3S0BA

Apis mellifera obp14 in complex with the fluorescent probe 1-n-phenylnaphthylamine (npn)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
total genus 49
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0bA00
3D78A 3OGNA 1OW4A 3S0EA 2WCHA 2GTEA 3NHIA 2PQLA 1ORGA 5DICA 3R1OA 3D74A 3R1PA 3B88A 4FQTA 4OZDA 3S0AA 2JPOA 2L2CA 4F7FA 3S0BA 2WC6A 2WCJA 3Q8IA 2WC5A 3N7HA 1OOIX 1C3YA 3BFAA 2P71A 2QEVA 3CABA 3NGVA 3L47A 3RZSA 3B6XA 3FE8A 1LS8A 3BJHA 3NHTA 1OOHA 3D75A 1OOGA 3PJIA 4JD9A 3FE9A 2WCKA 3QMEA 1QWVA 2ERBA 1C3ZA 3R72A 3D73A 3S0FA 3DZTA 3L4LA 3CDNA 1OOFA 3S0GA 3CYZA 2H8VA 2QEOA 1TUJA 2QDIA 1TWOA 3R1VA 3L4AA 3D77A 2WCLA 3B87A 1P28A 3DYEA 3B86A 2P70A 3CZ0A 4INWA 3D76A 3CZ1A 3BFHA 4INXA 3BFBA 1T14A 2WCMA 3DY9A 5EL2A 1GM0A 3FE6A 3S0DA 2QEHA 2KPHA 3CZ2A 3K1EA 4PT1A 2FJYA 2QEBA 3B7AA 1DQEA 3VB1A 3V2LA 1XFRA 3DXLA
chains in the Genus database with same CATH superfamily
2LMUA 2FCEA 4PDZA 2QACA 2L51A 1NPQA 1KK8B 3S0EA 1TNPA 4A4CA 1F55A 2NLNA 3GK2A 5FI2A 1NYAA 1UHIA 1OE9B 1ORGA 1S6IA 2F8PA 5DKNA 2M9GA 3SS4A 3D74A 3R1PA 3TDIA 2LMTA 1JBAA 1NX1A 2Y4QA 1MF8B 2FOTA 2LANA 2WCFA 2ZNEA 2G2BA 3OB2B 3JTDC 1FW4A 3S0AA 1W7IB 1ZMZA 2E30A 4WQ3A 1WDCB 5AXIA 1EH2A 2BECA 2MLFC 1MXEA 2Y5IA 4YI9A 1B9AA 1OZSA 1SRAA 2KI4B 2WC6A 2WCJA 1D1OA 5DKRA 1K95A 1F4OA 1SL7A 2Q4UA 3CR2A 2AUCA 4PE1A 1C3YA 4PHNA 1F70A 1NSHA 1QXPA 1RJVA 1ODBA 4MLWA 2MBXA 4YGBB 1JWDA 1QVIZ 2BL0C 1K8UA 3DVEA 4YGEB 2I18A 5I2LA 1QJTA 3GOFA 3NGVA 3L47A 5CSNA 1A29A 1TTXA 3NHTA 1ZUZA 1OOHA 4IJ7A 4Q04A 1XYDA 1DF0B 2KQYA 3HX4A 1IG5A 1RTP1 3BYAA 3PN7C 3CZTX 3SIAA 2M3WA 3IF7A 4JD9A 4PHJA 5KSZA 2WCKA 3QMEA 1SKTA 4ZCUA 1QIVA 4DIRA 1G8IA 1SYMA 1OMRA 1K9UA 2AAOA 2ERBA 2A4JA 2LVIA 3ZNIA 1PRWA 3NSKA 1YRTB 2F3YA 2KHNA 3R72A 1DGVA 3K21A 1J7QA 3RLZA 4GGFA 2BKIB 2KYFA 3VGOA 5HKYA 1CMFA 2CBLA 4R1EA 1IRJA 3CDNA 3S0GA 2FJUB 2KDHA 3CYZA 2JT3A 2KGRA 4BY4A 2JRFA 2PVBA 2GV5A 3IVTA 3BQ3A 2PASA 2QDIA 4GFTA 4L9MA 1F71A 1BODA 2EGDA 1EL4A 2LHIA 3KF9A 1KCYA 4PE4A 1GQMA 1CFDA 1DELA 3B87A 1CLMA 3NXAA 2LLSA 3SG3A 5BPJA 3B86A 1JF0A 1NX3A 2HETA 4ICBA 2L5XB 1DVIA 3BOWA 3CZ0A 3I5FC 2JTTA 3NSLA 2BCAA 1HQVA 2H61A 3EKJA 2NCPA 5HL1A 2K7DA 2FCDA 5CPVA 4INXA 3BFBA 1XFYO 4OR9B 4CFRA 3O4YA 1YTZC 3AKAA 2LCPA 1BOCA 2WCMA 4DCKA 1QVIY 3FE6A 1UURA 3CS1A 4D1EA 1SL8A 5FYXA 1TNWA 5KTYA 5HKZA 3I5FB 1TN4A 3CZ2A 1YUTA 2BCBA 3AAJA 1QIWA 2LLUA 2M7NA 2WCBA 1TCFA 1YURA 