4FTGA

The crystal structure of an ahnak peptide in complex with the s100a10/anxa2 heterotetramer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein/protein binding
molecule keywords Protein S100-A10
publication title Structure of a C-terminal AHNAK peptide in a 1:2:2 complex with S100A10 and an acetylated N-terminal peptide of annexin A2.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ftgA00
2JTZA 3A4UB 1J7RA 1KK8B 3BOWA 2KSPA 4ORCB 2BBMA 2H2KA 3SIBA 2WC8A 1N0YA 1M46A 1FI6A 2LP2A 2WCEA 1YRTB 1RWYA 1J1EA 1K9PA 3IQQA 3KO0A 1YRUB 5F6TA 2KDHA 4I5KA 1EL4A 3FWBA 2KGRA 2LVVA 3FIAA 3OB1B 2I7AA 2CBLA 1CFCA 2K2FA 2H61A 3DD4A 2KNEA 3WXAA 1PVBA 1XFWO 4PCWA 1ZMZA 1Y1UA 3SG6A 5J3XA 1S6IA 2M8UA 1XVJA 1QX2A 2F3ZA 1AHRA 1SW8A 2L0PA 1F54A 2PRUA 2AUCA 1B8RA 1JFJA 4UPGA 2F3YA 2JWWA 2V53A 4MSPA 4DUQA 1ODBA 3KPXA 1PK0D 2M97A 2SASA 3AAKA 1F4QA 3SG2A 1WLMA 3NXAA 3BQ3A 2B1UA 1KFUL 2EC6B 1W7JB 2KI6D 4M2PA 4HSZA 4DCKA 2Y1MA 1M63B 1XFVO 2KQYA 4MZLA 2MHHA 1U5IB 4F0ZB 3A8RA 3I5GC 1AK8A 3PSRA 2GV5A 2ZNDA 4JWQA 1K2HA 1EXRA 1YX8A 1CDNA 2MLFC 2JT8A 1M39A 4DIRA 4OKHA 3SG5A 3BUNB 3OX6A 1J7OA 1C07A 2LMTA 1CLBA 1S36A 1K96A 2ZFDA 4OCIA 4YGEB 5JOLA 2LMVA 5CSJA 4OR9B 1S5GZ 4CPVA 1DMOA 1SBJA 4BY5A 1ALWA 1SL9A 1YURA 3I5GB 1M45A 1QXPA 1FI5A 4YGBB 1TNWA 1KQMC 1F8HA 4ORAB 1SK6D 4PHKA 1H8BA 1J7QA 1IJ6A 3DVMA 1SYMA 2F2PA 1EG3A 1BR4B 3KF9A 1AUIB 1G4YR 2JTTA 2JXLA 2M7NA 1GGZA 1K90D 2BECA 1LXFC 3LK1A 4M2OA 1CFDA 1AJ4A 1NP8A 2LLSA 1S6CA 1SCMC 3CTNA 5G08A 5I8NA 1UWOA 1CDMA 1Y1XA 3CR5X 1CFFA 3M0WA 1ZFSA 1BU3A 1DJHA 4YGDB 1HT9A 1MF8B 2BE4A 1NCYA 4WQ2A 1QX7A 2CXJA 3OP0A 1KQMB 1KK7Y 2Q4UA 4MRYA 1QV1A 2KI6C 1KFXS 1OQPA 4I5NB 2LE9B 2CTNA 2JPTA 1PRWA 4MEWA 1CM1A 1OMVA 1QATA 1QTXA 2AMIA 2E6WA 2K7DA 2LV7A 3TS5C 1CNPA 3GK2A 2F8PA 2KBMA 1DF0B 1VRKA 5DKNA 2KYCA 3NSIA 1YTZC 4PE4A 4GGNA 1A2XA 2K7BA 1WLZA 1AVSA 3EKHA 3NSOA 5DKQA 4QJ5B 1V1GA 1KK8C 1QIWA 1SKTA 1LA3A 1OSAA 3D10A 1XO5A 1IWQA 2K8MB 3PM8A 1UHIA 2JU0A 1Y0VH 1UHJA 3I5FC 1NX2A 1C7WA 3IQOA 3LLEA 1PSBA 1BODA 1JWDA 1JF2A 4AOMA 1BOCA 1EH2A 3TS5B 1PSRA 1K93D 3FS7A 4AQIA 1SR6C 2KQ6A 2BCBA 5CSFA 4ZCVA 4ICBA 2KYFA 1RFJA 4YI9A 2OS8C 3DVKA 3OHMB 5AERA 3KEVA 2KI4C 1OE9B 4A4CA 1MWNA 3LL8B 2LMUA 1QV0A 1PALA 2LANA 2Y1NA 3IF7A 1JSAA 3WNXB 2JT3A 1TRFA 4XJKA 1YVHA 5FYXA 3VRRA 1IGVA 3I5FB 2LUXA 4FTGA 1R2UA 1H4BA 1BJFA 2ZNEA 1XA5A 1NUBA 3VRQA 4P5OE 4D1EA 3AKBA 5PALA 1RECA 1PULA 1SR6B 2NCOA 4PHJA 3I5IC 4GGFA 2EC6C 1F70A 1YUSA 2COLB 1C7VA 2K7OA 3O78A 2OS8B 3TZ1A 2Y5IA 1A29A 5I2QA 5HKWA 4XYNA 2KI4B 2K7CA 1RJVA 1UHHA 3VRPA 2A4JA 4HRGA 5BPJA 1SCVA 2ZRSA 1N2DA 2EGDA 2LVJA 2HF5A 2H61C 1TOPA 2M0RA 3SG4A 3EVRA 3BOWB 1WRZA 2WCFA 1NSHA 2BL0C 2BCAA 3I5IB 1IQ5A 5AEQA 1QVIY 1B7TZ 2OPOA 4HREE 1JFKA 4C0JA 2KAVA 2WCBA 1UHNA 1NYAA 2LM5A 2QPTA 1QS7A 5K89A 1YR5A 2RGIA 3EVVA 3VGOA 4CFRA 4E68A 3DVJA 1IJ5A 5B8IB 1WY9A 2AAOA 1DT7B 2L98A 2L4HA 3BUXB 3O2PA 1YVLA 1KSOA 4M2QA 2L51A 3VROA 1A75B 2BL0B 4CFQA 4N5XA 3BUOB 1FF1A 1QLKA 1XFZO 2LVKA 3E3RA 1CMFA 1F4OA 5AXIA 1MQ1A 2L4IA 1RTP1 2K61A 2NCPA 2O60A 3WHTB 5AANA 1DJZA 2FJUB 2BCXA 1CLLA 1X02A 4PALA 4U8DA 4YGAA 1SL8A 1NWDA 1KQVA 1K8UA 1OMRA 1CFPA 2JT0A 3EVUA 2R2IA 2L50A 3HCMA 1G8IA 1WRKA 1XFXO 1YUTA 4YBHB 4WRIA 4BY4A 1CB1A 1KSMA 3HX4A 3LK0A 2JC2A 2MA2A 1CMGA 1QX5B 3AAJA 1F55A 1IKUA 1UHKA 1DJXA 1KFXL 1Q80A 1KCYA 1DJGA 1DVIA 1S5GY 1K9KA 3D0YA 1DJYA 3CWGA 2LNKA 5DKRA 3RLZA 4QJ3B 2BBNA 3EKJA 4JQ0D 1TN4A 3BUWB 1DGUA 2HPSA 3EK7A 2I94A 1LA0A 1F71A 3DF0A 1FW4A 1XK4C 3ICBA 3H4SE 5HYDA 2CCMA 2JNFA 1E8AA 1BLQA 2SCPA 1IH0A 3PFVA 2NLNA 4NDBA 3LCPC 4GFTA 1DJWA 2K0JA 1SL7A 2PMYA 3PN7B 4JPZB 3TDUA 1NCXA 2BKIB 1TCFA 4YI8A 1MHOA 5D7FA 1S6JA 4CLNA 2IS9A 2K2AA 1SPYA 1J1DA 1SNLA 1UUSA 3I5HC 1BG1A 1S26D 2I2RE 3NSLA 3FWCA 1MR8A 2KOTA 3VRNA 1FPWA 1S3PA 2HETA 3BXKA 3MSEB 2ZRTA 5HKZA 1TCOB 1CLMA 1CKKA 4ZCUA 1W7IB 2I18A 2Q91A 4QJ4B 1BF5A 1SMGA 2VRGA 1JC2A 1YX7A 5CSNA 5KTYA 1K9UA 4PE7A 3GK1A 4GPLB 1B8CA 2JQ6A 2EHBA 1QJTA 2ZKMX 1JUOA 2O5GA 3I5HB 3CZTX 4MVFA 2OTGC 1TNXA 1GGWA 1DJIA 2HQ8A 3C1VA 1ZOTB 4GAOA 4I5LB 1GJYA 1TTXA 1ZACA 3RM1A 1A03A 2M3WA 3CR2A 3GK4X 1OMDA 4IL1A 1N65A 4OV2A 2JULA 2KAYA 1LKJA 1OZSA 3O6BA 2D8NA 5I2OA 1RK9A 4GBAA 2M49B 2WOSA 4MBEA 2MBXA 3PALA 2GGMA 4GGFC 2MRDA 3OX5A 3JVTC 1TNQA 1AJ5A 1KWOC 1NX1A 5KU1A 2M1UA 1YUUA 4GUKA 1JBAA 1U5IA 1QVIZ 1IRJA 1LINA 1B1GA 1L2OC 2OTGB 4TNCA 1R6PA 2JNXA 2G9BA 2LUCA 2MJWB 4XJKB 1OZOA 4YRUA 1IQ3A 2L5XB 4C0LA 2ZN9A 3O4YA 3TDIA 2KHNA 1NCZA 3ZNIA 2WNDA 1BR1B 2KBIA 1XFUO 1QASA 1A75A 2JOJA 2HQWA 2TN4A 1EJ3A 5CSIA 5HKYA 5IBWA 1GQMA 3CR4X 3JVTB 2P6BB 4NDDA 1KWOB 2FCEA 4GNKB 3TDZA 5KSZA 2PALA 1L7ZA 2GGZA 2MLEC 1TIZA 1L2OB 3OB2B 4A4BA 1JF0A 2LP3A 5ER4X 2ISDA 3CLNA 2M7LA 1CM4A 4NDCA 3AKAA 1CTRA 1RROA 1SRAA 4MZJA 4YGCB 3SIAA 1KFUS 1B4CA 2LHLA 4ORBB 2CNPA 2ZN8A 4CIDA 1B7TY 1D1OA 1B47A 1AP4A 1MUXA 1TNPA 4MZKA 4NQGA 2LAPA 2KFGA 2M1KB 1WDCC 2LCPA 2WORA 5HLVA 1QIVA 1BT6A 4DRWA 1ZUZA 2NXQA 4Q04A 1NIWA 1EG4A 4N1GA 1G33A 2JXCA 1A4PA 1M31A 3F45A 2M29A 4PE1A 4C0KA 3PATA 1OOJA 1K94A 1KK7Z 4L9MA 2BKHB 1SY9A 3JTDC 1QLSA 3K21A 3SJSA 4USLA 1DF0A 3WHUB 4PHNA 3PN7C 4AQJA 2NZ0A 4OVNF 5AFPA 2KAXA 3SG3A 3TUYC 5JJGA 2L2EA 1WDCB 1BMOA 4N1FA 3BYAA 1WRLA 2DOQA 4PDZA 2LHIA 1HQVA 5GQQC 3BUMB 1V1FA 2FCDA 2JZIA 2PSRA 2Y4QA 4DS7A 1DTLA 4FQOA 2F33A 1NX3A 1FBVA 2KFHA 2LC5A 3JTDB 2CT9A 1ALVA 1UURA 5ER5A 2LLTA 1DGVA 1PVAA 1CDPA 1B9AA 4WQ3A 1XK4A 1MXEA 2BE6A 1NPQA 1UP5A 1K95A 3NSKA 2KFFA 3TUYB 1J7PA 1LVCD 3CGAA 3CS1A 3KHEA 2E30A 4PE0A 2QACA 5I2LA 5TNCA 3D0YB 2JRFA 2LVIA 3SG7A 3EK4A 1SCMB 5CPVA 4I5JA 2PASA 4MLWA 1Y1AA 4PHMA 2FOTA 3QRXA 1CDLA 4HRHA 1B8LA 1MXLC 2G2BA 4R1EA 1NX0A 2MAZA 2PVBA 3DF0B 3EK8A 5HLOA 1J55A 3DVEA 4P2YB 3ZWHA 2M9GA 2LLUA 1XYDA 1XFYO 1IG5A 4ETOA 2KGBC 3PLFB 4MN0A 2F2OA 4MRXA 1S1EA 3GOFA 5D69A 1Y6WA
