4FTGA

The crystal structure of an ahnak peptide in complex with the s100a10/anxa2 heterotetramer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
b'PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A10
publication title Structure of a C-terminal AHNAK peptide in a 1:2:2 complex with S100A10 and an acetylated N-terminal peptide of annexin A2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein/protein binding
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ftgA00
2JXCA 3AAJA 1WRLA 4NDBA 2CNPA 1WDCB 4ETOA 2ZRTA 5KTYA 1J7PA 1M46A 3PLFB 4DCKA 3H4SE 4OCIA 1K93D 1TIZA 3PFVA 1LINA 2Y1NA 3DVEA 3EK8A 5I2QA 1K90D 2H61A 1OSAA 1ALVA 3JVTB 4I5LB 4A4CA 1GJYA 1CFDA 1LVCD 1LKJA 1JBAA 2K7BA 3DF0B 1B8RA 1XFZO 4NQGA 3SIBA 1ZOTB 4E68A 1J7QA 4WQ2A 2L4HA 2CT9A 2M1KB 1NX3A 1PK0D 3I5IC 3FIAA 2M3WA 4M2PA 2KYFA 1EL4A 1TOPA 2BKIB 2COLB 1TN4A 2JNXA 1NCXA 4NDDA 1EH2A 1JFKA 2JXLA 2MAZA 4TNCA 5DKRA 2M7LA 4PHKA 2FCDA 4DIRA 5IBWA 2L5XB 2BCXA 4I5NB 3D0YB 1XFXO 1OMDA 2G2BA 1EG4A 5AANA 1NX2A 4R1EA 2LCPA 3BUMB 2A4JA 4FQOA 2Q4UA 2WOSA 1QX7A 2NCPA 2ZNDA 3FS7A 3VRQA 1QV0A 3CR4X 1DJGA 1XK4C 2F3YA 3KEVA 3DF0A 3DVJA 3GK4X 4DRWA 1PRWA 2BE6A 2LVIA 5AERA 1NCYA 1S5GZ 1K96A 5HKWA 1AUIB 4MLWA 2WCEA 4PE0A 4D1EA 1BLQA 2K7OA 2R2IA 1SL9A 1Y1XA 4JWQA 3CGAA 1TCOB 1NP8A 4PHMA 4ORAB 1UHJA 1QASA 2JZIA 3VGOA 3DVMA 2JTTA 2FJUB 1SYMA 3NSOA 4YBHB 1J7RA 1S6IA 1CLBA 1IJ5A 3TUYB 2L50A 3D10A 2K0JA 1SL7A 3I5GB 1K95A 1TRFA 2F2OA 5CSFA 1SNLA 3PM8A 3SIAA 1NUBA 1RROA 1VRKA 3LCPC 1EJ3A 3VRNA 4L9MA 2KSPA 2AMIA 1F70A 1QVIZ 3IF7A 1SKTA 2K61A 2QPTA 1CMFA 2WCFA 2KAVA 1F8HA 3LK1A 1KSOA 1KFUL 1K8UA 1YR5A 1IJ6A 4YI8A 2VRGA 3FWBA 4QJ5B 5I8NA 4YGBB 2MA2A 1CDMA 1R2UA 3EVRA 4ORCB 2M8UA 2BKHB 3OB1B 4PDZA 3WNXB 3CR2A 1S6JA 1CKKA 2M29A 2F2PA 2I94A 3WHTB 4CFQA 2CTNA 3QRXA 2F33A 1CTRA 2F8PA 3KPXA 2JT0A 1A75A 1N65A 1K9UA 4MZKA 1PVBA 1QLSA 1XVJA 2JULA 1TNPA 1ZFSA 1QLKA 2KI6D 1NX1A 2Y4QA 5K89A 3OX5A 1FI5A 1FF1A 2PALA 1K2HA 1BR1B 1KK8C 2KDHA 1MHOA 5JJGA 2KAYA 4CLNA 1SY9A 1QXPA 2RGIA 2NCOA 1JC2A 5D69A 1JF0A 2L98A 1M45A 1WLMA 2M9GA 3JTDB 4GPLB 4YI9A 1K9KA 3O78A 1IQ5A 2OPOA 4GUKA 1F55A 2ZN8A 4U8DA 3CWGA 2JU0A 1UUSA 2BCBA 5BPJA 1OMVA 1H4BA 1YRUB 1QV1A 1WRKA 1KFUS 2JT3A 1A2XA 2PMYA 1JWDA 1Q80A 1QTXA 1SMGA 2JC2A 1MWNA 2LVKA 2EC6B 4YGCB 1ODBA 2H2KA 5G08A 1SCMB 1PSBA 3CLNA 2L4IA 3DD4A 2LP2A 1BU3A 3I5FB 3SG4A 1KSMA 3GK2A 1F71A 1TNWA 1Y0VH 1CM4A 5DKNA 1DGVA 4PHNA 1MXEA 1XA5A 3CS1A 1AJ4A 2LHIA 2LUCA 1AJ5A 1LA0A 5DKQA 4GBAA 2KAXA 4OKHA 3GK1A 1QIVA 2O60A 1KFXL 1F4OA 1M31A 2I2RE 4N1GA 1B4CA 3EK4A 1ZACA 1OMRA 2LMUA 1WLZA 2MHHA 2E30A 3I5IB 3SG2A 1YUUA 2BCAA 4M2OA 3OX6A 1N0YA 1FBVA 1YVHA 4GGFC 1KWOC 1S3PA 1NPQA 4QJ3B 3VRPA 2HETA 1RJVA 3CZTX 1KQMC 3E3RA 2MBXA 5HYDA 1WRZA 1S5GY 5ER5A 2CCMA 1DVIA 4P5OE 2LP3A 1IKUA 3O6BA 1MF8B 2KFFA 3VRRA 4AOMA 1CB1A 3EVVA 4C0KA 4GAOA 4HRGA 1QX2A 3BOWB 2JPTA 3GOFA 2WORA 1U5IB 3CTNA 3PATA 3PN7C 2B1UA 1B8CA 4C0LA 1UHNA 1HQVA 2GV5A 2KBMA 3IQQA 3WHUB 2AAOA 2KGRA 1YX7A 1FPWA 2JT8A 1BODA 4IL1A 1KCYA 1B1GA 2LMTA 2KBIA 3HCMA 3KHEA 1S6CA 2ZFDA 3PN7B 3TS5C 1S1EA 3D0YA 5FYXA 3HX4A 1XFUO 4F0ZB 5B8IB 1JSAA 1MUXA 3M0WA 2BE4A 3AAKA 1QIWA 1QVIY 2P6BB 2PVBA 3MSEB 2HF5A 1NSHA 2K7DA 3CR5X 3O4YA 2IS9A 1XFYO 4GGFA 3TS5B 2V53A 2WNDA 2I18A 4GNKB 5AXIA 4PCWA 1BMOA 3KF9A 4MSPA 3NSLA 5ER4X 1DGUA 3BOWA 1GQMA 1U5IA 1DTLA 1G33A 3PALA 1V1GA 1XK4A 3PSRA 4C0JA 1CFPA 4XYNA 4N5XA 5F6TA 1M63B 2WCBA 3EKHA 2MLEC 3F45A 1ALWA 1SK6D 4YRUA 2I7AA 1J1EA 1PVAA 1QATA 1UHIA 2BBMA 3SG7A 2JOJA 1FI6A 1BR4B 1YX8A 4USLA 1XFVO 3BXKA 1B7TZ 1UP5A 1OE9B 5GQQC 1DJYA 3O2PA 1IG5A 4GGNA 1Y1AA 1A29A 3WXAA 1OZSA 1C07A 1GGZA 2MLFC 4XJKB 4MRXA 2WC8A 2LUXA 1YRTB 1IH0A 4HRHA 2ZKMX 1CDNA 2LE9B 1W7JB 4M2QA 5HKYA 1M39A 5D7FA 2H61C 4NDCA 1N2DA 1YUSA 5JOLA 1DJHA 4I5KA 1CDLA 2GGMA 2AUCA 1A03A 2M0RA 2L51A 2KQYA 1Y1UA 1KK8B 1XO5A 1CMGA 2Y5IA 3TDUA 4BY5A 4CFRA 2L2EA 2LM5A 1B47A 1ZMZA 2LC5A 2SASA 3ICBA 3EK7A 4MRYA 2LMVA 1NWDA 4WQ3A 1KK7Y 3A8RA 3TDZA 4CIDA 1CLMA 1CNPA 2BBNA 2M97A 2K8MB 2JTZA 2LLSA 2K2AA 1SBJA 1OZOA 2LV7A 1KK7Z 1DJXA 2LHLA 1UHKA 4ZCVA 3OP0A 1F4QA 4CPVA 1FW4A 2FCEA 2JQ6A 1AVSA 3A4UB 3IQOA 1TNXA 3BYAA 1OOJA 5HLVA 3TDIA 1SCVA 4BY4A 3JVTC 4PHJA 2EHBA 3OHMB 5TNCA 2KNEA 2HQWA 1PALA 2HPSA 3C1VA 2KI6C 1K94A 1YUTA 2KFGA 1B9AA 1C7WA 1UHHA 2FOTA 5CSNA 2JNFA 1J7OA 1F54A 4AQIA 3EKJA 1JFJA 5AFPA 2KI4C 1PSRA 2GGZA 2K2FA 1NIWA 1DMOA 4OV2A 1RWYA 1EG3A 1RFJA 1KQVA 3K21A 1DJZA 2LLUA 4PE7A 5CSIA 4DUQA 1MXLC 3BUXB 4P2YB 1DF0B 3TZ1A 4AQJA 2PSRA 2PRUA 1KWOB 2KI4B 1X02A 4ORBB 4FTGA 4YGEB 5J3XA 2JRFA 2LVJA 1KQMB 2KFHA 1AHRA 4A4BA 1D1OA 3SG5A 1CFCA 1QX5B 4UPGA 1LXFC 1UWOA 3SG3A 2NLNA 1AP4A 1SR6C 2ZRSA 5AEQA 1UURA 4YGAA 1IRJA 2G9BA 1L2OC 4OR9B 2ISDA 1BF5A 1IGVA 1SW8A 1EXRA 1GGWA 1S36A 1G8IA 3BQ3A 2PASA 1J55A 3SG6A 3BUWB 3DVKA 5CSJA 4MVFA 1BJFA 5HKZA 1XFWO 1XYDA 2Y1MA 1KFXS 3AKBA 1SR6B 4HSZA 2M7NA 1RECA 4N1FA 3SJSA 1L2OB 4JQ0D 1SL8A 2KQ6A 1S26D 2JWWA 3TUYC 1DF0A 2KHNA 1A4PA 1K9PA 1QJTA 1RK9A 2F3ZA 3I5GC 3KO0A 1CFFA 3OB2B 1JF2A 3FWCA 2BL0C 3BUNB 1AK8A 1H8BA 2E6WA 1J1DA 1L7ZA 2MRDA 3LK0A 2M1UA 2MJWB 1Y6WA 5HLOA 3AKAA 4Q04A 4GFTA 1DJIA 1ZUZA 2D8NA 2KGBC 4MN0A 4MZJA 5I2LA 2BL0B 1A75B 4HREE 1B7TY 2KYCA 2LVVA 1PULA 1TNQA 4DS7A 2L0PA 1SPYA 1NCZA 1CDPA 2ZNEA 3VROA 2SCPA 1C7VA 2CXJA 3NSIA 5PALA 4I5JA 1CM1A 3EVUA 3NSKA 1G4YR 4PE4A 2OTGC 1YTZC 1LA3A 2DOQA 2ZN9A 2O5GA 2HQ8A 1DT7B 3LLEA 1IQ3A 2EGDA 4YGDB 1R6PA 3NXAA 4MEWA 3ZNIA 1RTP1 1BG1A 2CBLA 1IWQA 2LNKA 2K7CA 2LANA 4WRIA 1NYAA 5CPVA 2OTGB 4PE1A 2BECA 1B8LA 5I2OA 2OS8C 1TTXA 1TCFA 2NXQA 1BOCA 1WY9A 2M49B 4ZCUA 4QJ4B 1JUOA 2NZ0A 4ICBA 1MQ1A 1MR8A 1NX0A 4MZLA 4PALA 1E8AA 1W7IB 3LL8B 3RM1A 1SRAA 1HT9A 2OS8B 2KOTA 3JTDC 3I5HC 5KSZA 1BT6A 2LLTA 1YVLA 3BUOB 1OQPA 5KU1A 4JPZB 1DJWA 4XJKA 1QS7A 1CLLA 1WDCC 3ZWHA 1V1FA 2EC6C 2LAPA 2QACA 3I5HB 1SCMC 4MBEA 4OVNF 1YURA 3I5FC 3RLZA 2TN4A 2Q91A
