3S0BA

Apis mellifera obp14 in complex with the fluorescent probe 1-n-phenylnaphthylamine (npn)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
molecule keywords OBP14
total genus 49
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0bA00
1P28A 2FJYA 3D74A 1OOIX 4FQTA 2WC5A 3B88A 3D78A 2P71A 1T14A 3S0BA 3L4LA 2PQLA 2WCMA 3QMEA 3NHIA 4JD9A 2QEOA 3S0GA 1GM0A 3CDNA 2GTEA 3S0FA 3VB1A 3R1PA 3BFAA 1C3YA 5EL2A 1OOFA 3B7AA 3S0EA 3PJIA 3Q8IA 1XFRA 3B6XA 3D76A 3CABA 3K1EA 3BFHA 3NGVA 4PT1A 3L47A 2QDIA 3CZ1A 3B86A 2QEBA 3DY9A 2WCHA 1QWVA 3RZSA 3CZ0A 2JPOA 3CZ2A 3S0AA 2L2CA 3OGNA 1OW4A 2KPHA 3D73A 4INXA 2H8VA 5DICA 3D75A 2WCJA 3R1OA 2WCKA 3BFBA 1OOGA 3CYZA 4OZDA 3FE9A 2WCLA 1TUJA 3R1VA 4INWA 4F7FA 3DYEA 3S0DA 2P70A 3B87A 2WC6A 2ERBA 3FE6A 3DZTA 1OOHA 2QEVA 1DQEA 3FE8A 3D77A 1LS8A 3BJHA 3DXLA 1ORGA 3L4AA 2QEHA 3NHTA 3V2LA 3R72A 1C3ZA 3N7HA 1TWOA
chains in the Genus database with same CATH superfamily
2KFHA 1P28A 5ER4X 5I2LA 2L98A 2FJYA 1SR6B 2IS9A 2KLDA 4FQTA 1IJ5A 1YURA 1V1FA 4MEWA 1DJXA 1GJYA 1FW4A 1QLKA 2WC5A 3HX4A 5FYXA 3D78A 1CLLA 2EC6B 2P71A 3CR2A 3DVMA 5KSZA 4WQ2A 1NX0A 2PQLA 2WCFA 5K89A 1CFCA 2K2FA 5I8NA 2BCAA 4GAOA 2OTGC 4DS7A 3SG7A 2DOQA 3CLNA 3IF7A 3M0WA 1BR4B 2FJUB 1DJZA 3BQ3A 1F71A 3NSKA 2L51A 2Q91A 4JD9A 2KAXA 2KSPA 1LKJA 3NXAA 1R2UA 2LP2A 3KPXA 2KAYA 1J1DA 3VB1A 1YUTA 2NCOA 3O78A 4IJ7A 1WY9A 2PASA 4Q04A 4C0JA 1YRTB 3C1VA 2LMVA 1ZFSA 2NLNA 1M31A 1K9UA 1U5IB 2K7CA 1U5IA 1UHNA 4UPGA 1NWDA 2I2RE 2Q4UA 4GGFC 5DKQA 1SW8A 1XK4C 2L2EA 3Q8IA 2K60A 1QX7A 1B1GA 1NX2A 2LUXA 1W7JB 2K0JA 3D76A 1MUXA 1OE9B 2F2PA 4NDDA 2PRUA 3PM8A 4WQ3A 1XFXO 4HSZA 2KI4C 2F33A 2KBMA 2L4HA 2PYQA 4NDBA 1J7OA 1NPQA 1RTP1 3B86A 5GQQC 1N65A 1DEKA 1S36A 2PMYA 3DVEA 1TUZA 1TTXA 2KBIA 4AOMA 3RZSA 2BL0B 1KK8C 1XFUO 4WRIA 3CZ2A 4NDCA 1F54A 1WRZA 1KCYA 2L2CA 2L5XB 3EG5B 3SG4A 1OW4A 2KPHA 1S3PA 4GFTA 1UURA 1KSMA 1KQMB 1QJTA 1A75B 3D75A 2WCJA 1YUSA 2Y1NA 1AK8A 2LLTA 4A4CA 3FIAA 2LV7A 4ORCB 4JKTA 1GGWA 2B1UA 1B47A 5HLOA 3VROA 4PALA 1BOCA 3BOWA 2KI4B 2JULA 4D1EA 1BG1A 3ZWHA 2JTTA 5DKRA 3BXKA 2YGUA 4MZJA 4F7FA 2HETA 5HKYA 5HKWA 2AAOA 1JSAA 3QRXA 3EK4A 1QV1A 1SYMA 3S0DA 5AXIA 1IQ3A 1N0YA 1VRKA 1YRUB 2MLEC 4MRXA 1QXPA 1K95A 1A29A 2ZRTA 3OB1B 4ICBA 1A03A 3LK0A 3I5FC 4MZKA 2BBNA 1MXLC 3DZTA 3K21A 5CSJA 3A4UB 3GK4X 2EHBA 3ICBA 1EL4A 3FE8A 2QACA 3D77A 4FTGA 1IRJA 3PN7B 3NSLA 1MQ1A 4M2PA 3TDZA 3HCMA 3LL8B 