3S0BA

Apis mellifera obp14 in complex with the fluorescent probe 1-n-phenylnaphthylamine (npn)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 49
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0bA00
3D73A 4OZDA 2QEOA 3CZ1A 3BJHA 4FQTA 3B88A 3NHTA 3N7HA 3QMEA 3L4LA 4INXA 3VB1A 3CZ0A 3R72A 5DICA 4PT1A 2L2CA 4INWA 2H8VA 3D78A 3D74A 3CYZA 2WCKA 3R1VA 3B87A 3L4AA 2WC5A 3Q8IA 1C3YA 3B86A 2WCMA 1TUJA 5EL2A 3K1EA 2WCLA 3B6XA 2KPHA 3D76A 1OW4A 2WCHA 1ORGA 3CZ2A 3S0EA 3BFBA 2P70A 1T14A 3FE9A 4JD9A 2WCJA 3R1PA 3S0BA 1TWOA 3PJIA 4F7FA 2QEBA 3S0AA 1LS8A 2QDIA 2JPOA 3OGNA 3R1OA 1OOGA 1OOFA 2QEHA 3FE6A 2GTEA 2PQLA 3BFHA 3S0FA 1DQEA 1P28A 3DXLA 3NHIA 1QWVA 1XFRA 3D77A 3DZTA 1OOHA 2WC6A 3RZSA 3S0GA 3B7AA 3CABA 3NGVA 2P71A 1GM0A 1OOIX 3FE8A 3L47A 2QEVA 2ERBA 3BFAA 3V2LA 3D75A 1C3ZA 3CDNA 2FJYA 3DYEA 3DY9A 3S0DA
chains in the Genus database with same CATH superfamily
1CDMA 1K9UA 1XK4C 2K7CA 1KQVA 4E68A 2K61A 1EG4A 1XYDA 1JWDA 1YX7A 3NSIA 2QEOA 2LVVA 2Y1NA 1VRKA 4D1EA 1HQVA 2JT8A 3JTDB 1OZSA 3UO9A 2M97A 2LMVA 2EC6B 2KI6D 3PM8A 5CSFA 3PM2A 4QJ4B 2OPOA 1WLZA 2RGIA 1SKTA 3EKHA 4PALA 4YGCB 3L4LA 5I94A 4INXA 1NX2A 1M31A 1R6PA 2BCBA 1SL9A 1UURA 1KWOC 5CSNA 2CXJA 1DJWA 1Y0VH 1YUTA 1JSAA 1MUXA 3I5IB 2WCBA 4ORBB 2WCEA 2LMUA 5HL1A 4INWA 2OTGB 1B7TY 2KI4C 2MAZA 3EKJA 2BBNA 2K2AA 3SS4A 4A4CA 1PRWA 3WNXB 1ODBA 1V1FA 2K7DA 2KAVA 1TCFA 2Q4UA 4IJ7A 1C7WA 4ETOA 1DGUA 1QASA 1B8CA 3A4UB 1TOPA 3F45A 2LVKA 3B6XA 2L98A 3MSEB 2Q91A 2F8PA 2HF5A 2ZFDA 1V1GA 4YGEB 1TIZA 3BUNB 1YVLA 1OMVA 1CM4A 1WLMA 2WCHA 1ZOTB 3EG5B 3CZ2A 5BPJA 3DD4A 5K89A 4WQ3A 3BFBA 1CFFA 1MQ1A 2P70A 4JD9A 2G9BA 2WCJA 2SASA 3TZ1A 1KK8C 1JFJA 2ZN9A 1F8HA 4CFRA 1TWOA 2QEBA 2KDHA 1KQMC 3PN7C 4WQ2A 3S0AA 3TUYC 1DMOA 4FQOA 2KAXA 3UNWA 3BUMB 2JXLA 2Y5IA 4CLNA 3I5HB 2BE4A 1NX1A 2LUCA 1AJ5A 3GK4X 3KO0A 4I5NB 2TN4A 2QDIA 1DEKA 1FI6A 4HRHA 2KHNA 1IWQA 2M49B 5CPVA 1B4CA 2LMTA 5FI2A 2DOQA 1UP5A 3I5FC 2JNFA 4ICBA 4JPZB 3VRPA 4PDZA 4MZKA 1QX5B 1QTXA 1J7OA 2JTTA 2KGRA 2SCPA 1F71A 1UHIA 1XFVO 2PQLA 3FWCA 1ZACA 1P28A 1K94A 2GV5A 1XFUO 2LC5A 3EVRA 3NHIA 3EK4A 1QWVA 1A75A 2L50A 2I18A 3TS5C 4AOMA 3DZTA 1XA5A 4MRYA 1S6IA 4NDCA 1BLQA 1CDNA 4MRXA 5HLVA 3IVTA 2AMIA 2K7OA 1EXRA 1CFCA 2A4JA 1OSAA 1EG3A 1R2UA 5PALA 1B47A 1MWNA 2JULA 1BJFA 1OOIX 2HETA 3DF0A 3WXAA 4XJKA 5FYXA 4A4BA 1S26D 1PSBA 1TCOB 2R2IA 4GPLB 1KFXL 3OX5A 1YRTB 1TNXA 1WRZA 3O2PA 