chains in the Genus database with same CATH superfamily
2JXCA 3AAJA 1WRLA 4NDBA 2CNPA 1WDCB 4ETOA 2ZRTA 5KTYA 1J7PA 1M46A 3BFHA 3PLFB 4DCKA 3H4SE 4OCIA 5I94A 1K93D 1TIZA 3PFVA 1LINA 2Y1NA 3DVEA 3EK8A 5I2QA 1K90D 2H61A 4FQTA 1OSAA 1ALVA 3JVTB 4I5LB 4A4CA 1GJYA 1CFDA 1LVCD 1LKJA 1JBAA 2K7BA 3DF0B 1B8RA 1XFZO 4NQGA 3SIBA 1ZOTB 4E68A 1J7QA 1P28A 3IVTA 3DZTA 4INWA 2L4HA 4WQ2A 1OW4A 2CT9A 2M1KB 1NX3A 1PK0D 3I5IC 3FIAA 3DYEA 2M3WA 4M2PA 2KYFA 1EL4A 3B7AA 1TOPA 2BKIB 2QEHA 2COLB 1TN4A 2JNXA 1NCXA 4NDDA 1EH2A 1JFKA 2JXLA 2MAZA 3SS5A 4TNCA 5DKRA 2JPOA 2M7LA 4PHKA 2FCDA 4DIRA 5IBWA 2QDIA 3UNWA 2L5XB 2BCXA 4I5NB 3D0YB 1XFXO 1OMDA 2G2BA 1EG4A 5AANA 1NX2A 1TUJA 4R1EA 2LCPA 3BUMB 5D3OA 2A4JA 4FQOA 3S0GA 2Q4UA 2WOSA 1QX7A 2NCPA 2ZNDA 3FS7A 3VRQA 1QV0A 3CR4X 1DJGA 1XK4C 2F3YA 3KEVA 2WCLA 3O4XA 3DF0A 3DVJA 3GK4X 4DRWA 3S0EA 1PRWA 2BE6A 2LVIA 5AERA 1NCYA 1S5GZ 1K96A 3Q8IA 5HKWA 1AUIB 4MLWA 2WCEA 1OOHA 4PE0A 4D1EA 1BLQA 2K7OA 1DEKA 2R2IA 1SL9A 1Y1XA 4JWQA 3CGAA 1TCOB 1NP8A 4PHMA 4ORAB 1UHJA 1QASA 2JZIA 3VGOA 3DVMA 2JTTA 2FJUB 1SYMA 3NSOA 4YBHB 1J7RA 1S6IA 1CLBA 1IJ5A 3TUYB 2L50A 3D10A 2K0JA 1SL7A 3EG5B 3I5GB 1K95A 2FJYA 1TRFA 2F2OA 5CSFA 1SNLA 3PM8A 3SIAA 1NUBA 1RROA 1VRKA 3LCPC 1EJ3A 3VRNA 4L9MA 2KSPA 2AMIA 1F70A 1QVIZ 3IF7A 1SKTA 2K61A 2QPTA 3DY9A 1CMFA 2WCFA 2KAVA 1F8HA 3LK1A 1KSOA 1KFUL 3NHTA 1K8UA 1YR5A 2WCJA 3R72A 1IJ6A 4YI8A 2VRGA 3B6XA 3S0FA 3FWBA 4QJ5B 5I8NA 3CZ2A 2MA2A 3D77A 4YGBB 2WCHA 3SS3A 1CDMA 1R2UA 3EVRA 4ORCB 2M8UA 2BKHB 3OB1B 4PDZA 3WNXB 3CR2A 1S6JA 4IJ7A 1CKKA 2M29A 2F2PA 2I94A 3WHTB 4CFQA 1XFRA 2PQLA 2CTNA 3QRXA 2F33A 1CTRA 2F8PA 3KPXA 2JT0A 1A75A 1N65A 1K9UA 4MZKA 1PVBA 1QLSA 1XVJA 3OBVA 2JULA 1TNPA 1ZFSA 1QLKA 2KI6D 1NX1A 2Y4QA 5K89A 3OX5A 1FI5A 1FF1A 2PALA 1K2HA 1BR1B 1KK8C 2KDHA 1IIOA 1MHOA 5JJGA 2KAYA 4CLNA 1SY9A 2K60A 1QXPA 2BNXA 2RGIA 2NCOA 1JC2A 2QEBA 5D69A 1JF0A 2L98A 1M45A 1WLMA 2M9GA 3JTDB 3K1EA 4GPLB 1K9KA 4YI9A 3O78A 1IQ5A 2OPOA 2WCMA 4GUKA 1F55A 2ZN8A 4U8DA 3CWGA 2JU0A 1UUSA 2BCBA 5BPJA 1OMVA 1H4BA 1YRUB 1QV1A 1WRKA 2QEOA 3N7HA 1KFUS 2JT3A 1A2XA 2PMYA 2YGUA 1JWDA 1Q80A 1QTXA 1SMGA 2JC2A 1MWNA 2LVKA 2EC6B 4YGCB 1ODBA 2H2KA 5G08A 1SCMB 3D74A 1PSBA 3CLNA 2L4IA 3DD4A 2LP2A 1BU3A 3I5FB 3SG4A 1KSMA 3GK2A 1F71A 1TNWA 1Y0VH 1CM4A 5DKNA 1DGVA 4PHNA 1MXEA 1XA5A 3CS1A 4OZDA 1AJ4A 2LHIA 2LUCA 1AJ5A 1LA0A 5DKQA 4GBAA 2KAXA 4OKHA 3S0DA 3GK1A 1QIVA 2O60A 3B86A 2KLEA 1C3ZA 1KFXL 1F4OA 1M31A 1OOIX 2I2RE 4N1GA 1B4CA 3EK4A 1ZACA 1OMRA 2LMUA 1WLZA 2MHHA 2E30A 3I5IB 4F7FA 3SG2A 1YUUA 2BCAA 4M2OA 3OGNA 1N0YA 3OX6A 1FBVA 1YVHA 4GGFC 1KWOC 3L4AA 3FE9A 1S3PA 1NPQA 4QJ3B 3VRPA 2HETA 1RJVA 3CZTX 1KQMC 3E3RA 2MBXA 1GM0A 5HYDA 1WRZA 1S5GY 5ER5A 2CCMA 1DVIA 4P5OE 2LP3A 1IKUA 3O6BA 1MF8B 2KFFA 1Z2CB 3CZ0A 3VRRA 4AOMA 1CB1A 3EVVA 4C0KA 3NGVA 4GAOA 4HRGA 1QX2A 3BOWB 2JPTA 3GOFA 2WORA 1U5IB 3CTNA 3PATA 3PJIA 3PN7C 3CZ1A 2B1UA 1B8CA 4C0LA 1UHNA 1HQVA 2GV5A 2KBMA 3IQQA 3R1VA 3WHUB 2AAOA 2KGRA 1YX7A 2PYQA 2JT8A 5FI2A 1FPWA 5EL2A 1BODA 4IL1A 1KCYA 1B1GA 2LMTA 2KBIA 3HCMA 3KHEA 1S6CA 2ZFDA 3PN7B 3TS5C 1S1EA 3D0YA 3D73A 5FYXA 3HX4A 1XFUO 4F0ZB 5B8IB 3S0BA 1JSAA 1MUXA 3M0WA 2BE4A 3AAKA 1QIWA 1QVIY 2P6BB 2PVBA 3MSEB 2HF5A 1NSHA 2K7DA 3CR5X 3O4YA 2IS9A 1XFYO 3FE6A 4GGFA 2V53A 2WNDA 3TS5B 2I18A 4GNKB 1TWOA 5AXIA 4PCWA 1BMOA 3KF9A 4MSPA 3NSLA 5FI7A 5ER4X 1DGUA 3BOWA 1GQMA 1U5IA 2P71A 1DTLA 1G33A 3PALA 1V1GA 1XK4A 3PSRA 4C0JA 1CFPA 4XYNA 2BAPA 4N5XA 5F6TA 5FI6A 1M63B 2WCBA 3EKHA 2MLEC 3F45A 1ALWA 1SK6D 4YRUA 4PT1A 2I7AA 1J1EA 1PVAA 1QATA 1UHIA 2BBMA 3SG7A 2JOJA 1FI6A 1BR4B 1YX8A 4USLA 1XFVO 3BXKA 1B7TZ 1UP5A 1OE9B 5GQQC 1DJYA 3O2PA 1IG5A 4GGNA 3QMEA 1Y1AA 1A29A 3WXAA 1OZSA 1C07A 1GGZA 2MLFC 2KPHA 1DC1A 4XJKB 4MRXA 2WC8A 2LUXA 1YRTB 1IH0A 4HRHA 2ZKMX 1CDNA 2LE9B 1W7JB 2WCKA 4M2QA 5HKYA 1M39A 5D7FA 2H61C 4NDCA 1N2DA 1YUSA 5JOLA 1DJHA 1W9ZA 3D76A 4I5KA 2L2CA 1CDLA 2GGMA 2AUCA 1A03A 1Z4HA 2M0RA 2L51A 2KQYA 1Y1UA 1KK8B 1XO5A 1CMGA 2Y5IA 3TDUA 4BY5A 4CFRA 3L4LA 2L2EA 2LM5A 1B47A 3FE8A 1ZMZA 2LC5A 2SASA 3ICBA 3EK7A 4MRYA 2LMVA 1NWDA 4WQ3A 1KK7Y 3A8RA 3TDZA 4CIDA 1CLMA 1CNPA 2BBNA 2M97A 2K8MB 2GTEA 2JTZA 2LLSA 2K2AA 1SBJA 4JD9A 1OZOA 1ORGA 2LV7A 1C3YA 1KK7Z 1DJXA 2LHLA 1UHKA 4ZCVA 3OP0A 1F4QA 4CPVA 1FW4A 2FCEA 2JQ6A 1AVSA 3A4UB 3IQOA 1TNXA 3BYAA 1OOJA 3NHIA 5HLVA 1SCVA 3TDIA 4BY4A 3B87A 3JVTC 4PHJA 2EHBA 3R1PA 3OHMB 5TNCA 1SSEB 3BFAA 2KNEA 2HQWA 1PALA 2HPSA 1OOGA 3C1VA 2KI6C 1K94A 1YUTA 2KFGA 1B9AA 1C7WA 1UHHA 2H8VA 2FOTA 5CSNA 2JNFA 1J7OA 1F54A 4AQIA 2WC6A 3EKJA 5AFPA 1JFJA 2KI4C 1PSRA 2GGZA 2K2FA 3V2LA 1NIWA 1DMOA 4OV2A 1RWYA 1EG3A 1RFJA 1KQVA 4JKTA 3K21A 4INXA 1DJZA 2LLUA 4PE7A 5CSIA 2P70A 4DUQA 1MXLC 3BUXB 4P2YB 1DF0B 3TZ1A 4AQJA 2PSRA 2PRUA 1KWOB 2KI4B 3RZSA 1DELA 1X02A 3CDNA 4FTGA 4ORBB 4YGEB 5J3XA 2JRFA 2LVJA 1KQMB 2KFHA 3CABA 1AHRA 1OOFA 4A4BA 1D1OA 3SG5A 1CFCA 1QX5B 4UPGA 1LXFC 2L5YA 1UWOA 3SG3A 2NLNA 1AP4A 3PM2A 1SR6C 2ZRSA 5AEQA 