4DUQA 5I2OA 1MHOA 3BJHA 1ORGA 2L0PA 1C7VA 2BE6A 2BKIB 2QEHA 4MBEA 4AQJA 1ZOTB 1LVCD 5PALA 1QS7A 4QJ4B 1C3ZA 1NYAA 5J3XA 1KWOB 1OMDA 2HF5A 2F3YA 4M2QA 1J55A 1OOIX 3UNWA 1QTXA 1SY9A 2AUCA 2L4IA 1SRAA 5FI7A 1BLQA 1A2XA 3B88A 1XFWO 1IIOA 1CMGA 3I5IB 1XK4A 4YGDB 3VRNA 1UUSA 1ZACA 3BOWB 1XA5A 3OBVA 2H2KA 1KSOA 2K7DA 1DELA 1QX2A 5KU1A 3SJSA 4OKHA 1SL7A 2GV5A 2M7LA 2Y4QA 2MBXA 3EK8A 3A8RA 1TCFA 4N5XA 1OMVA 3CDNA 2GTEA 1IQ5A 2NCPA 1GM0A 2LVIA 3PFVA 4KYNA 4CLNA 1A75A 1KK7Y 1XFZO 1AP4A 1B7TZ 2LP3A 3TDIA 2K61A 4BY5A 4QJ3B 5HL1A 1C3YA 2K2AA 2KAVA 2JT3A 1G4YR 5EL2A 2KQYA 3KO0A 5CSNA 3TUYC 1CB1A 2JNXA 4U8DA 2LE9B 3AAJA 1DT7B 3PJIA 2O5GA 1IKUA 1DJYA 2M1KB 1CNPA 5D7FA 1KWOC 1BMOA 1B8LA 3CABA 4PHKA 3FS7A 1EH2A 1RROA 2CBLA 3BFHA 3I5FB 3NGVA 1KFUS 1UHJA 4PT1A 4A4BA 1NX3A 2QDIA 3CZ1A 3KEVA 4IL1A 2BNXA 4GGFA 2RGIA 1ZUZA 2QEBA 4OV2A 1IH0A 1JWDA 2BAPA 2JXLA 4ZCVA 1DJIA 1EG3A 4DIRA 2FOTA 3BYAA 4MRYA 1QWVA 2E6WA 2EGDA 1CDLA 2JWWA 1F55A 1X02A 3CZ0A 3TUYB 3DVJA 2LHIA 1TRFA 2LVJA 1RFJA 4I5KA 5B8IB 1PVBA 2ZNEA 1CFFA 1XFVO 2MRDA 2PSRA 1CM1A 1W9ZA 3I5HB 5ER5A 1MR8A 1AUIB 1NSHA 2BE4A 5DICA 5G08A 1F70A 4YI9A 1ODBA 1WRKA 1WRLA 2I7AA 5JOLA 3BFBA 5AEQA 3GOFA 1AHRA 4OZDA 2WC8A 1M63B 1NCYA 3OP0A 4MN0A 2Y5IA 3VGOA 2LHLA 2CTNA 1HQVA 1JFJA 1QLSA 1IGVA 4NQGA 1DJGA 3DYEA 4XJKA 4F0ZB 1OOJA 2P70A 1WDCC 2GGZA 1N2DA 3B87A 3I5IC 2LM5A 1PSRA 1S26D 2ERBA 2KGRA 1DGVA 4PCWA 2KYCA 1CFPA 1MWNA 2KDHA 1DVIA 1BU3A 1XYDA 3DF0B 3DF0A 1SK6D 3UO9A 2FCDA 2KQ6A 1NUBA 3OX5A 4OVNF 2OS8B 3JVTC 2OS8C 3JVTB 4PE1A 5AFPA 1TNXA 1DTLA 2KLEA 3IQQA 3PATA 1BT6A 3NHTA 2JC2A 1JC2A 1SL8A 1J7PA 3EVUA 1TWOA 3N7HA 1B9AA 2MAZA 1RECA 1UHIA 2HQ8A 2JT0A 3FWCA 3D74A 1DF0B 2NXQA 1DF0A 1TIZA 4ORAB 1S6JA 2M8UA 3TS5B 3SG2A 1LINA 2CCMA 4P2YB 5D3OA 3S0BA 3L4LA 1WLMA 2MJWB 1YR5A 3O4XA 1L7ZA 4AQIA 2I18A 2MHHA 2OTGB 4CFQA 1J1EA 4YGBB 1AJ4A 2LUCA 4XYNA 1BODA 1ZMZA 1R6PA 4CPVA 1QVIY 3H4SE 2EC6C 1GQMA 2KOTA 2KFGA 3OX6A 2LNKA 1K94A 2M0RA 3E3RA 2WNDA 1KFUL 2NZ0A 3S0FA 3I5HC 2MLFC 4OR9B 3O6BA 1ALVA 1GGZA 1WLZA 4GUKA 2LANA 4HRGA 2ZN8A 2G2BA 1Z2CB 3NSOA 4ETOA 1D1OA 3RLZA 1UHKA 1L2OB 2JQ6A 4GPLB 3SS3A 1S5GY 1DMOA 1F4OA 2BCBA 1QIWA 1DJHA 2OPOA 4PDZA 1S6CA 1YX7A 1IWQA 1PSBA 3S0EA 3VRRA 1Y6WA 2L5YA 2WOSA 1SCVA 1KQMC 1XFRA 4XJKB 1XO5A 1YVHA 1OZSA 3B6XA 1QV0A 3OHMB 1L2OC 2M29A 3K1EA 1QATA 1EXRA 1NX1A 1PRWA 5HYDA 2JPTA 1TN4A 1ALWA 2BL0C 3EKJA 4YGCB 3SS5A 1FF1A 1YVLA 