4FTGA

The crystal structure of an ahnak peptide in complex with the s100a10/anxa2 heterotetramer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A10
publication title Structure of a C-terminal AHNAK peptide in a 1:2:2 complex with S100A10 and an acetylated N-terminal peptide of annexin A2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein/protein binding
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ftgA00
4AQJA 2LAPA 1BMOA 1GQMA 2KFHA 1IJ5A 1XFZO 1UHIA 1D1OA 1UHKA 5DKRA 4TNCA 2LLSA 5AEQA 1LVCD 1K95A 1NWDA 1DVIA 1YRTB 3DVEA 1AVSA 1G4YR 4CPVA 4JQ0D 4WRIA 1KWOC 5DKQA 1YUUA 1XK4C 2Y5IA 1JUOA 2M8UA 2M3WA 1GJYA 2OTGB 1B47A 2F8PA 1M31A 2NXQA 1PVAA 3EKHA 1KFXL 5CSIA 5HKYA 4PE1A 3ZWHA 2GV5A 3GK4X 5HLVA 1FPWA 4MSPA 4YRUA 3SG7A 3TUYB 1TNPA 1JFKA 3AAKA 1WLMA 4NDCA 1K2HA 2IS9A 1QLSA 1EH2A 1TNWA 1CFDA 2AAOA 2V53A 1BG1A 1F55A 4GFTA 2AUCA 1R2UA 2FJUB 1TNQA 3JTDB 5PALA 1FI6A 1S5GY 1DJWA 2H61A 1SL8A 4U8DA 2KOTA 4DCKA 5TNCA 3SG3A 2FCDA 1OMDA 3CLNA 3AKAA 1RROA 4JPZB 1A75A 1V1FA 2LM5A 4HRGA 4MLWA 3BUOB 2BL0C 1N0YA 1DJYA 1B8LA 5CSFA 1Y1UA 2FOTA 4MEWA 4GAOA 1BU3A 2JT0A 2CTNA 3PATA 4YGEB 2GGMA 2ZKMX 3BOWB 1GGZA 1OOJA 1S1EA 3SIAA 1MF8B 3O6BA 1SCMB 2BCAA 2LLUA 1J7QA 1Q80A 1LA0A 1AP4A 1XFYO 1SKTA 1RWYA 4DIRA 1SCVA 2BECA 1QLKA 4ZCUA 2B1UA 2ZFDA 1S6IA 4FQOA 2ZN8A 3NXAA 1B9AA 1JSAA 1S26D 1WRLA 1XVJA 1YVHA 2NCOA 3JVTB 1DJIA 2GGZA 2JPTA 4ORCB 2LHLA 3SJSA 1RJVA 1UHJA 1LXFC 2KHNA 4ETOA 2KAYA 1SL7A 2MRDA 4MVFA 4YGAA 1TCFA 3SG4A 1IJ6A 1CFPA 1ZFSA 4Q04A 2KSPA 4PHMA 1PSRA 3FS7A 2BCBA 1QASA 3VROA 1B8CA 3JVTC 2JQ6A 2K7BA 2F3ZA 5I8NA 1CLMA 3M0WA 3O2PA 1AJ5A 1SR6C 3I5GC 1J7RA 1RK9A 4UPGA 2M7NA 1TNXA 2JT3A 2F3YA 3D10A 1SYMA 3CR2A 4XYNA 1K9PA 2JTZA 3E3RA 2ISDA 1J7OA 1JWDA 1ZUZA 1G8IA 4L9MA 1CLLA 4HREE 4NQGA 4XJKA 2P6BB 3BUXB 3I5FC 1F8HA 2K2FA 2JULA 4OVNF 1BR4B 3SG5A 1AJ4A 1QXPA 1S5GZ 2I2RE 5KTYA 2KQ6A 1K9KA 1B8RA 2BCXA 3ZNIA 3PFVA 1KCYA 5AFPA 2JWWA 1J1DA 4YGDB 4PDZA 1HT9A 1NP8A 2EC6C 1YUTA 3DVMA 3PALA 3DVJA 5BPJA 2CCMA 2HETA 4I5LB 5HLOA 1PULA 1CKKA 1JF2A 1WRZA 1U5IB 2K8MB 1QV1A 3NSIA 4ICBA 1JFJA 3SIBA 2JNFA 4PALA 1CDLA 4HRHA 1ALWA 4I5JA 1J1EA 4MN0A 2BKHB 2CNPA 3BOWA 5D69A 4A4CA 2KAVA 4GUKA 4CIDA 3TS5B 1YX7A 4WQ3A 1A03A 1EXRA 4OR9B 4YI8A 1IQ3A 2WORA 1MUXA 1B1GA 2COLB 3CGAA 1L2OB 1RFJA 3NSOA 5DKNA 4MZLA 5FYXA 3PM8A 1PVBA 3DD4A 2CBLA 2M97A 3H4SE 3A8RA 3DVKA 2PVBA 2K7CA 1KFUS 1LKJA 1JF0A 4XJKB 1TN4A 4PHKA 1QX2A 1M46A 4I5KA 2KYFA 1CDNA 4E68A 4N5XA 2KI4B 3WXAA 1G33A 2MAZA 4GPLB 2PSRA 3I5IB 2OTGC 2WCEA 1IQ5A 2JXLA 1XYDA 1SK6D 4I5NB 1OMRA 1K90D 3OB1B 3TDIA 3GK1A 1YTZC 2Q91A 3ICBA 4YGBB 2KFGA 2BKIB 1F4OA 5CPVA 3TUYC 2LVIA 1EL4A 3LLEA 1F54A 2PRUA 2EGDA 1C7VA 4N1GA 1SY9A 4CFQA 2LP3A 1XFUO 1KK8B 3JTDC 4OKHA 4C0JA 1DGVA 2OS8B 1CDMA 1IRJA 1KFXS 2LCPA 2LMVA 4QJ3B 4BY5A 4DUQA 5AERA 2BBNA 1K93D 4NDBA 4F0ZB 3VRPA 2SASA 3EVUA 2FCEA 2KI6D 4FTGA 3BUMB 3TZ1A 3WHUB 3LCPC 2WC8A 2ZN9A 1DTLA 1DGUA 4GNKB 4QJ4B 1KK7Y 1S6JA 1SBJA 1NX3A 1SCMC 1CTRA 1OSAA 3PN7B 1C07A 1J7PA 1QVIY 1UURA 1U5IA 2JC2A 4MZKA 1MWNA 2K0JA 1J55A 1K8UA 1UHNA 4A4BA 3OHMB 3CZTX 2F33A 1NCZA 2L4IA 2LNKA 1DT7B 5J3XA 2M7LA 3CR5X 2LC5A 1PK0D 2Q4UA 1WDCB 3NSLA 1FF1A 1H4BA 2QPTA 2OPOA 2M1UA 5CSJA 4DRWA 3LK1A 3VRNA 3LL8B 1YX8A 1XO5A 4USLA 1CFCA 5B8IB 1K94A 2R2IA 2MJWB 1SL9A 4OCIA 1FW4A 1E8AA 4YI9A 5ER5A 2LUXA 3F45A 3HX4A 3K21A 1Y6WA 5AANA 5ER4X 2H2KA 3LK0A 1EG4A 1PALA 3GOFA 4MBEA 3EKJA 2D8NA 4ZCVA 3RLZA 2H61C 2PMYA 1MXEA 2RGIA 3EK8A 2M49B 3I5HB 4D1EA 3FIAA 1SMGA 1YURA 1WY9A 2JTTA 1JBAA 4ORAB 1DJZA 3TDZA 2I18A 2NCPA 2L50A 3O78A 1DF0B 1FBVA 2KGBC 1NX2A 2L98A 5I2QA 1PSBA 4CLNA 2MA2A 1S3PA 1UHHA 3DF0A 2JRFA 2LUCA 5HKZA 1A2XA 1AUIB 2I94A 1B4CA 1F4QA 2LHIA 4AQIA 1NCYA 3WNXB 1B7TY 1M63B 2ZNEA 1TCOB 5I2OA 2BE4A 2MLFC 2F2PA 3D0YB 5I2LA 1X02A 1QIVA 1BT6A 1YR5A 2MHHA 1V1GA 3WHTB 2M0RA 2JU0A 2QACA 2HPSA 2LVVA 3AKBA 4PCWA 1H8BA 2F2OA 1Y1XA 2TN4A 1YUSA 4R1EA 2ZRSA 1XFVO 3EK4A 5KSZA 1KK7Z 1KQMB 2K61A 2L5XB 3EK7A 2JXCA 2LANA 4YBHB 2K7DA 2KNEA 1DJXA 1BLQA 1KSOA 1S36A 2KI6C 3EVRA 1TOPA 2Y1NA 2WCFA 1N2DA 1KWOB 1CM1A 1NSHA 2EHBA 3BYAA 3TS5C 1R6PA 4JWQA 2M1KB 1KQMC 3C1VA 4MZJA 4PHJA 1ALVA 1L2OC 1CM4A 2KQYA 1QIWA 1K9UA 4N1FA 1BODA 1SW8A 4MRYA 1TIZA 2L51A 4NDDA 1DMOA 1OE9B 1QX5B 1A4PA 2ZRTA 1OZSA 3PLFB 1QATA 1UP5A 3EVVA 1UWOA 5D7FA 2AMIA 1WLZA 3DF0B 1ZACA 1NUBA 3BUWB 1CB1A 2KI4C 3KF9A 3KHEA 1NPQA 2KFFA 2BE6A 1QJTA 1BOCA 1BJFA 3I5IC 3AAJA 2E6WA 2BBMA 2LE9B 1BR1B 4C0KA 1L7ZA 1M45A 2LMTA 1N65A 2CXJA 3SG2A 2G2BA 4HSZA 1XFWO 2Y1MA 4PE4A 2BL0B 4MRXA 5JOLA 3CR4X 1OZOA 1NX0A 2L2EA 1DF0A 1RECA 2LV7A 4M2PA 1LA3A 2G9BA 1K96A 3OX6A 3FWCA 1KK8C 1QTXA 2HQ8A 2KDHA 5HKWA 1ZMZA 2NLNA 3O4YA 3OX5A 3TDUA 1B7TZ 1RTP1 2OS8C 2K2AA 2PALA 3IF7A 3KEVA 4GGNA 1WRKA 4GBAA 1MXLC 5JJGA 5CSNA 1SNLA 2HF5A 1CMGA 2WCBA 1HQVA 4GGFA 1A29A 3FWBA 3PSRA 1IGVA 1MQ1A 2LVKA 1QV0A 1W7IB 1SPYA 2E30A 3BXKA 3D0YA 1Y1AA 4PE7A 3VRRA 2LVJA 2KBIA 1YVLA 1ODBA 4QJ5B 1IWQA 2JZIA 3PN7C 3KPXA 1DJGA 1W7JB 2SCPA 1MR8A 3CS1A 5F6TA 3HCMA 3IQQA 2L0PA 1CDPA 1ZOTB 3VGOA 1TTXA 1JC2A 1XFXO 1QX7A 1CNPA 4C0LA 3I5GB 1SR6B 1WDCC 1AK8A 2JNXA 1IH0A 3CTNA 1XK4A 2MLEC 2WOSA 3OP0A 3BUNB 1F70A 2JOJA 2JT8A 4IL1A 1BF5A 2O60A 4ORBB 3OB2B 1AHRA 5AXIA 1EG3A 1C7WA 3I5FB 2KYCA 1CMFA 1KQVA 2LP2A 1NX1A 2M29A 1FI5A 1OMVA 5GQQC 2PASA 2VRGA 1PRWA 1A75B 3I5HC 4OV2A 1KSMA 5K89A 2A4JA 1LINA 3BQ3A 3IQOA 4WQ2A 4DS7A 4BY4A 2DOQA 2M9GA 3MSEB 3NSKA 2MBXA 2CT9A 5HYDA 1VRKA 1GGWA 2EC6B 1CFFA 4PE0A 2Y4QA 2KAXA 2NZ0A 3GK2A 2KBMA 4M2OA 2L4HA 1NYAA 4CFRA 1F71A 1EJ3A 1TRFA 2HQWA 3SG6A 3CWGA 2K7OA 1IKUA 1YRUB 4AOMA 5KU1A 1XA5A 4P5OE 1NCXA 3KO0A 1MHOA 4P2YB 4GGFC 1M39A 1KFUL 2LLTA 1OQPA 2O5GA 2ZNDA 3VRQA 2WNDA 5G08A 1SRAA 3RM1A 4PHNA 1Y0VH 1QVIZ 2LMUA 4M2QA 1NIWA 1UUSA 3A4UB 3QRXA 4YGCB 5IBWA 2KGRA 1CLBA 1DJHA 1QS7A 1S6CA 1IG5A 2I7AA