1UURA 3B88A 4YGAA 1IRJA 2G9BA 1L2OC 4OR9B 2ISDA 1BF5A 1IGVA 1SW8A 1EXRA 1GGWA 1S36A 3R1OA 1G8IA 3BQ3A 2PASA 1J55A 1T14A 3SG6A 3BUWB 3DVKA 5CSJA 3DXLA 4MVFA 1BJFA 5HKZA 1XFWO 1XYDA 2Y1MA 1KFXS 3AKBA 1SR6B 4HSZA 2M7NA 1RECA 4N1FA 3SJSA 1L2OB 1LS8A 4JQ0D 1SL8A 2KQ6A 1S26D 2JWWA 3TUYC 1DF0A 2KHNA 3UO9A 1A4PA 1K9PA 1QJTA 1RK9A 2F3ZA 3I5GC 3KO0A 4KYNA 3OB2B 1CFFA 1JF2A 3FWCA 2BL0C 3BUNB 3CYZA 1AK8A 1H8BA 2E6WA 1J1DA 1L7ZA 2ERBA 2MRDA 3LK0A 2M1UA 2MJWB 1Y6WA 5HLOA 3AKAA 4Q04A 4GFTA 1DJIA 1ZUZA 2D8NA 2KGBC 4MN0A 4MZJA 5I2LA 2BL0B 1A75B 4HREE 2QEVA 1B7TY 2KYCA 2LVVA 1PULA 1TNQA 3L47A 4DS7A 2L0PA 1SPYA 1NCZA 1CDPA 2ZNEA 3VROA 2SCPA 3D78A 2CXJA 3NSIA 5PALA 4I5JA 1CM1A 3EVUA 3NSKA 1G4YR 3S0AA 3SS4A 4PE4A 3BJHA 2OTGC 1YTZC 1LA3A 2DOQA 2ZN9A 3BFBA 2O5GA 2HQ8A 1DT7B 3LLEA 1IQ3A 2EGDA 4YGDB 1R6PA 3NXAA 4MEWA 3ZNIA 1RTP1 1BG1A 2CBLA 1IWQA 5DICA 2LNKA 2K7CA 2LANA 4WRIA 1NYAA 5CPVA 2OTGB 4PE1A 2BECA 1B8LA 5I2OA 2OS8C 1TTXA 1TCFA 2NXQA 1BOCA 1WY9A 2M49B 4ZCUA 4QJ4B 1JUOA 2NZ0A 4ICBA 1MQ1A 1MR8A 1NX0A 4MZLA 4PALA 1E8AA 1W7IB 3LL8B 3RM1A 1SRAA 1HT9A 2OS8B 1C7VA 1TUZA 2KLDA 2KOTA 3JTDC 3I5HC 5KSZA 1BT6A 2LLTA 1YVLA 3BUOB 1OQPA 5KU1A 4JPZB 1DQEA 5HL1A 3D75A 1QWVA 1DJWA 4XJKA 1QS7A 1CLLA 1WDCC 3ZWHA 1V1FA 2EC6C 2LAPA 2QACA 3I5HB 1SCMC 4MBEA 4OVNF 1YURA 3I5FC 3RLZA 3VB1A 2TN4A 2WC5A 2Q91A
chains in the Genus database with same CATH topology
2JXCA 3AAJA 1WRLA 4NDBA 2CNPA 1WDCB 4ETOA 2ZRTA 5KTYA 1J7PA 1M46A 3PLFB 4DCKA 3H4SE 4OCIA 1K93D 1TIZA 3PFVA 1LINA 2Y1NA 3DVEA 3EK8A 5I2QA 1K90D 2H61A 1OSAA 1ALVA 3JVTB 4I5LB 4A4CA 1GJYA 1CFDA 1LVCD 1LKJA 1JBAA 2K7BA 3DF0B 1B8RA 1XFZO 4NQGA 3SIBA 1ZOTB 4E68A 1J7QA 4WQ2A 2L4HA 2CT9A 2M1KB 1NX3A 1PK0D 3I5IC 3FIAA 2M3WA 4M2PA 2KYFA 1EL4A 1TOPA 2BKIB 2COLB 1TN4A 2JNXA 1NCXA 4NDDA 1EH2A 1JFKA 2JXLA 2MAZA 4TNCA 5DKRA 2M7LA 4PHKA 2FCDA 4DIRA 5IBWA 2L5XB 2BCXA 4I5NB 3D0YB 1XFXO 1OMDA 2G2BA 1EG4A 5AANA 1NX2A 4R1EA 2LCPA 3BUMB 2A4JA 4FQOA 2Q4UA 2WOSA 1QX7A 2NCPA 2ZNDA 3FS7A 3VRQA 1QV0A 3CR4X 1DJGA 1XK4C 2F3YA 3KEVA 3DF0A 3DVJA 3GK4X 4DRWA 1PRWA 2BE6A 2LVIA 5AERA 1NCYA 1S5GZ 1K96A 5HKWA 1AUIB 4MLWA 2WCEA 4PE0A 4D1EA 1BLQA 2K7OA 2R2IA 1SL9A 1Y1XA 4JWQA 3CGAA 1TCOB 1NP8A 4PHMA 4ORAB 1UHJA 1QASA 2JZIA 3VGOA 3DVMA 2JTTA 2FJUB 1SYMA 3NSOA 4YBHB 1J7RA 1S6IA 1CLBA 1IJ5A 3TUYB 2L50A 3D10A 2K0JA 1SL7A 3I5GB 1K95A 1TRFA 2F2OA 5CSFA 1SNLA 3PM8A 3SIAA 1NUBA 1RROA 1VRKA 3LCPC 1EJ3A 3VRNA 4L9MA 2KSPA 2AMIA 1F70A 1QVIZ 3IF7A 1SKTA 2K61A 2QPTA 1CMFA 2WCFA 2KAVA 1F8HA 3LK1A 1KSOA 1KFUL 1K8UA 1YR5A 1IJ6A 4YI8A 2VRGA 3FWBA 4QJ5B 5I8NA 4YGBB 2MA2A 1CDMA 1R2UA 3EVRA 4ORCB 2M8UA 2BKHB 3OB1B 4PDZA 3WNXB 3CR2A 1S6JA 1CKKA 2M29A 2F2PA 2I94A 3WHTB 4CFQA 2CTNA 3QRXA 2F33A 1CTRA 2F8PA 3KPXA 2JT0A 1A75A 1N65A 1K9UA 4MZKA 1PVBA 1QLSA 1XVJA 2JULA 1TNPA 1ZFSA 1QLKA 2KI6D 1NX1A 2Y4QA 5K89A 3OX5A 1FI5A 1FF1A 2PALA 1K2HA 1BR1B 1KK8C 2KDHA 1MHOA 5JJGA 2KAYA 4CLNA 1SY9A 1QXPA 2RGIA 2NCOA 1JC2A 5D69A 1JF0A 2L98A 1M45A 1WLMA 2M9GA 3JTDB 4GPLB 4YI9A 1K9KA 3O78A 1IQ5A 2OPOA 4GUKA 1F55A 2ZN8A 4U8DA 3CWGA 2JU0A 1UUSA 2BCBA 5BPJA 1OMVA 1H4BA 1YRUB 1QV1A 1WRKA 1KFUS 2JT3A 1A2XA 2PMYA 1JWDA 1Q80A 1QTXA 1SMGA 2JC2A 1MWNA 2LVKA 2EC6B 4YGCB 1ODBA 2H2KA 5G08A 1SCMB 1PSBA 3CLNA 2L4IA 3DD4A 2LP2A 1BU3A 3I5FB 3SG4A 1KSMA 3GK2A 1F71A 1TNWA 1Y0VH 1CM4A 5DKNA 1DGVA 4PHNA 1MXEA 1XA5A 3CS1A 1AJ4A 2LHIA 2LUCA 1AJ5A 1LA0A 5DKQA 4GBAA 2KAXA 4OKHA 3GK1A 1QIVA 2O60A 1KFXL 1F4OA 1M31A 2I2RE 4N1GA 1B4CA 3EK4A 1ZACA 1OMRA 2LMUA 1WLZA 2MHHA 2E30A 3I5IB 3SG2A 1YUUA 2BCAA 4M2OA 3OX6A 1N0YA 1FBVA 1YVHA 4GGFC 1KWOC 1S3PA 1NPQA 4QJ3B 3VRPA 2HETA 1RJVA 3CZTX 1KQMC 3E3RA 2MBXA 5HYDA 1WRZA 1S5GY 5ER5A 2CCMA 1DVIA 4P5OE 2LP3A 1IKUA 3O6BA 1MF8B 2KFFA 3VRRA 4AOMA 1CB1A 3EVVA 4C0KA 4GAOA 4HRGA 1QX2A 3BOWB 2JPTA 3GOFA 2WORA 1U5IB 3CTNA 3PATA 3PN7C 2B1UA 1B8CA 4C0LA 1UHNA 1HQVA 2GV5A 2KBMA 3IQQA 3WHUB 2AAOA 2KGRA 1YX7A 1FPWA 2JT8A 1BODA 4IL1A 1KCYA 1B1GA 2LMTA 2KBIA 3HCMA 3KHEA 1S6CA 2ZFDA 3PN7B 3TS5C 1S1EA 3D0YA 5FYXA 3HX4A 1XFUO 4F0ZB 5B8IB 1JSAA 1MUXA 3M0WA 2BE4A 3AAKA 1QIWA 1QVIY 2P6BB 2PVBA 3MSEB 2HF5A 1NSHA 2K7DA 3CR5X 3O4YA 2IS9A 1XFYO 4GGFA 3TS5B 2V53A 2WNDA 2I18A 4GNKB 5AXIA 4PCWA 1BMOA 3KF9A 4MSPA 3NSLA 5ER4X 1DGUA 3BOWA 1GQMA 1U5IA 1DTLA 1G33A 3PALA 1V1GA 1XK4A 3PSRA 4C0JA 1CFPA 4XYNA 4N5XA 5F6TA 1M63B 2WCBA 3EKHA 2MLEC 3F45A 1ALWA 1SK6D 4YRUA 2I7AA 1J1EA 1PVAA 1QATA 1UHIA 2BBMA 3SG7A 2JOJA 1FI6A 1BR4B 1YX8A 4USLA 1XFVO 3BXKA 1B7TZ 1UP5A 1OE9B 5GQQC 1DJYA 3O2PA 1IG5A 4GGNA 1Y1AA 1A29A 3WXAA 1OZSA 1C07A 1GGZA 2MLFC 4XJKB 4MRXA 2WC8A 2LUXA 1YRTB 1IH0A 4HRHA 2ZKMX 1CDNA 2LE9B 1W7JB 4M2QA 5HKYA 1M39A 5D7FA 2H61C 4NDCA 1N2DA 1YUSA 5JOLA 1DJHA 4I5KA 1CDLA 2GGMA 2AUCA 1A03A 2M0RA 2L51A 2KQYA 1Y1UA 1KK8B 1XO5A 1CMGA 2Y5IA 3TDUA 4BY5A 4CFRA 2L2EA 2LM5A 1B47A 1ZMZA 2LC5A 2SASA 3ICBA 3EK7A 4MRYA 2LMVA 1NWDA 4WQ3A 1KK7Y 3A8RA 3TDZA 4CIDA 1CLMA 1CNPA 2BBNA 2M97A 2K8MB 2JTZA 2LLSA 2K2AA 1SBJA 1OZOA 2LV7A 1KK7Z 1DJXA 2LHLA 1UHKA 4ZCVA 3OP0A 1F4QA 4CPVA 1FW4A 2FCEA 2JQ6A 1AVSA 3A4UB 3IQOA 1TNXA 3BYAA 1OOJA 5HLVA 3TDIA 1SCVA 4BY4A 3JVTC 4PHJA 2EHBA 3OHMB 5TNCA 2KNEA 2HQWA 1PALA 2HPSA 3C1VA 2KI6C 1K94A 1YUTA 2KFGA 1B9AA 1C7WA 1UHHA 2FOTA 5CSNA 2JNFA 1J7OA 1F54A 4AQIA 3EKJA 1JFJA 5AFPA 2KI4C 1PSRA 2GGZA 2K2FA 1NIWA 1DMOA 4OV2A 1RWYA 1EG3A 1RFJA 1KQVA 3K21A 1DJZA 2LLUA 4PE7A 5CSIA 4DUQA 1MXLC 3BUXB 4P2YB 1DF0B 3TZ1A 4AQJA 2PSRA 