2LCPA 4ORBB 3WHUB 4N1FA 3D10A 1CDPA 2ZRSA 2K8MB 1K2HA 2KI6D 2WCHA 5I2QA 2G9BA 3FWBA 2Y1MA 4MVFA 5DKNA 5BPJA 2BBMA 2R2IA 2V53A 3CTNA 1RJVA 2PALA 3BUOB 1MF8B 3JTDB 3OGNA 4ZCUA 2M1UA 1DC1A 2FCEA 3CS1A 1BR1B 1CFDA 1NIWA 1V1GA 4INXA 5AANA 1NCXA 2M9GA 3WNXB 2LMUA 1QASA 2GGMA 1XVJA 3R1OA 2WCKA 3TS5C 2LVVA 3AKAA 1DGUA 1F4QA 2LLSA 2KGBC 2ZKMX 4I5NB 4PE4A 5KTYA 1S1EA 1FPWA 1YUUA 3BUNB 3F45A 1CM4A 3PSRA 3O2PA 2A4JA 1TUJA 2ZN9A 3R1VA 4FQOA 4OCIA 1S6IA 1CDMA 1G33A 1SBJA 3LK1A 1JF0A 1PVAA 2JZIA 5HLVA 3KHEA 3WXAA 1SNLA 5HKZA 2WC6A 1CLBA 2LAPA 2LC5A 5CPVA 2KFFA 2D8NA 1K9KA 2LLUA 3CR5X 3SIAA 2KYFA 4JWQA 2JNFA 4YI8A 4C0KA 3I5GB 1S5GZ 2L50A 1LA0A 1B4CA 1IG5A 1BJFA 1LS8A 2JT8A 3IVTA 3IQOA 3DXLA 3L4AA 5FI2A 4QJ5B 1B8CA 3V2LA 2HPSA 4I5JA 1KQVA 2PVBA 3PLFB 4L9MA 1K90D 1SR6C 1SKTA 1B7TY 2E30A 2KHNA 4I5LB 3BUXB 1AJ5A 4PE7A 1H8BA 3EKHA 4TNCA 3SS4A 3MSEB 1KFXL 4PHJA 1SL9A 1SCMB 2H61A 3OB2B 1T14A 2F8PA 1UWOA 1E8AA 1TOPA 3D0YA 2BECA 2O60A 3DVKA 5JJGA 1C7WA 1J7RA 2F3ZA 2WCMA 2JTZA 5I94A 1PALA 4DRWA 4PHNA 3NSIA 2WCEA 1MXEA 2BCXA 2KNEA 1K8UA 2H61C 5CSFA 1K96A 3QMEA 3NHIA 2I94A 2QEOA 3S0GA 4C0LA 1CLMA 4YRUA 1SCMC 3CWGA 2JXCA 1UP5A 3GK1A 4HREE 1AVSA 3SG5A 3R1PA 1J7QA 2JOJA 2QPTA 2COLB 3DD4A 4HRHA 3SG3A 1CDNA 1RWYA 1YX8A 1TNPA 3TZ1A 2LVKA 1KK8B 3BFAA 4R1EA 2MA2A 4MLWA 5CSIA 5FI6A 3BUMB 3AKBA 2K7BA 5F6TA 1OQPA 3EVRA 1KFXS 1OOFA 3B7AA 1SSEB 2K7OA 2HQWA 1SMGA 4GNKB 1B8RA 3PALA 3I5GC 1G8IA 4MZLA 3ZNIA 1FBVA 1K93D 2M97A 2M3WA 3LCPC 1OMRA 1W7IB 2M7NA 2P6BB 1OZOA 1Y1AA 3CGAA 3BUWB 3KF9A 4PE0A 4YBHB 1IJ6A 1OSAA 4JQ0D 2SCPA 1JUOA 1LXFC 3L47A 5AERA 3WHTB 2BKHB 2F2OA 4BY4A 4CIDA 1BF5A 1F8HA 3RM1A 3DY9A 5IBWA 4N1GA 3PN7C 1K9PA 2AMIA 2CXJA 1YTZC 1RK9A 3EVVA 1CTRA 2JPOA 3GK2A 4YGEB 4PHMA 3S0AA 3O4YA 1M39A 1UHHA 1HT9A 4GGNA 1JFKA 3D73A 1PULA 2H8VA 2LMTA 1EJ3A 2ZNDA 1SPYA 1M45A 1TNQA 1XFYO 3TDUA 1FI6A 1Y1XA 1CMFA 4M2OA 1WDCB 5D69A 1OOGA 2M49B 3JTDC 4CFRA 3VRPA 2WCBA 4GBAA 4JPZB 3CYZA 3D0YB 3FE9A 4E68A 1JF2A 2JU0A 1Z4HA 2WCLA 4INWA 1KK7Z 1TNWA 1C07A 1NCZA 2CNPA 1QX5B 2ZFDA 3SG6A 4USLA 4DCKA 1TCOB 1H4BA 2CT9A 3CZTX 1Y1UA 3FE6A 1OOHA 2QEVA 1PK0D 4P5OE 3CR4X 2ISDA 1EG4A 3AAKA 1DQEA 2WORA 3PM2A 3SIBA 1JBAA 1DJWA 2TN4A 1QIVA 1FI5A 1Q80A 3VRQA 1LA3A 2SASA 1QVIZ 2JRFA 3EK7A 1M46A 4MSPA 4YGAA 1Y0VH 5TNCA 3LLEA 1A4PA 1CKKA 3R72A 1NP8A 2VRGA 2KI6C
chains in the Genus database with same CATH topology