3K1EA 4PT1A 1B8RA 1B1GA 1J7RA 2SCPA 3CGAA 2MA2A 1BF5A 1X02A 1W9ZA 2NCOA 1DQEA 2ISDA 1ALVA 2ZN8A 2HQ8A 1RECA 2WCEA 1QV1A 1M39A 2KSPA 4GPLB 1LXFC 1R2UA 3D78A 1CDMA 1OMVA 1J7PA 2LM5A 4FQOA 3O6BA 1A03A 2K61A 1IIOA 4NQGA 1U5IB 2KLEA 1CLBA 2GGZA 1CLLA 4HRGA 3CR4X 4U8DA 2JU0A 5JOLA 2LE9B 1SL9A 2LNKA 1DF0A 4XJKA 2JPOA 2M29A 5K89A 1WLZA 2JZIA 1DT7B 3TZ1A 1S6CA 3S0BA 4I5KA 3SG7A 2M8UA 4NDCA 2B1UA 3I5IC 4ETOA 3WXAA 1OOIX 2LUCA 3VRPA 1KQMC 1AUIB 1W7JB 3PM8A 1JFJA 3SS3A 1SNLA 2QEVA 4CIDA 1UUSA 4MEWA 1YVHA 5F6TA 1QS7A 5CSJA 2EC6C 1M31A 3B6XA 4DRWA 2ZFDA 3FE8A 1LS8A 2LVJA 1CTRA 2WNDA 2ZRSA 3O78A 4A4BA 2F33A 1KK7Z 1Z2CB 1BR1B 1B8CA 1Z4HA 2BKHB 3D10A 1YUUA 4MZLA 2WORA 3PJIA 1DGUA 3M0WA 1ALWA 1OSAA 4MZKA 1NCXA 2BBNA 2F3ZA 1MQ1A 4CFQA 1KQMB 1C07A 2COLB 1PSRA 1BJFA 3GK1A 2LC5A 3ZWHA 1DJIA 2MLEC 3LCPC 4CPVA 1F54A 4JKTA 4NDBA 2HQWA 1GGWA 4OVNF 3BUMB 2KBMA 2LV7A 5B8IB 5D69A 1IQ3A 2LAPA 4USLA 3JVTC 1G4YR 2PSRA 3FWBA 3L4LA 2KOTA 1OOFA 1OOJA 1J7OA 3JTDB 1E8AA 1EG4A 1QATA 2I94A 2QEOA 2TN4A 1CDPA 3NSOA 1JC2A 1XFXO 1XA5A 4XJKB 2KYCA 1EJ3A 3R1VA 2WCLA 3A8RA 1TRFA 3HCMA 1Y0VH 4ORAB 4MBEA 1S36A 3DYEA 1K9KA 5ER4X 2BL0B 1K93D 3CR5X 4AQIA 3TS5C 4IL1A 2R2IA 5D3OA 2JTZA 3VROA 1RFJA 1T14A 3CLNA 4PE7A 5TNCA 2K2AA 5CSIA 3SJSA 1JFKA 2K60A 1J55A 2KI6C 3PN7B 2M97A 3LLEA 1CNPA 3O2PA 5EL2A 3BUOB 1GM0A 1U5IA 2LVKA 4YGAA 3WNXB 5HYDA 2PYQA 1NCYA 3WHTB 1DMOA 2QEHA 1CKKA 2KPHA 1ZFSA 3LK1A 1GJYA 1KK7Y 1KFUL 2FJYA 1QLSA 3FWCA 1WY9A 2JT8A 1TCOB 1S6JA 2BCXA 4OV2A 1B8LA 1TNQA 2F2PA 3C1VA 3SG2A 3V2LA 5I2OA 1YX7A 3EK8A 1NX2A 2CT9A 2L5YA 2BBMA 1IWQA 2WC8A 2L98A 1MXLC 3BUXB 5I94A 1RROA 2WCHA 1IGVA 3SG5A 4AQJA 2L4IA 1Y1AA 2LHLA 3CTNA 3NHIA 3SIBA 1CDNA 2AMIA 4FQTA 1QX2A 3B88A 4OZDA 4YRUA 1K2HA 1J1EA 4KYNA 1SR6C 1LINA 1VRKA 2OTGC 3EVRA 1A75B 1Y1XA 2L2CA 3RM1A 4C0JA 1QX5B 1Y6WA 4F7FA 4M2OA 3IQOA 4HSZA 1CM1A 1M45A 1CFCA 4P5OE 3KPXA 4P2YB 1RK9A 2KI6D 5J3XA 2WC5A 1YRUB 3N7HA 5HLVA 1H8BA 5DKQA 2EHBA 3BFAA 1SMGA 3AKBA 4GGNA 2P71A 3VRRA 1XK4A 1KSMA 2LMVA 2JXLA 1KFXL 2BAPA 3E3RA 3I5GC 1SR6B 2SASA 2IS9A 2OTGB 3CABA 3RZSA 2JOJA 1TIZA 1N0YA 2CTNA 1BMOA 1QV0A 2JWWA 2P6BB 3IQQA 3BJHA 5AANA 4MZJA 1MR8A 1DJYA 1QTXA 2I7AA 2M49B 2LVVA 1BU3A 3A4UB 1J1DA 2BNXA 2KAXA 3DVJA 2L50A 3PLFB 1LVCD 5I2QA 2L4HA 3EK7A 4MRXA 2NZ0A 4FTGA 1R6PA 3I5GB 1HT9A 3OB1B 4I5NB 2MJWB 2M0RA 2LLTA 1CFFA 1SCMC 3D73A 4GNKB 1NIWA 3DZTA 1GGZA 2OPOA 4N1FA 2KAVA 