3S0BA

Apis mellifera obp14 in complex with the fluorescent probe 1-n-phenylnaphthylamine (npn)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
119
structure length
119
Chain Sequence
b'MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 49
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0bA00
3N7HA 3CABA 1OOGA 1DQEA 3R1OA 1OOFA 1C3YA 3VB1A 4INXA 3NHTA 3V2LA 3DZTA 3B86A 3R1VA 1P28A 3S0AA 3K1EA 2QEHA 3BFHA 1GM0A 2KPHA 3L4AA 3S0DA 1ORGA 4PT1A 1TWOA 3BJHA 3L4LA 3S0BA 3S0GA 1TUJA 3DXLA 2WCJA 2WC6A 3D73A 2QDIA 3D77A 3RZSA 3D76A 1OOHA 1T14A 2PQLA 3CZ2A 1XFRA 3BFAA 3B87A 3OGNA 3CDNA 4OZDA 3D75A 3B88A 2QEBA 1OOIX 3DYEA 2JPOA 3B6XA 3Q8IA 3FE8A 3FE6A 3S0EA 3R1PA 4FQTA 3NHIA 2WC5A 3CYZA 2WCMA 2P71A 3FE9A 4INWA 1C3ZA 2L2CA 2GTEA 2QEOA 3CZ1A 5DICA 2QEVA 3QMEA 3D74A 4JD9A 3L47A 3B7AA 2P70A 2H8VA 5EL2A 3CZ0A 3R72A 3PJIA 3DY9A 1OW4A 3NGVA 1LS8A 3S0FA 3D78A 2WCKA 2WCHA 2WCLA 1QWVA 4F7FA 2ERBA 2FJYA 3BFBA
chains in the Genus database with same CATH superfamily
1MXEA 2LHIA 2WCFA 4GFTA 1NX0A 3I5GC 1E8AA 1BR1B 1YRTB 1BF5A 2M9GA 2MHHA 1CFPA 1J7QA 2LV7A 3CABA 4TNCA 1U5IB 1CFDA 1UHHA 3SIAA 1OOFA 1B47A 1M39A 5HLOA 1IKUA 3OHMB 1C3YA 3JVTB 1AVSA 3O4XA 1B1GA 2LVJA 2ISDA 1Y0VH 3V2LA 1DT7B 3DZTA 1A4PA 3PM8A 1KQMC 1TRFA 1YX7A 3O6BA 3GK2A 3IQOA 1Z4HA 5DKQA 1QX7A 3AAJA 1OOJA 1QV1A 2LMUA 4M2QA 2KPHA 1C7VA 1ORGA 1TCOB 5D69A 1FW4A 4MRXA 3RLZA 1JUOA 1S5GY 3K21A 4CFQA 2FOTA 4GUKA 3S0BA 2WOSA 2L98A 2F8PA 4HRHA 4MZLA 5D7FA 2WCJA 1MHOA 2WC6A 4MN0A 1BG1A 1XFVO 3D77A 4M2OA 4ETOA 1KK8C 2JNXA 4DUQA 2BAPA 4MZKA 1OE9B 3WHTB 1LINA 1XFWO 3TUYC 1CMGA 3CZ2A 5I2OA 2GGMA 1BMOA 1GQMA 2M1KB 2WCEA 3AAKA 1CDNA 2BCXA 2B1UA 4OR9B 1BJFA 3CDNA 4ORBB 4PHJA 2V53A 1V1FA 3D75A 4MSPA 1NCXA 4PALA 2KLEA 1RROA 2CBLA 3IF7A 1W7JB 3BUOB 1AK8A 2K2AA 4BY5A 5ER5A 3FE8A 2PMYA 4AOMA 4JQ0D 3A8RA 3FE6A 3M0WA 1GGWA 5KTYA 1U5IA 1KSOA 3NHIA 5K89A 2KI4B 5CSNA 2WC5A 3JVTC 2COLB 1OSAA 4FTGA 4C0LA 2RGIA 4M2PA 2IS9A 1NYAA 1M31A 1CFCA 1IIOA 4OCIA 1SL7A 1QIWA 3DVMA 5FI2A 1B7TZ 1UHNA 2KGRA 3BOWB 4PHKA 4N1GA 1KK7Y 1QASA 4INWA 2L2EA 1C3ZA 3EG5B 1K96A 2L2CA 3KHEA 1J1DA 1Y1AA 1ZMZA 2LCPA 5CSJA 1XVJA 1M45A 4YGBB 3DF0B 2K7OA 3O78A 4P5OE 1AP4A 1BT6A 2GV5A 3QMEA 4AQIA 3LCPC 1QLSA 2MA2A 4N5XA 1JBAA 2BBMA 