2PRUA 1KWOB 2KI4B 1X02A 4ORBB 4FTGA 4YGEB 5J3XA 2JRFA 2LVJA 1KQMB 2KFHA 1AHRA 4A4BA 1D1OA 3SG5A 1CFCA 1QX5B 4UPGA 1LXFC 1UWOA 3SG3A 2NLNA 1AP4A 1SR6C 2ZRSA 5AEQA 1UURA 4YGAA 1IRJA 2G9BA 1L2OC 4OR9B 2ISDA 1BF5A 1IGVA 1SW8A 1EXRA 1GGWA 1S36A 1G8IA 3BQ3A 2PASA 1J55A 3SG6A 3BUWB 3DVKA 5CSJA 4MVFA 1BJFA 5HKZA 1XFWO 1XYDA 2Y1MA 1KFXS 3AKBA 1SR6B 4HSZA 2M7NA 1RECA 4N1FA 3SJSA 1L2OB 4JQ0D 1SL8A 2KQ6A 1S26D 2JWWA 3TUYC 1DF0A 2KHNA 1A4PA 1K9PA 1QJTA 1RK9A 2F3ZA 3I5GC 3KO0A 1CFFA 3OB2B 1JF2A 3FWCA 2BL0C 3BUNB 1AK8A 1H8BA 2E6WA 1J1DA 1L7ZA 2MRDA 3LK0A 2M1UA 2MJWB 1Y6WA 5HLOA 3AKAA 4Q04A 4GFTA 1DJIA 1ZUZA 2D8NA 2KGBC 4MN0A 4MZJA 5I2LA 2BL0B 1A75B 4HREE 1B7TY 2KYCA 2LVVA 1PULA 1TNQA 4DS7A 2L0PA 1SPYA 1NCZA 1CDPA 2ZNEA 3VROA 2SCPA 1C7VA 2CXJA 3NSIA 5PALA 4I5JA 1CM1A 3EVUA 3NSKA 1G4YR 4PE4A 2OTGC 1YTZC 1LA3A 2DOQA 2ZN9A 2O5GA 2HQ8A 1DT7B 3LLEA 1IQ3A 2EGDA 4YGDB 1R6PA 3NXAA 4MEWA 3ZNIA 1RTP1 1BG1A 2CBLA 1IWQA 2LNKA 2K7CA 2LANA 4WRIA 1NYAA 5CPVA 2OTGB 4PE1A 2BECA 1B8LA 5I2OA 2OS8C 1TTXA 1TCFA 2NXQA 1BOCA 1WY9A 2M49B 4ZCUA 4QJ4B 1JUOA 2NZ0A 4ICBA 1MQ1A 1MR8A 1NX0A 4MZLA 4PALA 1E8AA 1W7IB 3LL8B 3RM1A 1SRAA 1HT9A 2OS8B 2KOTA 3JTDC 3I5HC 5KSZA 1BT6A 2LLTA 1YVLA 3BUOB 1OQPA 5KU1A 4JPZB 1DJWA 4XJKA 1QS7A 1CLLA 1WDCC 3ZWHA 1V1FA 2EC6C 2LAPA 2QACA 3I5HB 1SCMC 4MBEA 4OVNF 1YURA 3I5FC 3RLZA 2TN4A 2Q91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXC A;  3AAJ A;  1WRL A;  4NDB A;  2CNP A;  1WDC B;  4ETO A;  2ZRT A;  5KTY A;  1J7P A;  1M46 A;  3PLF B;  4DCK A;  3H4S E;  4OCI A;  1K93 D;  1TIZ A;  3PFV A;  1LIN A;  2Y1N A;  3DVE A;  3EK8 A;  5I2Q A;  1K90 D;  2H61 A;  1OSA A;  1ALV A;  3JVT B;  4I5L B;  4A4C A;  1GJY A;  1CFD A;  1LVC D;  1LKJ A;  1JBA A;  2K7B A;  3DF0 B;  1B8R A;  1XFZ O;  4NQG A;  3SIB A;  1ZOT B;  4E68 A;  1J7Q A;  4WQ2 A;  2L4H A;  2CT9 A;  2M1K B;  1NX3 A;  1PK0 D;  3I5I C;  3FIA A;  2M3W A;  4M2P A;  2KYF A;  1EL4 A;  1TOP A;  2BKI B;  2COL B;  1TN4 A;  2JNX A;  1NCX A;  4NDD A;  1EH2 A;  1JFK A;  2JXL A;  2MAZ A;  4TNC A;  5DKR A;  2M7L A;  4PHK A;  2FCD A;  4DIR A;  5IBW A;  2L5X B;  2BCX A;  4I5N B;  3D0Y B;  1XFX O;  1OMD A;  2G2B A;  1EG4 A;  5AAN A;  1NX2 A;  4R1E A;  2LCP A;  3BUM B;  2A4J A;  4FQO A;  2Q4U A;  2WOS A;  1QX7 A;  2NCP A;  2ZND A;  3FS7 A;  3VRQ A;  1QV0 A;  3CR4 X;  1DJG A;  1XK4 C;  2F3Y A;  3KEV A;  3DF0 A;  3DVJ A;  3GK4 X;  4DRW A;  1PRW A;  2BE6 A;  2LVI A;  5AER A;  1NCY A;  1S5G Z;  1K96 A;  5HKW A;  1AUI B;  4MLW A;  2WCE A;  4PE0 A;  4D1E A;  1BLQ A;  2K7O A;  2R2I A;  1SL9 A;  1Y1X A;  4JWQ A;  3CGA A;  1TCO B;  1NP8 A;  4PHM A;  4ORA B;  1UHJ A;  1QAS A;  2JZI A;  3VGO A;  3DVM A;  2JTT A;  2FJU B;  1SYM A;  3NSO A;  4YBH B;  1J7R A;  1S6I A;  1CLB A;  1IJ5 A;  3TUY B;  2L50 A;  3D10 A;  2K0J A;  1SL7 A;  3I5G B;  1K95 A;  1TRF A;  2F2O A;  5CSF A;  1SNL A;  3PM8 A;  3SIA A;  1NUB A;  1RRO A;  1VRK A;  3LCP C;  1EJ3 A;  3VRN A;  4L9M A;  2KSP A;  2AMI A;  1F70 A;  1QVI Z;  3IF7 A;  1SKT A;  2K61 A;  2QPT A;  1CMF A;  2WCF A;  2KAV A;  1F8H A;  3LK1 A;  1KSO A;  1KFU L;  1K8U A;  1YR5 A;  1IJ6 A;  4YI8 A;  2VRG A;  3FWB A;  4QJ5 B;  5I8N A;  4YGB B;  2MA2 A;  1CDM A;  1R2U A;  3EVR A;  4ORC B;  2M8U A;  2BKH B;  3OB1 B;  4PDZ A;  3WNX B;  3CR2 A;  1S6J A;  1CKK A;  2M29 A;  2F2P A;  2I94 A;  3WHT B;  4CFQ A;  2CTN A;  3QRX A;  2F33 A;  1CTR A;  2F8P A;  3KPX A;  2JT0 A;  1A75 A;  1N65 A;  1K9U A;  4MZK A;  1PVB A;  1QLS A;  1XVJ A;  2JUL A;  1TNP A;  1ZFS A;  1QLK A;  2KI6 D;  1NX1 A;  2Y4Q A;  5K89 A;  3OX5 A;  1FI5 A;  1FF1 A;  2PAL A;  1K2H A;  1BR1 B;  1KK8 C;  2KDH A;  1MHO A;  5JJG A;  2KAY A;  4CLN A;  1SY9 A;  1QXP A;  2RGI A;  2NCO A;  1JC2 A;  5D69 A;  1JF0 A;  2L98 A;  1M45 A;  1WLM A;  2M9G A;  3JTD B;  4GPL B;  4YI9 A;  1K9K A;  3O78 A;  1IQ5 A;  2OPO A;  4GUK A;  1F55 A;  2ZN8 A;  4U8D A;  3CWG A;  2JU0 A;  1UUS A;  2BCB A;  5BPJ A;  1OMV A;  1H4B A;  1YRU B;  1QV1 A;  1WRK A;  1KFU S;  2JT3 A;  1A2X A;  2PMY A;  1JWD A;  1Q80 A;  1QTX A;  1SMG A;  2JC2 A;  1MWN A;  2LVK A;  2EC6 B;  4YGC B;  1ODB A;  2H2K A;  5G08 A;  1SCM B;  1PSB A;  3CLN A;  2L4I A;  3DD4 A;  2LP2 A;  1BU3 A;  3I5F B;  3SG4 A;  1KSM A;  3GK2 A;  1F71 A;  1TNW A;  1Y0V H;  1CM4 A;  5DKN A;  1DGV A;  4PHN A;  1MXE A;  1XA5 A;  3CS1 A;  1AJ4 A;  2LHI A;  2LUC A;  1AJ5 A;  1LA0 A;  5DKQ A;  4GBA A;  2KAX A;  4OKH A;  3GK1 A;  1QIV A;  2O60 A;  1KFX L;  1F4O A;  1M31 A;  2I2R E;  4N1G A;  1B4C A;  3EK4 A;  1ZAC A;  1OMR A;  2LMU A;  1WLZ A;  2MHH A;  2E30 A;  3I5I B;  3SG2 A;  1YUU A;  2BCA A;  4M2O A;  3OX6 A;  1N0Y A;  1FBV A;  1YVH A;  4GGF C;  1KWO C;  1S3P A;  1NPQ A;  4QJ3 B;  3VRP A;  2HET A;  1RJV A;  3CZT X;  1KQM C;  3E3R A;  2MBX A;  5HYD A;  1WRZ A;  1S5G Y;  5ER5 A;  2CCM A;  1DVI A;  4P5O E;  2LP3 A;  1IKU A;  3O6B A;  1MF8 B;  2KFF A;  3VRR A;  4AOM A;  1CB1 A;  3EVV A;  4C0K A;  4GAO A;  4HRG A;  1QX2 A;  3BOW B;  2JPT A;  3GOF A;  2WOR A;  1U5I B;  3CTN A;  3PAT A;  3PN7 C;  2B1U A;  1B8C A;  4C0L A;  1UHN A;  1HQV A;  2GV5 A;  2KBM A;  3IQQ A;  3WHU B;  2AAO A;  2KGR A;  1YX7 A;  1FPW A;  2JT8 A;  1BOD A;  4IL1 A;  1KCY A;  1B1G A;  2LMT A;  2KBI A;  3HCM A;  3KHE A;  1S6C A;  2ZFD A;  3PN7 B;  3TS5 C;  1S1E A;  3D0Y A;  5FYX A;  3HX4 A;  1XFU O;  4F0Z B;  5B8I B;  1JSA A;  1MUX A;  3M0W A;  2BE4 A;  3AAK