chains in the Genus database with same CATH superfamily
4AQJA 2LAPA 1BMOA 1GQMA 2KFHA 1IJ5A 1XFZO 1UHIA 1D1OA 1UHKA 1SSEB 5DKRA 1TUJA 4TNCA 2LLSA 5AEQA 1LVCD 1K95A 1NWDA 1DVIA 3CDNA 1YRTB 3DVEA 3R72A 1AVSA 1G4YR 4CPVA 4JQ0D 4WRIA 1KWOC 5DKQA 1YUUA 1XK4C 2Y5IA 1JUOA 2M8UA 2M3WA 1GJYA 2OTGB 1B47A 2F8PA 1M31A 2NXQA 1PVAA 3BJHA 3EKHA 1KFXL 5CSIA 5HKYA 4PE1A 3ZWHA 2GV5A 3GK4X 5HLVA 1FPWA 4MSPA 4YRUA 3SG7A 3NGVA 3TUYB 1TNPA 1JFKA 3AAKA 1WLMA 4NDCA 1K2HA 2IS9A 1QLSA 1EH2A 1TNWA 1CFDA 2AAOA 2V53A 1BG1A 1F55A 3R1PA 4GFTA 2AUCA 1R2UA 2FJUB 1TNQA 3JTDB 5PALA 1FI6A 1S5GY 1DJWA 2H61A 1SL8A 4U8DA 2KOTA 4DCKA 5TNCA 3SG3A 2FCDA 1OMDA 3CLNA 3AKAA 1RROA 4JPZB 1A75A 1V1FA 2LM5A 4HRGA 4MLWA 3BUOB 2BL0C 1N0YA 1DJYA 3V2LA 1B8LA 2KLDA 5CSFA 1Y1UA 2FOTA 4MEWA 4GAOA 1BU3A 2JT0A 2CTNA 3PATA 2FJYA 2GGMA 2ZKMX 4YGEB 3BOWB 1GGZA 1OOJA 1S1EA 3FE6A 1MF8B 3SIAA 3O6BA 1SCMB 1Z4HA 2BCAA 2LLUA 1J7QA 3R1OA 3S0FA 1Q80A 1LA0A 1AP4A 1XFYO 3PM2A 1SKTA 1RWYA 3R1VA 4DIRA 1SCVA 2BECA 1QLKA 4ZCUA 3SS5A 2B1UA 2ZFDA 1S6IA 4FQOA 2ZN8A 3NXAA 1B9AA 1JSAA 1S26D 1WRLA 1XVJA 1YVHA 2NCOA 3JVTB 1DJIA 2GGZA 2JPTA 3B7AA 4ORCB 5D3OA 2LHLA 3SJSA 1RJVA 1UHJA 1LXFC 2KHNA 1DC1A 4ETOA 2KAYA 1SL7A 2MRDA 4MVFA 4YGAA 1TCFA 3SG4A 1IJ6A 2H8VA 1CFPA 1ZFSA 4Q04A 2KSPA 4PHMA 1PSRA 1P28A 2BCBA 1QASA 3FS7A 1B8CA 3JVTC 3VROA 2JQ6A 2K7BA 3BFBA 2F3ZA 5I8NA 1CLMA 3M0WA 3PJIA 3CYZA 3O2PA 1AJ5A 1SR6C 3I5GC 1J7RA 1RK9A 4UPGA 2M7NA 1TUZA 1TNXA 2JT3A 2F3YA 3D10A 1SYMA 3CR2A 4XYNA 5HL1A 2QEBA 1K9PA 2JTZA 3E3RA 2ISDA 1J7OA 1JWDA 1ZUZA 1G8IA 4L9MA 1CLLA 4HREE 4NQGA 4IJ7A 4XJKA 2P6BB 2WCLA 3BUXB 3I5FC 1F8HA 2K2FA 2JULA 4OVNF 1BR4B 3SG5A 1AJ4A 1QXPA 3O4XA 1S5GZ 2I2RE 5KTYA 2KQ6A 1K9KA 1B8RA 2BCXA 3ZNIA 3PFVA 1KCYA 1IIOA 5AFPA 3L4LA 2JWWA 3DXLA 1J1DA 4YGDB 4PDZA 1HT9A 1NP8A 2EC6C 3N7HA 1YUTA 3DVMA 3PALA 3DVJA 5BPJA 2CCMA 2HETA 4I5LB 5HLOA 1PULA 1CKKA 1JF2A 5EL2A 1WRZA 1U5IB 2K8MB 3FE8A 3BFAA 1QV1A 3NSIA 2P71A 4ICBA 4KYNA 1JFJA 3SIBA 2JNFA 3VB1A 4F7FA 4PALA 1CDLA 1DQEA 1ALWA 4HRHA 1J1EA 4I5JA 4MN0A 2BKHB 2CNPA 3BOWA 5D69A 4A4CA 2KAVA 3QMEA 4GUKA 4CIDA 3TS5B 1YX7A 4WQ3A 1A03A 3D75A 1EXRA 4OR9B 4YI8A 1IQ3A 3CABA 2WORA 1MUXA 1B1GA 2COLB 3CGAA 1L2OB 1RFJA 2K60A 2WCKA 3EG5B 3NSOA 3PM8A 4MZLA 5DKNA 5FYXA 1PVBA 3DD4A 1OOHA 2CBLA 2M97A 3DY9A 3H4SE 3A8RA 3DVKA 2PVBA 2K7CA 1KFUS 1LKJA 1JF0A 4XJKB 1TN4A 4PHKA 1QX2A 1M46A 4I5KA 2KYFA 1CDNA 4E68A 4N5XA 2KI4B 3WXAA 1G33A 2MAZA 4GPLB 2PSRA 3I5IB 2OTGC 2WCEA 1IQ5A 2JXLA 1XYDA 1SK6D 4I5NB 1C3YA 1OMRA 1K90D 5FI6A 5IBWA 3OB1B 3TDIA 3GK1A 1YTZC 2Q91A 3ICBA 4YGBB 1Z2CB 2KFGA 1ORGA 2BKIB 3DYEA 1F4OA 5CPVA 3TUYC 2LVIA 1EL4A 3LLEA 2PYQA 2PRUA 1F54A 2EGDA 1C7VA 5FI2A 4N1GA 1SY9A 4CFQA 2LP3A 1XFUO 1KK8B 3D78A 3JTDC 4INWA 4OKHA 4C0JA 1DGVA 2OS8B 1CDMA 1IRJA 1KFXS 2LCPA 2LMVA 4INXA 4QJ3B 4BY5A 5I94A 4DUQA 5AERA 2BBNA 1K93D 4NDBA 4F0ZB 3VRPA 2SASA 3EVUA 2FCEA 1W9ZA 2KI6D 4FTGA 3BUMB 3TZ1A 3WHUB 3OGNA 3SS4A 3LCPC 2WC8A 2PQLA 2ZN9A 1DTLA 2BAPA 1DGUA 3CZ1A 3NHTA 4GNKB 3S0EA 4QJ4B 1KK7Y 1S6JA 1SBJA 1NX3A 1SCMC 1CTRA 1OSAA 3PN7B 1C07A 1J7PA 1QVIY 1UURA 3B88A 1U5IA 2JC2A 4MZKA 1MWNA 2K0JA 1J55A 1K8UA 1UHNA 4A4BA 3OHMB 3CZTX 2F33A 1NCZA 2L4IA 2LNKA 1DT7B 3B87A 5J3XA 4FQTA 1T14A 2LC5A 1PK0D 2Q4UA 3CR5X 1WDCB 3NSLA 2M7LA 1FF1A 1H4BA 2QPTA 2QEVA 2OPOA 2M1UA 5CSJA 4DRWA 2QDIA 3LK1A 3S0GA 3VRNA 3LL8B 1YX8A 1XO5A 4USLA 1CFCA 5B8IB 1K94A 2R2IA 2MJWB 1SL9A 4OCIA 1FW4A 1OW4A 1E8AA 4YI9A 5ER5A 2LUXA 3F45A 2L2CA 3HX4A 3K21A 1Y6WA 5AANA 5ER4X 2H2KA 3LK0A 1EG4A 1PALA 3GOFA 4MBEA 3EKJA 2D8NA 4ZCVA 3RLZA 2H61C 2PMYA 1MXEA 2RGIA 3B6XA 2M49B 3EK8A 3I5HB 4D1EA 3FIAA 1SMGA 1YURA 2WCJA 1WY9A 2JTTA 3D73A 1JBAA 4ORAB 2BNXA 1DJZA 3TDZA 2I18A 2NCPA 2L50A 3O78A 1DF0B 3L47A 1FBVA 2JPOA 2KGBC 1NX2A 1XFRA 2L98A 5I2QA 1PSBA 4CLNA 2MA2A 1S3PA 1UHHA 2QEHA 2JRFA 2WC5A 3DF0A 2LUCA 5HKZA 1A2XA 1AUIB 2I94A 1B4CA 1F4QA 2LHIA 4AQIA 1NCYA 1QWVA 3WNXB 1B7TY 1M63B 2ZNEA 1TCOB 4JKTA 5I2OA 2BE4A 2MLFC 2F2PA 3D0YB 5I2LA 1X02A 1QIVA 1BT6A 1YR5A 2MHHA 1V1GA 3WHTB 2M0RA 1OOIX 1LS8A 2HPSA 2JU0A 2LVVA 2QACA 3AKBA 4PCWA 2F2OA 1H8BA 1Y1XA 2TN4A 1YUSA 4R1EA 2ZRSA 1XFVO 3EK4A 5KSZA 1KK7Z 1KQMB 2K61A 2L5XB 3EK7A 2JXCA 2LANA 2WCHA 4YBHB 2K7DA 2KNEA 1DJXA 1BLQA 1KSOA 1S36A 2KI6C 3EVRA 1TOPA 2Y1NA 2WCFA 1N2DA 1KWOB 1CM1A 1NSHA 2EHBA 3BYAA 3TS5C 1R6PA 4JWQA 2M1KB 1KQMC 3C1VA 4MZJA 4OZDA 4PHJA 1ALVA 1L2OC 1CM4A 2KQYA 1QIWA 1K9UA 4N1FA 1BODA 3UNWA 1SW8A 4MRYA 1TIZA 2L51A 3NHIA 4NDDA 1DMOA 1OE9B 1QX5B 1A4PA 2ZRTA 1OZSA 3PLFB 1QATA 1UP5A 3EVVA 1UWOA 5D7FA 2AMIA 1WLZA 3DF0B 1ZACA 1NUBA 3BUWB 1CB1A 2KI4C 3KF9A 3KHEA 1DEKA 1NPQA 2KFFA 2P70A 2BE6A 3CZ2A 1QJTA 1BOCA 1BJFA 3I5IC 3RZSA 3AAJA 5DICA 2E6WA 5FI7A 2BBMA 2GTEA 2LE9B 1BR1B 4C0KA 1L7ZA 1M45A 2LMTA 1TWOA 1N65A 2CXJA 3SG2A 2G2BA 4HSZA 1XFWO 2Y1MA 4PE4A 2BL0B 4MRXA 5JOLA 3CR4X 1OZOA 1NX0A 2L2EA 4PT1A 1DF0A 1RECA 2LV7A 4M2PA 1LA3A 2G9BA 1K96A 3OX6A 3FWCA 1KK8C 1QTXA 2HQ8A 2KDHA 5HKWA 1ZMZA 2NLNA 4JD9A 3O4YA 3OX5A 3TDUA 1B7TZ 