1P28A 2FJYA 3D74A 1OOIX 4FQTA 2WC5A 3B88A 3D78A 2P71A 1T14A 3S0BA 3L4LA 2PQLA 2WCMA 3QMEA 3NHIA 4JD9A 2QEOA 3S0GA 1GM0A 3CDNA 2GTEA 3S0FA 3VB1A 3R1PA 3BFAA 1C3YA 5EL2A 1OOFA 3B7AA 3S0EA 3PJIA 3Q8IA 1XFRA 3B6XA 3D76A 3CABA 3K1EA 3BFHA 3NGVA 4PT1A 3L47A 2QDIA 3CZ1A 3B86A 2QEBA 3DY9A 2WCHA 1QWVA 3RZSA 3CZ0A 2JPOA 3CZ2A 3S0AA 2L2CA 3OGNA 1OW4A 2KPHA 3D73A 4INXA 2H8VA 5DICA 3D75A 2WCJA 3R1OA 2WCKA 3BFBA 1OOGA 3CYZA 4OZDA 3FE9A 2WCLA 1TUJA 3R1VA 4INWA 4F7FA 3DYEA 3S0DA 2P70A 3B87A 2WC6A 2ERBA 3FE6A 3DZTA 1OOHA 2QEVA 1DQEA 3FE8A 3D77A 1LS8A 3BJHA 3DXLA 1ORGA 3L4AA 2QEHA 3NHTA 3V2LA 3R72A 1C3ZA 3N7HA 1TWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P28 A;  2FJY A;  3D74 A;  1OOI X;  4FQT A;  2WC5 A;  3B88 A;  3D78 A;  2P71 A;  1T14 A;  3S0B A;  3L4L A;  2PQL A;  2WCM A;  3QME A;  3NHI A;  4JD9 A;  2QEO A;  3S0G A;  1GM0 A;  3CDN A;  2GTE A;  3S0F A;  3VB1 A;  3R1P A;  3BFA A;  1C3Y A;  5EL2 A;  1OOF A;  3B7A A;  3S0E A;  3PJI A;  3Q8I A;  1XFR A;  3B6X A;  3D76 A;  3CAB A;  3K1E A;  3BFH A;  3NGV A;  4PT1 A;  3L47 A;  2QDI A;  3CZ1 A;  3B86 A;  2QEB A;  3DY9 A;  2WCH A;  1QWV A;  3RZS A;  3CZ0 A;  2JPO A;  3CZ2 A;  3S0A A;  2L2C A;  3OGN A;  1OW4 A;  2KPH A;  3D73 A;  4INX A;  2H8V A;  5DIC A;  3D75 A;  2WCJ A;  3R1O A;  2WCK A;  3BFB A;  1OOG A;  3CYZ A;  4OZD A;  3FE9 A;  2WCL A;  1TUJ A;  3R1V A;  4INW A;  4F7F A;  3DYE A;  3S0D A;  2P70 A;  3B87 A;  2WC6 A;  2ERB A;  3FE6 A;  3DZT A;  1OOH A;  2QEV A;  1DQE A;  3FE8 A;  3D77 A;  1LS8 A;  3BJH A;  3DXL A;  1ORG A;  3L4A A;  2QEH A;  3NHT A;  3V2L A;  3R72 A;  1C3Z A;  3N7H A;  1TWO A; 
#chains in the Genus database with same CATH topology
 2KFH A;  1P28 A;  5ER4 X;  5I2L A;  2L98 A;  2FJY A;  1SR6 B;  2IS9 A;  2KLD A;  4FQT A;  1IJ5 A;  1YUR A;  1V1F A;  4MEW A;  1DJX A;  1GJY A;  1FW4 A;  1QLK A;  2WC5 A;  3HX4 A;  5FYX A;  3D78 A;  1CLL A;  2EC6 B;  2P71 A;  3CR2 A;  3DVM A;  5KSZ A;  4WQ2 A;  1NX0 A;  2PQL A;  2WCF A;  5K89 A;  1CFC A;  2K2F A;  5I8N A;  2BCA A;  4GAO A;  2OTG C;  4DS7 A;  3SG7 A;  2DOQ A;  3CLN A;  3IF7 A;  3M0W A;  1BR4 B;  2FJU B;  1DJZ A;  3BQ3 A;  1F71 A;  3NSK A;  2L51 A;  2Q91 A;  4JD9 A;  2KAX A;  2KSP A;  1LKJ A;  3NXA A;  1R2U A;  2LP2 A;  3KPX A;  2KAY A;  1J1D A;  3VB1 A;  1YUT A;  2NCO A;  3O78 A;  4IJ7 A;  1WY9 A;  2PAS A;  4Q04 A;  4C0J A;  1YRT B;  3C1V A;  2LMV A;  1ZFS A;  2NLN A;  