chains in the Genus database with same CATH superfamily
2JTZA 3R72A 3A4UB 1J7RA 1KK8B 3BOWA 2KSPA 4ORCB 2BBMA 2H2KA 3SIBA 2WC8A 2KPHA 3S0AA 2QEBA 1N0YA 1M46A 1FI6A 3NHIA 2LP2A 2WCEA 1YRTB 1RWYA 1J1EA 1K9PA 3IQQA 3KO0A 5D3OA 1YRUB 5F6TA 2KDHA 4I5KA 1EL4A 3FWBA 2KGRA 3D75A 2ERBA 2LVVA 3FIAA 3OB1B 2I7AA 2CBLA 1CFCA 2K2FA 2H61A 3DD4A 2KNEA 3WXAA 1PVBA 1XFWO 4PCWA 1ZMZA 1Y1UA 3SG6A 5J3XA 1S6IA 2M8UA 1XVJA 1QX2A 2F3ZA 1AHRA 1SW8A 2L0PA 3CDNA 1F54A 2PRUA 2AUCA 2KLDA 1B8RA 1JFJA 4UPGA 2F3YA 3V2LA 2JWWA 2V53A 4MSPA 4DUQA 1ODBA 3KPXA 1PK0D 2M97A 2SASA 3AAKA 1F4QA 2WCLA 3SG2A 3SS5A 1WLMA 3NXAA 3BQ3A 2B1UA 1KFUL 2EC6B 1W7JB 2KI6D 4M2PA 4HSZA 4DCKA 2Y1MA 1M63B 1SSEB 1XFVO 1DELA 2KQYA 2BAPA 2MHHA 3FE9A 4MZLA 3S0GA 1U5IB 4F0ZB 3A8RA 3I5GC 1AK8A 3PSRA 2GV5A 2ZNDA 4JWQA 1K2HA 1EXRA 1YX8A 1CDNA 2MLFC 2JT8A 1M39A 4DIRA 4OKHA 3SG5A 3BUNB 3OX6A 3CABA 1J7OA 1C07A 2LMTA 1CLBA 1S36A 1K96A 2ZFDA 4OCIA 4YGEB 5JOLA 2LMVA 5CSJA 4OR9B 1S5GZ 4CPVA 1DMOA 1SBJA 4BY5A 1ALWA 1SL9A 3B86A 1YURA 3I5GB 3SS4A 1M45A 1QXPA 1FI5A 4YGBB 3S0DA 1TNWA 1KQMC 1F8HA 4ORAB 1SK6D 4PHKA 1H8BA 1J7QA 1IJ6A 3DVMA 1SYMA 2F2PA 1EG3A 1BR4B 3KF9A 1AUIB 1G4YR 2JTTA 2JXLA 2M7NA 1GGZA 1K90D 2BECA 1LXFC 3LK1A 4M2OA 1CFDA 1AJ4A 1NP8A 2LLSA 1S6CA 1SCMC 3CTNA 4JD9A 5G08A 5I8NA 1UWOA 1CDMA 1Y1XA 3CR5X 1CFFA 3M0WA 1ZFSA 1BU3A 1DJHA 4YGDB 1HT9A 1MF8B 1QWVA 1NCYA 2BE4A 4WQ2A 1QX7A 1Z4HA 2CXJA 3OP0A 1KQMB 1KK7Y 2Q4UA 4MRYA 1QV1A 2KI6C 1KFXS 1OQPA 4I5NB 2LE9B 2CTNA 2JPTA 1PRWA 4MEWA 1CM1A 1OMVA 3DY9A 3DYEA 1QATA 5EL2A 1QTXA 2AMIA 2E6WA 2K7DA 2LV7A 3TS5C 1CNPA 3GK2A 2F8PA 2KBMA 1DF0B 1VRKA 5DKNA 2KYCA 3NSIA 1YTZC 4PE4A 4GGNA 1A2XA 2K7BA 1WLZA 1AVSA 3EKHA 3NSOA 3DZTA 5DKQA 4QJ5B 1V1GA 1OW4A 1KK8C 1QIWA 2BNXA 1SKTA 1LA3A 1OSAA 3D10A 1OOFA 1XO5A 1IWQA 2K8MB 3N7HA 3PM8A 1UHIA 2JU0A 1Y0VH 3FE6A 1UHJA 3I5FC 1NX2A 1C7WA 3IQOA 3LLEA 5FI6A 3UO9A 2WCHA 1PSBA 1BODA 1JWDA 1C3ZA 1JF2A 4AOMA 1BOCA 1EH2A 3TS5B 1PSRA 1K93D 2WC6A 3FS7A 1SR6C 4AQIA 2KQ6A 2BCBA 5CSFA 4ZCVA 4ICBA 2KYFA 1RFJA 3IVTA 4YI9A 2OS8C 3DVKA 3OHMB 1Z2CB 3KEVA 5AERA 2KI4C 1OE9B 4A4CA 1MWNA 3LL8B 2LMUA 1QV0A 1PALA 2LANA 2Y1NA 3IF7A 1JSAA 3WNXB 2JT3A 1TRFA 3D76A 4XJKA 1YVHA 5FYXA 3VRRA 1IGVA 3I5FB 2LUXA 4FTGA 3D74A 1R2UA 1H4BA 1BJFA 2ZNEA 1XA5A 1NUBA 3VRQA 4P5OE 4D1EA 3AKBA 5PALA 1RECA 1PULA 1SR6B 2NCOA 3CZ0A 4PHJA 3I5IC 4GGFA 1OOHA 2L2CA 2EC6C 1F70A 1YUSA 2COLB 1C7VA 2K7OA 3O78A 2OS8B 3TZ1A 2Y5IA 1A29A 5I2QA 5HKWA 4XYNA 2KI4B 3B7AA 2K7CA 1RJVA 1UHHA 3VRPA 2A4JA 4HRGA 1OOGA 5BPJA 1SCVA 2ZRSA 1N2DA 2EGDA 2LVJA 2HF5A 2H61C 1TOPA 2M0RA 3R1PA 3SG4A 3EVRA 3BOWB 1WRZA 2WCFA 1NSHA 2BL0C 3S0BA 2BCAA 3I5IB 1IQ5A 5AEQA 1QVIY 1B7TZ 3FE8A 2OPOA 4HREE 1JFKA 4C0JA 3SS3A 3PM2A 2KAVA 2WCBA 1DQEA 1UHNA 1NYAA 2LM5A 2QPTA 1QS7A 2WCJA 4F7FA 1YR5A 2RGIA 3NHTA 3EVVA 3VGOA 4CFRA 5K89A 3DVJA 3RZSA 4E68A 1IJ5A 2WCMA 5B8IB 1WY9A 2AAOA 1DT7B 2L98A 2L4HA 3BUXB 3O2PA 1YVLA 1KSOA 4M2QA 2L51A 3VROA 1A75B 2BL0B 4CFQA 4N5XA 3BUOB 1FF1A 1QLKA 1XFZO 2LVKA 3E3RA 1CMFA 1F4OA 5AXIA 1MQ1A 2L4IA 1RTP1 2K61A 2NCPA 2QEOA 2O60A 3WHTB 5AANA 1TWOA 1DJZA 2FJYA 2FJUB 2BCXA 1CLLA 4KYNA 1X02A 4PALA 4U8DA 4YGAA 3O4XA 1SL8A 1NWDA 1KQVA 1K8UA 1OMRA 1CFPA 2KLEA 2JT0A 4IJ7A 3L47A 3EVUA 2R2IA 2L50A 3HCMA 4PT1A 1G8IA 1WRKA 1XFXO 3CZ2A 1YUTA 4YBHB 4WRIA 4BY4A 2QEHA 1CB1A 1KSMA 3HX4A 3LK0A 2JC2A 2MA2A 1CMGA 1QX5B 3AAJA 1F55A 3VB1A 1IKUA 1ORGA 1UHKA 1DJXA 1KFXL 1Q80A 1KCYA 1DJGA 1DVIA 1S5GY 3PJIA 1K9KA 3D0YA 1DJYA 3D73A 3CWGA 2LNKA 3B6XA 5DKRA 4QJ3B 2BBNA 3RLZA 1IIOA 3EKJA 4JQ0D 4INWA 1TN4A 3BUWB 1DGUA 2HPSA 3EK7A 2I94A 1LA0A 1F71A 3DF0A 1FW4A 1XK4C 3ICBA 3H4SE 1LS8A 5HL1A 5HYDA 2CCMA 2JNFA 1E8AA 1BLQA 2SCPA 2P71A 1IH0A 3PFVA 2NLNA 1GM0A 4NDBA 3LCPC 4GFTA 1DJWA 2K0JA 1SL7A 2PMYA 3PN7B 4JPZB 3TDUA 1NCXA 2BKIB 1TCFA 3NGVA 4YI8A 3EG5B 1MHOA 5D7FA 1S6JA 4CLNA 2GTEA 2IS9A 3BFBA 3L4AA 2K2AA 3UNWA 1SPYA 1J1DA 1SNLA 1UUSA 3I5HC 1BG1A 1S26D 2I2RE 3NSLA 2H8VA 3FWCA 1MR8A 2KOTA 3VRNA 1FPWA 1S3PA 2HETA 3BXKA 3MSEB 2PQLA 2ZRTA 5HKZA 1TCOB 1CLMA 1CKKA 4ZCUA 1W7IB 2I18A 2Q91A 4QJ4B 1BF5A 1SMGA 2VRGA 1JC2A 1YX7A 5CSNA 5KTYA 1K9UA 3CZ1A 4PE7A 3GK1A 4GPLB 1B8CA 2JQ6A 2EHBA 1QJTA 2ZKMX 1JUOA 2O5GA 3I5HB 3CZTX 4MVFA 2OTGC 1TNXA 1GGWA 1DJIA 2HQ8A 3C1VA 1ZOTB 4GAOA 4I5LB 1GJYA 1TTXA 1ZACA 3RM1A 1A03A 2M3WA 3CR2A 3GK4X 1OMDA 4IL1A 1N65A 4OV2A 2JULA 2KAYA 1LKJA 1OZSA 3O6BA 2D8NA 5I2OA 1RK9A 4GBAA 3BJHA 2M49B 2WOSA 4MBEA 5FI7A 3PALA 2GGMA 2MBXA 4GGFC 2MRDA 3OX5A 3JVTC 1TNQA 1AJ5A 1KWOC 1NX1A 5KU1A 2M1UA 1YUUA 4GUKA 1JBAA 1U5IA 1QVIZ 1IRJA 1LINA 1B1GA 1L2OC 2OTGB 4TNCA 1R6PA 2JNXA 2G9BA 2LUCA 2MJWB 4XJKB 1OZOA 4YRUA 1IQ3A 2L5XB 4C0LA 2ZN9A 3O4YA 3TDIA 2KHNA 1NCZA 3ZNIA 2WNDA 3R1VA 1BR1B 2KBIA 3S0EA 1XFUO 1QASA 1A75A 5FI2A 2JOJA 2HQWA 2TN4A 1EJ3A 5CSIA 3OBVA 5HKYA 5IBWA 1GQMA 3CR4X 3JVTB 2P6BB 3OGNA 4NDDA 1KWOB 2FCEA 4GNKB 3TDZA 5KSZA 2PALA 4JKTA 1XFRA 1L7ZA 2GGZA 2MLEC 1TIZA 1L2OB 3OB2B 4A4BA 1DEKA 1JF0A 2LP3A 5ER4X 2ISDA 3CLNA 2M7LA 1CM4A 1DC1A 4NDCA 3AKAA 1CTRA 