1RTP1 2OS8C 2K2AA 2PALA 3IF7A 3KEVA 4GGNA 1WRKA 4GBAA 1MXLC 5JJGA 5CSNA 1SNLA 2HF5A 2WC6A 2WCBA 2WCMA 1CMGA 1HQVA 4GGFA 2L5YA 1A29A 3FWBA 3PSRA 1IGVA 1MQ1A 2ERBA 2LVKA 1QV0A 1W7IB 1SPYA 2E30A 3BXKA 3D0YA 1Y1AA 4PE7A 3VRRA 2LVJA 2KBIA 1YVLA 1ODBA 4QJ5B 1IWQA 2JZIA 3S0AA 3PN7C 3KPXA 1DJGA 1W7JB 2SCPA 1MR8A 3CS1A 5F6TA 3HCMA 3IQQA 2L0PA 1CDPA 3K1EA 1ZOTB 3D76A 3VGOA 1C3ZA 1TTXA 3S0BA 3UO9A 1JC2A 1XFXO 1QX7A 3D74A 3D77A 1CNPA 4C0LA 3DZTA 3I5GB 1SR6B 1WDCC 1AK8A 2JNXA 1IH0A 3CTNA 3L4AA 3Q8IA 1XK4A 2MLEC 2WOSA 3OP0A 3BUNB 1F70A 2JOJA 2JT8A 4IL1A 1BF5A 2O60A 4ORBB 3OB2B 1AHRA 5AXIA 1EG3A 3SS3A 1C7WA 2KPHA 3I5FB 2KYCA 1CMFA 1KQVA 2LP2A 1NX1A 2M29A 1FI5A 1OMVA 3IVTA 5GQQC 2PASA 2VRGA 1PRWA 1A75B 3I5HC 4OV2A 1KSMA 5K89A 2A4JA 1LINA 3BQ3A 3IQOA 4WQ2A 4DS7A 4BY4A 2DOQA 2M9GA 3MSEB 3NSKA 3OBVA 2CT9A 2MBXA 1VRKA 5HYDA 2EC6B 1CFFA 1GGWA 4PE0A 2Y4QA 2KAXA 2NZ0A 3GK2A 1OOGA 2KBMA 2QEOA 4M2OA 1GM0A 2L4HA 3B86A 1NYAA 4CFRA 1F71A 1EJ3A 1TRFA 2HQWA 3SG6A 3CWGA 2K7OA 1IKUA 1YRUB 4AOMA 5KU1A 1XA5A 2YGUA 3CZ0A 1NCXA 3BFHA 4P5OE 3KO0A 1MHOA 4P2YB 4GGFC 1M39A 1KFUL 2LLTA 1OQPA 2O5GA 2ZNDA 3VRQA 2WNDA 5G08A 1SRAA 2KLEA 3RM1A 3S0DA 4PHNA 1Y0VH 1QVIZ 1OOFA 2LMUA 1NIWA 1UUSA 3A4UB 3QRXA 4M2QA 4YGCB 2KGRA 3FE9A 1CLBA 1DJHA 1DELA 1QS7A 1S6CA 1IG5A 2I7AA
chains in the Genus database with same CATH topology
4AQJA 2LAPA 1BMOA 1GQMA 2KFHA 1IJ5A 1XFZO 1UHIA 1D1OA 1UHKA 5DKRA 4TNCA 2LLSA 5AEQA 1LVCD 1K95A 1NWDA 1DVIA 1YRTB 3DVEA 1AVSA 1G4YR 4CPVA 4JQ0D 4WRIA 1KWOC 5DKQA 1YUUA 1XK4C 2Y5IA 1JUOA 2M8UA 2M3WA 1GJYA 2OTGB 1B47A 2F8PA 1M31A 2NXQA 1PVAA 3EKHA 1KFXL 5CSIA 5HKYA 4PE1A 3ZWHA 2GV5A 3GK4X 5HLVA 1FPWA 4MSPA 4YRUA 3SG7A 3TUYB 1TNPA 1JFKA 3AAKA 1WLMA 4NDCA 1K2HA 2IS9A 1QLSA 1EH2A 1TNWA 1CFDA 2AAOA 2V53A 1BG1A 1F55A 4GFTA 2AUCA 1R2UA 2FJUB 1TNQA 3JTDB 5PALA 1FI6A 1S5GY 1DJWA 2H61A 1SL8A 4U8DA 2KOTA 4DCKA 5TNCA 3SG3A 2FCDA 1OMDA 3CLNA 3AKAA 1RROA 4JPZB 1A75A 1V1FA 2LM5A 4HRGA 4MLWA 3BUOB 2BL0C 1N0YA 1DJYA 1B8LA 5CSFA 1Y1UA 2FOTA 4MEWA 4GAOA 1BU3A 2JT0A 2CTNA 3PATA 4YGEB 2GGMA 2ZKMX 3BOWB 1GGZA 1OOJA 1S1EA 3SIAA 1MF8B 3O6BA 1SCMB 2BCAA 2LLUA 1J7QA 1Q80A 1LA0A 1AP4A 1XFYO 1SKTA 1RWYA 4DIRA 1SCVA 2BECA 1QLKA 4ZCUA 2B1UA 2ZFDA 1S6IA 4FQOA 2ZN8A 3NXAA 1B9AA 1JSAA 1S26D 1WRLA 1XVJA 1YVHA 2NCOA 3JVTB 1DJIA 2GGZA 2JPTA 4ORCB 2LHLA 3SJSA 1RJVA 1UHJA 1LXFC 2KHNA 4ETOA 2KAYA 1SL7A 2MRDA 4MVFA 4YGAA 1TCFA 3SG4A 1IJ6A 1CFPA 1ZFSA 4Q04A 2KSPA 4PHMA 1PSRA 3FS7A 2BCBA 1QASA 3VROA 1B8CA 3JVTC 2JQ6A 2K7BA 2F3ZA 5I8NA 1CLMA 3M0WA 3O2PA 1AJ5A 1SR6C 3I5GC 1J7RA 1RK9A 4UPGA 2M7NA 1TNXA 2JT3A 2F3YA 3D10A 1SYMA 3CR2A 4XYNA 1K9PA 2JTZA 3E3RA 2ISDA 1J7OA 1JWDA 1ZUZA 1G8IA 4L9MA 1CLLA 4HREE 4NQGA 4XJKA 2P6BB 3BUXB 3I5FC 1F8HA 2K2FA 2JULA 4OVNF 1BR4B 3SG5A 1AJ4A 1QXPA 1S5GZ 2I2RE 5KTYA 2KQ6A 1K9KA 1B8RA 2BCXA 3ZNIA 3PFVA 1KCYA 5AFPA 2JWWA 1J1DA 4YGDB 4PDZA 1HT9A 1NP8A 2EC6C 1YUTA 3DVMA 3PALA 3DVJA 5BPJA 2CCMA 2HETA 4I5LB 5HLOA 1PULA 1CKKA 1JF2A 1WRZA 1U5IB 2K8MB 1QV1A 3NSIA 4ICBA 1JFJA 3SIBA 2JNFA 4PALA 1CDLA 4HRHA 1ALWA 4I5JA 1J1EA 4MN0A 2BKHB 2CNPA 3BOWA 5D69A 4A4CA 2KAVA 4GUKA 4CIDA 3TS5B 1YX7A 4WQ3A 1A03A 1EXRA 4OR9B 4YI8A 1IQ3A 2WORA 1MUXA 1B1GA 2COLB 3CGAA 1L2OB 1RFJA 3NSOA 5DKNA 4MZLA 5FYXA 3PM8A 1PVBA 3DD4A 2CBLA 2M97A 3H4SE 3A8RA 3DVKA 2PVBA 2K7CA 1KFUS 1LKJA 1JF0A 4XJKB 1TN4A 4PHKA 1QX2A 1M46A 4I5KA 2KYFA 1CDNA 4E68A 4N5XA 2KI4B 3WXAA 1G33A 2MAZA 4GPLB 2PSRA 3I5IB 2OTGC 2WCEA 1IQ5A 2JXLA 1XYDA 1SK6D 4I5NB 1OMRA 1K90D 3OB1B 3TDIA 3GK1A 1YTZC 2Q91A 3ICBA 4YGBB 2KFGA 2BKIB 1F4OA 5CPVA 3TUYC 2LVIA 1EL4A 3LLEA 1F54A 2PRUA 2EGDA 1C7VA 4N1GA 1SY9A 4CFQA 2LP3A 1XFUO 1KK8B 3JTDC 4OKHA 4C0JA 1DGVA 2OS8B 1CDMA 1IRJA 1KFXS 2LCPA 2LMVA 4QJ3B 4BY5A 4DUQA 5AERA 2BBNA 1K93D 4NDBA 4F0ZB 3VRPA 2SASA 3EVUA 2FCEA 2KI6D 4FTGA 3BUMB 3TZ1A 3WHUB 3LCPC 2WC8A 2ZN9A 1DTLA 1DGUA 4GNKB 4QJ4B 1KK7Y 1S6JA 1SBJA 1NX3A 1SCMC 1CTRA 1OSAA 3PN7B 1C07A 1J7PA 1QVIY 1UURA 1U5IA 2JC2A 4MZKA 1MWNA 2K0JA 1J55A 1K8UA 1UHNA 4A4BA 3OHMB 3CZTX 2F33A 1NCZA 2L4IA 2LNKA 1DT7B 5J3XA 2M7LA 3CR5X 2LC5A 1PK0D 2Q4UA 1WDCB 3NSLA 1FF1A 1H4BA 2QPTA 2OPOA 2M1UA 5CSJA 4DRWA 3LK1A 3VRNA 3LL8B 1YX8A 1XO5A 4USLA 1CFCA 5B8IB 1K94A 2R2IA 2MJWB 1SL9A 4OCIA 1FW4A 1E8AA 4YI9A 5ER5A 2LUXA 3F45A 3HX4A 3K21A 1Y6WA 5AANA 5ER4X 2H2KA 3LK0A 1EG4A 1PALA 3GOFA 4MBEA 3EKJA 2D8NA 4ZCVA 3RLZA 2H61C 2PMYA 1MXEA 2RGIA 3EK8A 2M49B 3I5HB 4D1EA 3FIAA 1SMGA 1YURA 1WY9A 2JTTA 1JBAA 4ORAB 1DJZA 3TDZA 2I18A 2NCPA 2L50A 3O78A 1DF0B 1FBVA 2KGBC 1NX2A 2L98A 5I2QA 1PSBA 4CLNA 2MA2A 1S3PA 1UHHA 3DF0A 2JRFA 2LUCA 5HKZA 1A2XA 1AUIB 2I94A 1B4CA 1F4QA 2LHIA 4AQIA 1NCYA 3WNXB 1B7TY 1M63B 2ZNEA 1TCOB 5I2OA 2BE4A 2MLFC 2F2PA 3D0YB 5I2LA 1X02A 1QIVA 1BT6A 1YR5A 2MHHA 1V1GA 3WHTB 2M0RA 2JU0A 2QACA 2HPSA 2LVVA 3AKBA 4PCWA 1H8BA 2F2OA 1Y1XA 2TN4A 1YUSA 4R1EA 2ZRSA 1XFVO 3EK4A 5KSZA 1KK7Z 1KQMB 2K61A 2L5XB 3EK7A 2JXCA 2LANA 4YBHB 2K7DA 2KNEA 1DJXA 1BLQA 1KSOA 1S36A 2KI6C 3EVRA 1TOPA 2Y1NA 2WCFA 1N2DA 1KWOB 1CM1A 1NSHA 2EHBA 3BYAA 3TS5C 1R6PA 4JWQA 2M1KB 1KQMC 3C1VA 4MZJA 4PHJA 1ALVA 1L2OC 1CM4A 2KQYA 1QIWA 1K9UA 4N1FA 1BODA 1SW8A 4MRYA 1TIZA 2L51A 4NDDA 1DMOA 1OE9B 1QX5B 1A4PA 2ZRTA 1OZSA 3PLFB 1QATA 1UP5A 3EVVA 1UWOA 5D7FA 2AMIA 1WLZA 3DF0B 1ZACA 1NUBA 3BUWB 1CB1A 2KI4C 3KF9A 3KHEA 1NPQA 2KFFA 2BE6A 1QJTA 1BOCA 1BJFA 3I5IC 3AAJA 2E6WA 2BBMA 2LE9B 1BR1B 4C0KA 1L7ZA 1M45A 2LMTA 1N65A 