1M31 A;  1K9U A;  1U5I B;  2K7C A;  1U5I A;  1UHN A;  4UPG A;  1NWD A;  2I2R E;  2Q4U A;  4GGF C;  5DKQ A;  1SW8 A;  1XK4 C;  2L2E A;  3Q8I A;  2K60 A;  1QX7 A;  1B1G A;  1NX2 A;  2LUX A;  1W7J B;  2K0J A;  3D76 A;  1MUX A;  1OE9 B;  2F2P A;  4NDD A;  2PRU A;  3PM8 A;  4WQ3 A;  1XFX O;  4HSZ A;  2KI4 C;  2F33 A;  2KBM A;  2L4H A;  2PYQ A;  4NDB A;  1J7O A;  1NPQ A;  1RTP 1;  3B86 A;  5GQQ C;  1N65 A;  1DEK A;  1S36 A;  2PMY A;  3DVE A;  1TUZ A;  1TTX A;  2KBI A;  4AOM A;  3RZS A;  2BL0 B;  1KK8 C;  1XFU O;  4WRI A;  3CZ2 A;  4NDC A;  1F54 A;  1WRZ A;  1KCY A;  2L2C A;  2L5X B;  3EG5 B;  3SG4 A;  1OW4 A;  2KPH A;  1S3P A;  4GFT A;  1UUR A;  1KSM A;  1KQM B;  1QJT A;  1A75 B;  3D75 A;  2WCJ A;  1YUS A;  2Y1N A;  1AK8 A;  2LLT A;  4A4C A;  3FIA A;  2LV7 A;  4ORC B;  4JKT A;  1GGW A;  2B1U A;  1B47 A;  5HLO A;  3VRO A;  4PAL A;  1BOC A;  3BOW A;  2KI4 B;  2JUL A;  4D1E A;  1BG1 A;  3ZWH A;  2JTT A;  5DKR A;  3BXK A;  2YGU A;  4MZJ A;  4F7F A;  2HET A;  5HKY A;  5HKW A;  2AAO A;  1JSA A;  3QRX A;  3EK4 A;  1QV1 A;  1SYM A;  3S0D A;  5AXI A;  1IQ3 A;  1N0Y A;  1VRK A;  1YRU B;  2MLE C;  4MRX A;  1QXP A;  1K95 A;  1A29 A;  2ZRT A;  3OB1 B;  4ICB A;  1A03 A;  3LK0 A;  3I5F C;  4MZK A;  2BBN A;  1MXL C;  3DZT A;  3K21 A;  5CSJ A;  3A4U B;  3GK4 X;  2EHB A;  3ICB A;  1EL4 A;  3FE8 A;  2QAC A;  3D77 A;  4FTG A;  1IRJ A;  3PN7 B;  3NSL A;  1MQ1 A;  4M2P A;  3TDZ A;  3HCM A;  3LL8 B;  4DUQ A;  5I2O A;  1MHO A;  3BJH A;  1ORG A;  2L0P A;  1C7V A;  2BE6 A;  2BKI B;  2QEH A;  4MBE A;  4AQJ A;  1ZOT B;  1LVC D;  5PAL A;  1QS7 A;  4QJ4 B;  1C3Z A;  1NYA A;  5J3X A;  1KWO B;  1OMD A;  2HF5 A;  2F3Y A;  4M2Q A;  1J55 A;  1OOI X;  3UNW A;  1QTX A;  1SY9 A;  2AUC A;  2L4I A;  1SRA A;  5FI7 A;  1BLQ A;  1A2X A;  3B88 A;  1XFW O;  1IIO A;  1CMG A;  3I5I B;  1XK4 A;  4YGD B;  3VRN A;  1UUS A;  1ZAC A;  3BOW B;  1XA5 A;  3OBV A;  2H2K A;  1KSO A;  2K7D A;  1DEL A;  1QX2 A;  5KU1 A;  3SJS A;  4OKH A;  1SL7 A;  2GV5 A;  2M7L A;  2Y4Q A;  2MBX A;  3EK8 A;  3A8R A;  1TCF A;  4N5X A;  1OMV A;  3CDN A;  2GTE A;  1IQ5 A;  2NCP A;  1GM0 A;  2LVI A;  3PFV A;  4KYN A;  4CLN A;  1A75 A;  1KK7 Y;  1XFZ O;  1AP4 A;  1B7T Z;  2LP3 A;  3TDI A;  2K61 A;  4BY5 A;  4QJ3 B;  5HL1 A;  1C3Y A;  2K2A A;  2KAV A;  2JT3 A;  1G4Y R;  5EL2 A;  2KQY A;  3KO0 A;  5CSN A;  3TUY C;  1CB1 A;  2JNX A;  4U8D A;  2LE9 