3D74A 1IGVA 4HRGA 4JD9A 5I8NA 3NSLA 2KQ6A 2BKHB 3PM2A 1MUXA 1FBVA 5I2QA 1CM4A 1CDPA 1NSHA 1SMGA 2M0RA 1A2XA 1N0YA 1PSBA 4I5KA 2OPOA 4YBHB 1ZUZA 5FI6A 4GPLB 3SG2A 2JT0A 1FPWA 3CZ0A 4DCKA 3R72A 4PE7A 5AERA 1OW4A 4OVNF 1KK7Z 3OB2B 3MSEB 2K2FA 2LC5A 3OP0A 3FWBA 4GGNA 4N1FA 1RJVA 2JTTA 3EK8A 2JOJA 2WNDA 4C0JA 3F45A 1A75B 2EC6B 3LK0A 1ZFSA 3DVJA 1NX3A 2YGUA 2NCOA 5CSIA 3SS4A 4PE0A 4F0ZB 4YRUA 1JC2A 1MF8B 2KI4C 4AQJA 2LUCA 1LA3A 2F2PA 1DF0A 3OX6A 1DMOA 2LVKA 2Y5IA 1NX2A 5HYDA 1RK9A 2KYCA 1OOGA 2O60A 3FS7A 3TDIA 3R1OA 2F33A 1VRKA 2NZ0A 3GK1A 3VB1A 4INXA 3NHTA 3D0YB 1MWNA 1QIVA 3WNXB 3LL8B 2FCDA 1C7WA 3S0AA 3SG5A 3BOWA 1PULA 1DGVA 2L0PA 1DJYA 1IWQA 1F54A 1L2OB 2WCBA 4OKHA 5I2LA 3L4AA 3CZTX 3SJSA 3DF0A 1DJZA 5JOLA 3L4LA 2MAZA 2PALA 2JT3A 3S0GA 2PYQA 4UPGA 3PALA 1OMRA 1L7ZA 2LE9B 3D73A 2BE4A 2SASA 3GOFA 2BCAA 1K90D 3DVEA 2H61C 3D76A 1NCYA 3FIAA 1QX5B 5CPVA 2L51A 2Q4UA 5G08A 1DVIA 1WLZA 1UURA 1NWDA 1CKKA 3CGAA 3HCMA 3A4UB 2L4HA 2JXLA 3KO0A 2AUCA 1DJIA 1FF1A 1SNLA 3UO9A 1G4YR 3B87A 3BYAA 1XFZO 4OZDA 2EC6C 3EKHA 1WLMA 3CR4X 1LKJA 2QEBA 3ZWHA 1JFJA 3Q8IA 4P2YB 2JT8A 2L5XB 2Y1NA 3S0EA 1HQVA 1KSMA 1V1GA 1LXFC 3NXAA 1XFYO 1IG5A 1MR8A 2LM5A 3IQQA 1BOCA 5IBWA 1NCZA 3VRPA 2HPSA 1L2OC 4CFRA 3NSOA 2KBIA 2OTGB 2K60A 1QV0A 1RFJA 2LP3A 4ORCB 2GTEA 1YUUA 1S6IA 2BKIB 1S5GZ 3VRNA 3O4YA 4BY4A 4NDBA 2QEVA 4ORAB 2F3YA 2KI6C 1OZOA 1CFFA 1JFKA 3IVTA 4YGDB 2NCPA 1YVHA 1WDCB 4ZCVA 1PRWA 4CPVA 3B7AA 3KF9A 4GNKB 1QLKA 1CNPA 4E68A 2KFGA 1OZSA 1UP5A 2KI6D 1CDLA 2HF5A 3O2PA 1GJYA 3OB1B 2P70A 3VRRA 1K2HA 1UHJA 5EL2A 1UUSA 1QVIY 2HQWA 2I94A 1XK4C 2ZFDA 1SCMB 3DVKA 1YTZC 2R2IA 2M1UA 3NGVA 1LS8A 1F8HA 4Q04A 1QATA 1S3PA 3D78A 2O5GA 4WQ3A 2WCHA 5HKYA 1G8IA 3ICBA 2WCLA 1K9KA 4PCWA 1RWYA 1TNWA 1H8BA 3PSRA 2JPTA 3LLEA 3FWCA 1KWOB 3UNWA 2H2KA 2KLDA 4NQGA 1DJWA 2GGZA 3EVUA 3SS3A 2KAXA 1GGZA 1DQEA 4GAOA 2M29A 1QVIZ 1Q80A 3TDUA 1R6PA 1HT9A 1NP8A 2A4JA 2OTGC 1LVCD 1QX2A 1DJHA 2LHLA 3B86A 1P28A 4YI8A 2NLNA 3K1EA 2QEHA 4YI9A 2PSRA 1TNQA 1XFUO 3S0DA 1SSEB 1TOPA 1OQPA 1KFUL 1TWOA 2KQYA 1UHKA 3SG7A 3BUNB 3OX5A 1ZACA 2LVIA 1S26D 3KPXA 2Y1MA 1TUJA 1NX1A 3NSKA 4MLWA 1WDCC 3DXLA 3SG3A 1A29A 2QACA 1XO5A 2QDIA 1SYMA 4A4BA 2ZKMX 3R1VA 2LAPA 1N2DA 2ZRSA 1WY9A 4DIRA 5JJGA 3RZSA 1PK0D 4ZCUA 