ZWH A;  4A4C A;  1IH0 A;  3BXK A;  1ZAC A;  3AAK A;  1V1F A;  1CFC A;  2KOT A;  1WY9 A;  1GQM A;  3BYA A;  2TN4 A;  1M39 A;  1A75 B;  3EK8 A;  2DOQ A;  1K2H A;  1KWO C;  2ZRT A;  4WRI A;  1NCY A;  4ORC B;  5B8I B;  4DRW A;  1CFD A;  2GGM A;  4A4B A;  1XK4 A;  2D8N A;  2ISD A;  1UHJ A;  1LA3 A;  4PDZ A;  1M63 B;  1NX1 A;  4DCK A;  2LHL A;  3E3R A;  2LAP A;  4QJ5 B;  1EH2 A;  1UHH A;  1M31 A;  1NCZ A;  1XYD A;  3MSE B;  2FCD A;  4MZJ A;  4Q04 A;  4PAL A;  1DTL A;  1UHK A;  2LV7 A;  2FJU B;  2NXQ A;  1BT6 A;  1CM1 A;  1SR6 C;  1K9U A;  2B1U A;  1FF1 A;  1UUS A;  2BEC A;  1SYM A;  1H8B A;  1S6C A;  4PHK A;  3FIA A;  1F8H A;  2L5X B;  2WOR A;  1DVI A;  1YVL A;  2LP3 A;  3I5H B;  2PAS A;  4GPL B;  2K2F A;  1CFP A;  1CDP A;  1J1D A;  1QV0 A;  1NSH A;  4OCI A;  4C0L A;  1NX3 A;  1EL4 A;  2CCM A;  2KNE A;  1KSO A;  1U5I A;  4FTG A;  2ZRS A;  2M97 A;  3VRN A;  1NWD A;  2M7N A;  2L98 A;  1DJY A;  1HT9 A;  3BUX B;  1CNP A;  1W7I B;  1B9A A;  2CBL A;  1MF8 B;  2JTZ A;  1QIV A;  1OZS A;  2JPT A;  2KFF A;  3CTN A;  1J7O A;  1DJI A;  5FYX A;  4PHN A;  2BL0 B;  3GK1 A;  1BR4 B;  1L2O C;  5HYD A;  5CSF A;  1EJ3 A;  1G8I A;  2GV5 A;  1XO5 A;  2Y1N A;  4GFT A;  4MZK A;  1KK7 Y;  1CMG A;  3PLF B;  2G2B A;  1JBA A;  1JF0 A;  3A4U B;  5DKN A;  1SCV A;  2LCP A;  1KK8 B;  1YUU A;  2H2K A;  1MQ1 A;  2OS8 B;  1SPY A;  1DJW A;  1QLK A;  2KFH A;  1YX8 A;  3OB2 B;  2CXJ A;  2LVI A;  1BOC A;  2KAV A;  3TDI A;  1WRZ A;  1YRT B;  3C1V A;  1U5I B;  2K61 A;  3VRR A;  2R2I A;  1IKU A;  1PVA A;  2KYC A;  1XFX O;  3NSL A;  3PM8 A;  1KFU L;  2LLU A;  2RGI A;  1R6P A;  3KO0 A;  3D0Y A;  1W7J B;  4JQ0 D;  1A03 A;  1SCM C;  4MBE A;  2LVV A;  5HKZ A;  2NLN A;  2JTT A;  4YI8 A;  1NIW A;  1MHO A;  1NYA A;  5AXI A;  1QAS A;  1QAT A;  1N2D A;  3DVM A;  3I5F B;  5PAL A;  1CLL A;  1TIZ A;  3I5G B;  3OB1 B;  2ZN8 A;  1S36 A;  4PE7 A;  1J7Q A;  4I5N B;  5I2Q A;  1Y6W A;  2M1U A;  1VRK A;  1B8L A;  1IWQ A;  2E30 A;  2HPS A;  4IL1 A;  2OPO A;  2F2O A;  2KBI A;  2GGZ A;  1TNW A;  5G08 A;  2M3W A;  1J7P A;  3TS5 B;  1A4P A;  3EKJ A;  1DJX A;  2K8M B;  3PAL A;  2K7B A;  1R2U A;  3CR2 A;  4P2Y B;  3GOF A;  3QRX A;  1JC2 A;  1AK8 A;  2JOJ A;  5HKY A;  1IJ6 A;  1QVI Z;  3D0Y B;  1TCF A;  3JVT B;  5I2L A;  1L7Z A;  1MWN A;  1RJV A;  4MRY A;  1EG3 A;  1TN4 A;  4YI9 A;  2JC2 A;  3RLZ A;  5D7F A;  1PRW A;  1UUR A;  1Y1A A;  1LKJ A;  3O2P A;  1UHN A;  2JWW A;  2A4J A;  1CKK A;  3TDZ A;  3I5I B;  2F3Y A;  5JJG A;  3ICB A;  2M49 B;  1F71 A;  3SG4 A;  4FQO A;  4I5J A;  3WHU B;  1RWY A;  2WCF A;  4ORA B;  3CLN A;  1BOD A;  4CFR A;  5F6T A;  1XK4 C;  2PMY A;  2WCB A;  4CFQ A;  2LLT A;  4BY5 A;  5DKR A;  2JRF A;  2L4I A;  2M29 A;  1SK6 D;  1N65 A;  4MN0 A;  2K7C A;  3PAT A;  2LVK A;  2SCP A;  1OMD A;  1KFX S;  1TCO B;  2BL0 C;  1C07 A;  