A;  1QIW A;  1QVI Y;  2P6B B;  2PVB A;  3MSE B;  2HF5 A;  1NSH A;  2K7D A;  3CR5 X;  3O4Y A;  2IS9 A;  1XFY O;  4GGF A;  3TS5 B;  2V53 A;  2WND A;  2I18 A;  4GNK B;  5AXI A;  4PCW A;  1BMO A;  3KF9 A;  4MSP A;  3NSL A;  5ER4 X;  1DGU A;  3BOW A;  1GQM A;  1U5I A;  1DTL A;  1G33 A;  3PAL A;  1V1G A;  1XK4 A;  3PSR A;  4C0J A;  1CFP A;  4XYN A;  4N5X A;  5F6T A;  1M63 B;  2WCB A;  3EKH A;  2MLE C;  3F45 A;  1ALW A;  1SK6 D;  4YRU A;  2I7A A;  1J1E A;  1PVA A;  1QAT A;  1UHI A;  2BBM A;  3SG7 A;  2JOJ A;  1FI6 A;  1BR4 B;  1YX8 A;  4USL A;  1XFV O;  3BXK A;  1B7T Z;  1UP5 A;  1OE9 B;  5GQQ C;  1DJY A;  3O2P A;  1IG5 A;  4GGN A;  1Y1A A;  1A29 A;  3WXA A;  1OZS A;  1C07 A;  1GGZ A;  2MLF C;  4XJK B;  4MRX A;  2WC8 A;  2LUX A;  1YRT B;  1IH0 A;  4HRH A;  2ZKM X;  1CDN A;  2LE9 B;  1W7J B;  4M2Q A;  5HKY A;  1M39 A;  5D7F A;  2H61 C;  4NDC A;  1N2D A;  1YUS A;  5JOL A;  1DJH A;  4I5K A;  1CDL A;  2GGM A;  2AUC A;  1A03 A;  2M0R A;  2L51 A;  2KQY A;  1Y1U A;  1KK8 B;  1XO5 A;  1CMG A;  2Y5I A;  3TDU A;  4BY5 A;  4CFR A;  2L2E A;  2LM5 A;  1B47 A;  1ZMZ A;  2LC5 A;  2SAS A;  3ICB A;  3EK7 A;  4MRY A;  2LMV A;  1NWD A;  4WQ3 A;  1KK7 Y;  3A8R A;  3TDZ A;  4CID A;  1CLM A;  1CNP A;  2BBN A;  2M97 A;  2K8M B;  2JTZ A;  2LLS A;  2K2A A;  1SBJ A;  1OZO A;  2LV7 A;  1KK7 Z;  1DJX A;  2LHL A;  1UHK A;  4ZCV A;  3OP0 A;  1F4Q A;  4CPV A;  1FW4 A;  2FCE A;  2JQ6 A;  1AVS A;  3A4U B;  3IQO A;  1TNX A;  3BYA A;  1OOJ A;  5HLV A;  3TDI A;  1SCV A;  4BY4 A;  3JVT C;  4PHJ A;  2EHB A;  3OHM B;  5TNC A;  2KNE A;  2HQW A;  1PAL A;  2HPS A;  3C1V A;  2KI6 C;  1K94 A;  1YUT A;  2KFG A;  1B9A A;  1C7W A;  1UHH A;  2FOT A;  5CSN A;  2JNF A;  1J7O A;  1F54 A;  4AQI A;  3EKJ A;  1JFJ A;  5AFP A;  2KI4 C;  1PSR A;  2GGZ A;  2K2F A;  1NIW A;  1DMO A;  4OV2 A;  1RWY A;  1EG3 A;  1RFJ A;  1KQV A;  3K21 A;  1DJZ A;  2LLU A;  4PE7 A;  5CSI A;  4DUQ A;  1MXL C;  3BUX B;  4P2Y B;  1DF0 B;  3TZ1 A;  4AQJ A;  2PSR A;  2PRU A;  1KWO B;  2KI4 B;  1X02 A;  4ORB B;  4FTG A;  4YGE B;  5J3X A;  2JRF A;  2LVJ A;  1KQM B;  2KFH A;  1AHR A;  4A4B A;  1D1O A;  3SG5 A;  1CFC A;  1QX5 B;  4UPG A;  1LXF C;  1UWO A;  3SG3 A;  2NLN A;  1AP4 A;  1SR6 C;  2ZRS A;  5AEQ A;  1UUR A;  4YGA A;  1IRJ A;  2G9B A;  1L2O C;  4OR9 B;  2ISD A;  1BF5 A;  1IGV A;  1SW8 A;  1EXR A;  1GGW A;  1S36 A;  1G8I A;  3BQ3 A;  2PAS A;  1J55 A;  3SG6 A;  3BUW B;  3DVK A;  5CSJ A;  4MVF A;  1BJF A;  5HKZ A;  1XFW O;  1XYD A;  2Y1M A;  1KFX S;  3AKB A;  1SR6 B;  4HSZ A;  2M7N A;  1REC A;  4N1F A;  3SJS A;  1L2O B;  4JQ0 D;  1SL8 A;  2KQ6 A;  1S26 D;  2JWW A;  3TUY C;  1DF0 A;  2KHN A;  1A4P A;  1K9P A;  1QJT A;  1RK9 A;  2F3Z A;  3I5G C;  3KO0 A;  1CFF A;  3OB2 B;  1JF2 A;  3FWC A;  2BL0 C;  3BUN B;  1AK8 A;  1H8B A;  2E6W A;  1J1D A;  1L7Z A;  2MRD A;  3LK0 A;  2M1U A;  2MJW B;  1Y6W A;  5HLO A;  3AKA A;  4Q04 A;  4GFT A;  1DJI A;  1ZUZ A;  2D8N A;  2KGB C;  4MN0 A;  4MZJ A;  5I2L A;  2BL0 B;  1A75 B;  4HRE E;  1B7T Y;  2KYC A;  2LVV A;  1PUL A;  1TNQ A;  4DS7 A;  2L0P A;  1SPY A;  1NCZ A;  1CDP A;  2ZNE A;  3VRO A;  2SCP A;  1C7V A;  2CXJ A;  3NSI A;  5PAL A;  4I5J A;  1CM1 A;  3EVU A;  3NSK A;  1G4Y R;  4PE4 A;  2OTG C;  1YTZ C;  1LA3 A;  2DOQ A;  2ZN9 A;  2O5G A;  2HQ8 A;  1DT7 B;  3LLE A;  1IQ3 A;  2EGD A;  4YGD B;  1R6P A;  3NXA A;  4MEW A;  3ZNI A;  1RTP 1;  1BG1 A;  2CBL A;  1IWQ A;  2LNK A;  2K7C A;  2LAN A;  4WRI A;  1NYA A;  5CPV A;  2OTG B;  4PE1 A;  2BEC A;  1B8L A;  5I2O A;  2OS8 C;  1TTX A;  1TCF A;  2NXQ A;  1BOC A;  1WY9 A;  2M49 B;  4ZCU A;  4QJ4 B;  1JUO A;  2NZ0 A;  4ICB A;  1MQ1 A;  1MR8 A;  1NX0 A;  4MZL A;  4PAL A;  1E8A A;  1W7I B;  3LL8 B;  3RM1 A;  1SRA A;  1HT9 A;  2OS8 B;  2KOT A;  3JTD C;  3I5H C;  5KSZ A;  1BT6 A;  2LLT A;  1YVL A;  3BUO B;  1OQP A;  5KU1 A;  4JPZ B;  1DJW A;  4XJK A;  1QS7 A;  1CLL A;  1WDC C;  3ZWH A;  1V1F A;  2EC6 C;  2LAP A;  2QAC A;  3I5H B;  1SCM C;  4MBE A;  4OVN F;  1YUR A;  3I5F C;  3RLZ A;  2TN4 A;  2Q91 A; 
#chains in the Genus database with same CATH topology
 2JXC A;  3AAJ A;  1WRL A;  4NDB A;  2CNP A;  1WDC B;  4ETO A;  2ZRT A;  5KTY A;  1J7P A;  1M46 A;  3BFH A;  3PLF B;  4DCK A;  3H4S E;  4OCI A;  5I94 A;  1K93 D;  1TIZ A;  3PFV A;  1LIN A;  2Y1N A;  3DVE A;  3EK8 A;  5I2Q A;  1K90 D;  2H61 A;  4FQT A;  1OSA A;  1ALV A;  3JVT B;  4I5L B;  4A4C A;  1GJY A;  1CFD A;  1LVC D;  1LKJ A;  1JBA A;  2K7B A;  3DF0 B;  1B8R A;  1XFZ O;  4NQG A;  3SIB A;  1ZOT B;  4E68 A;  1J7Q A;  1P28 A;  3IVT A;  3DZT A;  4INW A;  2L4H A;  4WQ2 A;  1OW4 A;  2CT9 A;  2M1K B;  1NX3 A;  1PK0 D;  3I5I C;  3FIA A;  3DYE A;  2M3W A;  4M2P A;  2KYF A;  1EL4 A;  3B7A A;  1TOP A;  2BKI B;  2QEH A;  2COL B;  1TN4 A;  2JNX A;  1NCX A;  4NDD A;  1EH2 A;  1JFK A;  2JXL A;  2MAZ A;  3SS5 A;  4TNC A;  5DKR A;  2JPO A;  2M7L A;  4PHK A;  2FCD A;  4DIR A;  5IBW A;  2QDI A;  3UNW A;  2L5X B;  2BCX A;  4I5N B;  3D0Y B;  1XFX O;  1OMD A;  2G2B A;  1EG4 A;  5AAN A;  1NX2 A;  1TUJ A;  4R1E A;  2LCP A;  3BUM B;  5D3O A;  2A4J A;  4FQO A;  3S0G A;  2Q4U A;  2WOS A;  1QX7 A;  2NCP A;  2ZND A;  3FS7 A;  3VRQ A;  1QV0 A;  3CR4 X;  1DJG A;  1XK4 C;  2F3Y A;  3KEV A;  2WCL A;  3O4X A;  3DF0 A;  3DVJ A;  3GK4 X;  4DRW A;  3S0E A;  1PRW A;  2BE6 A;  2LVI A;  5AER A;  1NCY A;  1S5G Z;  1K96 A;  3Q8I A;  5HKW A;  