1OOHA 2BNXA 1SCMC 2M8UA 3SIBA 1AJ5A 2VRGA 5KSZA 3VGOA 1PVAA 2I18A 3CR5X 4KYNA 3CWGA 4JKTA 2Y4QA 2G9BA 5AANA 1PALA 4OV2A 5KU1A 4NDDA 4I5JA 2MBXA 3OGNA 1J7PA 1CLBA 2PRUA 1XA5A 1YUTA 2FCEA 3CS1A 1TIZA 2CXJA 4QJ4B 1Z2CB 1KWOC 1NPQA 2KFFA 4PE1A 3B6XA 1J7RA 4GGFC 1EXRA 1UHIA 5AEQA 2F2OA 1JF2A 4HREE 4MEWA 2M7LA 5AFPA 2M97A 4ICBA 3WHUB 1B4CA 3R1PA 4CIDA 1K8UA 3GK4X 1SR6B 1J7OA 3CYZA 2KNEA 2M7NA 2WCMA 2Q91A 2H61A 1Y6WA 2LLSA 2CCMA 1K93D 2P71A 1H4BA 1EG4A 3DD4A 4USLA 1UWOA 1IQ3A 1SPYA 3BUWB 2LNKA 4U8DA 1TTXA 1DELA 1K9UA 1DJXA 1OMVA 1OMDA 3TZ1A 2QEOA 1F70A 5DICA 1JF0A 1F55A 3AKAA 1K9PA 1AJ4A 1A75A 1MQ1A 2L5YA 1A03A 1B8RA 2K0JA 5FI7A 2AMIA 5HLVA 2LMTA 3EKJA 5BPJA 1X02A 2TN4A 4YGEB 2KGBC 3L47A 4PHMA 1JWDA 2LVVA 5B8IB 1LA0A 1MXLC 2MLFC 1EJ3A 2AAOA 1TNXA 4IL1A 1DJGA 5CSFA 1EG3A 2JWWA 1S1EA 2ZNDA 2EGDA 3ZNIA 2H8VA 1NUBA 1BLQA 1YX8A 3D0YA 1D1OA 2K7BA 2KDHA 1CMFA 3RM1A 3BXKA 2I7AA 1S6CA 2JNFA 1YUSA 1SRAA 2MRDA 2BBNA 3JTDB 4YGAA 1WRLA 1S6JA 2JULA 2MLEC 2SCPA 1SCVA 2OS8B 4XJKB 3VROA 3S0FA 1TCFA 3CR2A 2WCKA 1J1EA 1WRZA 4HSZA 2K7DA 3D10A 4JPZB 4F7FA 2ERBA 2FJYA 3BFBA 4YGCB 1FI5A 4IJ7A 1M63B 2WC8A 2M3WA 4MBEA 1SR6C 4NDCA 2JTZA 3N7HA 1W9ZA 2NXQA 3I5FB 3TDZA 2HQ8A 2KYFA 1M46A 1Y1XA 4MVFA 1XYDA 4I5NB 2DOQA 3I5IB 3I5HB 2HETA 2LUXA 1AHRA 1CTRA 1KFUS 1YVLA 1ALWA 2BCBA 2QPTA 3OBVA 4PE4A 3BFHA 1XK4A 1GM0A 5F6TA 1B7TY 5FYXA 4MRYA 1B8LA 1KFXS 4I5LB 1QJTA 3EK4A 4PT1A 1W7IB 4L9MA 1BU3A 2LP2A 4JWQA 2JXCA 3BJHA 1DTLA 1TUZA 1JSAA 2CTNA 1N65A 1J55A 2KAVA 1C07A 1QTXA 1PVBA 1CM1A 2E6WA 1SK6D 2BECA 2FJUB 2JC2A 2KSPA 1DF0B 1PSRA 2BL0B 4R1EA 1K95A 2BE6A 3SG4A 2M49B 5ER4X 1ALVA 2KOTA 3PN7B 3PFVA 4XYNA 1CB1A 2PVBA 3C1VA 4MZJA 1T14A 2KAYA 1SW8A 2PQLA 2PASA 1CLMA 3TS5B 3JTDC 1ODBA 4DRWA 2KFHA 1TNPA 1XFXO 1ZOTB 1XFRA 1YR5A 1KQVA 2OS8C 1QS7A 3BFAA 5HKWA 4XJKA 2K8MB 1FI6A 1KCYA 3KEVA 2P6BB 1F4QA 1S36A 2ZRTA 2LANA 3CTNA 3CLNA 3B88A 5HKZA 3BUXB 1CLLA 1RECA 3HX4A 2K61A 3VRQA 1OOIX 3DYEA 1BR4B 1SY9A 2JPOA 1QXPA 5DKNA 5TNCA 3QRXA 3I5FC 4WRIA 1EH2A 1KFXL 2KHNA 2K7CA 4FQTA 3AKBA 2EHBA 1IQ5A 3LK1A 3I5GB 3I5IC 2CT9A 3I5HC 1IH0A 1SKTA 3BUMB 3SS5A 2F3ZA 3NSIA 3FE9A 5I94A 2JZIA 1YRUB 2ZNEA 1KQMB 1DGUA 2ZN9A 1CDMA 3CZ1A 1SL8A 2I2RE 4C0KA 2G2BA 2E30A 1NIWA 4A4CA 1IJ6A 2LLTA 2BL0C 2ZN8A 