1RROA 1SRAA 4MZJA 4YGCB 3SIAA 1KFUS 3B87A 1B4CA 3B88A 2LHLA 4ORBB 2CNPA 2ZN8A 4FQTA 1B7TY 4CIDA 1D1OA 1B47A 1AP4A 1MUXA 1TNPA 4MZKA 3S0FA 2QEVA 2LAPA 4NQGA 2KFGA 2M1KB 1WDCC 2LCPA 2WORA 3BFHA 3BFAA 5HLVA 1QIVA 1BT6A 4DRWA 1ZUZA 2NXQA 4Q04A 1NIWA 1EG4A 4N1GA 1G33A 2JXCA 1A4PA 1M31A 3F45A 2M29A 4PE1A 4C0KA 3PATA 1OOJA 1K94A 1KK7Z 4L9MA 2BKHB 1SY9A 3L4LA 3JTDC 1QLSA 3K21A 3SJSA 2WCKA 4USLA 1DF0A 4OZDA 3WHUB 3D78A 3PN7C 4PHNA 2NZ0A 4OVNF 4AQJA 5AFPA 2QDIA 1P28A 2KAXA 3SG3A 3TUYC 1C3YA 5JJGA 2L2EA 1WDCB 1BMOA 4N1FA 3BYAA 1WRLA 2L5YA 2DOQA 4PDZA 2LHIA 1HQVA 5GQQC 3BUMB 1V1FA 2FCDA 2JZIA 2PSRA 2Y4QA 4DS7A 1DTLA 4FQOA 2F33A 1NX3A 1FBVA 2KFHA 2LC5A 3JTDB 2CT9A 1ALVA 1UURA 5ER5A 2LLTA 2WC5A 1DGVA 1PVAA 4INXA 3CYZA 1CDPA 1B9AA 4WQ3A 1XK4A 2K60A 1MXEA 2BE6A 1NPQA 1UP5A 1K95A 3K1EA 2KFFA 3NSKA 3TUYB 1J7PA 1LVCD 3CGAA 3CS1A 3KHEA 5DICA 2E30A 4PE0A 2QACA 5I2LA 2YGUA 2P70A 5TNCA 3D0YB 2JRFA 2LVIA 3R1OA 3SG7A 3EK4A 1SCMB 3QMEA 5CPVA 4I5JA 2PASA 4MLWA 1T14A 1OOIX 1Y1AA 4PHMA 2FOTA 3QRXA 1CDLA 4HRHA 1B8LA 1MXLC 2G2BA 2JPOA 1W9ZA 4R1EA 1NX0A 2MAZA 1TUZA 2PVBA 3DF0B 3Q8IA 3EK8A 5HLOA 1J55A 3DVEA 4P2YB 3ZWHA 2M9GA 2LLUA 2PYQA 1XYDA 1XFYO 1IG5A 4ETOA 1TUJA 2KGBC 3DXLA 5I94A 3PLFB 4MN0A 2F2OA 4MRXA 1S1EA 3D77A 3GOFA 5D69A 1Y6WA
chains in the Genus database with same CATH topology
2JTZA 3A4UB 1J7RA 1KK8B 3BOWA 2KSPA 4ORCB 2BBMA 2H2KA 3SIBA 2WC8A 1N0YA 1M46A 1FI6A 2LP2A 2WCEA 1YRTB 1RWYA 1J1EA 1K9PA 3IQQA 3KO0A 1YRUB 5F6TA 2KDHA 4I5KA 1EL4A 3FWBA 2KGRA 2LVVA 3FIAA 3OB1B 2I7AA 2CBLA 1CFCA 2K2FA 2H61A 3DD4A 2KNEA 3WXAA 1PVBA 1XFWO 4PCWA 1ZMZA 1Y1UA 3SG6A 5J3XA 1S6IA 2M8UA 1XVJA 1QX2A 2F3ZA 1AHRA 1SW8A 2L0PA 1F54A 2PRUA 2AUCA 1B8RA 1JFJA 4UPGA 2F3YA 2JWWA 2V53A 4MSPA 4DUQA 1ODBA 3KPXA 1PK0D 2M97A 2SASA 3AAKA 1F4QA 3SG2A 1WLMA 3NXAA 3BQ3A 2B1UA 1KFUL 2EC6B 1W7JB 2KI6D 4M2PA 4HSZA 4DCKA 2Y1MA 1M63B 1XFVO 2KQYA 4MZLA 2MHHA 1U5IB 4F0ZB 3A8RA 3I5GC 1AK8A 3PSRA 2GV5A 2ZNDA 4JWQA 1K2HA 1EXRA 1YX8A 1CDNA 2MLFC 2JT8A 1M39A 4DIRA 4OKHA 3SG5A 3BUNB 3OX6A 1J7OA 1C07A 2LMTA 1CLBA 1S36A 1K96A 2ZFDA 4OCIA 4YGEB 5JOLA 2LMVA 5CSJA 4OR9B 1S5GZ 4CPVA 1DMOA 1SBJA 4BY5A 1ALWA 1SL9A 1YURA 3I5GB 1M45A 1QXPA 1FI5A 4YGBB 1TNWA 1KQMC 1F8HA 4ORAB 1SK6D 4PHKA 1H8BA 1J7QA 1IJ6A 3DVMA 1SYMA 2F2PA 1EG3A 1BR4B 3KF9A 1AUIB 1G4YR 2JTTA 2JXLA 2M7NA 1GGZA 1K90D 2BECA 1LXFC 3LK1A 4M2OA 1CFDA 1AJ4A 1NP8A 2LLSA 1S6CA 1SCMC 3CTNA 5G08A 5I8NA 1UWOA 1CDMA 1Y1XA 3CR5X 1CFFA 3M0WA 1ZFSA 1BU3A 1DJHA 4YGDB 1HT9A 1MF8B 2BE4A 1NCYA 4WQ2A 1QX7A 2CXJA 3OP0A 1KQMB 1KK7Y 2Q4UA 4MRYA 1QV1A 2KI6C 1KFXS 1OQPA 4I5NB 2LE9B 2CTNA 2JPTA 1PRWA 4MEWA 1CM1A 1OMVA 1QATA 1QTXA 2AMIA 2E6WA 2K7DA 2LV7A 3TS5C 1CNPA 3GK2A 2F8PA 2KBMA 1DF0B 1VRKA 5DKNA 2KYCA 3NSIA 1YTZC 4PE4A 4GGNA 1A2XA 2K7BA 1WLZA 1AVSA 3EKHA 3NSOA 5DKQA 4QJ5B 1V1GA 1KK8C 1QIWA 1SKTA 1LA3A 1OSAA 3D10A 1XO5A 1IWQA 2K8MB 3PM8A 1UHIA 2JU0A 1Y0VH 1UHJA 3I5FC 1NX2A 1C7WA 3IQOA 3LLEA 1PSBA 1BODA 1JWDA 1JF2A 4AOMA 1BOCA 1EH2A 3TS5B 1PSRA 1K93D 3FS7A 4AQIA 1SR6C 2KQ6A 2BCBA 5CSFA 4ZCVA 4ICBA 2KYFA 1RFJA 4YI9A 2OS8C 3DVKA 3OHMB 5AERA 3KEVA 2KI4C 1OE9B 4A4CA 1MWNA 3LL8B 2LMUA 1QV0A 1PALA 2LANA 2Y1NA 3IF7A 1JSAA 3WNXB 2JT3A 1TRFA 4XJKA 1YVHA 5FYXA 3VRRA 1IGVA 3I5FB 2LUXA 4FTGA 1R2UA 1H4BA 1BJFA 2ZNEA 1XA5A 1NUBA 3VRQA 4P5OE 4D1EA 3AKBA 5PALA 1RECA 1PULA 1SR6B 2NCOA 4PHJA 3I5IC 4GGFA 2EC6C 1F70A 1YUSA 2COLB 1C7VA 2K7OA 3O78A 2OS8B 3TZ1A 2Y5IA 1A29A 5I2QA 5HKWA 4XYNA 2KI4B 2K7CA 1RJVA 1UHHA 3VRPA 2A4JA 4HRGA 5BPJA 1SCVA 2ZRSA 1N2DA 2EGDA 2LVJA 2HF5A 2H61C 1TOPA 2M0RA 3SG4A 3EVRA 3BOWB 1WRZA 2WCFA 1NSHA 2BL0C 2BCAA 3I5IB 1IQ5A 5AEQA 1QVIY 1B7TZ 2OPOA 4HREE 1JFKA 4C0JA 2KAVA 2WCBA 1UHNA 1NYAA 2LM5A 2QPTA 1QS7A 5K89A 1YR5A 2RGIA 3EVVA 3VGOA 4CFRA 4E68A 3DVJA 1IJ5A 5B8IB 1WY9A 2AAOA 1DT7B 2L98A 2L4HA 3BUXB 3O2PA 1YVLA 1KSOA 4M2QA 2L51A 3VROA 1A75B 2BL0B 4CFQA 4N5XA 3BUOB 1FF1A 1QLKA 1XFZO 2LVKA 3E3RA 1CMFA 1F4OA 5AXIA 1MQ1A 2L4IA 1RTP1 2K61A 2NCPA 2O60A 3WHTB 5AANA 1DJZA 2FJUB 2BCXA 1CLLA 1X02A 4PALA 4U8DA 4YGAA 1SL8A 1NWDA 1KQVA 1K8UA 1OMRA 1CFPA 2JT0A 3EVUA 2R2IA 2L50A 3HCMA 1G8IA 1WRKA 1XFXO 1YUTA 4YBHB 4WRIA 4BY4A 1CB1A 1KSMA 3HX4A 3LK0A 2JC2A 2MA2A 1CMGA 1QX5B 3AAJA 1F55A 1IKUA 1UHKA 1DJXA 1KFXL 1Q80A 1KCYA 1DJGA 1DVIA 1S5GY 1K9KA 3D0YA 1DJYA 3CWGA 2LNKA 5DKRA 3RLZA 4QJ3B 2BBNA 3EKJA 4JQ0D 1TN4A 3BUWB 1DGUA 2HPSA 3EK7A 2I94A 1LA0A 1F71A 3DF0A 1FW4A 1XK4C 3ICBA 3H4SE 5HYDA 2CCMA 2JNFA 1E8AA 1BLQA 2SCPA 1IH0A 3PFVA 2NLNA 4NDBA 3LCPC 4GFTA 1DJWA 2K0JA 1SL7A 2PMYA 3PN7B 4JPZB 3TDUA 1NCXA 2BKIB 1TCFA 4YI8A 1MHOA 5D7FA 1S6JA 4CLNA 2IS9A 2K2AA 1SPYA 1J1DA 1SNLA 1UUSA 3I5HC 1BG1A 1S26D 2I2RE 3NSLA 3FWCA 1MR8A 2KOTA 3VRNA 1FPWA 1S3PA 2HETA 3BXKA 3MSEB 2ZRTA 5HKZA 1TCOB 1CLMA 1CKKA 4ZCUA 1W7IB 2I18A 2Q91A 4QJ4B 1BF5A 1SMGA 2VRGA 1JC2A 1YX7A 5CSNA 5KTYA 1K9UA 4PE7A 3GK1A 4GPLB 1B8CA 2JQ6A 2EHBA 1QJTA 2ZKMX 1JUOA 2O5GA 3I5HB 3CZTX 4MVFA 2OTGC 1TNXA 1GGWA 1DJIA 2HQ8A 3C1VA 1ZOTB 4GAOA 4I5LB 1GJYA 1TTXA 1ZACA 3RM1A 1A03A 2M3WA 3CR2A 3GK4X 1OMDA 4IL1A 1N65A 4OV2A 2JULA 2KAYA 1LKJA 1OZSA 3O6BA 2D8NA 5I2OA 1RK9A 4GBAA 2M49B 2WOSA 4MBEA 2MBXA 3PALA 2GGMA 4GGFC 2MRDA 3OX5A 3JVTC 1TNQA 1AJ5A 1KWOC 1NX1A 5KU1A 2M1UA 1YUUA 4GUKA 1JBAA 1U5IA 1QVIZ 1IRJA 1LINA 1B1GA 1L2OC 2OTGB 4TNCA 1R6PA 2JNXA 2G9BA 2LUCA 2MJWB 4XJKB 1OZOA 4YRUA 1IQ3A 2L5XB 4C0LA 2ZN9A 3O4YA 3TDIA 2KHNA 1NCZA 3ZNIA 2WNDA 