1QTX A;  4XJK B;  1ZMZ A;  2H61 A;  4OVN F;  3AAJ A;  3EK7 A;  2ZFD A;  4N1F A;  3CZT X;  1JFK A;  4ORB B;  2L0P A;  3HX4 A;  3DF0 A;  3K21 A;  4ZCV A;  4I5L B;  1F70 A;  1B7T Z;  1LA0 A;  1K95 A;  2OS8 C;  1PAL A;  2F2P A;  2LUC A;  1SW8 A;  1S5G Y;  3NSI A;  1DGU A;  1YRU B;  2KGB C;  3EKH A;  1NX2 A;  3NSO A;  1KCY A;  1OQP A;  1EG4 A;  5BPJ A;  1QVI Y;  4MRX A;  2K2A A;  4DUQ A;  4HRE E;  1KQV A;  4DS7 A;  3GK4 X;  3F45 A;  2JZI A;  1MUX A;  3NXA A;  2LHI A;  4C0J A;  1SNL A;  3A8R A;  2MLF C;  1ZUZ A;  3PSR A;  3IF7 A;  1CMF A;  1DMO A;  1GGZ A;  2WCE A;  3BUN B;  1PSB A;  1ZOT B;  1XFU O;  1OSA A;  2LNK A;  4D1E A;  1DJZ A;  1PVB A;  2KSP A;  1YX7 A;  5AFP A;  2PAL A;  3WXA A;  2BCB A;  3BUM B;  4GBA A;  1SL7 A;  2EC6 B;  5GQQ C;  3I5F C;  1E8A A;  1K8U A;  3LK1 A;  5HKW A;  3DF0 B;  3TZ1 A;  1FPW A;  3I5G C;  2CTN A;  3KHE A;  2OTG B;  3FS7 A;  2HET A;  1WLM A;  1Q80 A;  1XVJ A;  4GGF C;  5K89 A;  4MSP A;  2K0J A;  2BBN A;  4UPG A;  3AKA A;  1B4C A;  4AQJ A;  1TRF A;  3TS5 C;  1M46 A;  4GGF A;  2HQ8 A;  4GNK B;  1ALV A;  4I5K A;  4ETO A;  2WC8 A;  2KBM A;  2NCO A;  2ZNE A;  2K7O A;  4MEW A;  2JUL A;  4NDC A;  4YGA A;  5KTY A;  1REC A;  1OMR A;  1PUL A;  2JU0 A;  3JVT C;  2I18 A;  3SIB A;  3TUY B;  2EHB A;  3H4S E;  1AHR A;  1XFV O;  1LVC D;  2L2E A;  1CDN A;  5TNC A;  2M9G A;  2WND A;  1SKT A;  1OOJ A;  4USL A;  3KF9 A;  4U8D A;  5DKQ A;  2COL B;  4QJ4 B;  2M8U A;  2CNP A;  2Q4U A;  3O78 A;  3I5I C;  2M7L A;  1AP4 A;  4NDB A;  1F54 A;  1Y1X A;  2ZND A;  3CWG A;  1IGV A;  1M45 A;  4F0Z B;  1SL8 A;  1WRL A;  3JTD B;  1B47 A;  1PSR A;  1ZFS A;  5AEQ A;  2P6B B;  5KSZ A;  1DJG A;  2LVJ A;  2KHN A;  1MR8 A;  1DT7 B;  4M2P A;  2MHH A;  1JF2 A;  5I2O A;  2CT9 A;  5AAN A;  2Q91 A;  2KQY A;  5I8N A;  1XFZ O;  1CM4 A;  3LL8 B;  1S3P A;  2AMI A;  2BE4 A;  4GGN A;  1JWD A;  2PVB A;  2F8P A;  1KQM B;  1ODB A;  1NUB A;  4XJK A;  5HLV A;  2KDH A;  5CPV A;  1SY9 A;  3OX5 A;  2Y1M A;  3BOW B;  1KFU S;  1DF0 A;  4YGE B;  2Y4Q A;  4L9M A;  3WNX B;  2LP2 A;  1RK9 A;  3PN7 B;  1C7W A;  2O60 A;  2JT0 A;  1K9P A;  3I5H C;  1F55 A;  1K9K A;  3IQO A;  1Y0V H;  3CGA A;  1JFJ A;  3SG5 A;  1K96 A;  1WDC B;  4WQ3 A;  2KI6 D;  1TNQ A;  1RTP 1;  3FWB A;  1CLM A;  3CR4 X;  2BCA A;  2QPT A;  1J1E A;  4CID A;  4YGC B;  4GAO A;  2KYF A;  2L51 A;  2MJW B;  2FOT A;  2H61 C;  4MLW A;  3HCM A;  2MRD A;  2EC6 C;  1UHI A;  4ZCU A;  1BLQ A;  2JXL A; 
#chains in the Genus database with same CATH topology