1WRKA 2WORA 3H4SE 1Y1UA 1DC1A 5DKRA 4FQOA 3EK7A 1G33A 4GGFA 3PN7C 4CLNA 1TN4A 5GQQC 3WXAA 1SBJA 2JU0A 3E3RA 4WQ2A 2L50A 1EL4A 1K94A 1AUIB 3SG6A 3TS5C 3EVVA 1B8CA 3PLFB 4GBAA 1IRJA 3EVRA 4QJ3B 2LMVA 4QJ5B 1KK8B 3BQ3A 1RTP1 3PATA 1B9AA 1IJ5A 3TUYB 3PJIA 1DEKA 2JQ6A 3DY9A 1R2UA 5PALA 5HL1A 2CNPA 2L4IA 4PHNA 2MJWB 1YURA 5D3OA 2D8NA 1F71A 1SL9A 4PDZA 1F4OA 2KBMA 2LLUA 4DS7A 5AXIA 1QWVA 4D1EA 2JRFA 1BODA 5J3XA
chains in the Genus database with same CATH topology
3N7HA 3CABA 1OOGA 1DQEA 3R1OA 1OOFA 1C3YA 3VB1A 4INXA 3NHTA 3V2LA 3DZTA 3B86A 3R1VA 1P28A 3S0AA 3K1EA 2QEHA 3BFHA 1GM0A 2KPHA 3L4AA 3S0DA 1ORGA 4PT1A 1TWOA 3BJHA 3L4LA 3S0BA 3S0GA 1TUJA 3DXLA 2WCJA 2WC6A 3D73A 2QDIA 3D77A 3RZSA 3D76A 1OOHA 1T14A 2PQLA 3CZ2A 1XFRA 3BFAA 3B87A 3OGNA 3CDNA 4OZDA 3D75A 3B88A 2QEBA 1OOIX 3DYEA 2JPOA 3B6XA 3Q8IA 3FE8A 3FE6A 3S0EA 3R1PA 4FQTA 3NHIA 2WC5A 3CYZA 2WCMA 2P71A 3FE9A 4INWA 1C3ZA 2L2CA 2GTEA 2QEOA 3CZ1A 5DICA 2QEVA 3QMEA 3D74A 4JD9A 3L47A 3B7AA 2P70A 2H8VA 5EL2A 3CZ0A 3R72A 3PJIA 3DY9A 1OW4A 3NGVA 1LS8A 3S0FA 3D78A 2WCKA 2WCHA 2WCLA 1QWVA 4F7FA 2ERBA 2FJYA 3BFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7H A;  3CAB A;  1OOG A;  1DQE A;  3R1O A;  1OOF A;  1C3Y A;  3VB1 A;  4INX A;  3NHT A;  3V2L A;  3DZT A;  3B86 A;  3R1V A;  1P28 A;  3S0A A;  3K1E A;  2QEH A;  3BFH A;  1GM0 A;  2KPH A;  3L4A A;  3S0D A;  1ORG A;  4PT1 A;  1TWO A;  3BJH A;  3L4L A;  3S0B A;  3S0G A;  1TUJ A;  3DXL A;  2WCJ A;  2WC6 A;  3D73 A;  2QDI A;  3D77 A;  3RZS A;  3D76 A;  1OOH A;  1T14 A;  2PQL A;  3CZ2 A;  1XFR A;  3BFA A;  3B87 A;  3OGN A;  3CDN A;  4OZD A;  3D75 A;  3B88 A;  2QEB A;  1OOI X;  3DYE A;  2JPO A;  3B6X A;  3Q8I A;  3FE8 A;  3FE6 A;  3S0E A;  3R1P A;  4FQT A;  3NHI A;  2WC5 A;  3CYZ A;  2WCM A;  2P71 A;  3FE9 A;  4INW A;  1C3Z A;  2L2C A;  2GTE A;  2QEO A;  3CZ1 A;  5DIC A;  2QEV A;  3QME A;  3D74 A;  4JD9 A;  3L47 A;  3B7A A;  2P70 A;  2H8V A;  5EL2 A;  3CZ0 A;  3R72 A;  3PJI A;  3DY9 A;  1OW4 A;  3NGV A;  1LS8 A;  3S0F A;  3D78 A;  2WCK A;  2WCH A;  2WCL A;  1QWV A;  4F7F A;  2ERB A;  2FJY A;  3BFB A; 
#chains in the Genus database with same CATH topology