1BR1B 2KBIA 1XFUO 1QASA 1A75A 2JOJA 2HQWA 2TN4A 1EJ3A 5CSIA 5HKYA 5IBWA 1GQMA 3CR4X 3JVTB 2P6BB 4NDDA 1KWOB 2FCEA 4GNKB 3TDZA 5KSZA 2PALA 1L7ZA 2GGZA 2MLEC 1TIZA 1L2OB 3OB2B 4A4BA 1JF0A 2LP3A 5ER4X 2ISDA 3CLNA 2M7LA 1CM4A 4NDCA 3AKAA 1CTRA 1RROA 1SRAA 4MZJA 4YGCB 3SIAA 1KFUS 1B4CA 2LHLA 4ORBB 2CNPA 2ZN8A 4CIDA 1B7TY 1D1OA 1B47A 1AP4A 1MUXA 1TNPA 4MZKA 4NQGA 2LAPA 2KFGA 2M1KB 1WDCC 2LCPA 2WORA 5HLVA 1QIVA 1BT6A 4DRWA 1ZUZA 2NXQA 4Q04A 1NIWA 1EG4A 4N1GA 1G33A 2JXCA 1A4PA 1M31A 3F45A 2M29A 4PE1A 4C0KA 3PATA 1OOJA 1K94A 1KK7Z 4L9MA 2BKHB 1SY9A 3JTDC 1QLSA 3K21A 3SJSA 4USLA 1DF0A 3WHUB 4PHNA 3PN7C 4AQJA 2NZ0A 4OVNF 5AFPA 2KAXA 3SG3A 3TUYC 5JJGA 2L2EA 1WDCB 1BMOA 4N1FA 3BYAA 1WRLA 2DOQA 4PDZA 2LHIA 1HQVA 5GQQC 3BUMB 1V1FA 2FCDA 2JZIA 2PSRA 2Y4QA 4DS7A 1DTLA 4FQOA 2F33A 1NX3A 1FBVA 2KFHA 2LC5A 3JTDB 2CT9A 1ALVA 1UURA 5ER5A 2LLTA 1DGVA 1PVAA 1CDPA 1B9AA 4WQ3A 1XK4A 1MXEA 2BE6A 1NPQA 1UP5A 1K95A 3NSKA 2KFFA 3TUYB 1J7PA 1LVCD 3CGAA 3CS1A 3KHEA 2E30A 4PE0A 2QACA 5I2LA 5TNCA 3D0YB 2JRFA 2LVIA 3SG7A 3EK4A 1SCMB 5CPVA 4I5JA 2PASA 4MLWA 1Y1AA 4PHMA 2FOTA 3QRXA 1CDLA 4HRHA 1B8LA 1MXLC 2G2BA 4R1EA 1NX0A 2MAZA 2PVBA 3DF0B 3EK8A 5HLOA 1J55A 3DVEA 4P2YB 3ZWHA 2M9GA 2LLUA 1XYDA 1XFYO 1IG5A 4ETOA 2KGBC 3PLFB 4MN0A 2F2OA 4MRXA 1S1EA 3GOFA 5D69A 1Y6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTZ A;  3A4U B;  1J7R A;  1KK8 B;  3BOW A;  2KSP A;  4ORC B;  2BBM A;  2H2K A;  3SIB A;  2WC8 A;  1N0Y A;  1M46 A;  1FI6 A;  2LP2 A;  2WCE A;  1YRT B;  1RWY A;  1J1E A;  1K9P A;  3IQQ A;  3KO0 A;  1YRU B;  5F6T A;  2KDH A;  4I5K A;  1EL4 A;  3FWB A;  2KGR A;  2LVV A;  3FIA A;  3OB1 B;  2I7A A;  2CBL A;  1CFC A;  2K2F A;  2H61 A;  3DD4 A;  2KNE A;  3WXA A;  1PVB A;  1XFW O;  4PCW A;  1ZMZ A;  1Y1U A;  3SG6 A;  5J3X A;  1S6I A;  2M8U A;  1XVJ A;  1QX2 A;  2F3Z A;  1AHR A;  1SW8 A;  2L0P A;  1F54 A;  2PRU A;  2AUC A;  1B8R A;  1JFJ A;  4UPG A;  2F3Y A;  2JWW A;  2V53 A;  4MSP A;  4DUQ A;  1ODB A;  3KPX A;  1PK0 D;  2M97 A;  2SAS A;  3AAK A;  1F4Q A;  3SG2 A;  1WLM A;  3NXA A;  3BQ3 A;  2B1U A;  1KFU L;  2EC6 B;  1W7J B;  2KI6 D;  4M2P A;  4HSZ A;  4DCK A;  2Y1M A;  1M63 B;  1XFV O;  2KQY A;  4MZL A;  2MHH A;  1U5I B;  4F0Z B;  3A8R A;  3I5G C;  1AK8 A;  3PSR A;  2GV5 A;  2ZND A;  4JWQ A;  1K2H A;  1EXR A;  1YX8 A;  1CDN A;  2MLF C;  2JT8 A;  1M39 A;  4DIR A;  4OKH A;  3SG5 A;  3BUN B;  3OX6 A;  1J7O A;  1C07 A;  2LMT A;  1CLB A;  1S36 A;  1K96 A;  2ZFD A;  4OCI A;  4YGE B;  5JOL A;  2LMV A;  5CSJ A;  4OR9 B;  1S5G Z;  4CPV A;  1DMO A;  1SBJ A;  4BY5 A;  1ALW A;  1SL9 A;  1YUR A;  3I5G B;  1M45 A;  1QXP A;  1FI5 A;  4YGB B;  1TNW A;  1KQM C;  1F8H A;  4ORA B;  1SK6 D;  4PHK A;  1H8B A;  1J7Q A;  1IJ6 A;  3DVM A;  1SYM A;  2F2P A;  1EG3 A;  1BR4 B;  3KF9 A;  1AUI B;  1G4Y R;  2JTT A;  2JXL A;  2M7N A;  1GGZ A;  1K90 D;  2BEC A;  1LXF C;  3LK1 A;  4M2O A;  1CFD A;  1AJ4 A;  1NP8 A;  2LLS A;  1S6C A;  1SCM C;  3CTN A;  5G08 A;  5I8N A;  1UWO A;  1CDM A;  1Y1X A;  3CR5 X;  1CFF A;  3M0W A;  1ZFS A;  1BU3 A;  1DJH A;  4YGD B;  1HT9 A;  1MF8 B;  2BE4 A;  1NCY A;  4WQ2 A;  1QX7 A;  2CXJ A;  3OP0 A;  1KQM B;  1KK7 Y;  2Q4U A;  4MRY A;  1QV1 A;  2KI6 C;  1KFX S;  1OQP A;  4I5N B;  2LE9 B;  2CTN A;  2JPT A;  1PRW A;  4MEW A;  1CM1 A;  1OMV A;  1QAT A;  1QTX A;  2AMI A;  2E6W A;  2K7D A;  2LV7 A;  3TS5 C;  1CNP A;  3GK2 A;  2F8P A;  2KBM A;  1DF0 B;  1VRK A;  5DKN A;  2KYC A;  3NSI A;  1YTZ C;  4PE4 A;  4GGN A;  1A2X A;  2K7B A;  1WLZ A;  1AVS A;  3EKH A;  3NSO A;  5DKQ A;  4QJ5 B;  1V1G A;  1KK8 C;  1QIW A;  1SKT A;  1LA3 A;  1OSA A;  3D10 A;  1XO5 A;  1IWQ A;  2K8M B;  3PM8 A;  1UHI A;  2JU0 A;  1Y0V H;  1UHJ A;  3I5F C;  1NX2 A;  1C7W A;  3IQO A;  3LLE A;  1PSB A;  1BOD A;  1JWD A;  1JF2 A;  4AOM A;  1BOC A;  1EH2 A;  3TS5 B;  1PSR A;  1K93 D;  3FS7 A;  4AQI A;  1SR6 C;  2KQ6 A;  2BCB A;  5CSF A;  4ZCV A;  4ICB A;  2KYF A;  1RFJ A;  4YI9 A;  2OS8 C;  3DVK A;  3OHM B;  5AER A;  3KEV A;  2KI4 C;  1OE9 B;  4A4C A;  1MWN A;  3LL8 B;  2LMU A;  1QV0 A;  1PAL A;  2LAN A;  2Y1N A;  3IF7 A;  1JSA A;  3WNX B;  2JT3 A;  1TRF A;  4XJK A;  1YVH A;  5FYX A;  3VRR A;  1IGV A;  3I5F B;  2LUX A;  4FTG A;  1R2U A;  1H4B A;  1BJF A;  2ZNE A;  1XA5 A;  1NUB A;  3VRQ A;  4P5O E;  4D1E A;  3AKB A;  5PAL A;  1REC A;  1PUL A;  1SR6 B;  2NCO A;  4PHJ A;  3I5I C;  4GGF A;  2EC6 C;  1F70 A;  1YUS A;  2COL B;  1C7V A;  2K7O A;  3O78 A;  2OS8 B;  3TZ1 A;  2Y5I A;  1A29 A;  5I2Q A;  5HKW A;  4XYN A;  2KI4 B;  2K7C A;  1RJV A;  1UHH A;  3VRP A;  2A4J A;  4HRG A;  5BPJ A;  1SCV A;  2ZRS A;  1N2D A;  2EGD A;  2LVJ A;  2HF5 A;  2H61 C;  1TOP A;  2M0R A;  3SG4 A;  3EVR A;  3BOW B;  1WRZ A;  2WCF A;  1NSH A;  2BL0 C;  2BCA A;  3I5I B;  1IQ5 A;  5AEQ A;  1QVI Y;  1B7T Z;  2OPO A;  4HRE E;  1JFK A;  4C0J A;  2KAV A;  2WCB A;  1UHN A;  1NYA A;  2LM5 A;  2QPT A;  1QS7 A;  5K89 A;  1YR5 A;  2RGI A;  3EVV A;  3VGO A;  4CFR A;  4E68 A;  3DVJ A;  1IJ5 A;  5B8I B;  1WY9 A;  2AAO A;  1DT7 B;  2L98 A;  2L4H A;  3BUX B;  3O2P A;  1YVL A;  1KSO A;  4M2Q A;  2L51 A;  3VRO A;  1A75 B;  2BL0 B;  4CFQ A;  4N5X A;  3BUO B;  1FF1 A;  1QLK A;  1XFZ O;  2LVK A;  3E3R A;  1CMF A;  1F4O A;  5AXI A;  1MQ1 A;  2L4I A;  1RTP 1;  2K61 A;  2NCP A;  2O60 A;  3WHT B;  5AAN A;  1DJZ A;  2FJU B;  2BCX A;  1CLL A;  1X02 A;  4PAL A;  