2CXJA 3SG2A 2G2BA 4HSZA 1XFWO 2Y1MA 4PE4A 2BL0B 4MRXA 5JOLA 3CR4X 1OZOA 1NX0A 2L2EA 1DF0A 1RECA 2LV7A 4M2PA 1LA3A 2G9BA 1K96A 3OX6A 3FWCA 1KK8C 1QTXA 2HQ8A 2KDHA 5HKWA 1ZMZA 2NLNA 3O4YA 3OX5A 3TDUA 1B7TZ 1RTP1 2OS8C 2K2AA 2PALA 3IF7A 3KEVA 4GGNA 1WRKA 4GBAA 1MXLC 5JJGA 5CSNA 1SNLA 2HF5A 1CMGA 2WCBA 1HQVA 4GGFA 1A29A 3FWBA 3PSRA 1IGVA 1MQ1A 2LVKA 1QV0A 1W7IB 1SPYA 2E30A 3BXKA 3D0YA 1Y1AA 4PE7A 3VRRA 2LVJA 2KBIA 1YVLA 1ODBA 4QJ5B 1IWQA 2JZIA 3PN7C 3KPXA 1DJGA 1W7JB 2SCPA 1MR8A 3CS1A 5F6TA 3HCMA 3IQQA 2L0PA 1CDPA 1ZOTB 3VGOA 1TTXA 1JC2A 1XFXO 1QX7A 1CNPA 4C0LA 3I5GB 1SR6B 1WDCC 1AK8A 2JNXA 1IH0A 3CTNA 1XK4A 2MLEC 2WOSA 3OP0A 3BUNB 1F70A 2JOJA 2JT8A 4IL1A 1BF5A 2O60A 4ORBB 3OB2B 1AHRA 5AXIA 1EG3A 1C7WA 3I5FB 2KYCA 1CMFA 1KQVA 2LP2A 1NX1A 2M29A 1FI5A 1OMVA 5GQQC 2PASA 2VRGA 1PRWA 1A75B 3I5HC 4OV2A 1KSMA 5K89A 2A4JA 1LINA 3BQ3A 3IQOA 4WQ2A 4DS7A 4BY4A 2DOQA 2M9GA 3MSEB 3NSKA 2MBXA 2CT9A 5HYDA 1VRKA 1GGWA 2EC6B 1CFFA 4PE0A 2Y4QA 2KAXA 2NZ0A 3GK2A 2KBMA 4M2OA 2L4HA 1NYAA 4CFRA 1F71A 1EJ3A 1TRFA 2HQWA 3SG6A 3CWGA 2K7OA 1IKUA 1YRUB 4AOMA 5KU1A 1XA5A 4P5OE 1NCXA 3KO0A 1MHOA 4P2YB 4GGFC 1M39A 1KFUL 2LLTA 1OQPA 2O5GA 2ZNDA 3VRQA 2WNDA 5G08A 1SRAA 3RM1A 4PHNA 1Y0VH 1QVIZ 2LMUA 4M2QA 1NIWA 1UUSA 3A4UB 3QRXA 4YGCB 5IBWA 2KGRA 1CLBA 1DJHA 1QS7A 1S6CA 1IG5A 2I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQJ A;  2LAP A;  1BMO A;  1GQM A;  2KFH A;  1IJ5 A;  1XFZ O;  1UHI A;  1D1O A;  1UHK A;  5DKR A;  4TNC A;  2LLS A;  5AEQ A;  1LVC D;  1K95 A;  1NWD A;  1DVI A;  1YRT B;  3DVE A;  1AVS A;  1G4Y R;  4CPV A;  4JQ0 D;  4WRI A;  1KWO C;  5DKQ A;  1YUU A;  1XK4 C;  2Y5I A;  1JUO A;  2M8U A;  2M3W A;  1GJY A;  2OTG B;  1B47 A;  2F8P A;  1M31 A;  2NXQ A;  1PVA A;  3EKH A;  1KFX L;  5CSI A;  5HKY A;  4PE1 A;  3ZWH A;  2GV5 A;  3GK4 X;  5HLV A;  1FPW A;  4MSP A;  4YRU A;  3SG7 A;  3TUY B;  1TNP A;  1JFK A;  3AAK A;  1WLM A;  4NDC A;  1K2H A;  2IS9 A;  1QLS A;  1EH2 A;  1TNW A;  1CFD A;  2AAO A;  2V53 A;  1BG1 A;  1F55 A;  4GFT A;  2AUC A;  1R2U A;  2FJU B;  1TNQ A;  3JTD B;  5PAL A;  1FI6 A;  1S5G Y;  1DJW A;  2H61 A;  1SL8 A;  4U8D A;  2KOT A;  4DCK A;  5TNC A;  3SG3 A;  2FCD A;  1OMD A;  3CLN A;  3AKA A;  1RRO A;  4JPZ B;  1A75 A;  1V1F A;  2LM5 A;  4HRG A;  4MLW A;  3BUO B;  2BL0 C;  1N0Y A;  1DJY A;  1B8L A;  5CSF A;  1Y1U A;  2FOT A;  4MEW A;  4GAO A;  1BU3 A;  2JT0 A;  2CTN A;  3PAT A;  4YGE B;  2GGM A;  2ZKM X;  3BOW B;  1GGZ A;  1OOJ A;  1S1E A;  3SIA A;  1MF8 B;  3O6B A;  1SCM B;  2BCA A;  2LLU A;  1J7Q A;  1Q80 A;  1LA0 A;  1AP4 A;  1XFY O;  1SKT A;  1RWY A;  4DIR A;  1SCV A;  2BEC A;  1QLK A;  4ZCU A;  2B1U A;  2ZFD A;  1S6I A;  4FQO A;  2ZN8 A;  3NXA A;  1B9A A;  1JSA A;  1S26 D;  1WRL A;  1XVJ A;  1YVH A;  2NCO A;  3JVT B;  1DJI A;  2GGZ A;  2JPT A;  4ORC B;  2LHL A;  3SJS A;  1RJV A;  1UHJ A;  1LXF C;  2KHN A;  4ETO A;  2KAY A;  1SL7 A;  2MRD A;  4MVF A;  4YGA A;  1TCF A;  3SG4 A;  1IJ6 A;  1CFP A;  1ZFS A;  4Q04 A;  2KSP A;  4PHM A;  1PSR A;  3FS7 A;  2BCB A;  1QAS A;  3VRO A;  1B8C A;  3JVT C;  2JQ6 A;  2K7B A;  2F3Z A;  5I8N A;  1CLM A;  3M0W A;  3O2P A;  1AJ5 A;  1SR6 C;  3I5G C;  1J7R A;  1RK9 A;  4UPG A;  2M7N A;  1TNX A;  2JT3 A;  2F3Y A;  3D10 A;  1SYM A;  3CR2 A;  4XYN A;  1K9P A;  2JTZ A;  3E3R A;  2ISD A;  1J7O A;  1JWD A;  1ZUZ A;  1G8I A;  4L9M A;  1CLL A;  4HRE E;  4NQG A;  4XJK A;  2P6B B;  3BUX B;  3I5F C;  1F8H A;  2K2F A;  2JUL A;  4OVN F;  1BR4 B;  3SG5 A;  1AJ4 A;  1QXP A;  1S5G Z;  2I2R E;  5KTY A;  2KQ6 A;  1K9K A;  1B8R A;  2BCX A;  3ZNI A;  3PFV A;  1KCY A;  5AFP A;  2JWW A;  1J1D A;  4YGD B;  4PDZ A;  1HT9 A;  1NP8 A;  2EC6 C;  1YUT A;  3DVM A;  3PAL A;  3DVJ A;  5BPJ A;  2CCM A;  2HET A;  4I5L B;  5HLO A;  1PUL A;  1CKK A;  1JF2 A;  1WRZ A;  1U5I B;  2K8M B;  1QV1 A;  3NSI A;  4ICB A;  1JFJ A;  3SIB A;  2JNF A;  4PAL A;  1CDL A;  4HRH A;  1ALW A;  4I5J A;  1J1E A;  4MN0 A;  2BKH B;  2CNP A;  3BOW A;  5D69 A;  4A4C A;  2KAV A;  4GUK A;  4CID A;  3TS5 B;  1YX7 A;  4WQ3 A;  1A03 A;  1EXR A;  4OR9 B;  4YI8 A;  1IQ3 A;  2WOR A;  1MUX A;  1B1G A;  2COL B;  3CGA A;  1L2O B;  1RFJ A;  3NSO A;  5DKN A;  4MZL A;  5FYX A;  3PM8 A;  1PVB A;  3DD4 A;  2CBL A;  2M97 A;  3H4S E;  3A8R A;  3DVK A;  2PVB A;  2K7C A;  1KFU S;  1LKJ A;  1JF0 A;  4XJK B;  1TN4 A;  4PHK A;  1QX2 A;  1M46 A;  4I5K A;  2KYF A;  1CDN A;  4E68 A;  4N5X A;  2KI4 B;  3WXA A;  1G33 A;  2MAZ A;  4GPL B;  2PSR A;  3I5I B;  2OTG C;  2WCE A;  1IQ5 A;  2JXL A;  1XYD A;  1SK6 D;  4I5N B;  1OMR A;  1K90 D;  3OB1 B;  3TDI A;  3GK1 A;  1YTZ C;  2Q91 A;  3ICB A;  4YGB B;  2KFG A;  2BKI B;  1F4O A;  5CPV A;  3TUY C;  2LVI A;  1EL4 A;  3LLE A;  1F54 A;  2PRU A;  2EGD A;  1C7V A;  4N1G A;  1SY9 A;  4CFQ A;  2LP3 A;  1XFU O;  1KK8 B;  3JTD C;  4OKH A;  4C0J A;  1DGV A;  2OS8 B;  1CDM A;  1IRJ A;  1KFX S;  2LCP A;  2LMV A;  4QJ3 B;  4BY5 A;  4DUQ A;  5AER A;  2BBN A;  1K93 D;  4NDB A;  4F0Z B;  3VRP A;  2SAS A;  3EVU A;  2FCE A;  2KI6 D;  4FTG A;  3BUM B;  3TZ1 A;  3WHU B;  3LCP C;  2WC8 A;  2ZN9 A;  1DTL A;  1DGU A;  4GNK B;  4QJ4 B;  1KK7 Y;  1S6J A;  1SBJ A;  1NX3 A;  1SCM C;  1CTR A;  1OSA A;  3PN7 B;  1C07 A;  1J7P A;  1QVI Y;  1UUR A;  1U5I A;  2JC2 A;  4MZK A;  1MWN A;  2K0J A;  1J55 A;  1K8U A;  1UHN A;  4A4B A;  3OHM B;  3CZT X;  2F33 A;  1NCZ A;  2L4I A;  2LNK