B;  3AAJ A;  1DT7 B;  3PJI A;  2O5G A;  1IKU A;  1DJY A;  2M1K B;  1CNP A;  5D7F A;  1KWO C;  1BMO A;  1B8L A;  3CAB A;  4PHK A;  3FS7 A;  1EH2 A;  1RRO A;  2CBL A;  3BFH A;  3I5F B;  3NGV A;  1KFU S;  1UHJ A;  4PT1 A;  4A4B A;  1NX3 A;  2QDI A;  3CZ1 A;  3KEV A;  4IL1 A;  2BNX A;  4GGF A;  2RGI A;  1ZUZ A;  2QEB A;  4OV2 A;  1IH0 A;  1JWD A;  2BAP A;  2JXL A;  4ZCV A;  1DJI A;  1EG3 A;  4DIR A;  2FOT A;  3BYA A;  4MRY A;  1QWV A;  2E6W A;  2EGD A;  1CDL A;  2JWW A;  1F55 A;  1X02 A;  3CZ0 A;  3TUY B;  3DVJ A;  2LHI A;  1TRF A;  2LVJ A;  1RFJ A;  4I5K A;  5B8I B;  1PVB A;  2ZNE A;  1CFF A;  1XFV O;  2MRD A;  2PSR A;  1CM1 A;  1W9Z A;  3I5H B;  5ER5 A;  1MR8 A;  1AUI B;  1NSH A;  2BE4 A;  5DIC A;  5G08 A;  1F70 A;  4YI9 A;  1ODB A;  1WRK A;  1WRL A;  2I7A A;  5JOL A;  3BFB A;  5AEQ A;  3GOF A;  1AHR A;  4OZD A;  2WC8 A;  1M63 B;  1NCY A;  3OP0 A;  4MN0 A;  2Y5I A;  3VGO A;  2LHL A;  2CTN A;  1HQV A;  1JFJ A;  1QLS A;  1IGV A;  4NQG A;  1DJG A;  3DYE A;  4XJK A;  4F0Z B;  1OOJ A;  2P70 A;  1WDC C;  2GGZ A;  1N2D A;  3B87 A;  3I5I C;  2LM5 A;  1PSR A;  1S26 D;  2ERB A;  2KGR A;  1DGV A;  4PCW A;  2KYC A;  1CFP A;  1MWN A;  2KDH A;  1DVI A;  1BU3 A;  1XYD A;  3DF0 B;  3DF0 A;  1SK6 D;  3UO9 A;  2FCD A;  2KQ6 A;  1NUB A;  3OX5 A;  4OVN F;  2OS8 B;  3JVT C;  2OS8 C;  3JVT B;  4PE1 A;  5AFP A;  1TNX A;  1DTL A;  2KLE A;  3IQQ A;  3PAT A;  1BT6 A;  3NHT A;  2JC2 A;  1JC2 A;  1SL8 A;  1J7P A;  3EVU A;  1TWO A;  3N7H A;  1B9A A;  2MAZ A;  1REC A;  1UHI A;  2HQ8 A;  2JT0 A;  3FWC A;  3D74 A;  1DF0 B;  2NXQ A;  1DF0 A;  1TIZ A;  4ORA B;  1S6J A;  2M8U A;  3TS5 B;  3SG2 A;  1LIN A;  2CCM A;  4P2Y B;  5D3O A;  3S0B A;  3L4L A;  1WLM A;  2MJW B;  1YR5 A;  3O4X A;  1L7Z A;  4AQI A;  2I18 A;  2MHH A;  2OTG B;  4CFQ A;  1J1E A;  4YGB B;  1AJ4 A;  2LUC A;  4XYN A;  1BOD A;  1ZMZ A;  1R6P A;  4CPV A;  1QVI Y;  3H4S E;  2EC6 C;  1GQM A;  2KOT A;  2KFG A;  3OX6 A;  2LNK A;  1K94 A;  2M0R A;  3E3R A;  2WND A;  1KFU L;  2NZ0 A;  3S0F A;  3I5H C;  2MLF C;  4OR9 B;  3O6B A;  1ALV A;  1GGZ A;  1WLZ A;  4GUK A;  2LAN A;  4HRG A;  2ZN8 A;  2G2B A;  1Z2C B;  3NSO A;  4ETO A;  1D1O A;  3RLZ A;  1UHK A;  1L2O B;  2JQ6 A;  4GPL B;  3SS3 A;  1S5G Y;  1DMO A;  1F4O A;  2BCB A;  1QIW A;  1DJH A;  2OPO A;  4PDZ A;  1S6C A;  1YX7 A;  1IWQ A;  1PSB A;  3S0E A;  3VRR A;  1Y6W A;  2L5Y A;  2WOS A;  