1TUZA 1N65A 2FJYA 4KYNA 3IQQA 2PASA 1RJVA 1XO5A 3DY9A 3QRXA 1CB1A 3CTNA 2FCEA 1SCVA 1QXPA 3D0YA 1YX8A 2K8MB 3D73A 1OQPA 1QJTA 2PSRA 4OZDA 1K2HA 5ER4X 2P6BB 2Y1MA 3CZ1A 3CR5X 4MSPA 3OP0A 2F3ZA 3O4YA 4GAOA 4FQTA 4GGFC 2LV7A 1GGZA 1MXEA 3B88A 1RECA 1QV0A 1U5IB 3ZWHA 3N7HA 1YUUA 2MLEC 1LINA 2JTZA 1TNWA 1BU3A 3CZTX 2JOJA 4P2YB 5CSIA 1NYAA 3LCPC 1AP4A 2M1KB 3CZ0A 1B8RA 1CTRA 3R72A 1DTLA 1DF0B 2I2RE 1K96A 2M0RA 3JVTB 4JWQA 4PT1A 1QATA 1KWOB 1X02A 1FPWA 2L2CA 1NX3A 1JF2A 2E30A 2KSPA 3PATA 1BMOA 4NDBA 1IJ6A 4YGBB 3BOWB 2H8VA 1PALA 2BCXA 2L5XB 1NUBA 4M2OA 3CYZA 1HT9A 3FS7A 2WCKA 3R1VA 2KI4B 3TDZA 4PE1A 3SG3A 4OCIA 1F54A 2KBMA 3VRNA 3L4AA 5KU1A 4PHMA 1Q80A 2NXQA 2ZN8A 1C3YA 3O4XA 1S5GZ 1QVIY 1EJ3A 1GJYA 1UWOA 4ORCB 1D1OA 4I5KA 1S36A 4N5XA 4U8DA 5AANA 4DCKA 1KCYA 4MBEA 1CLBA 2MLFC 2F33A 2BL0C 3DVMA 4HRGA 1LA0A 2KFHA 2KI6C 3EVUA 1B9AA 4NQGA 3OBVA 3SG5A 3S0EA 3OB1B 4OKHA 3S0BA 1UHJA 4ORAB 3PJIA 1S1EA 2M7NA 1Z2CB 1KK8B 3PSRA 5CSJA 5G08A 3WHTB 4AQJA 5KSZA 2WORA 1LS8A 3CR2A 1Y1UA 2YGUA 1KQMB 3PN7B 3TUYB 4CFQA 2V53A 1TNQA 2KOTA 1FF1A 5AEQA 2M3WA 3R1OA 1BG1A 1K8UA 2G2BA 1F4QA 4DUQA 2KLEA 3CS1A 5FI7A 3SIAA 5D7FA 1DJHA 2K2FA 2QEHA 3FE6A 3A8RA 3VROA 5DKQA 3I5FB 3S0FA 3BFHA 2LHIA 5TNCA 2BKIB 2L2EA 1DQEA 1KFUL 1SCMC 2BBMA 2H61A 4GBAA 2LHLA 3DXLA 4BY5A 4DS7A 1K95A 2BNXA 2E6WA 5I2QA 2H61C 3D77A 5AXIA 1AUIB 3TS5B 2CBLA 3VRRA 5HKZA 3DVKA 1OOHA 3AKAA 2KQ6A 2F2PA 2WC6A 1KSOA 3VGOA 1IGVA 2LM5A 3B7AA 1J55A 2LP3A 2MJWB 3CABA 3HX4A 3NGVA 1DT7B 1PVAA 2LNKA 1WRLA 1SL7A 1J7PA 1BT6A 3KHEA 1GM0A 1LXFC 5HYDA 3M0WA 1SR6B 1N0YA 1M63B 1MHOA 2JXCA 4ZCUA 2BCAA 3AKBA 1L7ZA 5AERA 3V2LA 2KGBC 4P5OE 2JPTA 3O78A 1AVSA 2LLSA 2MRDA 4YI8A 2L0PA 1KK7Z 3C1VA 1UHKA 3DYEA 1CKKA 1BOCA 1F70A 1JUOA 3S0DA 1QIVA 1SMGA 1SNLA 1DC1A 1Y1XA 1IQ5A 4ZCVA 2JRFA 1YTZC 2HQWA 3BYAA 1G8IA 1NIWA 3TDIA 1WY9A 4YRUA 4GGNA 1QX7A 2M9GA 2LVIA 3K21A 3QMEA 1LKJA 2LVJA 4MZLA 2M7LA 4HREE 3NXAA 3VB1A 2ZKMX 3DVEA 1CFDA 1BR4B 1QLSA 3EK8A 4YGDB 4OV2A 1CMGA 3I5GC 2JT0A 5B8IB 2KAYA 1H8BA 3BUWB 3BQ3A 3I5HC 3KEVA 3NSOA 1IRJA 3D78A 1KSMA 2ZNEA 3TDUA 1IIOA 1TNPA 4PHKA 3SG4A 2CCMA 2HQ8A 3B87A 1WDCC 3EVVA 1RK9A 1YUSA 2EGDA 1PVBA 5JOLA 3SIBA 2O5GA 1S6CA 3LLEA 1M46A 1W9ZA 1ZUZA 4WRIA 4OR9B 3SG7A 5HKWA 4R1EA 3K1EA 2KYCA 1A29A 2WCLA 3CLNA 1AK8A 3LL8B 1A03A 1NSHA 4GNKB 1ALVA 1MR8A 2PYQA 3D76A 1N2DA 2OS8C 4TNCA 1OW4A 1EH2A 5J3XA 1ORGA 2FJUB 3AAJA 2CT9A 