1BT6A 4PHMA 3F45A 1DC1A 1IJ5A 2JXCA 4ORCB 1MHOA 1XK4C 4YI8A 3OX6A 1Y1UA 4PE0A 1YUSA 3BXKA 1PULA 1C7VA 1AJ5A 1SCVA 1FI6A 1UHKA 4HRHA 1TWOA 3EK4A 4YGDB 3I5IB 1N65A 4OKHA 1P28A 4MRYA 1JSAA 1M46A 2QPTA 1SCMB 1UP5A 3OX5A 2P70A 2D8NA 2H2KA 4INWA 1FBVA 3D76A 2MAZA 3D0YB 2NXQA 1B4CA 2K0JA 2LP3A 2EC6B 2ZN9A 1BR4B 1AP4A 1NUBA 1OMDA 3DVMA 1NP8A 2KQ6A 2KAYA 3EVUA 1KSOA 3FIAA 3I5HC 1H4BA 1K90D 1M63B 2CXJA 2O60A 3MSEB 1KFUS 3DY9A 2K2FA 3SS5A 1L2OC 1CMGA 4QJ4B 5G08A 1WLMA 3TDUA 1FI5A 2JC2A 3EKHA 1DTLA 1A4PA 5HKWA 4OCIA 1A75A 4QJ3B 2KFFA 1EXRA 1YR5A 1G33A 4PALA 1WRLA 2QEBA 1AVSA 1XFVO 1FF1A 1B47A 3B7AA 3BUWB 3AAKA 3PM2A 3QRXA 4ZCVA 1KWOC 5AFPA 2K8MB 3JVTB 3KHEA 4JPZB 4M2PA 3I5HB 4WQ2A 4TNCA 2KFGA 2OS8C 3UO9A 2Y1MA 1XFWO 3PSRA 4CLNA 1IJ6A 4UPGA 4GBAA 5JJGA 1L2OB 1UWOA 2RGIA 3OGNA 1OZOA 1OW4A 1NX0A 2K7CA 1FPWA 1CM4A 1DJGA 1PK0D 1QASA 2GTEA 3PATA 5IBWA 5I8NA 5ER5A 2PQLA 4M2QA 3FS7A 4JQ0D 5DICA 4ORBB 4PCWA 3R1OA 4HREE 1CDLA 4DS7A 1CB1A 4GUKA 1IH0A 2ZNDA 1AHRA 1Q80A 1S3PA 4NDDA 1KWOB 5FI6A 1F4QA 4N5XA 1S26D 1S5GZ 3OP0A 2OS8B 1C7WA 3NSIA 1SW8A 2ZKMX 3TS5B 2E6WA 2JPTA 2Q91A 1XVJA 1A2XA 2WOSA 4C0KA 3Q8IA 1KFXS 1B7TZ 4I5JA 2GGMA 2LP2A 1QX7A 3DF0A 1AK8A 2VRGA 1MUXA 3DVKA 1PALA 5FI7A 3OHMB 5AEQA 2KNEA 1SPYA 3SG6A 2LUXA 4MN0A 4DUQA 3DD4A 1K96A 3KO0A 4MVFA 4GAOA 3H4SE 2V53A 1LA0A 2K7BA 3D75A 2JULA 2CCMA 3EVVA 1OOGA 1YVLA 2MHHA 1OQPA 2Y1NA 1SY9A 1PVAA 1IKUA 1YX8A 3FE9A 1SBJA 2JNXA 1QWVA 2YGUA 1ZACA 4QJ5B 2HPSA 2PALA 1NCZA 1C3ZA 3LK0A 1WRZA 2KLDA 3EG5B 3D0YA 1UHHA 2F2OA 2M1UA 2JNFA 1DJZA 3TDZA 2KGBC 1V1GA 3S0FA 5HLOA 3CWGA 1JF2A 4YGCB 3UNWA 1CFPA 3O4XA 4E68A 1AJ4A 1EG3A 1PSBA 4GGFC 2L2EA 3VRNA 2H8VA 1PVBA 2BE6A 1TUJA 1JUOA 3BUNB 3SG4A 4N1GA 3TUYC 1NWDA 3L4AA 3D77A 4XYNA 2I2RE 2MRDA 2JQ6A 1N2DA 4YBHB 5CSFA 1KQVA 1LKJA 5PALA 3OBVA 4PHKA 2O5GA 1K9PA 2CNPA 2ZRTA 2JT0A 3CZ1A 3DF0B 4I5LB 3BFHA 1S5GY 1DJHA 1V1FA 1WRKA 4JWQA 1TUZA 1XO5A 2H61C 1B7TY 1DJWA 1MWNA 1RWYA 3VRQA 2M7LA 4C0LA 1BLQA 3TUYB 1DEKA 3KEVA 1TOPA 3PALA 1S1EA 2M1KB 3ICBA 5D7FA 5GQQC 1TNXA 1DJXA 1K94A 4BY5A 2G9BA 1KK8C 4MSPA 1L7ZA 1F8HA 1XFUO 3S0DA 4AOMA 2PRUA 1QLKA 3LL8B 3PFVA 1ZOTB 1SK6D 2DOQA 3BOWB 1UHJA 2HF5A 1LA3A 2KBIA 2K7OA 3GK4X 1BG1A 1XFZO 1IQ5A 3VB1A 3WHUB 4F0ZB 2L0PA 2BE4A 2KFHA 1WDCC 1UHNA 5KU1A 5AERA 1SSEB 1XFRA 4WRIA 2KI4C 2PMYA 3DXLA
chains in the Genus database with same CATH topology