1SCV A;  1KQM C;  1XFR A;  4XJK B;  1XO5 A;  1YVH A;  1OZS A;  3B6X A;  1QV0 A;  3OHM B;  1L2O C;  2M29 A;  3K1E A;  1QAT A;  1EXR A;  1NX1 A;  1PRW A;  5HYD A;  2JPT A;  1TN4 A;  1ALW A;  2BL0 C;  3EKJ A;  4YGC B;  3SS5 A;  1FF1 A;  1YVL A;  2LCP A;  4ORB B;  3WHU B;  4N1F A;  3D10 A;  1CDP A;  2ZRS A;  2K8M B;  1K2H A;  2KI6 D;  2WCH A;  5I2Q A;  2G9B A;  3FWB A;  2Y1M A;  4MVF A;  5DKN A;  5BPJ A;  2BBM A;  2R2I A;  2V53 A;  3CTN A;  1RJV A;  2PAL A;  3BUO B;  1MF8 B;  3JTD B;  3OGN A;  4ZCU A;  2M1U A;  1DC1 A;  2FCE A;  3CS1 A;  1BR1 B;  1CFD A;  1NIW A;  1V1G A;  4INX A;  5AAN A;  1NCX A;  2M9G A;  3WNX B;  2LMU A;  1QAS A;  2GGM A;  1XVJ A;  3R1O A;  2WCK A;  3TS5 C;  2LVV A;  3AKA A;  1DGU A;  1F4Q A;  2LLS A;  2KGB C;  2ZKM X;  4I5N B;  4PE4 A;  5KTY A;  1S1E A;  1FPW A;  1YUU A;  3BUN B;  3F45 A;  1CM4 A;  3PSR A;  3O2P A;  2A4J A;  1TUJ A;  2ZN9 A;  3R1V A;  4FQO A;  4OCI A;  1S6I A;  1CDM A;  1G33 A;  1SBJ A;  3LK1 A;  1JF0 A;  1PVA A;  2JZI A;  5HLV A;  3KHE A;  3WXA A;  1SNL A;  5HKZ A;  2WC6 A;  1CLB A;  2LAP A;  2LC5 A;  5CPV A;  2KFF A;  2D8N A;  1K9K A;  2LLU A;  3CR5 X;  3SIA A;  2KYF A;  4JWQ A;  2JNF A;  4YI8 A;  4C0K A;  3I5G B;  1S5G Z;  2L50 A;  1LA0 A;  1B4C A;  1IG5 A;  1BJF A;  1LS8 A;  2JT8 A;  3IVT A;  3IQO A;  3DXL A;  3L4A A;  5FI2 A;  4QJ5 B;  1B8C A;  3V2L A;  2HPS A;  4I5J A;  1KQV A;  2PVB A;  3PLF B;  4L9M A;  1K90 D;  1SR6 C;  1SKT A;  1B7T Y;  2E30 A;  2KHN A;  4I5L B;  3BUX B;  1AJ5 A;  4PE7 A;  1H8B A;  3EKH A;  4TNC A;  3SS4 A;  3MSE B;  1KFX L;  4PHJ A;  1SL9 A;  1SCM B;  2H61 A;  3OB2 B;  1T14 A;  2F8P A;  1UWO A;  1E8A A;  1TOP A;  3D0Y A;  2BEC A;  2O60 A;  3DVK A;  5JJG A;  1C7W A;  1J7R A;  2F3Z A;  2WCM A;  2JTZ A;  5I94 A;  1PAL A;  4DRW A;  4PHN A;  3NSI A;  2WCE A;  1MXE A;  2BCX A;  2KNE A;  1K8U A;  2H61 C;  5CSF A;  1K96 A;  3QME A;  3NHI A;  2I94 A;  2QEO A;  3S0G A;  4C0L A;  1CLM A;  4YRU A;  1SCM C;  3CWG A;  2JXC A;  1UP5 A;  3GK1 A;  4HRE E;  1AVS A;  3SG5 A;  3R1P A;  1J7Q A;  2JOJ A;  2QPT A;  2COL B;  3DD4 A;  4HRH A;  3SG3 A;  1CDN A;  1RWY A;  1YX8 A;  1TNP A;  3TZ1 A;  2LVK A;  1KK8 B;  3BFA A;  4R1E A;  2MA2 A;  4MLW A;  5CSI A;  5FI6 A;  3BUM B;  3AKB A;  2K7B A;  5F6T A;  1OQP A;  3EVR A;  1KFX S;  1OOF A;  3B7A A;  1SSE B;  2K7O A;  2HQW A;  1SMG A;  4GNK B;  1B8R A;  3PAL A;  3I5G C;  1G8I