1C07A 1XFZO 5FI6A 2GGMA 5KTYA 5I8NA 3KPXA 4QJ5B 2K7BA 2QACA 3H4SE 2LAPA 1CLMA 1AHRA 3PFVA 4F7FA 1L2OC 1RROA 1NCYA 2JC2A 1IKUA 2IS9A 1CNPA 2JQ6A 1NX0A 1DELA 2KNEA 2FCDA 2BAPA 1CMFA 1CFPA 4CIDA 2PRUA 5ER5A 1OOGA 2H2KA 3FWBA 1DVIA 2QPTA 3LK1A 4PHJA 2MHHA 3SS3A 2AUCA 2PMYA 2L51A 3KF9A 1Y6WA 2LANA 1H4BA 1Z4HA 4F0ZB 3IF7A 1XK4A 1SCMB 1B7TZ 2KQYA 1RWYA 2VRGA 3BXKA 5JJGA 2BKHB 1ZMZA 1J7QA 1WRKA 2MA2A 4BY4A 4Q04A 4YBHB 1FI5A 1U5IA 1IH0A 1FW4A 3OX6A 3RZSA 2PALA 1IQ3A 1UHNA 1QLKA 1JF0A 1M39A 2ISDA 2KFGA 3BUOB 1DJZA 4DRWA 2M1UA 4PHNA 1DJYA 1S5GY 1W7JB 1DJXA 1DF0A 1OMRA 1TRFA 1IG5A 2K60A 1KFXS 4HSZA 4MN0A 4C0JA 1UUSA 2KBIA 3ZNIA 4L9MA 1CDPA 3L47A 5I2LA 4PCWA 3JVTC 2I94A 3GOFA 1GQMA 3BOWA 1F55A 3BFAA 1M45A 4MZJA 2LP2A 5I2OA 1CLLA 1YURA 2CNPA 2WC8A 3CGAA 1SBJA 2FOTA 4YGAA 1LA3A 3CWGA 1QV1A 5DKRA 1QX2A 2O60A 3JTDC 3NSLA 5DKNA 1A75B 1AJ4A 1FBVA 1NWDA 2EC6C 1K90D 4CPVA 3BJHA 1C7VA 1CDLA 1OZOA 4PE4A 3CR4X 3OB2B 4MLWA 3SG2A 1XFWO 2BE6A 3NHTA 2F2OA 1DJGA 1K93D 1DJIA 4C0LA 2L4IA 3HCMA 4QJ3B 3I5IC 5GQQC 5F6TA 5DICA 4N1GA 3DF0B 2OTGC 4XJKB 2NCPA 3O6BA 2LLUA 4I5LB 1Y1AA 4NDDA 1SRAA 4M2PA 3FIAA 2LE9B 1SK6D 1E8AA 2NZ0A 3GK1A 1JFKA 3D74A 4GFTA 2D8NA 3I5GB 3RLZA 3DVJA 1K9PA 4IL1A 1F4OA 3E3RA 4I5JA 2ZRSA 1RTP1 4N1FA 2NLNA 1NP8A 2WC5A 3Q8IA 3WHUB 1WDCB 3D0YB 3EK7A 3B86A 1SL8A 2WCMA 3LK0A 1TUJA 5EL2A 3RM1A 4OVNF 1XVJA 4JQ0D 1SYMA 2KPHA 3SS5A 1A4PA 1TTXA 2KFFA 3PLFB 5AFPA 1ALWA 1NPQA 2Y4QA 3BUXB 1CM1A 1MXLC 1S6JA 4MVFA 3ICBA 2OS8B 5HKYA 1GGWA 1T14A 3FE9A 1YVHA 2JWWA 1SSEB 4JKTA 1B1GA 1KK7Y 3R1PA 4PE7A 1QIWA 2B1UA 4XYNA 2WNDA 2K0JA 4GUKA 4USLA 4FTGA 2JT3A 1S3PA 2PVBA 1L2OB 1NCZA 1SR6C 4AQIA 2CTNA 1A2XA 1J1EA 1MF8B 1SPYA 1XFYO 2F3YA 2JPOA 3OGNA 4YI9A 3VRQA 4C0KA 2LUXA 2NCOA 1NCXA 3AAKA 1OOFA 2BECA 4DIRA 1JC2A 1PSRA 3SJSA 1KFUS 2JZIA 3IQOA 2JU0A 1PK0D 2GTEA 1IJ5A 3PALA 4PE0A 2I7AA 2COLB 1TN4A 2WCFA 2BL0B 2M8UA 5IBWA 2LCPA 3NSKA 1XFRA 1OMDA 4UPGA 1LVCD 1OE9B 1W7IB 1G33A 2KLDA 1K9KA 4MEWA 5D69A 1B8LA 4GGFA 1XFXO 1SW8A 3SG6A 2LLTA 3S0GA 2ZNDA 1YRUB 1QVIZ 3OHMB 1SY9A 2P71A 1J7RA 3FE8A 3GK2A 1DGVA 1RFJA 1UHHA 4M2QA 2ZRTA 1BODA 1JBAA 2KYFA 2QEVA 2ERBA 2L4HA 2WOSA 1J1DA 2JNXA 5D3OA 1OOJA 3D75A 2MBXA 3D10A 1C3ZA 3CDNA 2EHBA 1EL4A 2L5YA 1ZFSA 1G4YR 2AAOA 1PULA 1YR5A 2GGZA 5HLOA 2M29A 1BR1B 1QS7A 1BF5A 2HPSA
chains in the Genus database with same CATH topology