4U8D A;  4YGA A;  1SL8 A;  1NWD A;  1KQV A;  1K8U A;  1OMR A;  1CFP A;  2JT0 A;  3EVU A;  2R2I A;  2L50 A;  3HCM A;  1G8I A;  1WRK A;  1XFX O;  1YUT A;  4YBH B;  4WRI A;  4BY4 A;  1CB1 A;  1KSM A;  3HX4 A;  3LK0 A;  2JC2 A;  2MA2 A;  1CMG A;  1QX5 B;  3AAJ A;  1F55 A;  1IKU A;  1UHK A;  1DJX A;  1KFX L;  1Q80 A;  1KCY A;  1DJG A;  1DVI A;  1S5G Y;  1K9K A;  3D0Y A;  1DJY A;  3CWG A;  2LNK A;  5DKR A;  3RLZ A;  4QJ3 B;  2BBN A;  3EKJ A;  4JQ0 D;  1TN4 A;  3BUW B;  1DGU A;  2HPS A;  3EK7 A;  2I94 A;  1LA0 A;  1F71 A;  3DF0 A;  1FW4 A;  1XK4 C;  3ICB A;  3H4S E;  5HYD A;  2CCM A;  2JNF A;  1E8A A;  1BLQ A;  2SCP A;  1IH0 A;  3PFV A;  2NLN A;  4NDB A;  3LCP C;  4GFT A;  1DJW A;  2K0J A;  1SL7 A;  2PMY A;  3PN7 B;  4JPZ B;  3TDU A;  1NCX A;  2BKI B;  1TCF A;  4YI8 A;  1MHO A;  5D7F A;  1S6J A;  4CLN A;  2IS9 A;  2K2A A;  1SPY A;  1J1D A;  1SNL A;  1UUS A;  3I5H C;  1BG1 A;  1S26 D;  2I2R E;  3NSL A;  3FWC A;  1MR8 A;  2KOT A;  3VRN A;  1FPW A;  1S3P A;  2HET A;  3BXK A;  3MSE B;  2ZRT A;  5HKZ A;  1TCO B;  1CLM A;  1CKK A;  4ZCU A;  1W7I B;  2I18 A;  2Q91 A;  4QJ4 B;  1BF5 A;  1SMG A;  2VRG A;  1JC2 A;  1YX7 A;  5CSN A;  5KTY A;  1K9U A;  4PE7 A;  3GK1 A;  4GPL B;  1B8C A;  2JQ6 A;  2EHB A;  1QJT A;  2ZKM X;  1JUO A;  2O5G A;  3I5H B;  3CZT X;  4MVF A;  2OTG C;  1TNX A;  1GGW A;  1DJI A;  2HQ8 A;  3C1V A;  1ZOT B;  4GAO A;  4I5L B;  1GJY A;  1TTX A;  1ZAC A;  3RM1 A;  1A03 A;  2M3W A;  3CR2 A;  3GK4 X;  1OMD A;  4IL1 A;  1N65 A;  4OV2 A;  2JUL A;  2KAY A;  1LKJ A;  1OZS A;  3O6B A;  2D8N A;  5I2O A;  1RK9 A;  4GBA A;  2M49 B;  2WOS A;  4MBE A;  2MBX A;  3PAL A;  2GGM A;  4GGF C;  2MRD A;  3OX5 A;  3JVT C;  1TNQ A;  1AJ5 A;  1KWO C;  1NX1 A;  5KU1 A;  2M1U A;  1YUU A;  4GUK A;  1JBA A;  1U5I A;  1QVI Z;  1IRJ A;  1LIN A;  1B1G A;  1L2O C;  2OTG B;  4TNC A;  1R6P A;  2JNX A;  2G9B A;  2LUC A;  2MJW B;  4XJK B;  1OZO A;  4YRU A;  1IQ3 A;  2L5X B;  4C0L A;  2ZN9 A;  3O4Y A;  3TDI A;  2KHN A;  1NCZ A;  3ZNI A;  2WND A;  1BR1 B;  2KBI A;  1XFU O;  1QAS A;  1A75 A;  2JOJ A;  2HQW A;  2TN4 A;  1EJ3 A;  5CSI A;  5HKY A;  5IBW A;  1GQM A;  3CR4 X;  3JVT B;  2P6B B;  4NDD A;  1KWO B;  2FCE A;  4GNK B;  3TDZ A;  5KSZ A;  2PAL A;  1L7Z A;  2GGZ A;  2MLE C;  1TIZ A;  1L2O B;  3OB2 B;  4A4B A;  1JF0 A;  2LP3 A;  5ER4 X;  2ISD A;  3CLN A;  2M7L A;  1CM4 A;  4NDC A;  3AKA A;  1CTR A;  1RRO A;  1SRA A;  4MZJ A;  4YGC B;  3SIA A;  1KFU S;  1B4C A;  2LHL A;  4ORB B;  2CNP A;  2ZN8 A;  4CID A;  1B7T Y;  1D1O A;  1B47 A;  1AP4 A;  1MUX A;  1TNP A;  4MZK A;  4NQG A;  2LAP A;  2KFG A;  2M1K B;  1WDC C;  2LCP A;  2WOR A;  5HLV A;  1QIV A;  1BT6 A;  4DRW A;  1ZUZ A;  2NXQ A;  4Q04 A;  1NIW A;  1EG4 A;  4N1G A;  1G33 A;  2JXC A;  1A4P A;  1M31 A;  3F45 A;  2M29 A;  4PE1 A;  4C0K A;  3PAT A;  1OOJ A;  1K94 A;  1KK7 Z;  4L9M A;  2BKH B;  1SY9 A;  3JTD C;  1QLS A;  3K21 A;  3SJS A;  4USL A;  1DF0 A;  3WHU B;  4PHN A;  3PN7 C;  4AQJ A;  2NZ0 A;  4OVN F;  5AFP A;  2KAX A;  3SG3 A;  3TUY C;  5JJG A;  2L2E A;  1WDC B;  1BMO A;  4N1F A;  3BYA A;  1WRL A;  2DOQ A;  4PDZ A;  2LHI A;  1HQV A;  5GQQ C;  3BUM B;  1V1F A;  2FCD A;  2JZI A;  2PSR A;  2Y4Q A;  4DS7 A;  1DTL A;  4FQO A;  2F33 A;  1NX3 A;  1FBV A;  2KFH A;  2LC5 A;  3JTD B;  2CT9 A;  1ALV A;  1UUR A;  5ER5 A;  2LLT A;  1DGV A;  1PVA A;  1CDP A;  1B9A A;  4WQ3 A;  1XK4 A;  1MXE A;  2BE6 A;  1NPQ A;  1UP5 A;  1K95 A;  3NSK A;  2KFF A;  3TUY B;  1J7P A;  1LVC D;  3CGA A;  3CS1 A;  3KHE A;  2E30 A;  4PE0 A;  2QAC A;  5I2L A;  5TNC A;  3D0Y B;  2JRF A;  2LVI A;  3SG7 A;  3EK4 A;  1SCM B;  5CPV A;  4I5J A;  2PAS A;  4MLW A;  1Y1A A;  4PHM A;  2FOT A;  3QRX A;  1CDL A;  4HRH A;  1B8L A;  1MXL C;  2G2B A;  4R1E A;  1NX0 A;  2MAZ A;  2PVB A;  3DF0 B;  3EK8 A;  5HLO A;  1J55 A;  3DVE A;  4P2Y B;  3ZWH A;  2M9G A;  2LLU A;  1XYD A;  1XFY O;  1IG5 A;  4ETO A;  2KGB C;  3PLF B;  4MN0 A;  2F2O A;  4MRX A;  1S1E A;  3GOF A;  5D69 A;  1Y6W A; 
#chains in the Genus database with same CATH topology
 2JTZ A;  3R72 A;  3A4U B;  1J7R A;  1KK8 B;  3BOW A;  2KSP A;  4ORC B;  2BBM A;  2H2K A;  3SIB A;  2WC8 A;  2KPH A;  3S0A A;  2QEB A;  1N0Y A;  1M46 A;  1FI6 A;  3NHI A;  2LP2 A;  2WCE A;  1YRT B;  1RWY A;  1J1E A;  1K9P A;  3IQQ A;  3KO0 A;  5D3O A;  1YRU B;  5F6T A;  2KDH A;  4I5K A;  1EL4 A;  3FWB A;  2KGR A;  3D75 A;  2ERB A;  2LVV A;  3FIA A;  3OB1 B;  2I7A A;  2CBL A;  1CFC A;  2K2F A;  2H61 A;  3DD4 A;  2KNE A;  3WXA A;  1PVB A;  1XFW O;  4PCW A;  1ZMZ A;  1Y1U A;  3SG6 A;  5J3X A;  1S6I A;  2M8U A;  1XVJ A;  1QX2 A;  2F3Z A;  1AHR A;  1SW8 A;  2L0P A;  3CDN A;  1F54 A;  2PRU A;  2AUC A;  2KLD A;  1B8R A;  1JFJ A;  4UPG A;  2F3Y A;  3V2L A;  2JWW A;  2V53 A;  4MSP A;  4DUQ A;  1ODB A;  3KPX A;  1PK0 D;  2M97 A;  2SAS A;  3AAK A;  1F4Q A;  2WCL A;  3SG2 A;  3SS5 A;  1WLM A;  3NXA A;  3BQ3 A;  2B1U A;  1KFU L;  2EC6 B;  1W7J B;  2KI6 D;  4M2P A;  4HSZ A;  4DCK A;  2Y1M A;  1M63 B;  1SSE B;  1XFV O;  1DEL A;  2KQY A;  2BAP A;  2MHH A;  3FE9 A;  4MZL A;  3S0G A;  1U5I B;  4F0Z B;  3A8R A;  3I5G C;  1AK8 A;  3PSR A;  2GV5 A;  2ZND A;  4JWQ A;  1K2H A;  1EXR A;  1YX8 A;  1CDN A;  2MLF C;  2JT8 A;  1M39 A;  4DIR A;  4OKH A;  3SG5 A;  3BUN B;  3OX6 A;  3CAB A;  1J7O A;  1C07 A;  2LMT A;  1CLB A;  1S36 A;  1K96 A;  2ZFD A;  4OCI A;  