 1Z4H A;  4OR9 B;  4YRU A;  2KI4 B;  3D77 A;  2LUX A;  3AKB A;  1J7R A;  4M2O A;  1A29 A;  1CLB A;  1YUT A;  2OTG C;  3R1O A;  1CB1 A;  1IRJ A;  3DVK A;  1DF0 B;  3PJI A;  3UNW A;  1CFF A;  3LK0 A;  4P5O E;  5HLO A;  1OW4 A;  1KK8 C;  1QXP A;  2KAX A;  3SG7 A;  1YTZ C;  2I94 A;  1FBV A;  1Y1U A;  2LMU A;  4WQ2 A;  2KI6 C;  3B88 A;  2BBM A;  1G33 A;  3BQ3 A;  1V1G A;  4JPZ B;  4R1E A;  1RFJ A;  1KK7 Z;  3DVJ A;  4NQG A;  2G9B A;  2LMT A;  4PHM A;  2JT3 A;  2KGR A;  1PK0 D;  1NX0 A;  2MLE C;  2F3Z A;  3TUY C;  3DD4 A;  1MXL C;  1JSA A;  3B7A A;  2AAO A;  4PHJ A;  1F4Q A;  4XYN A;  4YGD B;  1QLS A;  5CSI A;  3SIA A;  1S6J A;  1ORG A;  2PSR A;  4PE4 A;  2K7D A;  1F4O A;  3GK2 A;  2FCE A;  1DGV A;  5AER A;  4PCW A;  2KLD A;  1G4Y R;  1SRA A;  2WOS A;  1S1E A;  1FI5 A;  1JUO A;  5D69 A;  1NCX A;  1NPQ A;  3R72 A;  3NHT A;  3VGO A;  4NDD A;  1AJ5 A;  1IJ5 A;  5FI7 A;  4TNC A;  1XFW O;  1UWO A;  3D78 A;  2E6W A;  2PRU A;  2O5G A;  4IJ7 A;  3V2L A;  3B87 A;  4OV2 A;  3EK4 A;  3JTD C;  4PE1 A;  3SJS A;  2LLS A;  2F33 A;  2VRG A;  1QX7 A;  5CSN A;  4INX A;  3B6X A;  1ALW A;  2M0R A;  2QEB A;  2ZN9 A;  4INW A;  1B8C A;  1TWO A;  4AOM A;  1KWO B;  1HQV A;  3PFV A;  1OE9 B;  4ICB A;  3M0W A;  5CSJ A;  1MXE A;  1DJH A;  2QAC A;  1QIW A;  4JKT A;  4CLN A;  3TDU A;  1SL9 A;  2KFG A;  3O4Y A;  4CPV A;  3WHT B;  3BUO B;  2L50 A;  4AQI A;  4E68 A;  1B7T Y;  1KQM C;  2NCP A;  3VRO A;  2IS9 A;  3D75 A;  2LM5 A;  1BJF A;  1BU3 A;  3KEV A;  2JQ6 A;  2KAY A;  4KYN A;  4HRH A;  2MBX A;  1NP8 A;  1D1O A;  3LLE A;  1N0Y A;  3R1V A;  4M2Q A;  3PN7 C;  1B8R A;  2AUC A;  2ZKM X;  2BKH B;  3O6B A;  4YGB B;  4OKH A;  1GGW A;  3BOW A;  2KLE A;  1SR6 B;  1XA5 A;  4C0K A;  1BF5 A;  3KPX A;  2JNX A;  1FW4 A;  1TNP A;  1K94 A;  2LAN A;  1BMO A;  3N7H A;  1WDC C;  3FE6 A;  1RRO A;  4FQT A;  2EGD A;  3S0E A;  4PE0 A;  1B1G A;  2SAS A;  2WCJ A;  3SG2 A;  2I2R E;  1K93 D;  1AJ4 A;  5ER5 A;  1YUR A;  1J55 A;  1LXF C;  1BG1 A;  1QX2 A;  3S0F A;  1WRK A;  3IQQ A;  1FI6 A;  3SG6 A;  4QJ3 B;  1S6I A;  1IQ3 A;  1GJY A;  5ER4 X;  4MZL A;  2HF5 A;  2MAZ A;  3D74 A;  3CR5 X;  4PT1 A;  2L4H A;  1K90 D;  3D10 A;  3LCP C;  2JXC A;  1EXR A;  2KI4 C;  2V53 A;  3L4L A;  1S26 D;  1WLZ A;  3EVR A;  4GUK A;  5FI2 A;  3VRQ A;  3VRP A;  3S0G A;  2KQ6 A;  1IQ5 A;  1SBJ A;  1UP5 A;  1QX5 B;  3RZS A;  1H4B A;  1LIN A;  2M1K B;  3OX6 A;  3DVE A;  4MVF A;  3SS4 A;  3SG3 A;  1XFY O;  1CTR A;  1L2O B;  1OOF A;  2QEV A;  1TTX A;  3EVV A;  1KSM A;  5J3X A;  2QDI A;  4DIR A;  3BJH A;  1A75 A;  1OMV A;  2BCX A;  3OHM B;  2JNF A;  1YR5 A;  1CDM A;  2HQW A;  5KU1 A;  4F7F A;  2JT8 A;  2BKI B;  1KFX L;  1IG5 A;  4HRG A;  1QS7 A;  4YBH B;  2K60 A;  1CDL A;  2Y5I A;  5JOL A;  1YUS A;  3OP0 A;  2NZ0 A;  1QV1 A;  2MA2 A;  3VB1 A;  3ZNI A;  1S5G Z;  1X02 A;  2LE9 B;  1QJT A;  2I7A A;  4N5X A;  1BR1 B;  4JWQ A;  3CS1 A;  3FWC A;  1SMG A;  1YVH A;  2BE6 A;  4N1G A;  1OZO A;  2LC5 A;  3RM1 A;  2QEO A;  2LMV A;  5IBW A;  1AUI B;  4BY4 A;  3NSK A;  1QWV A;  1TNX A;  4HSZ A;  2QEH A;  1AVS A;  3BUW B;  3EVU A;  1A2X A;  1C7V A;  1SCM B;  1TOP A;  3ZWH A;  