3D73A 4OZDA 2QEOA 3CZ1A 3BJHA 4FQTA 3B88A 3NHTA 3N7HA 3QMEA 3L4LA 4INXA 3VB1A 3CZ0A 3R72A 5DICA 4PT1A 2L2CA 4INWA 2H8VA 3D78A 3D74A 3CYZA 2WCKA 3R1VA 3B87A 3L4AA 2WC5A 3Q8IA 1C3YA 3B86A 2WCMA 1TUJA 5EL2A 3K1EA 2WCLA 3B6XA 2KPHA 3D76A 1OW4A 2WCHA 1ORGA 3CZ2A 3S0EA 3BFBA 2P70A 1T14A 3FE9A 4JD9A 2WCJA 3R1PA 3S0BA 1TWOA 3PJIA 4F7FA 2QEBA 3S0AA 1LS8A 2QDIA 2JPOA 3OGNA 3R1OA 1OOGA 1OOFA 2QEHA 3FE6A 2GTEA 2PQLA 3BFHA 3S0FA 1DQEA 1P28A 3DXLA 3NHIA 1QWVA 1XFRA 3D77A 3DZTA 1OOHA 2WC6A 3RZSA 3S0GA 3B7AA 3CABA 3NGVA 2P71A 1GM0A 1OOIX 3FE8A 3L47A 2QEVA 2ERBA 3BFAA 3V2LA 3D75A 1C3ZA 3CDNA 2FJYA 3DYEA 3DY9A 3S0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D73 A;  4OZD A;  2QEO A;  3CZ1 A;  3BJH A;  4FQT A;  3B88 A;  3NHT A;  3N7H A;  3QME A;  3L4L A;  4INX A;  3VB1 A;  3CZ0 A;  3R72 A;  5DIC A;  4PT1 A;  2L2C A;  4INW A;  2H8V A;  3D78 A;  3D74 A;  3CYZ A;  2WCK A;  3R1V A;  3B87 A;  3L4A A;  2WC5 A;  3Q8I A;  1C3Y A;  3B86 A;  2WCM A;  1TUJ A;  5EL2 A;  3K1E A;  2WCL A;  3B6X A;  2KPH A;  3D76 A;  1OW4 A;  2WCH A;  1ORG A;  3CZ2 A;  3S0E A;  3BFB A;  2P70 A;  1T14 A;  3FE9 A;  4JD9 A;  2WCJ A;  3R1P A;  3S0B A;  1TWO A;  3PJI A;  4F7F A;  2QEB A;  3S0A A;  1LS8 A;  2QDI A;  2JPO A;  3OGN A;  3R1O A;  1OOG A;  1OOF A;  2QEH A;  3FE6 A;  2GTE A;  2PQL A;  3BFH A;  3S0F A;  1DQE A;  1P28 A;  3DXL A;  3NHI A;  1QWV A;  1XFR A;  3D77 A;  3DZT A;  1OOH A;  2WC6 A;  3RZS A;  3S0G A;  3B7A A;  3CAB A;  3NGV A;  2P71 A;  1GM0 A;  1OOI X;  3FE8 A;  3L47 A;  2QEV A;  2ERB A;  3BFA A;  3V2L A;  3D75 A;  1C3Z A;  3CDN A;  2FJY A;  3DYE A;  3DY9 A;  3S0D A; 
#chains in the Genus database with same CATH topology
 1CDM A;  1K9U A;  1XK4 C;  2K7C A;  1KQV A;  4E68 A;  2K61 A;  1EG4 A;  1XYD A;  1JWD A;  1YX7 A;  3NSI A;  2QEO A;  2LVV A;  2Y1N A;  1VRK A;  4D1E A;  1HQV A;  2JT8 A;  3JTD B;  1OZS A;  3UO9 A;  2M97 A;  2LMV A;  2EC6 B;  2KI6 D;  3PM8 A;  5CSF A;  3PM2 A;  4QJ4 B;  2OPO A;  1WLZ A;  2RGI A;  1SKT A;  3EKH A;  4PAL A;  4YGC B;  3L4L A;  5I94 A;  4INX A;  1NX2 A;  1M31 A;  1R6P A;  2BCB A;  1SL9 A;  1UUR A;  1KWO C;  5CSN A;  2CXJ A;  1DJW A;  1Y0V H;  1YUT A;  1JSA A;  1MUX A;  3I5I B;  2WCB A;  4ORB B;  2WCE A;  2LMU A;  5HL1 A;  4INW A;  2OTG B;  1B7T Y;  2KI4 C;  2MAZ A;  3EKJ A;  2BBN A;  2K2A A;  3SS4 A;  4A4C A;  1PRW A;  3WNX B;  1ODB A;  1V1F A;  2K7D A;  2KAV A;  1TCF A;  2Q4U A;  4IJ7 A;  