4YGE B;  5JOL A;  2LMV A;  5CSJ A;  4OR9 B;  1S5G Z;  4CPV A;  1DMO A;  1SBJ A;  4BY5 A;  1ALW A;  1SL9 A;  3B86 A;  1YUR A;  3I5G B;  3SS4 A;  1M45 A;  1QXP A;  1FI5 A;  4YGB B;  3S0D A;  1TNW A;  1KQM C;  1F8H A;  4ORA B;  1SK6 D;  4PHK A;  1H8B A;  1J7Q A;  1IJ6 A;  3DVM A;  1SYM A;  2F2P A;  1EG3 A;  1BR4 B;  3KF9 A;  1AUI B;  1G4Y R;  2JTT A;  2JXL A;  2M7N A;  1GGZ A;  1K90 D;  2BEC A;  1LXF C;  3LK1 A;  4M2O A;  1CFD A;  1AJ4 A;  1NP8 A;  2LLS A;  1S6C A;  1SCM C;  3CTN A;  4JD9 A;  5G08 A;  5I8N A;  1UWO A;  1CDM A;  1Y1X A;  3CR5 X;  1CFF A;  3M0W A;  1ZFS A;  1BU3 A;  1DJH A;  4YGD B;  1HT9 A;  1MF8 B;  1QWV A;  1NCY A;  2BE4 A;  4WQ2 A;  1QX7 A;  1Z4H A;  2CXJ A;  3OP0 A;  1KQM B;  1KK7 Y;  2Q4U A;  4MRY A;  1QV1 A;  2KI6 C;  1KFX S;  1OQP A;  4I5N B;  2LE9 B;  2CTN A;  2JPT A;  1PRW A;  4MEW A;  1CM1 A;  1OMV A;  3DY9 A;  3DYE A;  1QAT A;  5EL2 A;  1QTX A;  2AMI A;  2E6W A;  2K7D A;  2LV7 A;  3TS5 C;  1CNP A;  3GK2 A;  2F8P A;  2KBM A;  1DF0 B;  1VRK A;  5DKN A;  2KYC A;  3NSI A;  1YTZ C;  4PE4 A;  4GGN A;  1A2X A;  2K7B A;  1WLZ A;  1AVS A;  3EKH A;  3NSO A;  3DZT A;  5DKQ A;  4QJ5 B;  1V1G A;  1OW4 A;  1KK8 C;  1QIW A;  2BNX A;  1SKT A;  1LA3 A;  1OSA A;  3D10 A;  1OOF A;  1XO5 A;  1IWQ A;  2K8M B;  3N7H A;  3PM8 A;  1UHI A;  2JU0 A;  1Y0V H;  3FE6 A;  1UHJ A;  3I5F C;  1NX2 A;  1C7W A;  3IQO A;  3LLE A;  5FI6 A;  3UO9 A;  2WCH A;  1PSB A;  1BOD A;  1JWD A;  1C3Z A;  1JF2 A;  4AOM A;  1BOC A;  1EH2 A;  3TS5 B;  1PSR A;  1K93 D;  2WC6 A;  3FS7 A;  1SR6 C;  4AQI A;  2KQ6 A;  2BCB A;  5CSF A;  4ZCV A;  4ICB A;  2KYF A;  1RFJ A;  3IVT A;  4YI9 A;  2OS8 C;  3DVK A;  3OHM B;  1Z2C B;  3KEV A;  5AER A;  2KI4 C;  1OE9 B;  4A4C A;  1MWN A;  3LL8 B;  2LMU A;  1QV0 A;  1PAL A;  2LAN A;  2Y1N A;  3IF7 A;  1JSA A;  3WNX B;  2JT3 A;  1TRF A;  3D76 A;  4XJK A;  1YVH A;  5FYX A;  3VRR A;  1IGV A;  3I5F B;  2LUX A;  4FTG A;  3D74 A;  1R2U A;  1H4B A;  1BJF A;  2ZNE A;  1XA5 A;  1NUB A;  3VRQ A;  4P5O E;  4D1E A;  3AKB A;  5PAL A;  1REC A;  1PUL A;  1SR6 B;  2NCO A;  3CZ0 A;  4PHJ A;  3I5I C;  4GGF A;  1OOH A;  2L2C A;  2EC6 C;  1F70 A;  1YUS A;  2COL B;  1C7V A;  2K7O A;  3O78 A;  2OS8 B;  3TZ1 A;  2Y5I A;  1A29 A;  5I2Q A;  5HKW A;  4XYN A;  2KI4 B;  3B7A A;  2K7C A;  1RJV A;  1UHH A;  3VRP A;  2A4J A;  4HRG A;  1OOG A;  5BPJ A;  1SCV A;  2ZRS A;  1N2D A;  2EGD A;  2LVJ A;  2HF5 A;  2H61 C;  1TOP A;  2M0R A;  3R1P A;  3SG4 A;  3EVR A;  3BOW B;  1WRZ A;  2WCF A;  1NSH A;  2BL0 C;  3S0B A;  2BCA A;  3I5I B;  1IQ5 A;  5AEQ A;  1QVI Y;  1B7T Z;  3FE8 A;  2OPO A;  4HRE E;  1JFK A;  4C0J A;  3SS3 A;  3PM2 A;  2KAV A;  2WCB A;  1DQE A;  1UHN A;  1NYA A;  2LM5 A;  2QPT A;  1QS7 A;  2WCJ A;  4F7F A;  1YR5 A;  2RGI A;  3NHT A;  3EVV A;  3VGO A;  4CFR A;  5K89 A;  3DVJ A;  3RZS A;  4E68 A;  1IJ5 A;  2WCM A;  5B8I B;  1WY9 A;  2AAO A;  1DT7 B;  2L98 A;  2L4H A;  3BUX B;  3O2P A;  1YVL A;  1KSO A;  4M2Q A;  2L51 A;  3VRO A;  1A75 B;  2BL0 B;  4CFQ A;  4N5X A;  3BUO B;  1FF1 A;  1QLK A;  1XFZ O;  2LVK A;  3E3R A;  1CMF A;  1F4O A;  5AXI A;  1MQ1 A;  2L4I A;  1RTP 1;  2K61 A;  2NCP A;  2QEO A;  2O60 A;  3WHT B;  5AAN A;  1TWO A;  1DJZ A;  2FJY A;  2FJU B;  2BCX A;  1CLL A;  4KYN A;  1X02 A;  4PAL A;  4U8D A;  4YGA A;  3O4X A;  1SL8 A;  1NWD A;  1KQV A;  1K8U A;  1OMR A;  1CFP A;  2KLE A;  2JT0 A;  4IJ7 A;  3L47 A;  3EVU A;  2R2I A;  2L50 A;  3HCM A;  4PT1 A;  1G8I A;  1WRK A;  1XFX O;  3CZ2 A;  1YUT A;  4YBH B;  4WRI A;  4BY4 A;  2QEH A;  1CB1 A;  1KSM A;  3HX4 A;  3LK0 A;  2JC2 A;  2MA2 A;  1CMG A;  1QX5 B;  3AAJ A;  1F55 A;  3VB1 A;  1IKU A;  1ORG A;  1UHK A;  1DJX A;  1KFX L;  1Q80 A;  1KCY A;  1DJG A;  1DVI A;  1S5G Y;  3PJI A;  1K9K A;  3D0Y A;  1DJY A;  3D73 A;  3CWG A;  2LNK A;  3B6X A;  5DKR A;  4QJ3 B;  2BBN A;  3RLZ A;  1IIO A;  3EKJ A;  4JQ0 D;  4INW A;  1TN4 A;  3BUW B;  1DGU A;  2HPS A;  3EK7 A;  2I94 A;  1LA0 A;  1F71 A;  3DF0 A;  1FW4 A;  1XK4 C;  3ICB A;  3H4S E;  1LS8 A;  5HL1 A;  5HYD A;  2CCM A;  2JNF A;  1E8A A;  1BLQ A;  2SCP A;  2P71 A;  1IH0 A;  3PFV A;  2NLN A;  1GM0 A;  4NDB A;  3LCP C;  4GFT A;  1DJW A;  2K0J A;  1SL7 A;  2PMY A;  3PN7 B;  4JPZ B;  3TDU A;  1NCX A;  2BKI B;  1TCF A;  3NGV A;  4YI8 A;  3EG5 B;  1MHO A;  5D7F A;  1S6J A;  4CLN A;  2GTE A;  2IS9 A;  3BFB A;  3L4A A;  2K2A A;  3UNW A;  1SPY A;  1J1D A;  1SNL A;  1UUS A;  3I5H C;  1BG1 A;  1S26 D;  2I2R E;  3NSL A;  2H8V A;  3FWC A;  1MR8 A;  2KOT A;  3VRN A;  1FPW A;  1S3P A;  2HET A;  3BXK A;  3MSE B;  2PQL A;  2ZRT A;  5HKZ A;  1TCO B;  1CLM A;  1CKK A;  4ZCU A;  1W7I B;  2I18 A;  2Q91 A;  4QJ4 B;  1BF5 A;  1SMG A;  2VRG A;  1JC2 A;  1YX7 A;  5CSN A;  5KTY A;  1K9U A;  3CZ1 A;  4PE7 A;  3GK1 A;  4GPL B;  1B8C A;  2JQ6 A;  2EHB A;  1QJT A;  2ZKM X;  1JUO A;  2O5G A;  3I5H B;  3CZT X;  4MVF A;  2OTG C;  1TNX A;  1GGW A;  1DJI A;  2HQ8 A;  3C1V A;  1ZOT B;  4GAO A;  4I5L B;  1GJY A;  1TTX A;  1ZAC A;  3RM1 A;  1A03 A;  2M3W A;  3CR2 A;  3GK4 X;  1OMD A;  4IL1 A;  1N65 A;  4OV2 A;  2JUL A;  2KAY A;  1LKJ A;  1OZS A;  3O6B A;  2D8N A;  5I2O A;  1RK9 A;  4GBA A;  3BJH A;  2M49 B;  2WOS A;  4MBE A;  5FI7 A;  3PAL A;  2GGM A;  2MBX A;  4GGF C;  2MRD A;  3OX5 A;  3JVT C;  1TNQ A;  1AJ5 A;  1KWO C;  1NX1 A;  5KU1 A;  2M1U A;  1YUU A;  4GUK A;  1JBA A;  1U5I A;  