A;  4MZL A;  3ZNI A;  1FBV A;  1K93 D;  2M97 A;  2M3W A;  3LCP C;  1OMR A;  1W7I B;  2M7N A;  2P6B B;  1OZO A;  1Y1A A;  3CGA A;  3BUW B;  3KF9 A;  4PE0 A;  4YBH B;  1IJ6 A;  1OSA A;  4JQ0 D;  2SCP A;  1JUO A;  1LXF C;  3L47 A;  5AER A;  3WHT B;  2BKH B;  2F2O A;  4BY4 A;  4CID A;  1BF5 A;  1F8H A;  3RM1 A;  3DY9 A;  5IBW A;  4N1G A;  3PN7 C;  1K9P A;  2AMI A;  2CXJ A;  1YTZ C;  1RK9 A;  3EVV A;  1CTR A;  2JPO A;  3GK2 A;  4YGE B;  4PHM A;  3S0A A;  3O4Y A;  1M39 A;  1UHH A;  1HT9 A;  4GGN A;  1JFK A;  3D73 A;  1PUL A;  2H8V A;  2LMT A;  1EJ3 A;  2ZND A;  1SPY A;  1M45 A;  1TNQ A;  1XFY O;  3TDU A;  1FI6 A;  1Y1X A;  1CMF A;  4M2O A;  1WDC B;  5D69 A;  1OOG A;  2M49 B;  3JTD C;  4CFR A;  3VRP A;  2WCB A;  4GBA A;  4JPZ B;  3CYZ A;  3D0Y B;  3FE9 A;  4E68 A;  1JF2 A;  2JU0 A;  1Z4H A;  2WCL A;  4INW A;  1KK7 Z;  1TNW A;  1C07 A;  1NCZ A;  2CNP A;  1QX5 B;  2ZFD A;  3SG6 A;  4USL A;  4DCK A;  1TCO B;  1H4B A;  2CT9 A;  3CZT X;  1Y1U A;  3FE6 A;  1OOH A;  2QEV A;  1PK0 D;  4P5O E;  3CR4 X;  2ISD A;  1EG4 A;  3AAK A;  1DQE A;  2WOR A;  3PM2 A;  3SIB A;  1JBA A;  1DJW A;  2TN4 A;  1QIV A;  1FI5 A;  1Q80 A;  3VRQ A;  1LA3 A;  2SAS A;  1QVI Z;  2JRF A;  3EK7 A;  1M46 A;  4MSP A;  4YGA A;  1Y0V H;  5TNC A;  3LLE A;  1A4P A;  1CKK A;  3R72 A;  1NP8 A;  2VRG A;  2KI6 C; 
#chains in the Genus database with same CATH homology
 1P28 A;  2FJY A;  3D74 A;  1OOI X;  4FQT A;  2WC5 A;  3B88 A;  3D78 A;  2P71 A;  1T14 A;  3S0B A;  3L4L A;  2PQL A;  2WCM A;  3QME A;  3NHI A;  4JD9 A;  2QEO A;  3S0G A;  1GM0 A;  3CDN A;  2GTE A;  3S0F A;  3VB1 A;  3R1P A;  3BFA A;  1C3Y A;  5EL2 A;  1OOF A;  3B7A A;  3S0E A;  3PJI A;  3Q8I A;  1XFR A;  3B6X A;  3D76 A;  3CAB A;  3K1E A;  3BFH A;  3NGV A;  4PT1 A;  3L47 A;  2QDI A;  3CZ1 A;  3B86 A;  2QEB A;  3DY9 A;  2WCH A;  1QWV A;  3RZS A;  3CZ0 A;  2JPO A;  3CZ2 A;  3S0A A;  2L2C A;  3OGN A;  1OW4 A;  2KPH A;  3D73 A;  4INX A;  2H8V A;  5DIC A;  3D75 A;  2WCJ A;  3R1O A;  2WCK A;  3BFB A;  1OOG A;  3CYZ A;  4OZD A;  3FE9 A;  2WCL A;  1TUJ A;  3R1V A;  4INW A;  4F7F A;  3DYE A;  3S0D A;  2P70 A;  3B87 A;  2WC6 A;  2ERB A;  3FE6 A;  3DZT A;  1OOH A;  2QEV A;  1DQE A;  3FE8 A;  3D77 A;  1LS8 A;  3BJH A;  3DXL A;  1ORG A;  3L4A A;  2QEH A;  3NHT A;  3V2L A;  3R72 A;  1C3Z A;  3N7H A;  1TWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...