1C7W A;  4ETO A;  1DGU A;  1QAS A;  1B8C A;  3A4U B;  1TOP A;  3F45 A;  2LVK A;  3B6X A;  2L98 A;  3MSE B;  2Q91 A;  2F8P A;  2HF5 A;  2ZFD A;  1V1G A;  4YGE B;  1TIZ A;  3BUN B;  1YVL A;  1OMV A;  1CM4 A;  1WLM A;  2WCH A;  1ZOT B;  3EG5 B;  3CZ2 A;  5BPJ A;  3DD4 A;  5K89 A;  4WQ3 A;  3BFB A;  1CFF A;  1MQ1 A;  2P70 A;  4JD9 A;  2G9B A;  2WCJ A;  2SAS A;  3TZ1 A;  1KK8 C;  1JFJ A;  2ZN9 A;  1F8H A;  4CFR A;  1TWO A;  2QEB A;  2KDH A;  1KQM C;  3PN7 C;  4WQ2 A;  3S0A A;  3TUY C;  1DMO A;  4FQO A;  2KAX A;  3UNW A;  3BUM B;  2JXL A;  2Y5I A;  4CLN A;  3I5H B;  2BE4 A;  1NX1 A;  2LUC A;  1AJ5 A;  3GK4 X;  3KO0 A;  4I5N B;  2TN4 A;  2QDI A;  1DEK A;  1FI6 A;  4HRH A;  2KHN A;  1IWQ A;  2M49 B;  5CPV A;  1B4C A;  2LMT A;  5FI2 A;  2DOQ A;  1UP5 A;  3I5F C;  2JNF A;  4ICB A;  4JPZ B;  3VRP A;  4PDZ A;  4MZK A;  1QX5 B;  1QTX A;  1J7O A;  2JTT A;  2KGR A;  2SCP A;  1F71 A;  1UHI A;  1XFV O;  2PQL A;  3FWC A;  1ZAC A;  1P28 A;  1K94 A;  2GV5 A;  1XFU O;  2LC5 A;  3EVR A;  3NHI A;  3EK4 A;  1QWV A;  1A75 A;  2L50 A;  2I18 A;  3TS5 C;  4AOM A;  3DZT A;  1XA5 A;  4MRY A;  1S6I A;  4NDC A;  1BLQ A;  1CDN A;  4MRX A;  5HLV A;  3IVT A;  2AMI A;  2K7O A;  1EXR A;  1CFC A;  2A4J A;  1OSA A;  1EG3 A;  1R2U A;  5PAL A;  1B47 A;  1MWN A;  2JUL A;  1BJF A;  1OOI X;  2HET A;  3DF0 A;  3WXA A;  4XJK A;  5FYX A;  4A4B A;  1S26 D;  1PSB A;  1TCO B;  2R2I A;  4GPL B;  1KFX L;  3OX5 A;  1YRT B;  1TNX A;  1WRZ A;  3O2P A;  1TUZ A;  1N65 A;  2FJY A;  4KYN A;  3IQQ A;  2PAS A;  1RJV A;  1XO5 A;  3DY9 A;  3QRX A;  1CB1 A;  3CTN A;  2FCE A;  1SCV A;  1QXP A;  3D0Y A;  1YX8 A;  2K8M B;  3D73 A;  1OQP A;  1QJT A;  2PSR A;  4OZD A;  1K2H A;  5ER4 X;  2P6B B;  2Y1M A;  3CZ1 A;  3CR5 X;  4MSP A;  3OP0 A;  2F3Z A;  3O4Y A;  4GAO A;  4FQT A;  4GGF C;  2LV7 A;  1GGZ A;  1MXE A;  3B88 A;  1REC A;  1QV0 A;  1U5I B;  3ZWH A;  3N7H A;  1YUU A;  2MLE C;  1LIN A;  2JTZ A;  1TNW A;  1BU3 A;  3CZT X;  2JOJ A;  4P2Y B;  5CSI A;  1NYA A;  3LCP C;  1AP4 A;  2M1K B;  3CZ0 A;  1B8R A;  1CTR A;  3R72 A;  1DTL A;  1DF0 B;  2I2R E;  1K96 A;  2M0R A;  3JVT B;  4JWQ A;  4PT1 A;  1QAT A;  1KWO B;  1X02 A;  1FPW A;  2L2C A;  1NX3 A;  1JF2 A;  2E30 A;  2KSP A;  3PAT A;  1BMO A;  4NDB A;  1IJ6 A;  4YGB B;  3BOW B;  2H8V A;  1PAL A;  2BCX A;  2L5X B;  1NUB A;  4M2O A;  3CYZ A;  1HT9 A;  3FS7 A;  2WCK A;  3R1V A;  