1AUI B;  4MLW A;  2WCE A;  1OOH A;  4PE0 A;  4D1E A;  1BLQ A;  2K7O A;  1DEK A;  2R2I A;  1SL9 A;  1Y1X A;  4JWQ A;  3CGA A;  1TCO B;  1NP8 A;  4PHM A;  4ORA B;  1UHJ A;  1QAS A;  2JZI A;  3VGO A;  3DVM A;  2JTT A;  2FJU B;  1SYM A;  3NSO A;  4YBH B;  1J7R A;  1S6I A;  1CLB A;  1IJ5 A;  3TUY B;  2L50 A;  3D10 A;  2K0J A;  1SL7 A;  3EG5 B;  3I5G B;  1K95 A;  2FJY A;  1TRF A;  2F2O A;  5CSF A;  1SNL A;  3PM8 A;  3SIA A;  1NUB A;  1RRO A;  1VRK A;  3LCP C;  1EJ3 A;  3VRN A;  4L9M A;  2KSP A;  2AMI A;  1F70 A;  1QVI Z;  3IF7 A;  1SKT A;  2K61 A;  2QPT A;  3DY9 A;  1CMF A;  2WCF A;  2KAV A;  1F8H A;  3LK1 A;  1KSO A;  1KFU L;  3NHT A;  1K8U A;  1YR5 A;  2WCJ A;  3R72 A;  1IJ6 A;  4YI8 A;  2VRG A;  3B6X A;  3S0F A;  3FWB A;  4QJ5 B;  5I8N A;  3CZ2 A;  2MA2 A;  3D77 A;  4YGB B;  2WCH A;  3SS3 A;  1CDM A;  1R2U A;  3EVR A;  4ORC B;  2M8U A;  2BKH B;  3OB1 B;  4PDZ A;  3WNX B;  3CR2 A;  1S6J A;  4IJ7 A;  1CKK A;  2M29 A;  2F2P A;  2I94 A;  3WHT B;  4CFQ A;  1XFR A;  2PQL A;  2CTN A;  3QRX A;  2F33 A;  1CTR A;  2F8P A;  3KPX A;  2JT0 A;  1A75 A;  1N65 A;  1K9U A;  4MZK A;  1PVB A;  1QLS A;  1XVJ A;  3OBV A;  2JUL A;  1TNP A;  1ZFS A;  1QLK A;  2KI6 D;  1NX1 A;  2Y4Q A;  5K89 A;  3OX5 A;  1FI5 A;  1FF1 A;  2PAL A;  1K2H A;  1BR1 B;  1KK8 C;  2KDH A;  1IIO A;  1MHO A;  5JJG A;  2KAY A;  4CLN A;  1SY9 A;  2K60 A;  1QXP A;  2BNX A;  2RGI A;  2NCO A;  1JC2 A;  2QEB A;  5D69 A;  1JF0 A;  2L98 A;  1M45 A;  1WLM A;  2M9G A;  3JTD B;  3K1E A;  4GPL B;  1K9K A;  4YI9 A;  3O78 A;  1IQ5 A;  2OPO A;  2WCM A;  4GUK A;  1F55 A;  2ZN8 A;  4U8D A;  3CWG A;  2JU0 A;  1UUS A;  2BCB A;  5BPJ A;  1OMV A;  1H4B A;  1YRU B;  1QV1 A;  1WRK A;  2QEO A;  3N7H A;  1KFU S;  2JT3 A;  1A2X A;  2PMY A;  2YGU A;  1JWD A;  1Q80 A;  1QTX A;  1SMG A;  2JC2 A;  1MWN A;  2LVK A;  2EC6 B;  4YGC B;  1ODB A;  2H2K A;  5G08 A;  1SCM B;  3D74 A;  1PSB A;  3CLN A;  2L4I A;  3DD4 A;  2LP2 A;  1BU3 A;  3I5F B;  3SG4 A;  1KSM A;  3GK2 A;  1F71 A;  1TNW A;  1Y0V H;  1CM4 A;  5DKN A;  1DGV A;  4PHN A;  1MXE A;  1XA5 A;  3CS1 A;  4OZD A;  1AJ4 A;  2LHI A;  2LUC A;  1AJ5 A;  1LA0 A;  5DKQ A;  4GBA A;  2KAX A;  4OKH A;  3S0D A;  3GK1 A;  1QIV A;  2O60 A;  3B86 A;  2KLE A;  1C3Z A;  1KFX L;  1F4O A;  1M31 A;  1OOI X;  2I2R E;  4N1G A;  1B4C A;  3EK4 A;  1ZAC A;  1OMR A;  2LMU A;  1WLZ A;  2MHH A;  2E30 A;  3I5I B;  4F7F A;  3SG2 A;  1YUU A;  2BCA A;  4M2O A;  3OGN A;  1N0Y A;  3OX6 A;  1FBV A;  1YVH A;  4GGF C;  1KWO C;  3L4A A;  3FE9 A;  1S3P A;  1NPQ A;  4QJ3 B;  3VRP A;  2HET A;  1RJV A;  3CZT X;  1KQM C;  3E3R A;  2MBX A;  1GM0 A;  5HYD A;  1WRZ A;  1S5G Y;  5ER5 A;  2CCM A;  1DVI A;  4P5O E;  2LP3 A;  1IKU A;  3O6B A;  1MF8 B;  2KFF A;  1Z2C B;  3CZ0 A;  3VRR A;  4AOM A;  1CB1 A;  3EVV A;  4C0K A;  3NGV A;  4GAO A;  4HRG A;  1QX2 A;  3BOW B;  2JPT A;  3GOF A;  2WOR A;  1U5I B;  3CTN A;  3PAT A;  3PJI A;  3PN7 C;  3CZ1 A;  2B1U A;  1B8C A;  4C0L A;  1UHN A;  1HQV A;  2GV5 A;  2KBM A;  3IQQ A;  3R1V A;  3WHU B;  2AAO A;  2KGR A;  1YX7 A;  2PYQ A;  2JT8 A;  5FI2 A;  1FPW A;  5EL2 A;  1BOD A;  4IL1 A;  1KCY A;  1B1G A;  2LMT A;  2KBI A;  3HCM A;  3KHE A;  1S6C A;  2ZFD A;  3PN7 B;  3TS5 C;  1S1E A;  3D0Y A;  3D73 A;  5FYX A;  3HX4 A;  1XFU O;  4F0Z B;  5B8I B;  3S0B A;  1JSA A;  1MUX A;  3M0W A;  2BE4 A;  3AAK A;  1QIW A;  1QVI Y;  2P6B B;  2PVB A;  3MSE B;  2HF5 A;  1NSH A;  2K7D A;  3CR5 X;  3O4Y A;  2IS9 A;  1XFY O;  3FE6 A;  4GGF A;  2V53 A;  2WND A;  3TS5 B;  2I18 A;  4GNK B;  1TWO A;  5AXI A;  4PCW A;  1BMO A;  3KF9 A;  4MSP A;  3NSL A;  5FI7 A;  5ER4 X;  1DGU A;  3BOW A;  1GQM A;  1U5I A;  2P71 A;  1DTL A;  1G33 A;  3PAL A;  1V1G A;  1XK4 A;  3PSR A;  4C0J A;  1CFP A;  4XYN A;  2BAP A;  4N5X A;  5F6T A;  5FI6 A;  1M63 B;  2WCB A;  3EKH A;  2MLE C;  3F45 A;  1ALW A;  1SK6 D;  4YRU A;  4PT1 A;  2I7A A;  1J1E A;  1PVA A;  1QAT A;  1UHI A;  2BBM A;  3SG7 A;  2JOJ A;  1FI6 A;  1BR4 B;  1YX8 A;  4USL A;  1XFV O;  3BXK A;  1B7T Z;  1UP5 A;  1OE9 B;  5GQQ C;  1DJY A;  3O2P A;  1IG5 A;  4GGN A;  3QME A;  1Y1A A;  1A29 A;  3WXA A;  1OZS A;  1C07 A;  1GGZ A;  2MLF C;  2KPH A;  1DC1 A;  4XJK B;  4MRX A;  2WC8 A;  2LUX A;  1YRT B;  1IH0 A;  4HRH A;  2ZKM X;  1CDN A;  2LE9 B;  1W7J B;  2WCK A;  4M2Q A;  5HKY A;  1M39 A;  5D7F A;  2H61 C;  4NDC A;  1N2D A;  1YUS A;  5JOL A;  1DJH A;  1W9Z A;  3D76 A;  4I5K A;  2L2C A;  1CDL A;  2GGM A;  2AUC A;  1A03 A;  1Z4H A;  2M0R A;  2L51 A;  2KQY A;  1Y1U A;  1KK8 B;  1XO5 A;  1CMG A;  2Y5I A;  3TDU A;  4BY5 A;  4CFR A;  3L4L A;  2L2E A;  2LM5 A;  1B47 A;  3FE8 A;  1ZMZ A;  2LC5 A;  2SAS A;  3ICB A;  3EK7 A;  4MRY A;  2LMV A;  1NWD A;  4WQ3 A;  1KK7 Y;  3A8R A;  3TDZ A;  4CID A;  1CLM A;  1CNP A;  2BBN A;  2M97 A;  2K8M B;  2GTE A;  2JTZ A;  2LLS A;  2K2A A;  1SBJ A;  4JD9 A;  1OZO A;  1ORG A;  2LV7 A;  1C3Y A;  1KK7 Z;  1DJX A;  2LHL A;  1UHK A;  4ZCV A;  3OP0 A;  1F4Q A;  4CPV A;  1FW4 A;  2FCE A;  2JQ6 A;  1AVS A;  3A4U B;  3IQO A;  1TNX A;  3BYA A;  1OOJ A;  3NHI A;  5HLV A;  1SCV A;  3TDI A;  4BY4 A;  3B87 A;  3JVT C;  4PHJ A;  2EHB A;  3R1P A;  3OHM B;  5TNC A;  1SSE B;  3BFA A;  2KNE A;  2HQW A;  1PAL A;  2HPS A;  1OOG A;  3C1V A;  2KI6 C;  1K94 A;  1YUT A;  2KFG A;  1B9A A;  1C7W A;  1UHH A;  2H8V A;  2FOT A;  5CSN A;  2JNF A;  1J7O A;  1F54 A;  4AQI A;  