3D78A 3OGNA 1OW4A 3S0EA 2WCHA 2GTEA 3NHIA 2PQLA 1ORGA 5DICA 3R1OA 3D74A 3R1PA 3B88A 4FQTA 4OZDA 3S0AA 2JPOA 2L2CA 4F7FA 3S0BA 2WC6A 2WCJA 3Q8IA 2WC5A 3N7HA 1OOIX 1C3YA 3BFAA 2P71A 2QEVA 3CABA 3NGVA 3L47A 3RZSA 3B6XA 3FE8A 1LS8A 3BJHA 3NHTA 1OOHA 3D75A 1OOGA 3PJIA 4JD9A 3FE9A 2WCKA 3QMEA 1QWVA 2ERBA 1C3ZA 3R72A 3D73A 3S0FA 3DZTA 3L4LA 3CDNA 1OOFA 3S0GA 3CYZA 2H8VA 2QEOA 1TUJA 2QDIA 1TWOA 3R1VA 3L4AA 3D77A 2WCLA 3B87A 1P28A 3DYEA 3B86A 2P70A 3CZ0A 4INWA 3D76A 3CZ1A 3BFHA 4INXA 3BFBA 1T14A 2WCMA 3DY9A 5EL2A 1GM0A 3FE6A 3S0DA 2QEHA 2KPHA 3CZ2A 3K1EA 4PT1A 2FJYA 2QEBA 3B7AA 1DQEA 3VB1A 3V2LA 1XFRA 3DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D78 A;  3OGN A;  1OW4 A;  3S0E A;  2WCH A;  2GTE A;  3NHI A;  2PQL A;  1ORG A;  5DIC A;  3R1O A;  3D74 A;  3R1P A;  3B88 A;  4FQT A;  4OZD A;  3S0A A;  2JPO A;  2L2C A;  4F7F A;  3S0B A;  2WC6 A;  2WCJ A;  3Q8I A;  2WC5 A;  3N7H A;  1OOI X;  1C3Y A;  3BFA A;  2P71 A;  2QEV A;  3CAB A;  3NGV A;  3L47 A;  3RZS A;  3B6X A;  3FE8 A;  1LS8 A;  3BJH A;  3NHT A;  1OOH A;  3D75 A;  1OOG A;  3PJI A;  4JD9 A;  3FE9 A;  2WCK A;  3QME A;  1QWV A;  2ERB A;  1C3Z A;  3R72 A;  3D73 A;  3S0F A;  3DZT A;  3L4L A;  3CDN A;  1OOF A;  3S0G A;  3CYZ A;  2H8V A;  2QEO A;  1TUJ A;  2QDI A;  1TWO A;  3R1V A;  3L4A A;  3D77 A;  2WCL A;  3B87 A;  1P28 A;  3DYE A;  3B86 A;  2P70 A;  3CZ0 A;  4INW A;  3D76 A;  3CZ1 A;  3BFH A;  4INX A;  3BFB A;  1T14 A;  2WCM A;  3DY9 A;  5EL2 A;  1GM0 A;  3FE6 A;  3S0D A;  2QEH A;  2KPH A;  3CZ2 A;  3K1E A;  4PT1 A;  2FJY A;  2QEB A;  3B7A A;  1DQE A;  3VB1 A;  3V2L A;  1XFR A;  3DXL A; 
#chains in the Genus database with same CATH topology
 2LMU A;  2FCE A;  4PDZ A;  2QAC A;  2L51 A;  1NPQ A;  1KK8 B;  3S0E A;  1TNP A;  4A4C A;  1F55 A;  2NLN A;  3GK2 A;  5FI2 A;  1NYA A;  1UHI A;  1OE9 B;  1ORG A;  1S6I A;  2F8P A;  5DKN A;  2M9G A;  3SS4 A;  3D74 A;  3R1P A;  3TDI A;  2LMT A;  1JBA A;  1NX1 A;  2Y4Q A;  1MF8 B;  2FOT A;  2LAN A;  2WCF A;  2ZNE A;  2G2B A;  3OB2 B;  3JTD C;  1FW4 A;  3S0A A;  1W7I B;  1ZMZ A;  2E30 A;  4WQ3 A;  1WDC B;  5AXI A;  1EH2 A;  2BEC A;  2MLF C;  1MXE A;  2Y5I A;  4YI9 A;  1B9A A;  1OZS A;  1SRA A;  2KI4 B;  2WC6 A;  2WCJ A;  1D1O A;  5DKR A;  1K95 A;  1F4O A;  1SL7 A;  2Q4U A;  3CR2 A;  2AUC A;  4PE1 A;  1C3Y A;  4PHN A;  1F70 A;  1NSH A;  1QXP A;  1RJV A;  1ODB A;  4MLW A;  2MBX A;  4YGB B;  1JWD A;  1QVI