2KI4 B;  3TDZ A;  4PE1 A;  3SG3 A;  4OCI A;  1F54 A;  2KBM A;  3VRN A;  3L4A A;  5KU1 A;  4PHM A;  1Q80 A;  2NXQ A;  2ZN8 A;  1C3Y A;  3O4X A;  1S5G Z;  1QVI Y;  1EJ3 A;  1GJY A;  1UWO A;  4ORC B;  1D1O A;  4I5K A;  1S36 A;  4N5X A;  4U8D A;  5AAN A;  4DCK A;  1KCY A;  4MBE A;  1CLB A;  2MLF C;  2F33 A;  2BL0 C;  3DVM A;  4HRG A;  1LA0 A;  2KFH A;  2KI6 C;  3EVU A;  1B9A A;  4NQG A;  3OBV A;  3SG5 A;  3S0E A;  3OB1 B;  4OKH A;  3S0B A;  1UHJ A;  4ORA B;  3PJI A;  1S1E A;  2M7N A;  1Z2C B;  1KK8 B;  3PSR A;  5CSJ A;  5G08 A;  3WHT B;  4AQJ A;  5KSZ A;  2WOR A;  1LS8 A;  3CR2 A;  1Y1U A;  2YGU A;  1KQM B;  3PN7 B;  3TUY B;  4CFQ A;  2V53 A;  1TNQ A;  2KOT A;  1FF1 A;  5AEQ A;  2M3W A;  3R1O A;  1BG1 A;  1K8U A;  2G2B A;  1F4Q A;  4DUQ A;  2KLE A;  3CS1 A;  5FI7 A;  3SIA A;  5D7F A;  1DJH A;  2K2F A;  2QEH A;  3FE6 A;  3A8R A;  3VRO A;  5DKQ A;  3I5F B;  3S0F A;  3BFH A;  2LHI A;  5TNC A;  2BKI B;  2L2E A;  1DQE A;  1KFU L;  1SCM C;  2BBM A;  2H61 A;  4GBA A;  2LHL A;  3DXL A;  4BY5 A;  4DS7 A;  1K95 A;  2BNX A;  2E6W A;  5I2Q A;  2H61 C;  3D77 A;  5AXI A;  1AUI B;  3TS5 B;  2CBL A;  3VRR A;  5HKZ A;  3DVK A;  1OOH A;  3AKA A;  2KQ6 A;  2F2P A;  2WC6 A;  1KSO A;  3VGO A;  1IGV A;  2LM5 A;  3B7A A;  1J55 A;  2LP3 A;  2MJW B;  3CAB A;  3HX4 A;  3NGV A;  1DT7 B;  1PVA A;  2LNK A;  1WRL A;  1SL7 A;  1J7P A;  1BT6 A;  3KHE A;  1GM0 A;  1LXF C;  5HYD A;  3M0W A;  1SR6 B;  1N0Y A;  1M63 B;  1MHO A;  2JXC A;  4ZCU A;  2BCA A;  3AKB A;  1L7Z A;  5AER A;  3V2L A;  2KGB C;  4P5O E;  2JPT A;  3O78 A;  1AVS A;  2LLS A;  2MRD A;  4YI8 A;  2L0P A;  1KK7 Z;  3C1V A;  1UHK A;  3DYE A;  1CKK A;  1BOC A;  1F70 A;  1JUO A;  3S0D A;  1QIV A;  1SMG A;  1SNL A;  1DC1 A;  1Y1X A;  1IQ5 A;  4ZCV A;  2JRF A;  1YTZ C;  2HQW A;  3BYA A;  1G8I A;  1NIW A;  3TDI A;  1WY9 A;  4YRU A;  4GGN A;  1QX7 A;  2M9G A;  2LVI A;  3K21 A;  3QME A;  1LKJ A;  2LVJ A;  4MZL A;  2M7L A;  4HRE E;  3NXA A;  3VB1 A;  2ZKM X;  3DVE A;  1CFD A;  1BR4 B;  1QLS A;  3EK8 A;  4YGD B;  4OV2 A;  1CMG A;  3I5G C;  2JT0 A;  5B8I B;  2KAY A;  1H8B A;  3BUW B;  3BQ3 A;  3I5H C;  3KEV A;  3NSO A;  1IRJ A;  3D78 A;  1KSM A;  2ZNE A;  3TDU A;  1IIO A;  1TNP A;  4PHK A;  3SG4 A;  2CCM A;  2HQ8 A;  3B87 A;  1WDC C;  3EVV A;  1RK9 A;  1YUS A;  2EGD A;  1PVB A;  5JOL A;  3SIB A;  2O5G A;  1S6C A;  3LLE A;  1M46 A;  1W9Z A;  