1QVI Z;  1IRJ A;  1LIN A;  1B1G A;  1L2O C;  2OTG B;  4TNC A;  1R6P A;  2JNX A;  2G9B A;  2LUC A;  2MJW B;  4XJK B;  1OZO A;  4YRU A;  1IQ3 A;  2L5X B;  4C0L A;  2ZN9 A;  3O4Y A;  3TDI A;  2KHN A;  1NCZ A;  3ZNI A;  2WND A;  3R1V A;  1BR1 B;  2KBI A;  3S0E A;  1XFU O;  1QAS A;  1A75 A;  5FI2 A;  2JOJ A;  2HQW A;  2TN4 A;  1EJ3 A;  5CSI A;  3OBV A;  5HKY A;  5IBW A;  1GQM A;  3CR4 X;  3JVT B;  2P6B B;  3OGN A;  4NDD A;  1KWO B;  2FCE A;  4GNK B;  3TDZ A;  5KSZ A;  2PAL A;  4JKT A;  1XFR A;  1L7Z A;  2GGZ A;  2MLE C;  1TIZ A;  1L2O B;  3OB2 B;  4A4B A;  1DEK A;  1JF0 A;  2LP3 A;  5ER4 X;  2ISD A;  3CLN A;  2M7L A;  1CM4 A;  1DC1 A;  4NDC A;  3AKA A;  1CTR A;  1RRO A;  1SRA A;  4MZJ A;  4YGC B;  3SIA A;  1KFU S;  3B87 A;  1B4C A;  3B88 A;  2LHL A;  4ORB B;  2CNP A;  2ZN8 A;  4FQT A;  1B7T Y;  4CID A;  1D1O A;  1B47 A;  1AP4 A;  1MUX A;  1TNP A;  4MZK A;  3S0F A;  2QEV A;  2LAP A;  4NQG A;  2KFG A;  2M1K B;  1WDC C;  2LCP A;  2WOR A;  3BFH A;  3BFA A;  5HLV A;  1QIV A;  1BT6 A;  4DRW A;  1ZUZ A;  2NXQ A;  4Q04 A;  1NIW A;  1EG4 A;  4N1G A;  1G33 A;  2JXC A;  1A4P A;  1M31 A;  3F45 A;  2M29 A;  4PE1 A;  4C0K A;  3PAT A;  1OOJ A;  1K94 A;  1KK7 Z;  4L9M A;  2BKH B;  1SY9 A;  3L4L A;  3JTD C;  1QLS A;  3K21 A;  3SJS A;  2WCK A;  4USL A;  1DF0 A;  4OZD A;  3WHU B;  3D78 A;  3PN7 C;  4PHN A;  2NZ0 A;  4OVN F;  4AQJ A;  5AFP A;  2QDI A;  1P28 A;  2KAX A;  3SG3 A;  3TUY C;  1C3Y A;  5JJG A;  2L2E A;  1WDC B;  1BMO A;  4N1F A;  3BYA A;  1WRL A;  2L5Y A;  2DOQ A;  4PDZ A;  2LHI A;  1HQV A;  5GQQ C;  3BUM B;  1V1F A;  2FCD A;  2JZI A;  2PSR A;  2Y4Q A;  4DS7 A;  1DTL A;  4FQO A;  2F33 A;  1NX3 A;  1FBV A;  2KFH A;  2LC5 A;  3JTD B;  2CT9 A;  1ALV A;  1UUR A;  5ER5 A;  2LLT A;  2WC5 A;  1DGV A;  1PVA A;  4INX A;  3CYZ A;  1CDP A;  1B9A A;  4WQ3 A;  1XK4 A;  2K60 A;  1MXE A;  2BE6 A;  1NPQ A;  1UP5 A;  1K95 A;  3K1E A;  2KFF A;  3NSK A;  3TUY B;  1J7P A;  1LVC D;  3CGA A;  3CS1 A;  3KHE A;  5DIC A;  2E30 A;  4PE0 A;  2QAC A;  5I2L A;  2YGU A;  2P70 A;  5TNC A;  3D0Y B;  2JRF A;  2LVI A;  3R1O A;  3SG7 A;  3EK4 A;  1SCM B;  3QME A;  5CPV A;  4I5J A;  2PAS A;  4MLW A;  1T14 A;  1OOI X;  1Y1A A;  4PHM A;  2FOT A;  3QRX A;  1CDL A;  4HRH A;  1B8L A;  1MXL C;  2G2B A;  2JPO A;  1W9Z A;  4R1E A;  1NX0 A;  2MAZ A;  1TUZ A;  2PVB A;  3DF0 B;  3Q8I A;  3EK8 A;  5HLO A;  1J55 A;  3DVE A;  4P2Y B;  3ZWH A;  2M9G A;  2LLU A;  2PYQ A;  1XYD A;  1XFY O;  1IG5 A;  4ETO A;  1TUJ A;  2KGB C;  3DXL A;  5I94 A;  3PLF B;  4MN0 A;  2F2O A;  4MRX A;  1S1E A;  3D77 A;  3GOF A;  5D69 A;  1Y6W A; 
#chains in the Genus database with same CATH homology
 2JTZ A;  3A4U B;  1J7R A;  1KK8 B;  3BOW A;  2KSP A;  4ORC B;  2BBM A;  2H2K A;  3SIB A;  2WC8 A;  1N0Y A;  1M46 A;  1FI6 A;  2LP2 A;  2WCE A;  1YRT B;  1RWY A;  1J1E A;  1K9P A;  3IQQ A;  3KO0 A;  1YRU B;  5F6T A;  2KDH A;  4I5K A;  1EL4 A;  3FWB A;  2KGR A;  2LVV A;  3FIA A;  3OB1 B;  2I7A A;  2CBL A;  1CFC A;  2K2F A;  2H61 A;  3DD4 A;  2KNE A;  3WXA A;  1PVB A;  1XFW O;  4PCW A;  1ZMZ A;  1Y1U A;  3SG6 A;  5J3X A;  1S6I A;  2M8U A;  1XVJ A;  1QX2 A;  2F3Z A;  1AHR A;  1SW8 A;  2L0P A;  1F54 A;  2PRU A;  2AUC A;  1B8R A;  1JFJ A;  4UPG A;  2F3Y A;  2JWW A;  2V53 A;  4MSP A;  4DUQ A;  1ODB A;  3KPX A;  1PK0 D;  2M97 A;  2SAS A;  3AAK A;  1F4Q A;  3SG2 A;  1WLM A;  3NXA A;  3BQ3 A;  2B1U A;  1KFU L;  2EC6 B;  1W7J B;  2KI6 D;  4M2P A;  4HSZ A;  4DCK A;  2Y1M A;  1M63 B;  1XFV O;  2KQY A;  4MZL A;  2MHH A;  1U5I B;  4F0Z B;  3A8R A;  3I5G C;  1AK8 A;  3PSR A;  2GV5 A;  2ZND A;  4JWQ A;  1K2H A;  1EXR A;  1YX8 A;  1CDN A;  2MLF C;  2JT8 A;  1M39 A;  4DIR A;  4OKH A;  3SG5 A;  3BUN B;  3OX6 A;  1J7O A;  1C07 A;  2LMT A;  1CLB A;  1S36 A;  1K96 A;  2ZFD A;  4OCI A;  4YGE B;  5JOL A;  2LMV A;  5CSJ A;  4OR9 B;  1S5G Z;  4CPV A;  1DMO A;  1SBJ A;  4BY5 A;  1ALW A;  1SL9 A;  1YUR A;  3I5G B;  1M45 A;  1QXP A;  1FI5 A;  4YGB B;  1TNW A;  1KQM C;  1F8H A;  4ORA B;  1SK6 D;  4PHK A;  1H8B A;  1J7Q A;  1IJ6 A;  3DVM A;  1SYM A;  2F2P A;  1EG3 A;  1BR4 B;  3KF9 A;  1AUI B;  1G4Y R;  2JTT A;  2JXL A;  2M7N A;  1GGZ A;  1K90 D;  2BEC A;  1LXF C;  3LK1 A;  4M2O A;  1CFD A;  1AJ4 A;  1NP8 A;  2LLS A;  1S6C A;  1SCM C;  3CTN A;  5G08 A;  5I8N A;  1UWO A;  1CDM A;  1Y1X A;  3CR5 X;  1CFF A;  3M0W A;  1ZFS A;  1BU3 A;  1DJH A;  4YGD B;  1HT9 A;  1MF8 B;  2BE4 A;  1NCY A;  4WQ2 A;  1QX7 A;  2CXJ A;  3OP0 A;  1KQM B;  1KK7 Y;  2Q4U A;  4MRY A;  1QV1 A;  2KI6 C;  1KFX S;  1OQP A;  4I5N B;  2LE9 B;  2CTN A;  2JPT A;  1PRW A;  4MEW A;  1CM1 A;  1OMV A;  1QAT A;  1QTX A;  2AMI A;  2E6W A;  2K7D A;  2LV7 A;  3TS5 C;  1CNP A;  3GK2 A;  2F8P A;  2KBM A;  1DF0 B;  1VRK A;  5DKN A;  2KYC A;  3NSI A;  1YTZ C;  4PE4 A;  4GGN A;  1A2X A;  2K7B A;  1WLZ A;  1AVS A;  3EKH A;  3NSO A;  5DKQ A;  4QJ5 B;  1V1G A;  1KK8 C;  1QIW A;  1SKT A;  1LA3 A;  1OSA A;  3D10 A;  1XO5 A;  1IWQ A;  2K8M B;  3PM8 A;  1UHI A;  2JU0 A;  1Y0V H;  1UHJ A;  3I5F C;  1NX2 A;  1C7W A;  3IQO A;  3LLE A;  1PSB A;  1BOD A;  1JWD A;  1JF2 A;  4AOM A;  1BOC A;  1EH2 A;  3TS5 B;  1PSR A;  1K93 D;  3FS7 A;  4AQI A;  1SR6 C;  2KQ6 A;  2BCB A;  5CSF A;  4ZCV A;  4ICB A;  2KYF A;  1RFJ A;  4YI9 A;  2OS8 C;  3DVK A;  3OHM B;  5AER A;  3KEV A;  2KI4 C;  1OE9 B;  4A4C A;  1MWN A;  3LL8 B;  2LMU