4A4C A;  1IH0 A;  3BXK A;  1ZAC A;  3AAK A;  1TUJ A;  1V1F A;  1CFC A;  2KOT A;  1WY9 A;  1GQM A;  5EL2 A;  3BYA A;  2TN4 A;  1M39 A;  1A75 B;  3EK8 A;  2DOQ A;  1K2H A;  3BFB A;  1KWO C;  2ZRT A;  4WRI A;  1NCY A;  1GM0 A;  4ORC B;  5B8I B;  3OGN A;  4DRW A;  1CFD A;  2GGM A;  4A4B A;  1XK4 A;  2D8N A;  2ISD A;  1UHJ A;  1LA3 A;  1OOG A;  4PDZ A;  1M63 B;  1NX1 A;  4DCK A;  2LHL A;  3E3R A;  2LAP A;  4QJ5 B;  1EH2 A;  1UHH A;  1M31 A;  1NCZ A;  1XYD A;  3MSE B;  2FCD A;  4MZJ A;  4Q04 A;  4PAL A;  1DTL A;  1UHK A;  2LV7 A;  2H8V A;  2FJU B;  3CZ1 A;  2NXQ A;  1BT6 A;  1CM1 A;  1SR6 C;  1K9U A;  2B1U A;  1FF1 A;  1UUS A;  2BEC A;  1SYM A;  1H8B A;  3OBV A;  1S6C A;  5D3O A;  4PHK A;  3FIA A;  1F8H A;  2L5X B;  3S0B A;  2WOR A;  1DVI A;  1YVL A;  2LP3 A;  3I5H B;  2PAS A;  4GPL B;  2K2F A;  1CFP A;  1CDP A;  1J1D A;  1QV0 A;  1NSH A;  4OCI A;  4C0L A;  1NX3 A;  1EL4 A;  2CCM A;  3L47 A;  5I94 A;  2KNE A;  1KSO A;  1U5I A;  5HL1 A;  4FTG A;  2KPH A;  2L5Y A;  2ZRS A;  3B86 A;  3FE8 A;  2M97 A;  3VRN A;  1NWD A;  1P28 A;  2L98 A;  1DJY A;  2M7N A;  1HT9 A;  2WCM A;  3BUX B;  1CNP A;  1W7I B;  1B9A A;  2CBL A;  1MF8 B;  2JTZ A;  1QIV A;  1OZS A;  2JPT A;  2KFF A;  3CTN A;  1J7O A;  1DJI A;  5FYX A;  4PHN A;  2BL0 B;  3GK1 A;  1BR4 B;  1L2O C;  5HYD A;  5CSF A;  1EJ3 A;  1G8I A;  2GV5 A;  1XO5 A;  2Y1N A;  4GFT A;  4MZK A;  1KK7 Y;  1CMG A;  3PLF B;  2G2B A;  1JBA A;  1JF0 A;  4OZD A;  3A4U B;  5DKN A;  1SCV A;  2LCP A;  2YGU A;  1KK8 B;  1YUU A;  2H2K A;  1MQ1 A;  2OS8 B;  3FE9 A;  1SPY A;  1DJW A;  1QLK A;  2KFH A;  1YX8 A;  3OB2 B;  2CXJ A;  2LVI A;  1BOC A;  2KAV A;  3TDI A;  1WRZ A;  1YRT B;  3C1V A;  1U5I B;  2K61 A;  3L4A A;  2R2I A;  3VRR A;  1IKU A;  1PVA A;  2KYC A;  1XFX O;  3NSL A;  3PM8 A;  1KFU L;  2LLU A;  2RGI A;  1R6P A;  3KO0 A;  3K1E A;  3D0Y A;  1W7J B;  4JQ0 D;  1A03 A;  1SCM C;  4MBE A;  2LVV A;  5HKZ A;  1LS8 A;  2NLN A;  2JTT A;  4YI8 A;  2WC6 A;  1NIW A;  1MHO A;  1NYA A;  5AXI A;  1QAS A;  1QAT A;  1N2D A;  3DVM A;  3I5F B;  5PAL A;  2WCL A;  1CLL A;  1TIZ A;  3I5G B;  3OB1 B;  2ZN8 A;  1S36 A;  4PE7 A;  1J7Q A;  4I5N B;  5I2Q A;  1Y6W A;  2M1U A;  1VRK A;  1B8L A;  1IWQ A;  2E30 A;  2HPS A;  1XFR A;  3BFA A;  4IL1 A;  2OPO A;  2F2O A;  2KBI A;  2GGZ A;  1TNW A;  5G08 A;  2M3W A;  1OOI X;  2PYQ A;  1J7P A;  3TS5 B;  1A4P A;  3EKJ A;  1DJX A;  2K8M B;  3PAL A;  2K7B A;  1R2U A;  3CR2 A;  4P2Y B;  3GOF A;  3QRX A;  1JC2 A;  1AK8 A;  2JOJ A;  3DY9 A;  5HKY A;  1IJ6 A;  1QVI Z;  3D0Y B;  1TCF A;  3JVT B;  5I2L A;  3UO9 A;  1L7Z A;  1C3Z A;  1MWN A;  3Q8I A;  1RJV A;  3BFH A;  4MRY A;  1EG3 A;  1TN4 A;  4YI9 A;  2JC2 A;  3RLZ A;  5D7F A;  1PRW A;  1UUR A;  1Y1A A;  1LKJ A;  3O2P A;  1UHN A;  2JWW A;  2A4J A;  3NHI A;  1CKK A;  3TDZ A;  3I5I B;  2F3Y A;  5JJG