1ZUZ A;  4WRI A;  4OR9 B;  3SG7 A;  5HKW A;  4R1E A;  3K1E A;  2KYC A;  1A29 A;  2WCL A;  3CLN A;  1AK8 A;  3LL8 B;  1A03 A;  1NSH A;  4GNK B;  1ALV A;  1MR8 A;  2PYQ A;  3D76 A;  1N2D A;  2OS8 C;  4TNC A;  1OW4 A;  1EH2 A;  5J3X A;  1ORG A;  2FJU B;  3AAJ A;  2CT9 A;  1C07 A;  1XFZ O;  5FI6 A;  2GGM A;  5KTY A;  5I8N A;  3KPX A;  4QJ5 B;  2K7B A;  2QAC A;  3H4S E;  2LAP A;  1CLM A;  1AHR A;  3PFV A;  4F7F A;  1L2O C;  1RRO A;  1NCY A;  2JC2 A;  1IKU A;  2IS9 A;  1CNP A;  2JQ6 A;  1NX0 A;  1DEL A;  2KNE A;  2FCD A;  2BAP A;  1CMF A;  1CFP A;  4CID A;  2PRU A;  5ER5 A;  1OOG A;  2H2K A;  3FWB A;  1DVI A;  2QPT A;  3LK1 A;  4PHJ A;  2MHH A;  3SS3 A;  2AUC A;  2PMY A;  2L51 A;  3KF9 A;  1Y6W A;  2LAN A;  1H4B A;  1Z4H A;  4F0Z B;  3IF7 A;  1XK4 A;  1SCM B;  1B7T Z;  2KQY A;  1RWY A;  2VRG A;  3BXK A;  5JJG A;  2BKH B;  1ZMZ A;  1J7Q A;  1WRK A;  2MA2 A;  4BY4 A;  4Q04 A;  4YBH B;  1FI5 A;  1U5I A;  1IH0 A;  1FW4 A;  3OX6 A;  3RZS A;  2PAL A;  1IQ3 A;  1UHN A;  1QLK A;  1JF0 A;  1M39 A;  2ISD A;  2KFG A;  3BUO B;  1DJZ A;  4DRW A;  2M1U A;  4PHN A;  1DJY A;  1S5G Y;  1W7J B;  1DJX A;  1DF0 A;  1OMR A;  1TRF A;  1IG5 A;  2K60 A;  1KFX S;  4HSZ A;  4MN0 A;  4C0J A;  1UUS A;  2KBI A;  3ZNI A;  4L9M A;  1CDP A;  3L47 A;  5I2L A;  4PCW A;  3JVT C;  2I94 A;  3GOF A;  1GQM A;  3BOW A;  1F55 A;  3BFA A;  1M45 A;  4MZJ A;  2LP2 A;  5I2O A;  1CLL A;  1YUR A;  2CNP A;  2WC8 A;  3CGA A;  1SBJ A;  2FOT A;  4YGA A;  1LA3 A;  3CWG A;  1QV1 A;  5DKR A;  1QX2 A;  2O60 A;  3JTD C;  3NSL A;  5DKN A;  1A75 B;  1AJ4 A;  1FBV A;  1NWD A;  2EC6 C;  1K90 D;  4CPV A;  3BJH A;  1C7V A;  1CDL A;  1OZO A;  4PE4 A;  3CR4 X;  3OB2 B;  4MLW A;  3SG2 A;  1XFW O;  2BE6 A;  3NHT A;  2F2O A;  1DJG A;  1K93 D;  1DJI A;  4C0L A;  2L4I A;  3HCM A;  4QJ3 B;  3I5I C;  5GQQ C;  5F6T A;  5DIC A;  4N1G A;  3DF0 B;  2OTG C;  4XJK B;  2NCP A;  3O6B A;  2LLU A;  4I5L B;  1Y1A A;  4NDD A;  1SRA A;  4M2P A;  3FIA A;  2LE9 B;  1SK6 D;  1E8A A;  2NZ0 A;  3GK1 A;  1JFK A;  3D74 A;  4GFT A;  2D8N A;  3I5G B;  3RLZ A;  3DVJ A;  1K9P A;  4IL1 A;  1F4O A;  3E3R A;  4I5J A;  2ZRS A;  1RTP 1;  4N1F A;  2NLN A;  1NP8 A;  2WC5 A;  3Q8I A;  3WHU B;  1WDC B;  3D0Y B;  3EK7 A;  3B86 A;  1SL8 A;  2WCM A;  3LK0 A;  1TUJ A;  5EL2 A;  3RM1 A;  4OVN F;  1XVJ A;  4JQ0 D;  1SYM A;  2KPH A;  3SS5 A;  1A4P A;  1TTX A;  2KFF A;  