A;  1QV0 A;  1PAL A;  2LAN A;  2Y1N A;  3IF7 A;  1JSA A;  3WNX B;  2JT3 A;  1TRF A;  4XJK A;  1YVH A;  5FYX A;  3VRR A;  1IGV A;  3I5F B;  2LUX A;  4FTG A;  1R2U A;  1H4B A;  1BJF A;  2ZNE A;  1XA5 A;  1NUB A;  3VRQ A;  4P5O E;  4D1E A;  3AKB A;  5PAL A;  1REC A;  1PUL A;  1SR6 B;  2NCO A;  4PHJ A;  3I5I C;  4GGF A;  2EC6 C;  1F70 A;  1YUS A;  2COL B;  1C7V A;  2K7O A;  3O78 A;  2OS8 B;  3TZ1 A;  2Y5I A;  1A29 A;  5I2Q A;  5HKW A;  4XYN A;  2KI4 B;  2K7C A;  1RJV A;  1UHH A;  3VRP A;  2A4J A;  4HRG A;  5BPJ A;  1SCV A;  2ZRS A;  1N2D A;  2EGD A;  2LVJ A;  2HF5 A;  2H61 C;  1TOP A;  2M0R A;  3SG4 A;  3EVR A;  3BOW B;  1WRZ A;  2WCF A;  1NSH A;  2BL0 C;  2BCA A;  3I5I B;  1IQ5 A;  5AEQ A;  1QVI Y;  1B7T Z;  2OPO A;  4HRE E;  1JFK A;  4C0J A;  2KAV A;  2WCB A;  1UHN A;  1NYA A;  2LM5 A;  2QPT A;  1QS7 A;  5K89 A;  1YR5 A;  2RGI A;  3EVV A;  3VGO A;  4CFR A;  4E68 A;  3DVJ A;  1IJ5 A;  5B8I B;  1WY9 A;  2AAO A;  1DT7 B;  2L98 A;  2L4H A;  3BUX B;  3O2P A;  1YVL A;  1KSO A;  4M2Q A;  2L51 A;  3VRO A;  1A75 B;  2BL0 B;  4CFQ A;  4N5X A;  3BUO B;  1FF1 A;  1QLK A;  1XFZ O;  2LVK A;  3E3R A;  1CMF A;  1F4O A;  5AXI A;  1MQ1 A;  2L4I A;  1RTP 1;  2K61 A;  2NCP A;  2O60 A;  3WHT B;  5AAN A;  1DJZ A;  2FJU B;  2BCX A;  1CLL A;  1X02 A;  4PAL A;  4U8D A;  4YGA A;  1SL8 A;  1NWD A;  1KQV A;  1K8U A;  1OMR A;  1CFP A;  2JT0 A;  3EVU A;  2R2I A;  2L50 A;  3HCM A;  1G8I A;  1WRK A;  1XFX O;  1YUT A;  4YBH B;  4WRI A;  4BY4 A;  1CB1 A;  1KSM A;  3HX4 A;  3LK0 A;  2JC2 A;  2MA2 A;  1CMG A;  1QX5 B;  3AAJ A;  1F55 A;  1IKU A;  1UHK A;  1DJX A;  1KFX L;  1Q80 A;  1KCY A;  1DJG A;  1DVI A;  1S5G Y;  1K9K A;  3D0Y A;  1DJY A;  3CWG A;  2LNK A;  5DKR A;  3RLZ A;  4QJ3 B;  2BBN A;  3EKJ A;  4JQ0 D;  1TN4 A;  3BUW B;  1DGU A;  2HPS A;  3EK7 A;  2I94 A;  1LA0 A;  1F71 A;  3DF0 A;  1FW4 A;  1XK4 C;  3ICB A;  3H4S E;  5HYD A;  2CCM A;  2JNF A;  1E8A A;  1BLQ A;  2SCP A;  1IH0 A;  3PFV A;  2NLN A;  4NDB A;  3LCP C;  4GFT A;  1DJW A;  2K0J A;  1SL7 A;  2PMY A;  3PN7 B;  4JPZ B;  3TDU A;  1NCX A;  2BKI B;  1TCF A;  4YI8 A;  1MHO A;  5D7F A;  1S6J A;  4CLN A;  2IS9 A;  2K2A A;  1SPY A;  1J1D A;  1SNL A;  1UUS A;  3I5H C;  1BG1 A;  1S26 D;  2I2R E;  3NSL A;  3FWC A;  1MR8 A;  2KOT A;  3VRN A;  1FPW A;  1S3P A;  2HET A;  3BXK A;  3MSE B;  2ZRT A;  5HKZ A;  1TCO B;  1CLM A;  1CKK A;  4ZCU A;  1W7I B;  2I18 A;  2Q91 A;  4QJ4 B;  1BF5 A;  1SMG A;  2VRG A;  1JC2 A;  1YX7 A;  5CSN A;  5KTY A;  1K9U A;  4PE7 A;  3GK1 A;  4GPL B;  1B8C A;  2JQ6 A;  2EHB A;  1QJT A;  2ZKM X;  1JUO A;  2O5G A;  3I5H B;  3CZT X;  4MVF A;  2OTG C;  1TNX A;  1GGW A;  1DJI A;  2HQ8 A;  3C1V A;  1ZOT B;  4GAO A;  4I5L B;  1GJY A;  1TTX A;  1ZAC A;  3RM1 A;  1A03 A;  2M3W A;  3CR2 A;  3GK4 X;  1OMD A;  4IL1 A;  1N65 A;  4OV2 A;  2JUL A;  2KAY A;  1LKJ A;  1OZS A;  3O6B A;  2D8N A;  5I2O A;  1RK9 A;  4GBA A;  2M49 B;  2WOS A;  4MBE A;  2MBX A;  3PAL A;  2GGM A;  4GGF C;  2MRD A;  3OX5 A;  3JVT C;  1TNQ A;  1AJ5 A;  1KWO C;  1NX1 A;  5KU1 A;  2M1U A;  1YUU A;  4GUK A;  1JBA A;  1U5I A;  1QVI Z;  1IRJ A;  1LIN A;  1B1G A;  1L2O C;  2OTG B;  4TNC A;  1R6P A;  2JNX A;  2G9B A;  2LUC A;  2MJW B;  4XJK B;  1OZO A;  4YRU A;  1IQ3 A;  2L5X B;  4C0L A;  2ZN9 A;  3O4Y A;  3TDI A;  2KHN A;  1NCZ A;  3ZNI A;  2WND A;  1BR1 B;  2KBI A;  1XFU O;  1QAS A;  1A75 A;  2JOJ A;  2HQW A;  2TN4 A;  1EJ3 A;  5CSI A;  5HKY A;  5IBW A;  1GQM A;  3CR4 X;  3JVT B;  2P6B B;  4NDD A;  1KWO B;  2FCE A;  4GNK B;  3TDZ A;  5KSZ A;  2PAL A;  1L7Z A;  2GGZ A;  2MLE C;  1TIZ A;  1L2O B;  3OB2 B;  4A4B A;  1JF0 A;  2LP3 A;  5ER4 X;  2ISD A;  3CLN A;  2M7L A;  1CM4 A;  4NDC A;  3AKA A;  1CTR A;  1RRO A;  1SRA A;  4MZJ A;  4YGC B;  3SIA A;  1KFU S;  1B4C A;  2LHL A;  4ORB B;  2CNP A;  2ZN8 A;  4CID A;  1B7T Y;  1D1O A;  1B47 A;  1AP4 A;  1MUX A;  1TNP A;  4MZK A;  4NQG A;  2LAP A;  2KFG A;  2M1K B;  1WDC C;  2LCP A;  2WOR A;  5HLV A;  1QIV A;  1BT6 A;  4DRW A;  1ZUZ A;  2NXQ A;  4Q04 A;  1NIW A;  1EG4 A;  4N1G A;  1G33 A;  2JXC A;  1A4P A;  1M31 A;  3F45 A;  2M29 A;  4PE1 A;  4C0K A;  3PAT A;  1OOJ A;  1K94 A;  1KK7 Z;  4L9M A;  2BKH B;  1SY9 A;  3JTD C;  1QLS A;  3K21 A;  3SJS A;  4USL A;  1DF0 A;  3WHU B;  4PHN A;  3PN7 C;  4AQJ A;  2NZ0 A;  4OVN F;  5AFP A;  2KAX A;  3SG3 A;  3TUY C;  5JJG A;  2L2E A;  1WDC B;  1BMO A;  4N1F A;  3BYA A;  1WRL A;  2DOQ A;  4PDZ A;  2LHI A;  1HQV A;  5GQQ C;  3BUM B;  1V1F A;  2FCD A;  2JZI A;  2PSR A;  2Y4Q A;  4DS7 A;  1DTL A;  4FQO A;  2F33 A;  1NX3 A;  1FBV A;  2KFH A;  2LC5 A;  3JTD B;  2CT9 A;  1ALV A;  1UUR A;  5ER5 A;  2LLT A;  1DGV A;  1PVA A;  1CDP A;  1B9A A;  4WQ3 A;  1XK4 A;  1MXE A;  2BE6 A;  1NPQ A;  1UP5 A;  1K95 A;  3NSK A;  2KFF A;  3TUY B;  1J7P A;  1LVC D;  3CGA A;  3CS1 A;  3KHE A;  2E30 A;  4PE0 A;  2QAC A;  5I2L A;  5TNC A;  3D0Y B;  2JRF A;  2LVI A;  3SG7 A;  3EK4 A;  1SCM B;  5CPV A;  4I5J A;  2PAS A;  4MLW A;  1Y1A A;  4PHM A;  2FOT A;  3QRX A;  1CDL A;  4HRH A;  1B8L A;  1MXL C;  2G2B A;  4R1E A;  1NX0 A;  2MAZ A;  2PVB A;  3DF0 B;  3EK8 A;  5HLO A;  1J55 A;  3DVE A;  4P2Y B;  3ZWH A;  2M9G A;  2LLU A;  1XYD A;  1XFY O;  1IG5 A;  4ETO A;  2KGB C;  3PLF B;  4MN0 A;  2F2O A;  4MRX A;  1S1E A;  3GOF A;  5D69 A;  1Y6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...