Z;  2BL0 C;  1K8U A;  3DVE A;  4YGE B;  2I18 A;  5I2L A;  1QJT A;  3GOF A;  3NGV A;  3L47 A;  5CSN A;  1A29 A;  1TTX A;  3NHT A;  1ZUZ A;  1OOH A;  4IJ7 A;  4Q04 A;  1XYD A;  1DF0 B;  2KQY A;  3HX4 A;  1IG5 A;  1RTP 1;  3BYA A;  3PN7 C;  3CZT X;  3SIA A;  2M3W A;  3IF7 A;  4JD9 A;  4PHJ A;  5KSZ A;  2WCK A;  3QME A;  1SKT A;  4ZCU A;  1QIV A;  4DIR A;  1G8I A;  1SYM A;  1OMR A;  1K9U A;  2AAO A;  2ERB A;  2A4J A;  2LVI A;  3ZNI A;  1PRW A;  3NSK A;  1YRT B;  2F3Y A;  2KHN A;  3R72 A;  1DGV A;  3K21 A;  1J7Q A;  3RLZ A;  4GGF A;  2BKI B;  2KYF A;  3VGO A;  5HKY A;  1CMF A;  2CBL A;  4R1E A;  1IRJ A;  3CDN A;  3S0G A;  2FJU B;  2KDH A;  3CYZ A;  2JT3 A;  2KGR A;  4BY4 A;  2JRF A;  2PVB A;  2GV5 A;  3IVT A;  3BQ3 A;  2PAS A;  2QDI A;  4GFT A;  4L9M A;  1F71 A;  1BOD A;  2EGD A;  1EL4 A;  2LHI A;  3KF9 A;  1KCY A;  4PE4 A;  1GQM A;  1CFD A;  1DEL A;  3B87 A;  1CLM A;  3NXA A;  2LLS A;  3SG3 A;  5BPJ A;  3B86 A;  1JF0 A;  1NX3 A;  2HET A;  4ICB A;  2L5X B;  1DVI A;  3BOW A;  3CZ0 A;  3I5F C;  2JTT A;  3NSL A;  2BCA A;  1HQV A;  2H61 A;  3EKJ A;  2NCP A;  5HL1 A;  2K7D A;  2FCD A;  5CPV A;  4INX A;  3BFB A;  1XFY O;  4OR9 B;  4CFR A;  3O4Y A;  1YTZ C;  3AKA A;  2LCP A;  1BOC A;  2WCM A;  4DCK A;  1QVI Y;  3FE6 A;  1UUR A;  3CS1 A;  4D1E A;  1SL8 A;  5FYX A;  1TNW A;  5KTY A;  5HKZ A;  3I5F B;  1TN4 A;  3CZ2 A;  1YUT A;  2BCB A;  3AAJ A;  1QIW A;  2LLU A;  2M7N A;  2WCB A;  1TCF A;  1YUR A;  3K1E A;  4PT1 A;  1B8R A;  1B1G A;  1J7R A;  2SCP A;  3CGA A;  2MA2 A;  1BF5 A;  1X02 A;  1W9Z A;  2NCO A;  1DQE A;  2ISD A;  1ALV A;  2ZN8 A;  2HQ8 A;  1REC A;  2WCE A;  1QV1 A;  1M39 A;  2KSP A;  4GPL B;  1LXF C;  1R2U A;  3D78 A;  1CDM A;  1OMV A;  1J7P A;  2LM5 A;  4FQO A;  3O6B A;  1A03 A;  2K61 A;  1IIO A;  4NQG A;  1U5I B;  2KLE A;  1CLB A;  2GGZ A;  1CLL A;  4HRG A;  3CR4 X;  4U8D A;  2JU0 A;  5JOL A;  2LE9 B;  1SL9 A;  2LNK A;  1DF0 A;  4XJK A;  2JPO A;  2M29 A;  5K89 A;  1WLZ A;  2JZI A;  1DT7 B;  3TZ1 A;  1S6C A;  3S0B A;  4I5K A;  3SG7 A;  2M8U A;  4NDC A;  2B1U A;  3I5I C;  4ETO A;  3WXA A;  1OOI X;  2LUC A;  3VRP A;  1KQM C;  1AUI B;  1W7J B;  3PM8 A;  1JFJ A;  3SS3 A;  1SNL A;  2QEV A;  4CID A;  1UUS A;  4MEW A;  1YVH A;  5F6T A;  1QS7 A;  5CSJ A;  2EC6 C;  1M31 A;  3B6X A;  4DRW A;  2ZFD A;  3FE8 A;  1LS8 A;  2LVJ A;  1CTR A;  2WND A;  2ZRS A;  3O78 A;  4A4B