 1MXE A;  2LHI A;  2WCF A;  4GFT A;  1NX0 A;  3I5G C;  1E8A A;  1BR1 B;  1YRT B;  1BF5 A;  2M9G A;  2MHH A;  1CFP A;  1J7Q A;  2LV7 A;  3CAB A;  4TNC A;  1U5I B;  1CFD A;  1UHH A;  3SIA A;  1OOF A;  1B47 A;  1M39 A;  5HLO A;  1IKU A;  3OHM B;  1C3Y A;  3JVT B;  1AVS A;  3O4X A;  1B1G A;  2LVJ A;  2ISD A;  1Y0V H;  3V2L A;  1DT7 B;  3DZT A;  1A4P A;  3PM8 A;  1KQM C;  1TRF A;  1YX7 A;  3O6B A;  3GK2 A;  3IQO A;  1Z4H A;  5DKQ A;  1QX7 A;  3AAJ A;  1OOJ A;  1QV1 A;  2LMU A;  4M2Q A;  2KPH A;  1C7V A;  1ORG A;  1TCO B;  5D69 A;  1FW4 A;  4MRX A;  3RLZ A;  1JUO A;  1S5G Y;  3K21 A;  4CFQ A;  2FOT A;  4GUK A;  3S0B A;  2WOS A;  2L98 A;  2F8P A;  4HRH A;  4MZL A;  5D7F A;  2WCJ A;  1MHO A;  2WC6 A;  4MN0 A;  1BG1 A;  1XFV O;  3D77 A;  4M2O A;  4ETO A;  1KK8 C;  2JNX A;  4DUQ A;  2BAP A;  4MZK A;  1OE9 B;  3WHT B;  1LIN A;  1XFW O;  3TUY C;  1CMG A;  3CZ2 A;  5I2O A;  2GGM A;  1BMO A;  1GQM A;  2M1K B;  2WCE A;  3AAK A;  1CDN A;  2BCX A;  2B1U A;  4OR9 B;  1BJF A;  3CDN A;  4ORB B;  4PHJ A;  2V53 A;  1V1F A;  3D75 A;  4MSP A;  1NCX A;  4PAL A;  2KLE A;  1RRO A;  2CBL A;  3IF7 A;  1W7J B;  3BUO B;  1AK8 A;  2K2A A;  4BY5 A;  5ER5 A;  3FE8 A;  2PMY A;  4AOM A;  4JQ0 D;  3A8R A;  3FE6 A;  3M0W A;  1GGW A;  5KTY A;  1U5I A;  1KSO A;  3NHI A;  5K89 A;  2KI4 B;  5CSN A;  2WC5 A;  3JVT C;  2COL B;  1OSA A;  4FTG A;  4C0L A;  2RGI A;  4M2P A;  2IS9 A;  1NYA A;  1M31 A;  1CFC A;  1IIO A;  4OCI A;  1SL7 A;  1QIW A;  3DVM A;  5FI2 A;  1B7T Z;  1UHN A;  2KGR A;  3BOW B;  4PHK A;  4N1G A;  1KK7 Y;  1QAS A;  4INW A;  2L2E A;  1C3Z A;  3EG5 B;  1K96 A;  2L2C A;  3KHE A;  1J1D A;  1Y1A A;  1ZMZ A;  2LCP A;  5CSJ A;  1XVJ A;  1M45 A;  4YGB B;  3DF0 B;  2K7O A;  3O78 A;  4P5O E;  1AP4 A;  1BT6 A;  2GV5 A;  3QME A;  4AQI A;  3LCP C;  1QLS A;  2MA2 A;  4N5X A;  1JBA A;  2BBM A;  3D74 A;  1IGV A;  4HRG A;  4JD9 A;  5I8N A;  3NSL A;  2KQ6 A;  2BKH B;  3PM2 A;  1MUX A;  1FBV A;  5I2Q A;  1CM4 A;  1CDP A;  1NSH A;  1SMG A;  2M0R A;  1A2X A;  1N0Y A;  1PSB A;  4I5K A;  2OPO A;  4YBH B;  1ZUZ A;  5FI6 A;  4GPL B;  3SG2 A;  2JT0 A;  1FPW A;  3CZ0 A;  4DCK A;  3R72 A;  4PE7 A;  5AER A;  1OW4 A;  4OVN F;  1KK7 Z;  3OB2 B;  3MSE B;  2K2F A;  2LC5 A;  3OP0 A;  3FWB A;  4GGN A;  4N1F A;  1RJV A;  2JTT A;  3EK8 A;  2JOJ A;  2WND A;  4C0J A;  