A;  3ICB A;  2M49 B;  2WCK A;  1F71 A;  3SG4 A;  4FQO A;  4I5J A;  3WHU B;  1RWY A;  2WCF A;  4ORA B;  3CLN A;  1BOD A;  4CFR A;  5F6T A;  1XK4 C;  2PMY A;  2WCB A;  4CFQ A;  2LLT A;  4BY5 A;  5DKR A;  2JRF A;  2L4I A;  2M29 A;  1C3Y A;  1SK6 D;  1N65 A;  4MN0 A;  3R1P A;  2K7C A;  3PAT A;  2LVK A;  2SCP A;  1OMD A;  1KFX S;  1TCO B;  2BL0 C;  1C07 A;  1QTX A;  4XJK B;  1ZMZ A;  2H61 A;  3EG5 B;  4OVN F;  3AAJ A;  2WCH A;  3EK7 A;  2ZFD A;  4N1F A;  3CZT X;  1JFK A;  4ORB B;  2L0P A;  3HX4 A;  3DF0 A;  3D76 A;  3K21 A;  2ERB A;  4I5L B;  4ZCV A;  1F70 A;  1B7T Z;  1LA0 A;  1K95 A;  2OS8 C;  1PAL A;  2F2P A;  2LUC A;  1SW8 A;  1S5G Y;  3CZ0 A;  3NSI A;  1DGU A;  1YRU B;  2KGB C;  3EKH A;  1NX2 A;  3NSO A;  1KCY A;  1OQP A;  1EG4 A;  5BPJ A;  1QVI Y;  1DC1 A;  4MRX A;  2K2A A;  4DUQ A;  4HRE E;  1KQV A;  4DS7 A;  2P70 A;  3GK4 X;  3F45 A;  2JZI A;  1MUX A;  3NXA A;  2LHI A;  4C0J A;  1SNL A;  3A8R A;  1DQE A;  1TUZ A;  3DYE A;  2MLF C;  1ZUZ A;  5DIC A;  3PSR A;  3IF7 A;  3SS3 A;  1CMF A;  1DMO A;  1GGZ A;  2WCE A;  3BUN B;  1DEL A;  1PSB A;  1ZOT B;  1XFU O;  1OSA A;  2LNK A;  4D1E A;  1DJZ A;  1PVB A;  2KSP A;  1YX7 A;  5AFP A;  2PAL A;  3WXA A;  2BCB A;  3BUM B;  4GBA A;  1SL7 A;  2EC6 B;  5GQQ C;  3I5F C;  1E8A A;  1K8U A;  3LK1 A;  5HKW A;  3DF0 B;  3TZ1 A;  1FPW A;  3I5G C;  2CTN A;  3KHE A;  2OTG B;  3FS7 A;  2HET A;  1WLM A;  1Q80 A;  1XVJ A;  4GGF C;  3CAB A;  5K89 A;  4MSP A;  3PM2 A;  2K0J A;  2BBN A;  4UPG A;  3SS5 A;  3AKA A;  1B4C A;  4AQJ A;  1TRF A;  3TS5 C;  1M46 A;  4GGF A;  2HQ8 A;  4GNK B;  1ALV A;  4I5K A;  3D73 A;  4ETO A;  2WC8 A;  2KBM A;  2NCO A;  2ZNE A;  2K7O A;  3DZT A;  2JUL A;  4MEW A;  4NDC A;  4YGA A;  5KTY A;  1REC A;  3CDN A;  1OMR A;  1PUL A;  1SSE B;  2JU0 A;  1OOH A;  3JVT C;  2I18 A;  3SIB A;  3TUY B;  2EHB A;  3QME A;  3H4S E;  1AHR A;  1XFV O;  1LVC D;  2L2E A;  1CDN A;  5TNC A;  2M9G A;  2WND A;  3IVT A;  1SKT A;  2JPO A;  1OOJ A;  4USL A;  3KF9 A;  4U8D A;  5DKQ A;  1Z2C B;  2COL B;  4QJ4 B;  2M8U A;  2CNP A;  2Q4U A;  3O78 A;  3I5I C;  2M7L A;  2PQL A;  4NDB A;  1AP4 A;  1F54 A;  1Y1X A;  2ZND A;  3CWG A;  1IGV A;  1M45 A;  4F0Z B;  2FJY A;  1SL8 A;  1WRL A;  3JTD B;  1B47 A;  1PSR A;  1ZFS A;  5AEQ A;  2P6B B;  5KSZ A;  2GTE A;  1DJG A;  2LVJ A;  2KHN A;  1MR8 A;  1DEK A;  1DT7 B;  4M2P A;  1IIO A;  2MHH A;  1JF2 A;  2P71 A;  5I2O A;  2CT9 A;  5AAN A;  2Q91 A;  2KQY A;  5I8N A;  1XFZ O;  1CM4 A;  3NGV A;  3LL8 B;  1S3P A;  2AMI A;  2BE4 A;  4GGN A;  1JWD A;  2PVB A;  4JD9 A;  2F8P A;  1KQM B;  1ODB A;  1NUB A;  4XJK A;  5HLV A;  2KDH A;  5CPV A;  1SY9 A;  3OX5 A;  2Y1M A;  3BOW B;  3CYZ A;  1KFU S;  1DF0 A;  4YGE B;  2Y4Q A;  4L9M A;  3WNX B;  2LP2 A;  1RK9 A;  2WC5 A;  3PN7 B;  1C7W A;  2BAP A;  2O60 A;  2JT0 A;  1K9P A;  1T14 