A;  2F33 A;  1KK7 Z;  1Z2C B;  1BR1 B;  1B8C A;  1Z4H A;  2BKH B;  3D10 A;  1YUU A;  4MZL A;  2WOR A;  3PJI A;  1DGU A;  3M0W A;  1ALW A;  1OSA A;  4MZK A;  1NCX A;  2BBN A;  2F3Z A;  1MQ1 A;  4CFQ A;  1KQM B;  1C07 A;  2COL B;  1PSR A;  1BJF A;  3GK1 A;  2LC5 A;  3ZWH A;  1DJI A;  2MLE C;  3LCP C;  4CPV A;  1F54 A;  4JKT A;  4NDB A;  2HQW A;  1GGW A;  4OVN F;  3BUM B;  2KBM A;  2LV7 A;  5B8I B;  5D69 A;  1IQ3 A;  2LAP A;  4USL A;  3JVT C;  1G4Y R;  2PSR A;  3FWB A;  3L4L A;  2KOT A;  1OOF A;  1OOJ A;  1J7O A;  3JTD B;  1E8A A;  1EG4 A;  1QAT A;  2I94 A;  2QEO A;  2TN4 A;  1CDP A;  3NSO A;  1JC2 A;  1XFX O;  1XA5 A;  4XJK B;  2KYC A;  1EJ3 A;  3R1V A;  2WCL A;  3A8R A;  1TRF A;  3HCM A;  1Y0V H;  4ORA B;  4MBE A;  1S36 A;  3DYE A;  1K9K A;  5ER4 X;  2BL0 B;  1K93 D;  3CR5 X;  4AQI A;  3TS5 C;  4IL1 A;  2R2I A;  5D3O A;  2JTZ A;  3VRO A;  1RFJ A;  1T14 A;  3CLN A;  4PE7 A;  5TNC A;  2K2A A;  5CSI A;  3SJS A;  1JFK A;  2K60 A;  1J55 A;  2KI6 C;  3PN7 B;  2M97 A;  3LLE A;  1CNP A;  3O2P A;  5EL2 A;  3BUO B;  1GM0 A;  1U5I A;  2LVK A;  4YGA A;  3WNX B;  5HYD A;  2PYQ A;  1NCY A;  3WHT B;  1DMO A;  2QEH A;  1CKK A;  2KPH A;  1ZFS A;  3LK1 A;  1GJY A;  1KK7 Y;  1KFU L;  2FJY A;  1QLS A;  3FWC A;  1WY9 A;  2JT8 A;  1TCO B;  1S6J A;  2BCX A;  4OV2 A;  1B8L A;  1TNQ A;  2F2P A;  3C1V A;  3SG2 A;  3V2L A;  5I2O A;  1YX7 A;  3EK8 A;  1NX2 A;  2CT9 A;  2L5Y A;  2BBM A;  1IWQ A;  2WC8 A;  2L98 A;  1MXL C;  3BUX B;  5I94 A;  1RRO A;  2WCH A;  1IGV A;  3SG5 A;  4AQJ A;  2L4I A;  1Y1A A;  2LHL A;  3CTN A;  3NHI A;  3SIB A;  1CDN A;  2AMI A;  4FQT A;  1QX2 A;  3B88 A;  4OZD A;  4YRU A;  1K2H A;  1J1E A;  4KYN A;  1SR6 C;  1LIN A;  1VRK A;  2OTG C;  3EVR A;  1A75 B;  1Y1X A;  2L2C A;  3RM1 A;  4C0J A;  1QX5 B;  1Y6W A;  4F7F A;  4M2O A;  3IQO A;  4HSZ A;  1CM1 A;  1M45 A;  1CFC A;  4P5O E;  3KPX A;  4P2Y B;  1RK9 A;  2KI6 D;  5J3X A;  2WC5 A;  1YRU B;  3N7H A;  5HLV A;  1H8B A;  5DKQ A;  2EHB A;  3BFA A;  1SMG A;  3AKB A;  4GGN A;  2P71 A;  3VRR A;  1XK4 A;  1KSM A;  2LMV A;  2JXL A;  1KFX L;  2BAP A;  3E3R A;  3I5G C;  1SR6 B;  2SAS A;  2IS9 A;  2OTG B;  3CAB A;  3RZS A;  2JOJ A;  1TIZ A;  1N0Y A;  2CTN A;  1BMO A;  1QV0 A;  2JWW A;  2P6B B;  3IQQ A;  3BJH A;  5AAN A;  4MZJ A;  1MR8 A;  1DJY A;  1QTX A;  2I7A A;  2M49 B;  2LVV A;  1BU3 A;  3A4U B;  1J1D A;  2BNX A;  2KAX