3F45 A;  1A75 B;  2EC6 B;  3LK0 A;  1ZFS A;  3DVJ A;  1NX3 A;  2YGU A;  2NCO A;  5CSI A;  3SS4 A;  4PE0 A;  4F0Z B;  4YRU A;  1JC2 A;  1MF8 B;  2KI4 C;  4AQJ A;  2LUC A;  1LA3 A;  2F2P A;  1DF0 A;  3OX6 A;  1DMO A;  2LVK A;  2Y5I A;  1NX2 A;  5HYD A;  1RK9 A;  2KYC A;  1OOG A;  2O60 A;  3FS7 A;  3TDI A;  3R1O A;  2F33 A;  1VRK A;  2NZ0 A;  3GK1 A;  3VB1 A;  4INX A;  3NHT A;  3D0Y B;  1MWN A;  1QIV A;  3WNX B;  3LL8 B;  2FCD A;  1C7W A;  3S0A A;  3SG5 A;  3BOW A;  1PUL A;  1DGV A;  2L0P A;  1DJY A;  1IWQ A;  1F54 A;  1L2O B;  2WCB A;  4OKH A;  5I2L A;  3L4A A;  3CZT X;  3SJS A;  3DF0 A;  1DJZ A;  5JOL A;  3L4L A;  2MAZ A;  2PAL A;  2JT3 A;  3S0G A;  2PYQ A;  4UPG A;  3PAL A;  1OMR A;  1L7Z A;  2LE9 B;  3D73 A;  2BE4 A;  2SAS A;  3GOF A;  2BCA A;  1K90 D;  3DVE A;  2H61 C;  3D76 A;  1NCY A;  3FIA A;  1QX5 B;  5CPV A;  2L51 A;  2Q4U A;  5G08 A;  1DVI A;  1WLZ A;  1UUR A;  1NWD A;  1CKK A;  3CGA A;  3HCM A;  3A4U B;  2L4H A;  2JXL A;  3KO0 A;  2AUC A;  1DJI A;  1FF1 A;  1SNL A;  3UO9 A;  1G4Y R;  3B87 A;  3BYA A;  1XFZ O;  4OZD A;  2EC6 C;  3EKH A;  1WLM A;  3CR4 X;  1LKJ A;  2QEB A;  3ZWH A;  1JFJ A;  3Q8I A;  4P2Y B;  2JT8 A;  2L5X B;  2Y1N A;  3S0E A;  1HQV A;  1KSM A;  1V1G A;  1LXF C;  3NXA A;  1XFY O;  1IG5 A;  1MR8 A;  2LM5 A;  3IQQ A;  1BOC A;  5IBW A;  1NCZ A;  3VRP A;  2HPS A;  1L2O C;  4CFR A;  3NSO A;  2KBI A;  2OTG B;  2K60 A;  1QV0 A;  1RFJ A;  2LP3 A;  4ORC B;  2GTE A;  1YUU A;  1S6I A;  2BKI B;  1S5G Z;  3VRN A;  3O4Y A;  4BY4 A;  4NDB A;  2QEV A;  4ORA B;  2F3Y A;  2KI6 C;  1OZO A;  1CFF A;  1JFK A;  3IVT A;  4YGD B;  2NCP A;  1YVH A;  1WDC B;  4ZCV A;  1PRW A;  4CPV A;  3B7A A;  3KF9 A;  4GNK B;  1QLK A;  1CNP A;  4E68 A;  2KFG A;  1OZS A;  1UP5 A;  2KI6 D;  1CDL A;  2HF5 A;  3O2P A;  1GJY A;  3OB1 B;  2P70 A;  3VRR A;  1K2H A;  1UHJ A;  5EL2 A;  1UUS A;  1QVI Y;  2HQW A;  2I94 A;  1XK4 C;  2ZFD A;  1SCM B;  3DVK A;  1YTZ C;  2R2I A;  2M1U A;  3NGV A;  1LS8 A;  1F8H A;  4Q04 A;  1QAT A;  1S3P A;  3D78 A;  2O5G A;  4WQ3 A;  2WCH A;  5HKY A;  1G8I A;  3ICB A;  2WCL A;  1K9K A;  4PCW A;  1RWY A;  1TNW A;  1H8B A;  3PSR A;  2JPT A;  3LLE A;  3FWC A;  1KWO B;  3UNW A;  2H2K A;  2KLD A;  4NQG A;  1DJW A;  2GGZ A;  