A;  1DT7 B;  5J3X A;  2M7L A;  3CR5 X;  2LC5 A;  1PK0 D;  2Q4U A;  1WDC B;  3NSL A;  1FF1 A;  1H4B A;  2QPT A;  2OPO A;  2M1U A;  5CSJ A;  4DRW A;  3LK1 A;  3VRN A;  3LL8 B;  1YX8 A;  1XO5 A;  4USL A;  1CFC A;  5B8I B;  1K94 A;  2R2I A;  2MJW B;  1SL9 A;  4OCI A;  1FW4 A;  1E8A A;  4YI9 A;  5ER5 A;  2LUX A;  3F45 A;  3HX4 A;  3K21 A;  1Y6W A;  5AAN A;  5ER4 X;  2H2K A;  3LK0 A;  1EG4 A;  1PAL A;  3GOF A;  4MBE A;  3EKJ A;  2D8N A;  4ZCV A;  3RLZ A;  2H61 C;  2PMY A;  1MXE A;  2RGI A;  3EK8 A;  2M49 B;  3I5H B;  4D1E A;  3FIA A;  1SMG A;  1YUR A;  1WY9 A;  2JTT A;  1JBA A;  4ORA B;  1DJZ A;  3TDZ A;  2I18 A;  2NCP A;  2L50 A;  3O78 A;  1DF0 B;  1FBV A;  2KGB C;  1NX2 A;  2L98 A;  5I2Q A;  1PSB A;  4CLN A;  2MA2 A;  1S3P A;  1UHH A;  3DF0 A;  2JRF A;  2LUC A;  5HKZ A;  1A2X A;  1AUI B;  2I94 A;  1B4C A;  1F4Q A;  2LHI A;  4AQI A;  1NCY A;  3WNX B;  1B7T Y;  1M63 B;  2ZNE A;  1TCO B;  5I2O A;  2BE4 A;  2MLF C;  2F2P A;  3D0Y B;  5I2L A;  1X02 A;  1QIV A;  1BT6 A;  1YR5 A;  2MHH A;  1V1G A;  3WHT B;  2M0R A;  2JU0 A;  2QAC A;  2HPS A;  2LVV A;  3AKB A;  4PCW A;  1H8B A;  2F2O A;  1Y1X A;  2TN4 A;  1YUS A;  4R1E A;  2ZRS A;  1XFV O;  3EK4 A;  5KSZ A;  1KK7 Z;  1KQM B;  2K61 A;  2L5X B;  3EK7 A;  2JXC A;  2LAN A;  4YBH B;  2K7D A;  2KNE A;  1DJX A;  1BLQ A;  1KSO A;  1S36 A;  2KI6 C;  3EVR A;  1TOP A;  2Y1N A;  2WCF A;  1N2D A;  1KWO B;  1CM1 A;  1NSH A;  2EHB A;  3BYA A;  3TS5 C;  1R6P A;  4JWQ A;  2M1K B;  1KQM C;  3C1V A;  4MZJ A;  4PHJ A;  1ALV A;  1L2O C;  1CM4 A;  2KQY A;  1QIW A;  1K9U A;  4N1F A;  1BOD A;  1SW8 A;  4MRY A;  1TIZ A;  2L51 A;  4NDD A;  1DMO A;  1OE9 B;  1QX5 B;  1A4P A;  2ZRT A;  1OZS A;  3PLF B;  1QAT A;  1UP5 A;  3EVV A;  1UWO A;  5D7F A;  2AMI A;  1WLZ A;  3DF0 B;  1ZAC A;  1NUB A;  3BUW B;  1CB1 A;  2KI4 C;  3KF9 A;  3KHE A;  1NPQ A;  2KFF A;  2BE6 A;  1QJT A;  1BOC A;  1BJF A;  3I5I C;  3AAJ A;  2E6W A;  2BBM A;  2LE9 B;  1BR1 B;  4C0K A;  1L7Z A;  1M45 A;  2LMT A;  1N65 A;  2CXJ A;  3SG2 A;  2G2B A;  4HSZ A;  1XFW O;  2Y1M A;  4PE4 A;  2BL0 B;  4MRX A;  5JOL A;  3CR4 X;  1OZO A;  1NX0 A;  2L2E A;  1DF0 A;  1REC A;  2LV7 A;  4M2P A;  1LA3 A;  2G9B A;  1K96 A;  3OX6 A;  3FWC A;  1KK8 C;  1QTX A;  2HQ8 A;  2KDH A;  5HKW A;  1ZMZ A;  2NLN A;  3O4Y A;  3OX5 A;  3TDU A;  1B7T Z;  1RTP 1;  2OS8 C;  2K2A A;  2PAL A;  3IF7 A;  3KEV A;  4GGN A;  1WRK A;  4GBA A;  1MXL C;  5JJG A;  5CSN A;  1SNL A;  2HF5 A;  1CMG A;  2WCB A;  1HQV A;  4GGF A;  1A29 A;  3FWB A;  3PSR A;  1IGV A;  1MQ1 A;  2LVK A;  1QV0 A;  1W7I B;  1SPY A;  2E30 A;  3BXK A;  3D0Y A;  1Y1A A;  4PE7 A;  3VRR A;  2LVJ A;  2KBI A;  1YVL A;  1ODB A;  4QJ5 B;  1IWQ A;  2JZI A;  3PN7 C;  3KPX A;  1DJG A;  1W7J B;  2SCP A;  1MR8 A;  3CS1 A;  5F6T A;  3HCM A;  3IQQ A;  2L0P A;  1CDP A;  1ZOT B;  3VGO A;  1TTX A;  1JC2 A;  1XFX O;  1QX7 A;  1CNP A;  4C0L A;  3I5G B;  1SR6 B;  1WDC C;  1AK8 A;  2JNX A;  1IH0 A;  3CTN A;  1XK4 A;  2MLE C;  2WOS A;  3OP0 A;  3BUN B;  1F70 A;  2JOJ A;  2JT8 A;  4IL1 A;  1BF5 A;  2O60 A;  4ORB B;  3OB2 B;  1AHR A;  5AXI A;  1EG3 A;  1C7W A;  3I5F B;  2KYC A;  1CMF A;  1KQV A;  2LP2 A;  1NX1 A;  2M29 A;  1FI5 A;  1OMV A;  5GQQ C;  2PAS A;  2VRG A;  1PRW A;  1A75 B;  3I5H C;  4OV2 A;  1KSM A;  5K89 A;  2A4J A;  1LIN A;  3BQ3 A;  3IQO A;  4WQ2 A;  4DS7 A;  4BY4 A;  2DOQ A;  2M9G A;  3MSE B;  3NSK A;  2MBX A;  2CT9 A;  5HYD A;  1VRK A;  1GGW A;  2EC6 B;  1CFF A;  4PE0 A;  2Y4Q A;  2KAX A;  2NZ0 A;  3GK2 A;  2KBM A;  4M2O A;  2L4H A;  1NYA A;  4CFR A;  1F71 A;  1EJ3 A;  1TRF A;  2HQW A;  3SG6 A;  3CWG A;  2K7O A;  1IKU A;  1YRU B;  4AOM A;  5KU1 A;  1XA5 A;  4P5O E;  1NCX A;  3KO0 A;  1MHO A;  4P2Y B;  4GGF C;  1M39 A;  1KFU L;  2LLT A;  1OQP A;  2O5G A;  2ZND A;  3VRQ A;  2WND A;  5G08 A;  1SRA A;  3RM1 A;  4PHN A;  1Y0V H;  1QVI Z;  2LMU A;  4M2Q A;  1NIW A;  1UUS A;  3A4U B;  3QRX A;  4YGC B;  5IBW A;  2KGR A;  1CLB A;  1DJH A;  1QS7 A;  1S6C A;  1IG5 A;  2I7A A; 
#chains in the Genus database with same CATH topology
 4AQJ A;  2LAP A;  1BMO A;  1GQM A;  2KFH A;  1IJ5 A;  1XFZ O;  1UHI A;  1D1O A;  1UHK A;  1SSE B;  5DKR A;  1TUJ A;  4TNC A;  2LLS A;  5AEQ A;  1LVC D;  1K95 A;  1NWD A;  1DVI A;  3CDN A;  1YRT B;  3DVE A;  3R72 A;  1AVS A;  1G4Y R;  4CPV A;  4JQ0 D;  4WRI A;  1KWO C;  5DKQ A;  1YUU A;  1XK4 C;  2Y5I A;  1JUO A;  2M8U A;  2M3W A;  1GJY A;  2OTG B;  1B47 A;  2F8P A;  1M31 A;  2NXQ A;  1PVA A;  3BJH A;  3EKH A;  1KFX L;  5CSI A;  5HKY A;  4PE1 A;  3ZWH A;  2GV5 A;  3GK4 X;  5HLV A;  1FPW A;  4MSP A;  4YRU A;  3SG7 A;  3NGV A;  3TUY B;  1TNP A;  1JFK A;  3AAK A;  1WLM A;  4NDC A;  1K2H A;  2IS9 A;  1QLS A;  1EH2 A;  1TNW A;  1CFD A;  2AAO A;  2V53 A;  1BG1 A;  1F55 A;  3R1P A;  4GFT A;  2AUC A;  1R2U A;  2FJU B;  1TNQ A;  3JTD B;  5PAL A;  1FI6 A;  1S5G Y;  1DJW A;  2H61 A;  1SL8 A;  4U8D A;  2KOT A;  4DCK A;  5TNC A;  3SG3 A;  2FCD A;  1OMD A;  3CLN A;  3AKA A;  1RRO A;  4JPZ B;  1A75 A;  1V1F A;  2LM5 A;  4HRG A;  4MLW A;  3BUO B;  2BL0 C;  1N0Y A;  1DJY A;  3V2L A;  1B8L A;  2KLD A;  5CSF A;  1Y1U A;  2FOT A;  4MEW A;  4GAO A;  1BU3 A;  2JT0 A;  2CTN A;  3PAT A;  2FJY A;  2GGM A;  2ZKM X;  4YGE B;  3BOW B;  1GGZ A;  1OOJ A;  1S1E A;  3FE6 A;  1MF8 B;  3SIA A;  3O6B A;  1SCM B;  1Z4H A;  2BCA A;  2LLU A;  1J7Q A;  3R1O A;  