A;  3DVJ A;  2L50 A;  3PLF B;  1LVC D;  5I2Q A;  2L4H A;  3EK7 A;  4MRX A;  2NZ0 A;  4FTG A;  1R6P A;  3I5G B;  1HT9 A;  3OB1 B;  4I5N B;  2MJW B;  2M0R A;  2LLT A;  1CFF A;  1SCM C;  3D73 A;  4GNK B;  1NIW A;  3DZT A;  1GGZ A;  2OPO A;  4N1F A;  2KAV A;  1BT6 A;  4PHM A;  3F45 A;  1DC1 A;  1IJ5 A;  2JXC A;  4ORC B;  1MHO A;  1XK4 C;  4YI8 A;  3OX6 A;  1Y1U A;  4PE0 A;  1YUS A;  3BXK A;  1PUL A;  1C7V A;  1AJ5 A;  1SCV A;  1FI6 A;  1UHK A;  4HRH A;  1TWO A;  3EK4 A;  4YGD B;  3I5I B;  1N65 A;  4OKH A;  1P28 A;  4MRY A;  1JSA A;  1M46 A;  2QPT A;  1SCM B;  1UP5 A;  3OX5 A;  2P70 A;  2D8N A;  2H2K A;  4INW A;  1FBV A;  3D76 A;  2MAZ A;  3D0Y B;  2NXQ A;  1B4C A;  2K0J A;  2LP3 A;  2EC6 B;  2ZN9 A;  1BR4 B;  1AP4 A;  1NUB A;  1OMD A;  3DVM A;  1NP8 A;  2KQ6 A;  2KAY A;  3EVU A;  1KSO A;  3FIA A;  3I5H C;  1H4B A;  1K90 D;  1M63 B;  2CXJ A;  2O60 A;  3MSE B;  1KFU S;  3DY9 A;  2K2F A;  3SS5 A;  1L2O C;  1CMG A;  4QJ4 B;  5G08 A;  1WLM A;  3TDU A;  1FI5 A;  2JC2 A;  3EKH A;  1DTL A;  1A4P A;  5HKW A;  4OCI A;  1A75 A;  4QJ3 B;  2KFF A;  1EXR A;  1YR5 A;  1G33 A;  4PAL A;  1WRL A;  2QEB A;  1AVS A;  1XFV O;  1FF1 A;  1B47 A;  3B7A A;  3BUW B;  3AAK A;  3PM2 A;  3QRX A;  4ZCV A;  1KWO C;  5AFP A;  2K8M B;  3JVT B;  3KHE A;  4JPZ B;  4M2P A;  3I5H B;  4WQ2 A;  4TNC A;  2KFG A;  2OS8 C;  3UO9 A;  2Y1M A;  1XFW O;  3PSR A;  4CLN A;  1IJ6 A;  4UPG A;  4GBA A;  5JJG A;  1L2O B;  1UWO A;  2RGI A;  3OGN A;  1OZO A;  1OW4 A;  1NX0 A;  2K7C A;  1FPW A;  1CM4 A;  1DJG A;  1PK0 D;  1QAS A;  2GTE A;  3PAT A;  5IBW A;  5I8N A;  5ER5 A;  2PQL A;  4M2Q A;  3FS7 A;  4JQ0 D;  5DIC A;  4ORB B;  4PCW A;  3R1O A;  4HRE E;  1CDL A;  4DS7 A;  1CB1 A;  4GUK A;  1IH0 A;  2ZND A;  1AHR A;  1Q80 A;  1S3P A;  4NDD A;  1KWO B;  5FI6 A;  1F4Q A;  4N5X A;  1S26 D;  1S5G Z;  3OP0 A;  2OS8 B;  1C7W A;  3NSI A;  1SW8 A;  2ZKM X;  3TS5 B;  2E6W A;  2JPT A;  2Q91 A;  1XVJ A;  1A2X A;  2WOS A;  4C0K A;  3Q8I A;  1KFX S;  1B7T Z;  4I5J A;  2GGM A;  2LP2 A;  1QX7 A;  3DF0 A;  1AK8 A;  2VRG A;  1MUX A;  3DVK A;  1PAL A;  5FI7 A;  3OHM B;  5AEQ A;  2KNE A;  1SPY A;  3SG6 A;  2LUX A;  4MN0 A;  4DUQ A;  3DD4 A;  1K96 A;  3KO0 A;  4MVF A;  4GAO A;  3H4S E;  2V53 A;  1LA0 A;  2K7B A;  3D75 A;  2JUL A;  2CCM A;  3EVV A;  1OOG A;  1YVL A;  2MHH A;  1OQP A;  2Y1N A;  1SY9 A;  1PVA A;  1IKU A;  1YX8 A;  3FE9 