A;  3CZ2 A;  3O4X A;  3I5H C;  1F55 A;  2L2C A;  1K9K A;  3DXL A;  1Y0V H;  3IQO A;  3CGA A;  5FI6 A;  1JFJ A;  3SG5 A;  1K96 A;  1WDC B;  4WQ3 A;  3S0A A;  2KI6 D;  1TNQ A;  1RTP 1;  3FWB A;  1W9Z A;  1CLM A;  3CR4 X;  2BCA A;  2QPT A;  3S0D A;  1J1E A;  4CID A;  4YGC B;  4GAO A;  2BNX A;  2KYF A;  2L51 A;  2MJW B;  2FOT A;  2H61 C;  4MLW A;  3HCM A;  2MRD A;  2EC6 C;  1UHI A;  4ZCU A;  1BLQ A;  2JXL A; 
#chains in the Genus database with same CATH homology
 4OR9 B;  4YRU A;  2KI4 B;  2LUX A;  3AKB A;  1J7R A;  4M2O A;  1A29 A;  1CLB A;  1YUT A;  2OTG C;  1CB1 A;  1IRJ A;  3DVK A;  1DF0 B;  1CFF A;  3LK0 A;  4P5O E;  5HLO A;  1KK8 C;  1QXP A;  2KAX A;  3SG7 A;  1YTZ C;  2I94 A;  1FBV A;  1Y1U A;  2LMU A;  4WQ2 A;  2KI6 C;  2BBM A;  1G33 A;  3BQ3 A;  1V1G A;  4JPZ B;  4R1E A;  1RFJ A;  1KK7 Z;  3DVJ A;  4NQG A;  2G9B A;  2LMT A;  4PHM A;  2JT3 A;  2KGR A;  1PK0 D;  1NX0 A;  2MLE C;  2F3Z A;  3TUY C;  3DD4 A;  1MXL C;  1JSA A;  2AAO A;  4PHJ A;  1F4Q A;  4XYN A;  4YGD B;  1QLS A;  5CSI A;  3SIA A;  1S6J A;  2PSR A;  4PE4 A;  2K7D A;  1F4O A;  3GK2 A;  2FCE A;  1DGV A;  5AER A;  4PCW A;  1G4Y R;  1SRA A;  2WOS A;  1S1E A;  1FI5 A;  1JUO A;  5D69 A;  1NCX A;  1NPQ A;  3VGO A;  4NDD A;  1AJ5 A;  1IJ5 A;  4TNC A;  1XFW O;  1UWO A;  2E6W A;  2PRU A;  2O5G A;  4OV2 A;  3EK4 A;  3JTD C;  4PE1 A;  3SJS A;  2LLS A;  2F33 A;  2VRG A;  1QX7 A;  5CSN A;  1ALW A;  2M0R A;  2ZN9 A;  4AOM A;  1B8C A;  1KWO B;  1HQV A;  3PFV A;  1OE9 B;  4ICB A;  3M0W A;  5CSJ A;  1MXE A;  1DJH A;  2QAC A;  1QIW A;  4CLN A;  3TDU A;  1SL9 A;  2KFG A;  3O4Y A;  4CPV A;  3WHT B;  3BUO B;  2L50 A;  4AQI A;  4E68 A;  1B7T Y;  1KQM C;  2NCP A;  3VRO A;  2IS9 A;  2LM5 A;  1BJF A;  1BU3 A;  3KEV A;  2JQ6 A;  2KAY A;  4HRH A;  2MBX A;  1NP8 A;  1D1O A;  3LLE A;  1N0Y A;  4M2Q A;  3PN7 C;  1B8R A;  2AUC A;  2ZKM X;  2BKH B;  3O6B A;  4YGB B;  4OKH A;  1GGW A;  3BOW A;  1SR6 B;  1XA5 A;  4C0K A;  1BF5 A;  3KPX A;  2JNX A;  1FW4 A;  1TNP A;  1K94 A;  2LAN A;  1BMO A;  1B1G A;  1WDC C;  1RRO A;  2EGD A;  4PE0 A;  2SAS A;  3SG2 A;  2I2R E;  1K93 D;  1AJ4 A;  5ER5 A;  1YUR A;  1J55 A;  1LXF C;  1BG1 A;  1QX2 A;  1WRK A;  3IQQ A;  1FI6 A;  3SG6 A;  4QJ3 B;  1S6I A;  1IQ3 A;  1GJY A;  5ER4 X;  4MZL A;  2HF5 A;  2MAZ A;  3CR5 X;  2L4H A;  1K90 D;  3D10 A;  3LCP C;  2JXC A;  1EXR A;  2KI4 C;  2V53 A;  4GUK A;  1S26 D;  1WLZ A;  3EVR A;  3VRQ A;  3VRP A;  2KQ6 A;  1IQ5 A;  1SBJ A;  1UP5 A;  1QX5 B;  1H4B A;  1LIN A;  2M1K B;  3OX6 A;  3DVE A;  4MVF A;  3SG3 A;  1XFY O;  1CTR A;  1L2O B;  3EVV A;  1TTX A;  1KSM A;  5J3X A;  4DIR A;  1A75 A;  1OMV A;  2BCX A;  3OHM B;  2JNF A;  1YR5 A;  1CDM A;  2HQW A;  5KU1 A;  2JT8 A;  2BKI B;  1KFX L;  1IG5 A;  4HRG A;  1QS7 A;  4YBH B;  2Y5I A;  1CDL A;  5JOL A;  1YUS A;  3OP0 A;  2NZ0 