3S0F A;  1Q80 A;  1LA0 A;  1AP4 A;  1XFY O;  3PM2 A;  1SKT A;  1RWY A;  3R1V A;  4DIR A;  1SCV A;  2BEC A;  1QLK A;  4ZCU A;  3SS5 A;  2B1U A;  2ZFD A;  1S6I A;  4FQO A;  2ZN8 A;  3NXA A;  1B9A A;  1JSA A;  1S26 D;  1WRL A;  1XVJ A;  1YVH A;  2NCO A;  3JVT B;  1DJI A;  2GGZ A;  2JPT A;  3B7A A;  4ORC B;  5D3O A;  2LHL A;  3SJS A;  1RJV A;  1UHJ A;  1LXF C;  2KHN A;  1DC1 A;  4ETO A;  2KAY A;  1SL7 A;  2MRD A;  4MVF A;  4YGA A;  1TCF A;  3SG4 A;  1IJ6 A;  2H8V A;  1CFP A;  1ZFS A;  4Q04 A;  2KSP A;  4PHM A;  1PSR A;  1P28 A;  2BCB A;  1QAS A;  3FS7 A;  1B8C A;  3JVT C;  3VRO A;  2JQ6 A;  2K7B A;  3BFB A;  2F3Z A;  5I8N A;  1CLM A;  3M0W A;  3PJI A;  3CYZ A;  3O2P A;  1AJ5 A;  1SR6 C;  3I5G C;  1J7R A;  1RK9 A;  4UPG A;  2M7N A;  1TUZ A;  1TNX A;  2JT3 A;  2F3Y A;  3D10 A;  1SYM A;  3CR2 A;  4XYN A;  5HL1 A;  2QEB A;  1K9P A;  2JTZ A;  3E3R A;  2ISD A;  1J7O A;  1JWD A;  1ZUZ A;  1G8I A;  4L9M A;  1CLL A;  4HRE E;  4NQG A;  4IJ7 A;  4XJK A;  2P6B B;  2WCL A;  3BUX B;  3I5F C;  1F8H A;  2K2F A;  2JUL A;  4OVN F;  1BR4 B;  3SG5 A;  1AJ4 A;  1QXP A;  3O4X A;  1S5G Z;  2I2R E;  5KTY A;  2KQ6 A;  1K9K A;  1B8R A;  2BCX A;  3ZNI A;  3PFV A;  1KCY A;  1IIO A;  5AFP A;  3L4L A;  2JWW A;  3DXL A;  1J1D A;  4YGD B;  4PDZ A;  1HT9 A;  1NP8 A;  2EC6 C;  3N7H A;  1YUT A;  3DVM A;  3PAL A;  3DVJ A;  5BPJ A;  2CCM A;  2HET A;  4I5L B;  5HLO A;  1PUL A;  1CKK A;  1JF2 A;  5EL2 A;  1WRZ A;  1U5I B;  2K8M B;  3FE8 A;  3BFA A;  1QV1 A;  3NSI A;  2P71 A;  4ICB A;  4KYN A;  1JFJ A;  3SIB A;  2JNF A;  3VB1 A;  4F7F A;  4PAL A;  1CDL A;  1DQE A;  1ALW A;  4HRH A;  1J1E A;  4I5J A;  4MN0 A;  2BKH B;  2CNP A;  3BOW A;  5D69 A;  4A4C A;  2KAV A;  3QME A;  4GUK A;  4CID A;  3TS5 B;  1YX7 A;  4WQ3 A;  1A03 A;  3D75 A;  1EXR A;  4OR9 B;  4YI8 A;  1IQ3 A;  3CAB A;  2WOR A;  1MUX A;  1B1G A;  2COL B;  3CGA A;  1L2O B;  1RFJ A;  2K60 A;  2WCK A;  3EG5 B;  3NSO A;  3PM8 A;  4MZL A;  5DKN A;  5FYX A;  1PVB A;  3DD4 A;  1OOH A;  2CBL A;  2M97 A;  3DY9 A;  3H4S E;  3A8R A;  3DVK A;  2PVB A;  2K7C A;  1KFU S;  1LKJ A;  1JF0 A;  4XJK B;  1TN4 A;  4PHK A;  1QX2 A;  1M46 A;  4I5K A;  2KYF A;  1CDN A;  4E68 A;  4N5X A;  2KI4 B;  3WXA A;  1G33 A;  2MAZ A;  4GPL B;  2PSR A;  3I5I B;  2OTG C;  2WCE A;  1IQ5 A;  2JXL A;  1XYD A;  1SK6 D;  4I5N B;  1C3Y A;  1OMR A;  1K90 D;  5FI6 A;  5IBW A;  3OB1 B;  3TDI A;  3GK1 A;  1YTZ C;  2Q91 A;  3ICB A;  4YGB B;  1Z2C B;  2KFG A;  1ORG A;  2BKI B;  3DYE A;  1F4O A;  5CPV A;  3TUY C;  2LVI A;  1EL4 A;  3LLE A;  2PYQ A;  2PRU A;  1F54 A;  2EGD A;  1C7V A;  5FI2 A;  4N1G A;  1SY9 A;  4CFQ A;  2LP3 A;  1XFU O;  1KK8 B;  3D78 A;  3JTD C;  4INW A;  4OKH A;  4C0J A;  1DGV A;  2OS8 B;  1CDM A;  1IRJ A;  1KFX S;  2LCP A;  2LMV A;  4INX A;  4QJ3 B;  4BY5 A;  5I94 A;  4DUQ A;  5AER A;  2BBN A;  1K93 D;  4NDB A;  4F0Z B;  3VRP A;  2SAS A;  3EVU A;  2FCE A;  1W9Z A;  2KI6 D;  4FTG A;  3BUM B;  3TZ1 A;  3WHU B;  3OGN A;  3SS4 A;  3LCP C;  2WC8 A;  2PQL A;  2ZN9 A;  1DTL A;  2BAP A;  1DGU A;  3CZ1 A;  3NHT A;  4GNK B;  3S0E A;  4QJ4 B;  1KK7 Y;  1S6J A;  1SBJ A;  1NX3 A;  1SCM C;  1CTR A;  1OSA A;  3PN7 B;  1C07 A;  1J7P A;  1QVI Y;  1UUR A;  3B88 A;  1U5I A;  2JC2 A;  4MZK A;  1MWN A;  2K0J A;  1J55 A;  1K8U A;  1UHN A;  4A4B A;  3OHM B;  3CZT X;  2F33 A;  1NCZ A;  2L4I A;  2LNK A;  1DT7 B;  3B87 A;  5J3X A;  4FQT A;  1T14 A;  2LC5 A;  1PK0 D;  2Q4U A;  3CR5 X;  1WDC B;  3NSL A;  2M7L A;  1FF1 A;  1H4B A;  2QPT A;  2QEV A;  2OPO A;  2M1U A;  5CSJ A;  4DRW A;  2QDI A;  3LK1 A;  3S0G A;  3VRN A;  3LL8 B;  1YX8 A;  1XO5 A;  4USL A;  1CFC A;  5B8I B;  1K94 A;  2R2I A;  2MJW B;  1SL9 A;  4OCI A;  1FW4 A;  1OW4 A;  1E8A A;  4YI9 A;  5ER5 A;  2LUX A;  3F45 A;  2L2C A;  3HX4 A;  3K21 A;  1Y6W A;  5AAN A;  5ER4 X;  2H2K A;  3LK0 A;  1EG4 A;  1PAL A;  3GOF A;  4MBE A;  3EKJ A;  2D8N A;  4ZCV A;  3RLZ A;  2H61 C;  2PMY A;  1MXE A;  2RGI A;  3B6X A;  2M49 B;  3EK8 A;  3I5H B;  4D1E A;  3FIA A;  1SMG A;  1YUR A;  2WCJ A;  1WY9 A;  2JTT A;  3D73 A;  1JBA A;  4ORA B;  2BNX A;  1DJZ A;  3TDZ A;  2I18 A;  2NCP A;  2L50 A;  3O78 A;  1DF0 B;  3L47 A;  1FBV A;  2JPO A;  2KGB C;  1NX2 A;  1XFR A;  2L98 A;  5I2Q A;  1PSB A;  4CLN A;  2MA2 A;  1S3P A;  1UHH A;  2QEH A;  2JRF A;  2WC5 A;  3DF0 A;  2LUC A;  5HKZ A;  1A2X A;  1AUI B;  2I94 A;  1B4C A;  1F4Q A;  2LHI A;  4AQI A;  1NCY A;  1QWV A;  3WNX B;  1B7T Y;  1M63 B;  2ZNE A;  1TCO B;  4JKT A;  5I2O A;  2BE4 A;  2MLF C;  2F2P A;  3D0Y B;  5I2L A;  1X02 A;  1QIV A;  1BT6 A;  1YR5 A;  2MHH A;  1V1G A;  3WHT B;  2M0R A;  1OOI X;  1LS8 A;  2HPS A;  2JU0 A;  2LVV A;  2QAC A;  3AKB A;  4PCW A;  2F2O A;  1H8B A;  1Y1X A;  2TN4 A;  1YUS A;  4R1E A;  2ZRS A;  1XFV O;  3EK4 A;  5KSZ A;  1KK7 Z;  1KQM B;  2K61 A;  2L5X B;  3EK7 A;  2JXC A;  2LAN A;  2WCH A;  4YBH B;  2K7D A;  2KNE A;  1DJX A;  1BLQ A;  1KSO A;  1S36 A;  2KI6 C;  3EVR A;  1TOP A;  2Y1N A;  2WCF A;  1N2D A;  1KWO B;  1CM1 A;  1NSH A;  2EHB A;  3BYA A;  3TS5 C;  1R6P A;  4JWQ A;  2M1K B;  1KQM C;  3C1V A;  4MZJ A;  4OZD A;  4PHJ A;  1ALV A;  1L2O C;  1CM4 A;  2KQY A;  1QIW A;  1K9U A;  4N1F A;  1BOD A;  3UNW A;  1SW8 A;  4MRY A;  1TIZ A;  2L51 A;  3NHI A;  4NDD A;  1DMO A;  1OE9 B;  1QX5 B;  1A4P A;  2ZRT A;  1OZS A;  3PLF B;  1QAT A;  1UP5 A;  3EVV A;  1UWO A;  5D7F