3EVU A;  3SS3 A;  2KAX A;  1GGZ A;  1DQE A;  4GAO A;  2M29 A;  1QVI Z;  1Q80 A;  3TDU A;  1R6P A;  1HT9 A;  1NP8 A;  2A4J A;  2OTG C;  1LVC D;  1QX2 A;  1DJH A;  2LHL A;  3B86 A;  1P28 A;  4YI8 A;  2NLN A;  3K1E A;  2QEH A;  4YI9 A;  2PSR A;  1TNQ A;  1XFU O;  3S0D A;  1SSE B;  1TOP A;  1OQP A;  1KFU L;  1TWO A;  2KQY A;  1UHK A;  3SG7 A;  3BUN B;  3OX5 A;  1ZAC A;  2LVI A;  1S26 D;  3KPX A;  2Y1M A;  1TUJ A;  1NX1 A;  3NSK A;  4MLW A;  1WDC C;  3DXL A;  3SG3 A;  1A29 A;  2QAC A;  1XO5 A;  2QDI A;  1SYM A;  4A4B A;  2ZKM X;  3R1V A;  2LAP A;  1N2D A;  2ZRS A;  1WY9 A;  4DIR A;  5JJG A;  3RZS A;  1PK0 D;  4ZCU A;  1OOH A;  2BNX A;  1SCM C;  2M8U A;  3SIB A;  1AJ5 A;  2VRG A;  5KSZ A;  3VGO A;  1PVA A;  2I18 A;  3CR5 X;  4KYN A;  3CWG A;  4JKT A;  2Y4Q A;  2G9B A;  5AAN A;  1PAL A;  4OV2 A;  5KU1 A;  4NDD A;  4I5J A;  2MBX A;  3OGN A;  1J7P A;  1CLB A;  2PRU A;  1XA5 A;  1YUT A;  2FCE A;  3CS1 A;  1TIZ A;  2CXJ A;  4QJ4 B;  1Z2C B;  1KWO C;  1NPQ A;  2KFF A;  4PE1 A;  3B6X A;  1J7R A;  4GGF C;  1EXR A;  1UHI A;  5AEQ A;  2F2O A;  1JF2 A;  4HRE E;  4MEW A;  2M7L A;  5AFP A;  2M97 A;  4ICB A;  3WHU B;  1B4C A;  3R1P A;  4CID A;  1K8U A;  3GK4 X;  1SR6 B;  1J7O A;  3CYZ A;  2KNE A;  2M7N A;  2WCM A;  2Q91 A;  2H61 A;  1Y6W A;  2LLS A;  2CCM A;  1K93 D;  2P71 A;  1H4B A;  1EG4 A;  3DD4 A;  4USL A;  1UWO A;  1IQ3 A;  1SPY A;  3BUW B;  2LNK A;  4U8D A;  1TTX A;  1DEL A;  1K9U A;  1DJX A;  1OMV A;  1OMD A;  3TZ1 A;  2QEO A;  1F70 A;  5DIC A;  1JF0 A;  1F55 A;  3AKA A;  1K9P A;  1AJ4 A;  1A75 A;  1MQ1 A;  2L5Y A;  1A03 A;  1B8R A;  2K0J A;  5FI7 A;  2AMI A;  5HLV A;  2LMT A;  3EKJ A;  5BPJ A;  1X02 A;  2TN4 A;  4YGE B;  2KGB C;  3L47 A;  4PHM A;  1JWD A;  2LVV A;  5B8I B;  1LA0 A;  1MXL C;  2MLF C;  1EJ3 A;  2AAO A;  1TNX A;  4IL1 A;  1DJG A;  5CSF A;  1EG3 A;  2JWW A;  1S1E A;  2ZND A;  2EGD A;  3ZNI A;  2H8V A;  1NUB A;  1BLQ A;  1YX8 A;  3D0Y A;  1D1O A;  2K7B A;  2KDH A;  1CMF A;  3RM1 A;  3BXK A;  2I7A A;  1S6C A;  2JNF A;  1YUS A;  1SRA A;  2MRD A;  2BBN A;  3JTD B;  4YGA A;  1WRL A;  1S6J A;  2JUL A;  2MLE C;  2SCP A;  1SCV A;  2OS8 B;  4XJK B;  3VRO A;  3S0F A;  1TCF A;  3CR2 A;  2WCK A;  1J1E A;  1WRZ A;  4HSZ A;  2K7D A;  