A;  1QV1 A;  2MA2 A;  3ZNI A;  1S5G Z;  1X02 A;  2LE9 B;  1QJT A;  2I7A A;  4N5X A;  1BR1 B;  4JWQ A;  3CS1 A;  3FWC A;  1SMG A;  1YVH A;  2BE6 A;  4N1G A;  1OZO A;  2LC5 A;  3RM1 A;  2LMV A;  5IBW A;  1AUI B;  4BY4 A;  3NSK A;  1TNX A;  4HSZ A;  1AVS A;  3BUW B;  3EVU A;  1A2X A;  1C7V A;  1SCM B;  1TOP A;  3ZWH A;  4A4C A;  1IH0 A;  3BXK A;  1ZAC A;  3AAK A;  1V1F A;  1CFC A;  2KOT A;  1WY9 A;  1GQM A;  3BYA A;  2TN4 A;  1M39 A;  1A75 B;  3EK8 A;  2DOQ A;  1K2H A;  1KWO C;  2ZRT A;  4WRI A;  1NCY A;  4ORC B;  5B8I B;  4DRW A;  1CFD A;  2GGM A;  4A4B A;  1XK4 A;  2D8N A;  2ISD A;  1UHJ A;  1LA3 A;  4PDZ A;  1M63 B;  1NX1 A;  4DCK A;  2LHL A;  3E3R A;  2LAP A;  4QJ5 B;  1EH2 A;  1UHH A;  1M31 A;  1NCZ A;  1XYD A;  3MSE B;  2FCD A;  4MZJ A;  4Q04 A;  4PAL A;  1DTL A;  1UHK A;  2LV7 A;  2FJU B;  2NXQ A;  1BT6 A;  1CM1 A;  1SR6 C;  1K9U A;  2B1U A;  1FF1 A;  1UUS A;  2BEC A;  1SYM A;  1H8B A;  1S6C A;  4PHK A;  3FIA A;  1F8H A;  2L5X B;  2WOR A;  1DVI A;  1YVL A;  2LP3 A;  3I5H B;  2PAS A;  4GPL B;  2K2F A;  1CFP A;  1CDP A;  1J1D A;  1QV0 A;  1NSH A;  4OCI A;  4C0L A;  1NX3 A;  1EL4 A;  2CCM A;  2KNE A;  1KSO A;  1U5I A;  4FTG A;  2ZRS A;  2M97 A;  3VRN A;  1NWD A;  2M7N A;  2L98 A;  1DJY A;  1HT9 A;  3BUX B;  1CNP A;  1W7I B;  1B9A A;  2CBL A;  1MF8 B;  2JTZ A;  1QIV A;  1OZS A;  2JPT A;  2KFF A;  3CTN A;  1J7O A;  1DJI A;  5FYX A;  4PHN A;  2BL0 B;  3GK1 A;  1BR4 B;  1L2O C;  5HYD A;  5CSF A;  1EJ3 A;  1G8I A;  2GV5 A;  1XO5 A;  2Y1N A;  4GFT A;  4MZK A;  1KK7 Y;  1CMG A;  3PLF B;  2G2B A;  1JBA A;  1JF0 A;  3A4U B;  5DKN A;  1SCV A;  2LCP A;  1KK8 B;  1YUU A;  2H2K A;  1MQ1 A;  2OS8 B;  1SPY A;  1DJW A;  1QLK A;  2KFH A;  1YX8 A;  3OB2 B;  2CXJ A;  2LVI A;  1BOC A;  2KAV A;  3TDI A;  1WRZ A;  1YRT B;  3C1V A;  1U5I B;  2K61 A;  3VRR A;  2R2I A;  1IKU A;  1PVA A;  2KYC A;  1XFX O;  3NSL A;  3PM8 A;  1KFU L;  2LLU A;  2RGI A;  1R6P A;  3KO0 A;  3D0Y A;  1W7J B;  4JQ0 D;  1A03 A;  1SCM C;  4MBE A;  2LVV A;  5HKZ A;  2NLN A;  2JTT A;  4YI8 A;  1NIW A;  1MHO A;  1NYA A;  5AXI A;  1QAS A;  1QAT A;  1N2D A;  3DVM A;  3I5F B;  5PAL A;  1CLL A;  1TIZ A;  3I5G B;  3OB1 B;  2ZN8 A;  1S36 A;  4PE7 A;  1J7Q A;  4I5N B;  5I2Q A;  1Y6W A;  2M1U A;  1VRK A;  1B8L A;  1IWQ A;  2E30 A;  2HPS A;  4IL1 A;  2OPO A;  2F2O A;  2KBI A;  2GGZ A;  1TNW A;  5G08 A;  2M3W A;  1J7P A;  3TS5 B;  1A4P A;  3EKJ A;  1DJX A;  2K8M B;  3PAL A;  2K7B A;  1R2U A;  3CR2 A;  4P2Y B;  3GOF A;  3QRX A;  1JC2 A;  1AK8 A;  2JOJ A;  5HKY A;  1IJ6 A;  1QVI Z;  3D0Y B;  1TCF A;  3JVT B;  5I2L A;  1L7Z A;  1MWN A;  1RJV A;  4MRY A;  1EG3 A;  1TN4 A;  4YI9 A;  2JC2 A;  3RLZ A;  5D7F A;  1PRW A;  1UUR A;  1Y1A A;  1LKJ A;  3O2P A;  1UHN A;  2JWW A;  2A4J A;  1CKK A;  3TDZ A;  3I5I B;  2F3Y A;  5JJG A;  3ICB A;  2M49 