A;  2AMI A;  1WLZ A;  3DF0 B;  1ZAC A;  1NUB A;  3BUW B;  1CB1 A;  2KI4 C;  3KF9 A;  3KHE A;  1DEK A;  1NPQ A;  2KFF A;  2P70 A;  2BE6 A;  3CZ2 A;  1QJT A;  1BOC A;  1BJF A;  3I5I C;  3RZS A;  3AAJ A;  5DIC A;  2E6W A;  5FI7 A;  2BBM A;  2GTE A;  2LE9 B;  1BR1 B;  4C0K A;  1L7Z A;  1M45 A;  2LMT A;  1TWO A;  1N65 A;  2CXJ A;  3SG2 A;  2G2B A;  4HSZ A;  1XFW O;  2Y1M A;  4PE4 A;  2BL0 B;  4MRX A;  5JOL A;  3CR4 X;  1OZO A;  1NX0 A;  2L2E A;  4PT1 A;  1DF0 A;  1REC A;  2LV7 A;  4M2P A;  1LA3 A;  2G9B A;  1K96 A;  3OX6 A;  3FWC A;  1KK8 C;  1QTX A;  2HQ8 A;  2KDH A;  5HKW A;  1ZMZ A;  2NLN A;  4JD9 A;  3O4Y A;  3OX5 A;  3TDU A;  1B7T Z;  1RTP 1;  2OS8 C;  2K2A A;  2PAL A;  3IF7 A;  3KEV A;  4GGN A;  1WRK A;  4GBA A;  1MXL C;  5JJG A;  5CSN A;  1SNL A;  2HF5 A;  2WC6 A;  2WCB A;  2WCM A;  1CMG A;  1HQV A;  4GGF A;  2L5Y A;  1A29 A;  3FWB A;  3PSR A;  1IGV A;  1MQ1 A;  2ERB A;  2LVK A;  1QV0 A;  1W7I B;  1SPY A;  2E30 A;  3BXK A;  3D0Y A;  1Y1A A;  4PE7 A;  3VRR A;  2LVJ A;  2KBI A;  1YVL A;  1ODB A;  4QJ5 B;  1IWQ A;  2JZI A;  3S0A A;  3PN7 C;  3KPX A;  1DJG A;  1W7J B;  2SCP A;  1MR8 A;  3CS1 A;  5F6T A;  3HCM A;  3IQQ A;  2L0P A;  1CDP A;  3K1E A;  1ZOT B;  3D76 A;  3VGO A;  1C3Z A;  1TTX A;  3S0B A;  3UO9 A;  1JC2 A;  1XFX O;  1QX7 A;  3D74 A;  3D77 A;  1CNP A;  4C0L A;  3DZT A;  3I5G B;  1SR6 B;  1WDC C;  1AK8 A;  2JNX A;  1IH0 A;  3CTN A;  3L4A A;  3Q8I A;  1XK4 A;  2MLE C;  2WOS A;  3OP0 A;  3BUN B;  1F70 A;  2JOJ A;  2JT8 A;  4IL1 A;  1BF5 A;  2O60 A;  4ORB B;  3OB2 B;  1AHR A;  5AXI A;  1EG3 A;  3SS3 A;  1C7W A;  2KPH A;  3I5F B;  2KYC A;  1CMF A;  1KQV A;  2LP2 A;  1NX1 A;  2M29 A;  1FI5 A;  1OMV A;  3IVT A;  5GQQ C;  2PAS A;  2VRG A;  1PRW A;  1A75 B;  3I5H C;  4OV2 A;  1KSM A;  5K89 A;  2A4J A;  1LIN A;  3BQ3 A;  3IQO A;  4WQ2 A;  4DS7 A;  4BY4 A;  2DOQ A;  2M9G A;  3MSE B;  3NSK A;  3OBV A;  2CT9 A;  2MBX A;  1VRK A;  5HYD A;  2EC6 B;  1CFF A;  1GGW A;  4PE0 A;  2Y4Q A;  2KAX A;  2NZ0 A;  3GK2 A;  1OOG A;  2KBM A;  2QEO A;  4M2O A;  1GM0 A;  2L4H A;  3B86 A;  1NYA A;  4CFR A;  1F71 A;  1EJ3 A;  1TRF A;  2HQW A;  3SG6 A;  3CWG A;  2K7O A;  1IKU A;  1YRU B;  4AOM A;  5KU1 A;  1XA5 A;  2YGU A;  3CZ0 A;  1NCX A;  3BFH A;  4P5O E;  3KO0 A;  1MHO A;  4P2Y B;  4GGF C;  1M39 A;  1KFU L;  2LLT A;  1OQP A;  2O5G A;  2ZND A;  3VRQ A;  2WND A;  5G08 A;  1SRA A;  2KLE A;  3RM1 A;  3S0D A;  4PHN A;  1Y0V H;  1QVI Z;  1OOF A;  2LMU A;  1NIW A;  1UUS A;  3A4U B;  3QRX A;  4M2Q A;  4YGC B;  2KGR A;  3FE9 A;  1CLB A;  1DJH A;  1DEL A;  1QS7 A;  1S6C A;  1IG5 A;  2I7A A; 
#chains in the Genus database with same CATH homology
 4AQJ A;  2LAP A;  1BMO A;  1GQM A;  2KFH A;  1IJ5 A;  1XFZ O;  1UHI A;  1D1O A;  1UHK A;  5DKR A;  4TNC A;  2LLS A;  5AEQ A;  1LVC D;  1K95 A;  1NWD A;  1DVI A;  1YRT B;  3DVE A;  1AVS A;  1G4Y R;  4CPV A;  4JQ0 D;  4WRI A;  1KWO C;  5DKQ A;  1YUU A;  1XK4 C;  2Y5I A;  1JUO A;  2M8U A;  2M3W A;  1GJY A;  2OTG B;  1B47 A;  2F8P A;  1M31 A;  2NXQ A;  1PVA A;  3EKH A;  1KFX L;  5CSI A;  5HKY A;  4PE1 A;  3ZWH A;  2GV5 A;  3GK4 X;  5HLV A;  1FPW A;  4MSP A;  4YRU A;  3SG7 A;  3TUY B;  1TNP A;  1JFK A;  3AAK A;  1WLM A;  4NDC A;  1K2H A;  2IS9 A;  1QLS A;  1EH2 A;  1TNW A;  1CFD A;  2AAO A;  2V53 A;  1BG1 A;  1F55 A;  4GFT A;  2AUC A;  1R2U A;  2FJU B;  1TNQ A;  3JTD B;  5PAL A;  1FI6 A;  1S5G Y;  1DJW A;  2H61 A;  1SL8 A;  4U8D A;  2KOT A;  4DCK A;  5TNC A;  3SG3 A;  2FCD A;  1OMD A;  3CLN A;  3AKA A;  1RRO A;  4JPZ B;  1A75 A;  1V1F A;  2LM5 A;  4HRG A;  4MLW A;  3BUO B;  2BL0 C;  1N0Y A;  1DJY A;  1B8L A;  5CSF A;  1Y1U A;  2FOT A;  4MEW A;  4GAO A;  1BU3 A;  2JT0 A;  2CTN A;  3PAT A;  4YGE B;  2GGM A;  2ZKM X;  3BOW B;  1GGZ A;  1OOJ A;  1S1E A;  3SIA A;  1MF8 B;  3O6B A;  1SCM B;  2BCA A;  2LLU A;  1J7Q A;  1Q80 A;  1LA0 A;  1AP4 A;  1XFY O;  1SKT A;  1RWY A;  4DIR A;  1SCV A;  2BEC A;  1QLK A;  4ZCU A;  2B1U A;  2ZFD A;  1S6I A;  4FQO A;  2ZN8 A;  3NXA A;  1B9A A;  1JSA A;  1S26 D;  1WRL A;  1XVJ A;  1YVH A;  2NCO A;  3JVT B;  1DJI A;  2GGZ A;  2JPT A;  4ORC B;  2LHL A;  3SJS A;  1RJV A;  1UHJ A;  1LXF C;  2KHN A;  4ETO A;  2KAY A;  1SL7 A;  2MRD A;  4MVF A;  4YGA A;  1TCF A;  3SG4 A;  1IJ6 A;  1CFP A;  1ZFS A;  4Q04 A;  2KSP A;  4PHM A;  1PSR A;  3FS7 A;  2BCB A;  1QAS A;  3VRO A;  1B8C A;  3JVT C;  2JQ6 A;  2K7B A;  2F3Z A;  5I8N A;  1CLM A;  3M0W A;  3O2P A;  1AJ5 A;  1SR6 C;  3I5G C;  1J7R A;  1RK9 A;  4UPG A;  2M7N A;  1TNX A;  2JT3 A;  2F3Y A;  3D10 A;  1SYM A;  3CR2 A;  4XYN A;  1K9P A;  2JTZ A;  3E3R A;  2ISD A;  1J7O A;  1JWD A;  1ZUZ A;  1G8I A;  4L9M A;  1CLL A;  4HRE E;  4NQG A;  4XJK A;  2P6B B;  3BUX B;  3I5F C;  1F8H A;  2K2F A;  2JUL A;  4OVN F;  1BR4 B;  3SG5 A;  1AJ4 A;  1QXP A;  1S5G Z;  2I2R E;  5KTY A;  2KQ6 A;  1K9K A;  1B8R A;  2BCX A;  3ZNI A;  3PFV A;  1KCY A;  5AFP A;  2JWW A;  1J1D A;  4YGD B;  4PDZ A;  1HT9 A;  1NP8 A;  2EC6 C;  1YUT A;  3DVM A;  3PAL A;  3DVJ A;  5BPJ A;  2CCM A;  2HET A;  4I5L B;  5HLO A;  1PUL A;  1CKK A;  1JF2 A;  1WRZ A;  1U5I B;  2K8M B;  1QV1 A;  3NSI A;  4ICB A;  1JFJ A;  3SIB A;  2JNF A;  4PAL A;  1CDL A;  4HRH A;  1ALW A;  4I5J A;  1J1E A;  4MN0 A;  2BKH B;  2CNP A;  3BOW A;  5D69 A;  4A4C A;  2KAV A;  4GUK A;  4CID A;  3TS5 B;  1YX7 A;  4WQ3 A;  1A03 A;  1EXR A;  