3PLF B;  5AFP A;  1ALW A;  1NPQ A;  2Y4Q A;  3BUX B;  1CM1 A;  1MXL C;  1S6J A;  4MVF A;  3ICB A;  2OS8 B;  5HKY A;  1GGW A;  1T14 A;  3FE9 A;  1YVH A;  2JWW A;  1SSE B;  4JKT A;  1B1G A;  1KK7 Y;  3R1P A;  4PE7 A;  1QIW A;  2B1U A;  4XYN A;  2WND A;  2K0J A;  4GUK A;  4USL A;  4FTG A;  2JT3 A;  1S3P A;  2PVB A;  1L2O B;  1NCZ A;  1SR6 C;  4AQI A;  2CTN A;  1A2X A;  1J1E A;  1MF8 B;  1SPY A;  1XFY O;  2F3Y A;  2JPO A;  3OGN A;  4YI9 A;  3VRQ A;  4C0K A;  2LUX A;  2NCO A;  1NCX A;  3AAK A;  1OOF A;  2BEC A;  4DIR A;  1JC2 A;  1PSR A;  3SJS A;  1KFU S;  2JZI A;  3IQO A;  2JU0 A;  1PK0 D;  2GTE A;  1IJ5 A;  3PAL A;  4PE0 A;  2I7A A;  2COL B;  1TN4 A;  2WCF A;  2BL0 B;  2M8U A;  5IBW A;  2LCP A;  3NSK A;  1XFR A;  1OMD A;  4UPG A;  1LVC D;  1OE9 B;  1W7I B;  1G33 A;  2KLD A;  1K9K A;  4MEW A;  5D69 A;  1B8L A;  4GGF A;  1XFX O;  1SW8 A;  3SG6 A;  2LLT A;  3S0G A;  2ZND A;  1YRU B;  1QVI Z;  3OHM B;  1SY9 A;  2P71 A;  1J7R A;  3FE8 A;  3GK2 A;  1DGV A;  1RFJ A;  1UHH A;  4M2Q A;  2ZRT A;  1BOD A;  1JBA A;  2KYF A;  2QEV A;  2ERB A;  2L4H A;  2WOS A;  1J1D A;  2JNX A;  5D3O A;  1OOJ A;  3D75 A;  2MBX A;  3D10 A;  1C3Z A;  3CDN A;  2EHB A;  1EL4 A;  2L5Y A;  1ZFS A;  1G4Y R;  2AAO A;  1PUL A;  1YR5 A;  2GGZ A;  5HLO A;  2M29 A;  1BR1 B;  1QS7 A;  1BF5 A;  2HPS A; 
#chains in the Genus database with same CATH homology
 3D73 A;  4OZD A;  2QEO A;  3CZ1 A;  3BJH A;  4FQT A;  3B88 A;  3NHT A;  3N7H A;  3QME A;  3L4L A;  4INX A;  3VB1 A;  3CZ0 A;  3R72 A;  5DIC A;  4PT1 A;  2L2C A;  4INW A;  2H8V A;  3D78 A;  3D74 A;  3CYZ A;  2WCK A;  3R1V A;  3B87 A;  3L4A A;  2WC5 A;  3Q8I A;  1C3Y A;  3B86 A;  2WCM A;  1TUJ A;  5EL2 A;  3K1E A;  2WCL A;  3B6X A;  2KPH A;  3D76 A;  1OW4 A;  2WCH A;  1ORG A;  3CZ2 A;  3S0E A;  3BFB A;  2P70 A;  1T14 A;  3FE9 A;  4JD9 A;  2WCJ A;  3R1P A;  3S0B A;  1TWO A;  3PJI A;  4F7F A;  2QEB A;  3S0A A;  1LS8 A;  2QDI A;  2JPO A;  3OGN A;  3R1O A;  1OOG A;  1OOF A;  2QEH A;  3FE6 A;  2GTE A;  2PQL A;  3BFH A;  3S0F A;  1DQE A;  1P28 A;  3DXL A;  3NHI A;  1QWV A;  1XFR A;  3D77 A;  3DZT A;  1OOH A;  2WC6 A;  3RZS A;  3S0G A;  3B7A A;  3CAB A;  3NGV A;  2P71 A;  1GM0 A;  1OOI X;  3FE8 A;  3L47 A;  2QEV A;  2ERB A;  3BFA A;  3V2L A;  3D75 A;  1C3Z A;  3CDN A;  2FJY A;  3DYE A;  3DY9 A;  3S0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...