B;  1F71 A;  3SG4 A;  4FQO A;  4I5J A;  3WHU B;  1RWY A;  2WCF A;  4ORA B;  3CLN A;  1BOD A;  4CFR A;  5F6T A;  1XK4 C;  2PMY A;  2WCB A;  4CFQ A;  2LLT A;  4BY5 A;  5DKR A;  2JRF A;  2L4I A;  2M29 A;  1SK6 D;  1N65 A;  4MN0 A;  2K7C A;  3PAT A;  2LVK A;  2SCP A;  1OMD A;  1KFX S;  1TCO B;  2BL0 C;  1C07 A;  1QTX A;  4XJK B;  1ZMZ A;  2H61 A;  4OVN F;  3AAJ A;  3EK7 A;  2ZFD A;  4N1F A;  3CZT X;  1JFK A;  4ORB B;  2L0P A;  3HX4 A;  3DF0 A;  3K21 A;  4ZCV A;  4I5L B;  1F70 A;  1B7T Z;  1LA0 A;  1K95 A;  2OS8 C;  1PAL A;  2F2P A;  2LUC A;  1SW8 A;  1S5G Y;  3NSI A;  1DGU A;  1YRU B;  2KGB C;  3EKH A;  1NX2 A;  3NSO A;  1KCY A;  1OQP A;  1EG4 A;  5BPJ A;  1QVI Y;  4MRX A;  2K2A A;  4DUQ A;  4HRE E;  1KQV A;  4DS7 A;  3GK4 X;  3F45 A;  2JZI A;  1MUX A;  3NXA A;  2LHI A;  4C0J A;  1SNL A;  3A8R A;  2MLF C;  1ZUZ A;  3PSR A;  3IF7 A;  1CMF A;  1DMO A;  1GGZ A;  2WCE A;  3BUN B;  1PSB A;  1ZOT B;  1XFU O;  1OSA A;  2LNK A;  4D1E A;  1DJZ A;  1PVB A;  2KSP A;  1YX7 A;  5AFP A;  2PAL A;  3WXA A;  2BCB A;  3BUM B;  4GBA A;  1SL7 A;  2EC6 B;  5GQQ C;  3I5F C;  1E8A A;  1K8U A;  3LK1 A;  5HKW A;  3DF0 B;  3TZ1 A;  1FPW A;  3I5G C;  2CTN A;  3KHE A;  2OTG B;  3FS7 A;  2HET A;  1WLM A;  1Q80 A;  1XVJ A;  4GGF C;  5K89 A;  4MSP A;  2K0J A;  2BBN A;  4UPG A;  3AKA A;  1B4C A;  4AQJ A;  1TRF A;  3TS5 C;  1M46 A;  4GGF A;  2HQ8 A;  4GNK B;  1ALV A;  4I5K A;  4ETO A;  2WC8 A;  2KBM A;  2NCO A;  2ZNE A;  2K7O A;  4MEW A;  2JUL A;  4NDC A;  4YGA A;  5KTY A;  1REC A;  1OMR A;  1PUL A;  2JU0 A;  3JVT C;  2I18 A;  3SIB A;  3TUY B;  2EHB A;  3H4S E;  1AHR A;  1XFV O;  1LVC D;  2L2E A;  1CDN A;  5TNC A;  2M9G A;  2WND A;  1SKT A;  1OOJ A;  4USL A;  3KF9 A;  4U8D A;  5DKQ A;  2COL B;  4QJ4 B;  2M8U A;  2CNP A;  2Q4U A;  3O78 A;  3I5I C;  2M7L A;  1AP4 A;  4NDB A;  1F54 A;  1Y1X A;  2ZND A;  3CWG A;  1IGV A;  1M45 A;  4F0Z B;  1SL8 A;  1WRL A;  3JTD B;  1B47 A;  1PSR A;  1ZFS A;  5AEQ A;  2P6B B;  5KSZ A;  1DJG A;  2LVJ A;  2KHN A;  1MR8 A;  1DT7 B;  4M2P A;  2MHH A;  1JF2 A;  5I2O A;  2CT9 A;  5AAN A;  2Q91 A;  2KQY A;  5I8N A;  1XFZ O;  1CM4 A;  3LL8 B;  1S3P A;  2AMI A;  2BE4 A;  4GGN A;  1JWD A;  2PVB A;  2F8P A;  1KQM B;  1ODB A;  1NUB A;  4XJK A;  5HLV A;  2KDH A;  5CPV A;  1SY9 A;  3OX5 A;  2Y1M A;  3BOW B;  1KFU S;  1DF0 A;  4YGE B;  2Y4Q A;  4L9M A;  3WNX B;  2LP2 A;  1RK9 A;  3PN7 B;  1C7W A;  2O60 A;  2JT0 A;  1K9P A;  3I5H C;  1F55 A;  1K9K A;  3IQO A;  1Y0V H;  3CGA A;  1JFJ A;  3SG5 A;  1K96 A;  1WDC B;  4WQ3 A;  2KI6 D;  1TNQ A;  1RTP 1;  3FWB A;  1CLM A;  3CR4 X;  2BCA A;  2QPT A;  1J1E A;  4CID A;  4YGC B;  4GAO A;  2KYF A;  2L51 A;  2MJW B;  2FOT A;  2H61 C;  4MLW A;  3HCM A;  2MRD A;  2EC6 C;  1UHI A;  4ZCU A;  1BLQ A;  2JXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...