4OR9 B;  4YI8 A;  1IQ3 A;  2WOR A;  1MUX A;  1B1G A;  2COL B;  3CGA A;  1L2O B;  1RFJ A;  3NSO A;  5DKN A;  4MZL A;  5FYX A;  3PM8 A;  1PVB A;  3DD4 A;  2CBL A;  2M97 A;  3H4S E;  3A8R A;  3DVK A;  2PVB A;  2K7C A;  1KFU S;  1LKJ A;  1JF0 A;  4XJK B;  1TN4 A;  4PHK A;  1QX2 A;  1M46 A;  4I5K A;  2KYF A;  1CDN A;  4E68 A;  4N5X A;  2KI4 B;  3WXA A;  1G33 A;  2MAZ A;  4GPL B;  2PSR A;  3I5I B;  2OTG C;  2WCE A;  1IQ5 A;  2JXL A;  1XYD A;  1SK6 D;  4I5N B;  1OMR A;  1K90 D;  3OB1 B;  3TDI A;  3GK1 A;  1YTZ C;  2Q91 A;  3ICB A;  4YGB B;  2KFG A;  2BKI B;  1F4O A;  5CPV A;  3TUY C;  2LVI A;  1EL4 A;  3LLE A;  1F54 A;  2PRU A;  2EGD A;  1C7V A;  4N1G A;  1SY9 A;  4CFQ A;  2LP3 A;  1XFU O;  1KK8 B;  3JTD C;  4OKH A;  4C0J A;  1DGV A;  2OS8 B;  1CDM A;  1IRJ A;  1KFX S;  2LCP A;  2LMV A;  4QJ3 B;  4BY5 A;  4DUQ A;  5AER A;  2BBN A;  1K93 D;  4NDB A;  4F0Z B;  3VRP A;  2SAS A;  3EVU A;  2FCE A;  2KI6 D;  4FTG A;  3BUM B;  3TZ1 A;  3WHU B;  3LCP C;  2WC8 A;  2ZN9 A;  1DTL A;  1DGU A;  4GNK B;  4QJ4 B;  1KK7 Y;  1S6J A;  1SBJ A;  1NX3 A;  1SCM C;  1CTR A;  1OSA A;  3PN7 B;  1C07 A;  1J7P A;  1QVI Y;  1UUR A;  1U5I A;  2JC2 A;  4MZK A;  1MWN A;  2K0J A;  1J55 A;  1K8U A;  1UHN A;  4A4B A;  3OHM B;  3CZT X;  2F33 A;  1NCZ A;  2L4I A;  2LNK A;  1DT7 B;  5J3X A;  2M7L A;  3CR5 X;  2LC5 A;  1PK0 D;  2Q4U A;  1WDC B;  3NSL A;  1FF1 A;  1H4B A;  2QPT A;  2OPO A;  2M1U A;  5CSJ A;  4DRW A;  3LK1 A;  3VRN A;  3LL8 B;  1YX8 A;  1XO5 A;  4USL A;  1CFC A;  5B8I B;  1K94 A;  2R2I A;  2MJW B;  1SL9 A;  4OCI A;  1FW4 A;  1E8A A;  4YI9 A;  5ER5 A;  2LUX A;  3F45 A;  3HX4 A;  3K21 A;  1Y6W A;  5AAN A;  5ER4 X;  2H2K A;  3LK0 A;  1EG4 A;  1PAL A;  3GOF A;  4MBE A;  3EKJ A;  2D8N A;  4ZCV A;  3RLZ A;  2H61 C;  2PMY A;  1MXE A;  2RGI A;  3EK8 A;  2M49 B;  3I5H B;  4D1E A;  3FIA A;  1SMG A;  1YUR A;  1WY9 A;  2JTT A;  1JBA A;  4ORA B;  1DJZ A;  3TDZ A;  2I18 A;  2NCP A;  2L50 A;  3O78 A;  1DF0 B;  1FBV A;  2KGB C;  1NX2 A;  2L98 A;  5I2Q A;  1PSB A;  4CLN A;  2MA2 A;  1S3P A;  1UHH A;  3DF0 A;  2JRF A;  2LUC A;  5HKZ A;  1A2X A;  1AUI B;  2I94 A;  1B4C A;  1F4Q A;  2LHI A;  4AQI A;  1NCY A;  3WNX B;  1B7T Y;  1M63 B;  2ZNE A;  1TCO B;  5I2O A;  2BE4 A;  2MLF C;  2F2P A;  3D0Y B;  5I2L A;  1X02 A;  1QIV A;  1BT6 A;  1YR5 A;  2MHH A;  1V1G A;  3WHT B;  2M0R A;  2JU0 A;  2QAC A;  2HPS A;  2LVV A;  3AKB A;  4PCW A;  1H8B A;  2F2O A;  1Y1X A;  2TN4 A;  1YUS A;  4R1E A;  2ZRS A;  1XFV O;  3EK4 A;  5KSZ A;  1KK7 Z;  1KQM B;  2K61 A;  2L5X B;  3EK7 A;  2JXC A;  2LAN A;  4YBH B;  2K7D A;  2KNE A;  1DJX A;  1BLQ A;  1KSO A;  1S36 A;  2KI6 C;  3EVR A;  1TOP A;  2Y1N A;  2WCF A;  1N2D A;  1KWO B;  1CM1 A;  1NSH A;  2EHB A;  3BYA A;  3TS5 C;  1R6P A;  4JWQ A;  2M1K B;  1KQM C;  3C1V A;  4MZJ A;  4PHJ A;  1ALV A;  1L2O C;  1CM4 A;  2KQY A;  1QIW A;  1K9U A;  4N1F A;  1BOD A;  1SW8 A;  4MRY A;  1TIZ A;  2L51 A;  4NDD A;  1DMO A;  1OE9 B;  1QX5 B;  1A4P A;  2ZRT A;  1OZS A;  3PLF B;  1QAT A;  1UP5 A;  3EVV A;  1UWO A;  5D7F A;  2AMI A;  1WLZ A;  3DF0 B;  1ZAC A;  1NUB A;  3BUW B;  1CB1 A;  2KI4 C;  3KF9 A;  3KHE A;  1NPQ A;  2KFF A;  2BE6 A;  1QJT A;  1BOC A;  1BJF A;  3I5I C;  3AAJ A;  2E6W A;  2BBM A;  2LE9 B;  1BR1 B;  4C0K A;  1L7Z A;  1M45 A;  2LMT A;  1N65 A;  2CXJ A;  3SG2 A;  2G2B A;  4HSZ A;  1XFW O;  2Y1M A;  4PE4 A;  2BL0 B;  4MRX A;  5JOL A;  3CR4 X;  1OZO A;  1NX0 A;  2L2E A;  1DF0 A;  1REC A;  2LV7 A;  4M2P A;  1LA3 A;  2G9B A;  1K96 A;  3OX6 A;  3FWC A;  1KK8 C;  1QTX A;  2HQ8 A;  2KDH A;  5HKW A;  1ZMZ A;  2NLN A;  3O4Y A;  3OX5 A;  3TDU A;  1B7T Z;  1RTP 1;  2OS8 C;  2K2A A;  2PAL A;  3IF7 A;  3KEV A;  4GGN A;  1WRK A;  4GBA A;  1MXL C;  5JJG A;  5CSN A;  1SNL A;  2HF5 A;  1CMG A;  2WCB A;  1HQV A;  4GGF A;  1A29 A;  3FWB A;  3PSR A;  1IGV A;  1MQ1 A;  2LVK A;  1QV0 A;  1W7I B;  1SPY A;  2E30 A;  3BXK A;  3D0Y A;  1Y1A A;  4PE7 A;  3VRR A;  2LVJ A;  2KBI A;  1YVL A;  1ODB A;  4QJ5 B;  1IWQ A;  2JZI A;  3PN7 C;  3KPX A;  1DJG A;  1W7J B;  2SCP A;  1MR8 A;  3CS1 A;  5F6T A;  3HCM A;  3IQQ A;  2L0P A;  1CDP A;  1ZOT B;  3VGO A;  1TTX A;  1JC2 A;  1XFX O;  1QX7 A;  1CNP A;  4C0L A;  3I5G B;  1SR6 B;  1WDC C;  1AK8 A;  2JNX A;  1IH0 A;  3CTN A;  1XK4 A;  2MLE C;  2WOS A;  3OP0 A;  3BUN B;  1F70 A;  2JOJ A;  2JT8 A;  4IL1 A;  1BF5 A;  2O60 A;  4ORB B;  3OB2 B;  1AHR A;  5AXI A;  1EG3 A;  1C7W A;  3I5F B;  2KYC A;  1CMF A;  1KQV A;  2LP2 A;  1NX1 A;  2M29 A;  1FI5 A;  1OMV A;  5GQQ C;  2PAS A;  2VRG A;  1PRW A;  1A75 B;  3I5H C;  4OV2 A;  1KSM A;  5K89 A;  2A4J A;  1LIN A;  3BQ3 A;  3IQO A;  4WQ2 A;  4DS7 A;  4BY4 A;  2DOQ A;  2M9G A;  3MSE B;  3NSK A;  2MBX A;  2CT9 A;  5HYD A;  1VRK A;  1GGW A;  2EC6 B;  1CFF A;  4PE0 A;  2Y4Q A;  2KAX A;  2NZ0 A;  3GK2 A;  2KBM A;  4M2O A;  2L4H A;  1NYA A;  4CFR A;  1F71 A;  1EJ3 A;  1TRF A;  2HQW A;  3SG6 A;  3CWG A;  2K7O A;  1IKU A;  1YRU B;  4AOM A;  5KU1 A;  1XA5 A;  4P5O E;  1NCX A;  3KO0 A;  1MHO A;  4P2Y B;  4GGF C;  1M39 A;  1KFU L;  2LLT A;  1OQP A;  2O5G A;  2ZND A;  3VRQ A;  2WND A;  5G08 A;  1SRA A;  3RM1 A;  4PHN A;  1Y0V H;  1QVI Z;  2LMU A;  4M2Q A;  1NIW A;  1UUS A;  3A4U B;  3QRX A;  4YGC B;  5IBW A;  2KGR A;  1CLB A;  1DJH A;  1QS7 A;  1S6C A;  1IG5 A;  2I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...