2WC6 A;  3EKJ A;  5AFP A;  1JFJ A;  2KI4 C;  1PSR A;  2GGZ A;  2K2F A;  3V2L A;  1NIW A;  1DMO A;  4OV2 A;  1RWY A;  1EG3 A;  1RFJ A;  1KQV A;  4JKT A;  3K21 A;  4INX A;  1DJZ A;  2LLU A;  4PE7 A;  5CSI A;  2P70 A;  4DUQ A;  1MXL C;  3BUX B;  4P2Y B;  1DF0 B;  3TZ1 A;  4AQJ A;  2PSR A;  2PRU A;  1KWO B;  2KI4 B;  3RZS A;  1DEL A;  1X02 A;  3CDN A;  4FTG A;  4ORB B;  4YGE B;  5J3X A;  2JRF A;  2LVJ A;  1KQM B;  2KFH A;  3CAB A;  1AHR A;  1OOF A;  4A4B A;  1D1O A;  3SG5 A;  1CFC A;  1QX5 B;  4UPG A;  1LXF C;  2L5Y A;  1UWO A;  3SG3 A;  2NLN A;  1AP4 A;  3PM2 A;  1SR6 C;  2ZRS A;  5AEQ A;  1UUR A;  3B88 A;  4YGA A;  1IRJ A;  2G9B A;  1L2O C;  4OR9 B;  2ISD A;  1BF5 A;  1IGV A;  1SW8 A;  1EXR A;  1GGW A;  1S36 A;  3R1O A;  1G8I A;  3BQ3 A;  2PAS A;  1J55 A;  1T14 A;  3SG6 A;  3BUW B;  3DVK A;  5CSJ A;  3DXL A;  4MVF A;  1BJF A;  5HKZ A;  1XFW O;  1XYD A;  2Y1M A;  1KFX S;  3AKB A;  1SR6 B;  4HSZ A;  2M7N A;  1REC A;  4N1F A;  3SJS A;  1L2O B;  1LS8 A;  4JQ0 D;  1SL8 A;  2KQ6 A;  1S26 D;  2JWW A;  3TUY C;  1DF0 A;  2KHN A;  3UO9 A;  1A4P A;  1K9P A;  1QJT A;  1RK9 A;  2F3Z A;  3I5G C;  3KO0 A;  4KYN A;  3OB2 B;  1CFF A;  1JF2 A;  3FWC A;  2BL0 C;  3BUN B;  3CYZ A;  1AK8 A;  1H8B A;  2E6W A;  1J1D A;  1L7Z A;  2ERB A;  2MRD A;  3LK0 A;  2M1U A;  2MJW B;  1Y6W A;  5HLO A;  3AKA A;  4Q04 A;  4GFT A;  1DJI A;  1ZUZ A;  2D8N A;  2KGB C;  4MN0 A;  4MZJ A;  5I2L A;  2BL0 B;  1A75 B;  4HRE E;  2QEV A;  1B7T Y;  2KYC A;  2LVV A;  1PUL A;  1TNQ A;  3L47 A;  4DS7 A;  2L0P A;  1SPY A;  1NCZ A;  1CDP A;  2ZNE A;  3VRO A;  2SCP A;  3D78 A;  2CXJ A;  3NSI A;  5PAL A;  4I5J A;  1CM1 A;  3EVU A;  3NSK A;  1G4Y R;  3S0A A;  3SS4 A;  4PE4 A;  3BJH A;  2OTG C;  1YTZ C;  1LA3 A;  2DOQ A;  2ZN9 A;  3BFB A;  2O5G A;  2HQ8 A;  1DT7 B;  3LLE A;  1IQ3 A;  2EGD A;  4YGD B;  1R6P A;  3NXA A;  4MEW A;  3ZNI A;  1RTP 1;  1BG1 A;  2CBL A;  1IWQ A;  5DIC A;  2LNK A;  2K7C A;  2LAN A;  4WRI A;  1NYA A;  5CPV A;  2OTG B;  4PE1 A;  2BEC A;  1B8L A;  5I2O A;  2OS8 C;  1TTX A;  1TCF A;  2NXQ A;  1BOC A;  1WY9 A;  2M49 B;  4ZCU A;  4QJ4 B;  1JUO A;  2NZ0 A;  4ICB A;  1MQ1 A;  1MR8 A;  1NX0 A;  4MZL A;  4PAL A;  1E8A A;  1W7I B;  3LL8 B;  3RM1 A;  1SRA A;  1HT9 A;  2OS8 B;  1C7V A;  1TUZ A;  2KLD A;  2KOT A;  3JTD C;  3I5H C;  5KSZ A;  1BT6 A;  2LLT A;  1YVL A;  3BUO B;  1OQP A;  5KU1 A;  4JPZ B;  1DQE A;  5HL1 A;  3D75 A;  1QWV A;  1DJW A;  4XJK A;  1QS7 A;  1CLL A;  1WDC C;  3ZWH A;  1V1F A;  2EC6 C;  2LAP A;  2QAC A;  3I5H B;  1SCM C;  4MBE A;  4OVN F;  1YUR A;  3I5F C;  3RLZ A;  3VB1 A;  2TN4 A;  2WC5 A;  2Q91 A; 
#chains in the Genus database with same CATH homology
 2JXC A;  3AAJ A;  1WRL A;  4NDB A;  2CNP A;  1WDC B;  4ETO A;  2ZRT A;  5KTY A;  1J7P A;  1M46 A;  3PLF B;  4DCK A;  3H4S E;  4OCI A;  1K93 D;  1TIZ A;  3PFV A;  1LIN A;  2Y1N A;  3DVE A;  3EK8 A;  5I2Q A;  1K90 D;  2H61 A;  1OSA A;  1ALV A;  3JVT B;  4I5L B;  4A4C A;  1GJY A;  1CFD A;  1LVC D;  1LKJ A;  1JBA A;  2K7B A;  3DF0 B;  1B8R A;  1XFZ O;  4NQG A;  3SIB A;  1ZOT B;  4E68 A;  1J7Q A;  4WQ2 A;  2L4H A;  2CT9 A;  2M1K B;  1NX3 A;  1PK0 D;  3I5I C;  3FIA A;  2M3W A;  4M2P A;  2KYF A;  1EL4 A;  1TOP A;  2BKI B;  2COL B;  1TN4 A;  2JNX A;  1NCX A;  4NDD A;  1EH2 A;  1JFK A;  2JXL A;  2MAZ A;  4TNC A;  5DKR A;  2M7L A;  4PHK A;  2FCD A;  4DIR A;  5IBW A;  2L5X B;  2BCX A;  4I5N B;  3D0Y B;  1XFX O;  1OMD A;  2G2B A;  1EG4 A;  5AAN A;  1NX2 A;  4R1E A;  2LCP A;  3BUM B;  2A4J A;  4FQO A;  2Q4U A;  2WOS A;  1QX7 A;  2NCP A;  2ZND A;  3FS7 A;  3VRQ A;  1QV0 A;  3CR4 X;  1DJG A;  1XK4 C;  2F3Y A;  3KEV A;  3DF0 A;  3DVJ A;  3GK4 X;  4DRW A;  1PRW A;  2BE6 A;  2LVI A;  5AER A;  1NCY A;  1S5G Z;  1K96 A;  5HKW A;  1AUI B;  4MLW A;  2WCE A;  4PE0 A;  4D1E A;  1BLQ A;  2K7O A;  2R2I A;  1SL9 A;  1Y1X A;  4JWQ A;  3CGA A;  1TCO B;  1NP8 A;  4PHM A;  4ORA B;  1UHJ A;  1QAS A;  2JZI A;  3VGO A;  3DVM A;  2JTT A;  2FJU B;  1SYM A;  3NSO A;  4YBH B;  1J7R A;  1S6I A;  1CLB A;  1IJ5 A;  3TUY B;  2L50 A;  3D10 A;  2K0J A;  1SL7 A;  3I5G B;  1K95 A;  1TRF A;  2F2O A;  5CSF A;  1SNL A;  3PM8 A;  3SIA A;  1NUB A;  1RRO A;  1VRK A;  3LCP C;  1EJ3 A;  3VRN A;  4L9M A;  2KSP A;  2AMI A;  1F70 A;  1QVI Z;  3IF7 A;  1SKT A;  2K61 A;  2QPT A;  1CMF A;  2WCF A;  2KAV A;  1F8H A;  3LK1 A;  1KSO A;  1KFU L;  1K8U A;  1YR5 A;  1IJ6 A;  4YI8 A;  2VRG A;  3FWB A;  4QJ5 B;  5I8N A;  4YGB B;  2MA2 A;  1CDM A;  1R2U A;  3EVR A;  4ORC B;  2M8U A;  2BKH B;  3OB1 B;  4PDZ A;  3WNX B;  3CR2 A;  1S6J A;  1CKK A;  2M29 A;  2F2P A;  2I94 A;  3WHT B;  4CFQ A;  2CTN A;  3QRX A;  2F33 A;  1CTR A;  2F8P A;  3KPX A;  2JT0 A;  1A75 A;  1N65 A;  1K9U A;  4MZK A;  1PVB A;  1QLS A;  1XVJ A;  2JUL A;  1TNP A;  1ZFS A;  1QLK A;  2KI6 D;  1NX1 A;  2Y4Q A;  5K89 A;  3OX5 A;  1FI5 A;  1FF1 A;  2PAL A;  1K2H A;  1BR1 B;  1KK8 C;  2KDH A;  1MHO A;  5JJG A;  2KAY A;  4CLN A;  1SY9 A;  1QXP A;  2RGI A;  2NCO A;  1JC2 A;  5D69 A;  1JF0 A;  2L98 A;  1M45 A;  1WLM A;  2M9G A;  3JTD B;  4GPL B;  4YI9 A;  1K9K A;  3O78 A;  1IQ5 A;  2OPO A;  4GUK A;  1F55 A;  2ZN8 A;  4U8D A;  3CWG A;  2JU0 A;  1UUS A;  2BCB A;  5BPJ A;  1OMV A;  1H4B A;  1YRU B;  1QV1 A;  1WRK A;  1KFU S;  2JT3 A;  1A2X A;  2PMY A;  1JWD A;  1Q80 A;  1QTX A;  1SMG A;  2JC2 A;  1MWN A;  2LVK A;  2EC6 B;  4YGC