A;  1SBJ A;  2JNX A;  1QWV A;  2YGU A;  1ZAC A;  4QJ5 B;  2HPS A;  2PAL A;  1NCZ A;  1C3Z A;  3LK0 A;  1WRZ A;  2KLD A;  3EG5 B;  3D0Y A;  1UHH A;  2F2O A;  2M1U A;  2JNF A;  1DJZ A;  3TDZ A;  2KGB C;  1V1G A;  3S0F A;  5HLO A;  3CWG A;  1JF2 A;  4YGC B;  3UNW A;  1CFP A;  3O4X A;  4E68 A;  1AJ4 A;  1EG3 A;  1PSB A;  4GGF C;  2L2E A;  3VRN A;  2H8V A;  1PVB A;  2BE6 A;  1TUJ A;  1JUO A;  3BUN B;  3SG4 A;  4N1G A;  3TUY C;  1NWD A;  3L4A A;  3D77 A;  4XYN A;  2I2R E;  2MRD A;  2JQ6 A;  1N2D A;  4YBH B;  5CSF A;  1KQV A;  1LKJ A;  5PAL A;  3OBV A;  4PHK A;  2O5G A;  1K9P A;  2CNP A;  2ZRT A;  2JT0 A;  3CZ1 A;  3DF0 B;  4I5L B;  3BFH A;  1S5G Y;  1DJH A;  1V1F A;  1WRK A;  4JWQ A;  1TUZ A;  1XO5 A;  2H61 C;  1B7T Y;  1DJW A;  1MWN A;  1RWY A;  3VRQ A;  2M7L A;  4C0L A;  1BLQ A;  3TUY B;  1DEK A;  3KEV A;  1TOP A;  3PAL A;  1S1E A;  2M1K B;  3ICB A;  5D7F A;  5GQQ C;  1TNX A;  1DJX A;  1K94 A;  4BY5 A;  2G9B A;  1KK8 C;  4MSP A;  1L7Z A;  1F8H A;  1XFU O;  3S0D A;  4AOM A;  2PRU A;  1QLK A;  3LL8 B;  3PFV A;  1ZOT B;  1SK6 D;  2DOQ A;  3BOW B;  1UHJ A;  2HF5 A;  1LA3 A;  2KBI A;  2K7O A;  3GK4 X;  1BG1 A;  1XFZ O;  1IQ5 A;  3VB1 A;  3WHU B;  4F0Z B;  2L0P A;  2BE4 A;  2KFH A;  1WDC C;  1UHN A;  5KU1 A;  5AER A;  1SSE B;  1XFR A;  4WRI A;  2KI4 C;  2PMY A;  3DXL A; 
#chains in the Genus database with same CATH homology
 3D78 A;  3OGN A;  1OW4 A;  3S0E A;  2WCH A;  2GTE A;  3NHI A;  2PQL A;  1ORG A;  5DIC A;  3R1O A;  3D74 A;  3R1P A;  3B88 A;  4FQT A;  4OZD A;  3S0A A;  2JPO A;  2L2C A;  4F7F A;  3S0B A;  2WC6 A;  2WCJ A;  3Q8I A;  2WC5 A;  3N7H A;  1OOI X;  1C3Y A;  3BFA A;  2P71 A;  2QEV A;  3CAB A;  3NGV A;  3L47 A;  3RZS A;  3B6X A;  3FE8 A;  1LS8 A;  3BJH A;  3NHT A;  1OOH A;  3D75 A;  1OOG A;  3PJI A;  4JD9 A;  3FE9 A;  2WCK A;  3QME A;  1QWV A;  2ERB A;  1C3Z A;  3R72 A;  3D73 A;  3S0F A;  3DZT A;  3L4L A;  3CDN A;  1OOF A;  3S0G A;  3CYZ A;  2H8V A;  2QEO A;  1TUJ A;  2QDI A;  1TWO A;  3R1V A;  3L4A A;  3D77 A;  2WCL A;  3B87 A;  1P28 A;  3DYE A;  3B86 A;  2P70 A;  3CZ0 A;  4INW A;  3D76 A;  3CZ1 A;  3BFH A;  4INX A;  3BFB A;  1T14 A;  2WCM A;  3DY9 A;  5EL2 A;  1GM0 A;  3FE6 A;  3S0D A;  2QEH A;  2KPH A;  3CZ2 A;  3K1E A;  4PT1 A;  2FJY A;  2QEB A;  3B7A A;  1DQE A;  3VB1 A;  3V2L A;  1XFR A;  3DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...