B;  1ODB A;  2H2K A;  5G08 A;  1SCM B;  1PSB A;  3CLN A;  2L4I A;  3DD4 A;  2LP2 A;  1BU3 A;  3I5F B;  3SG4 A;  1KSM A;  3GK2 A;  1F71 A;  1TNW A;  1Y0V H;  1CM4 A;  5DKN A;  1DGV A;  4PHN A;  1MXE A;  1XA5 A;  3CS1 A;  1AJ4 A;  2LHI A;  2LUC A;  1AJ5 A;  1LA0 A;  5DKQ A;  4GBA A;  2KAX A;  4OKH A;  3GK1 A;  1QIV A;  2O60 A;  1KFX L;  1F4O A;  1M31 A;  2I2R E;  4N1G A;  1B4C A;  3EK4 A;  1ZAC A;  1OMR A;  2LMU A;  1WLZ A;  2MHH A;  2E30 A;  3I5I B;  3SG2 A;  1YUU A;  2BCA A;  4M2O A;  3OX6 A;  1N0Y A;  1FBV A;  1YVH A;  4GGF C;  1KWO C;  1S3P A;  1NPQ A;  4QJ3 B;  3VRP A;  2HET A;  1RJV A;  3CZT X;  1KQM C;  3E3R A;  2MBX A;  5HYD A;  1WRZ A;  1S5G Y;  5ER5 A;  2CCM A;  1DVI A;  4P5O E;  2LP3 A;  1IKU A;  3O6B A;  1MF8 B;  2KFF A;  3VRR A;  4AOM A;  1CB1 A;  3EVV A;  4C0K A;  4GAO A;  4HRG A;  1QX2 A;  3BOW B;  2JPT A;  3GOF A;  2WOR A;  1U5I B;  3CTN A;  3PAT A;  3PN7 C;  2B1U A;  1B8C A;  4C0L A;  1UHN A;  1HQV A;  2GV5 A;  2KBM A;  3IQQ A;  3WHU B;  2AAO A;  2KGR A;  1YX7 A;  1FPW A;  2JT8 A;  1BOD A;  4IL1 A;  1KCY A;  1B1G A;  2LMT A;  2KBI A;  3HCM A;  3KHE A;  1S6C A;  2ZFD A;  3PN7 B;  3TS5 C;  1S1E A;  3D0Y A;  5FYX A;  3HX4 A;  1XFU O;  4F0Z B;  5B8I B;  1JSA A;  1MUX A;  3M0W A;  2BE4 A;  3AAK A;  1QIW A;  1QVI Y;  2P6B B;  2PVB A;  3MSE B;  2HF5 A;  1NSH A;  2K7D A;  3CR5 X;  3O4Y A;  2IS9 A;  1XFY O;  4GGF A;  3TS5 B;  2V53 A;  2WND A;  2I18 A;  4GNK B;  5AXI A;  4PCW A;  1BMO A;  3KF9 A;  4MSP A;  3NSL A;  5ER4 X;  1DGU A;  3BOW A;  1GQM A;  1U5I A;  1DTL A;  1G33 A;  3PAL A;  1V1G A;  1XK4 A;  3PSR A;  4C0J A;  1CFP A;  4XYN A;  4N5X A;  5F6T A;  1M63 B;  2WCB A;  3EKH A;  2MLE C;  3F45 A;  1ALW A;  1SK6 D;  4YRU A;  2I7A A;  1J1E A;  1PVA A;  1QAT A;  1UHI A;  2BBM A;  3SG7 A;  2JOJ A;  1FI6 A;  1BR4 B;  1YX8 A;  4USL A;  1XFV O;  3BXK A;  1B7T Z;  1UP5 A;  1OE9 B;  5GQQ C;  1DJY A;  3O2P A;  1IG5 A;  4GGN A;  1Y1A A;  1A29 A;  3WXA A;  1OZS A;  1C07 A;  1GGZ A;  2MLF C;  4XJK B;  4MRX A;  2WC8 A;  2LUX A;  1YRT B;  1IH0 A;  4HRH A;  2ZKM X;  1CDN A;  2LE9 B;  1W7J B;  4M2Q A;  5HKY A;  1M39 A;  5D7F A;  2H61 C;  4NDC A;  1N2D A;  1YUS A;  5JOL A;  1DJH A;  4I5K A;  1CDL A;  2GGM A;  2AUC A;  1A03 A;  2M0R A;  2L51 A;  2KQY A;  1Y1U A;  1KK8 B;  1XO5 A;  1CMG A;  2Y5I A;  3TDU A;  4BY5 A;  4CFR A;  2L2E A;  2LM5 A;  1B47 A;  1ZMZ A;  2LC5 A;  2SAS A;  3ICB A;  3EK7 A;  4MRY A;  2LMV A;  1NWD A;  4WQ3 A;  1KK7 Y;  3A8R A;  3TDZ A;  4CID A;  1CLM A;  1CNP A;  2BBN A;  2M97 A;  2K8M B;  2JTZ A;  2LLS A;  2K2A A;  1SBJ A;  1OZO A;  2LV7 A;  1KK7 Z;  1DJX A;  2LHL A;  1UHK A;  4ZCV A;  3OP0 A;  1F4Q A;  4CPV A;  1FW4 A;  2FCE A;  2JQ6 A;  1AVS A;  3A4U B;  3IQO A;  1TNX A;  3BYA A;  1OOJ A;  5HLV A;  3TDI A;  1SCV A;  4BY4 A;  3JVT C;  4PHJ A;  2EHB A;  3OHM B;  5TNC A;  2KNE A;  2HQW A;  1PAL A;  2HPS A;  3C1V A;  2KI6 C;  1K94 A;  1YUT A;  2KFG A;  1B9A A;  1C7W A;  1UHH A;  2FOT A;  5CSN A;  2JNF A;  1J7O A;  1F54 A;  4AQI A;  3EKJ A;  1JFJ A;  5AFP A;  2KI4 C;  1PSR A;  2GGZ A;  2K2F A;  1NIW A;  1DMO A;  4OV2 A;  1RWY A;  1EG3 A;  1RFJ A;  1KQV A;  3K21 A;  1DJZ A;  2LLU A;  4PE7 A;  5CSI A;  4DUQ A;  1MXL C;  3BUX B;  4P2Y B;  1DF0 B;  3TZ1 A;  4AQJ A;  2PSR A;  2PRU A;  1KWO B;  2KI4 B;  1X02 A;  4ORB B;  4FTG A;  4YGE B;  5J3X A;  2JRF A;  2LVJ A;  1KQM B;  2KFH A;  1AHR A;  4A4B A;  1D1O A;  3SG5 A;  1CFC A;  1QX5 B;  4UPG A;  1LXF C;  1UWO A;  3SG3 A;  2NLN A;  1AP4 A;  1SR6 C;  2ZRS A;  5AEQ A;  1UUR A;  4YGA A;  1IRJ A;  2G9B A;  1L2O C;  4OR9 B;  2ISD A;  1BF5 A;  1IGV A;  1SW8 A;  1EXR A;  1GGW A;  1S36 A;  1G8I A;  3BQ3 A;  2PAS A;  1J55 A;  3SG6 A;  3BUW B;  3DVK A;  5CSJ A;  4MVF A;  1BJF A;  5HKZ A;  1XFW O;  1XYD A;  2Y1M A;  1KFX S;  3AKB A;  1SR6 B;  4HSZ A;  2M7N A;  1REC A;  4N1F A;  3SJS A;  1L2O B;  4JQ0 D;  1SL8 A;  2KQ6 A;  1S26 D;  2JWW A;  3TUY C;  1DF0 A;  2KHN A;  1A4P A;  1K9P A;  1QJT A;  1RK9 A;  2F3Z A;  3I5G C;  3KO0 A;  1CFF A;  3OB2 B;  1JF2 A;  3FWC A;  2BL0 C;  3BUN B;  1AK8 A;  1H8B A;  2E6W A;  1J1D A;  1L7Z A;  2MRD A;  3LK0 A;  2M1U A;  2MJW B;  1Y6W A;  5HLO A;  3AKA A;  4Q04 A;  4GFT A;  1DJI A;  1ZUZ A;  2D8N A;  2KGB C;  4MN0 A;  4MZJ A;  5I2L A;  2BL0 B;  1A75 B;  4HRE E;  1B7T Y;  2KYC A;  2LVV A;  1PUL A;  1TNQ A;  4DS7 A;  2L0P A;  1SPY A;  1NCZ A;  1CDP A;  2ZNE A;  3VRO A;  2SCP A;  1C7V A;  2CXJ A;  3NSI A;  5PAL A;  4I5J A;  1CM1 A;  3EVU A;  3NSK A;  1G4Y R;  4PE4 A;  2OTG C;  1YTZ C;  1LA3 A;  2DOQ A;  2ZN9 A;  2O5G A;  2HQ8 A;  1DT7 B;  3LLE A;  1IQ3 A;  2EGD A;  4YGD B;  1R6P A;  3NXA A;  4MEW A;  3ZNI A;  1RTP 1;  1BG1 A;  2CBL A;  1IWQ A;  2LNK A;  2K7C A;  2LAN A;  4WRI A;  1NYA A;  5CPV A;  2OTG B;  4PE1 A;  2BEC A;  1B8L A;  5I2O A;  2OS8 C;  1TTX A;  1TCF A;  2NXQ A;  1BOC A;  1WY9 A;  2M49 B;  4ZCU A;  4QJ4 B;  1JUO A;  2NZ0 A;  4ICB A;  1MQ1 A;  1MR8 A;  1NX0 A;  4MZL A;  4PAL A;  1E8A A;  1W7I B;  3LL8 B;  3RM1 A;  1SRA A;  1HT9 A;  2OS8 B;  2KOT A;  3JTD C;  3I5H C;  5KSZ A;  1BT6 A;  2LLT A;  1YVL A;  3BUO B;  1OQP A;  5KU1 A;  4JPZ B;  1DJW A;  4XJK A;  1QS7 A;  1CLL A;  1WDC C;  3ZWH A;  1V1F A;  2EC6 C;  2LAP A;  2QAC A;  3I5H B;  1SCM C;  4MBE A;  4OVN F;  1YUR A;  3I5F C;  3RLZ A;  2TN4 A;  2Q91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...