3D10 A;  4JPZ B;  4F7F A;  2ERB A;  2FJY A;  3BFB A;  4YGC B;  1FI5 A;  4IJ7 A;  1M63 B;  2WC8 A;  2M3W A;  4MBE A;  1SR6 C;  4NDC A;  2JTZ A;  3N7H A;  1W9Z A;  2NXQ A;  3I5F B;  3TDZ A;  2HQ8 A;  2KYF A;  1M46 A;  1Y1X A;  4MVF A;  1XYD A;  4I5N B;  2DOQ A;  3I5I B;  3I5H B;  2HET A;  2LUX A;  1AHR A;  1CTR A;  1KFU S;  1YVL A;  1ALW A;  2BCB A;  2QPT A;  3OBV A;  4PE4 A;  3BFH A;  1XK4 A;  1GM0 A;  5F6T A;  1B7T Y;  5FYX A;  4MRY A;  1B8L A;  1KFX S;  4I5L B;  1QJT A;  3EK4 A;  4PT1 A;  1W7I B;  4L9M A;  1BU3 A;  2LP2 A;  4JWQ A;  2JXC A;  3BJH A;  1DTL A;  1TUZ A;  1JSA A;  2CTN A;  1N65 A;  1J55 A;  2KAV A;  1C07 A;  1QTX A;  1PVB A;  1CM1 A;  2E6W A;  1SK6 D;  2BEC A;  2FJU B;  2JC2 A;  2KSP A;  1DF0 B;  1PSR A;  2BL0 B;  4R1E A;  1K95 A;  2BE6 A;  3SG4 A;  2M49 B;  5ER4 X;  1ALV A;  2KOT A;  3PN7 B;  3PFV A;  4XYN A;  1CB1 A;  2PVB A;  3C1V A;  4MZJ A;  1T14 A;  2KAY A;  1SW8 A;  2PQL A;  2PAS A;  1CLM A;  3TS5 B;  3JTD C;  1ODB A;  4DRW A;  2KFH A;  1TNP A;  1XFX O;  1ZOT B;  1XFR A;  1YR5 A;  1KQV A;  2OS8 C;  1QS7 A;  3BFA A;  5HKW A;  4XJK A;  2K8M B;  1FI6 A;  1KCY A;  3KEV A;  2P6B B;  1F4Q A;  1S36 A;  2ZRT A;  2LAN A;  3CTN A;  3CLN A;  3B88 A;  5HKZ A;  3BUX B;  1CLL A;  1REC A;  3HX4 A;  2K61 A;  3VRQ A;  1OOI X;  3DYE A;  1BR4 B;  1SY9 A;  2JPO A;  1QXP A;  5DKN A;  5TNC A;  3QRX A;  3I5F C;  4WRI A;  1EH2 A;  1KFX L;  2KHN A;  2K7C A;  4FQT A;  3AKB A;  2EHB A;  1IQ5 A;  3LK1 A;  3I5G B;  3I5I C;  2CT9 A;  3I5H C;  1IH0 A;  1SKT A;  3BUM B;  3SS5 A;  2F3Z A;  3NSI A;  3FE9 A;  5I94 A;  2JZI A;  1YRU B;  2ZNE A;  1KQM B;  1DGU A;  2ZN9 A;  1CDM A;  3CZ1 A;  1SL8 A;  2I2R E;  4C0K A;  2G2B A;  2E30 A;  1NIW A;  4A4C A;  1IJ6 A;  2LLT A;  2BL0 C;  2ZN8 A;  1WRK A;  2WOR A;  3H4S E;  1Y1U A;  1DC1 A;  5DKR A;  4FQO A;  3EK7 A;  1G33 A;  4GGF A;  3PN7 C;  4CLN A;  1TN4 A;  5GQQ C;  3WXA A;  1SBJ A;  2JU0 A;  3E3R A;  4WQ2 A;  2L50 A;  1EL4 A;  1K94 A;  1AUI B;  3SG6 A;  3TS5 C;  3EVV A;  1B8C A;  3PLF B;  4GBA A;  1IRJ A;  3EVR A;  4QJ3 B;  2LMV A;  4QJ5 B;  1KK8 B;  3BQ3 A;  1RTP 1;  3PAT A;  1B9A A;  1IJ5 A;  3TUY B;  3PJI A;  1DEK A;  2JQ6 A;  3DY9 A;  1R2U A;  5PAL A;  5HL1 A;  2CNP A;  2L4I A;  4PHN A;  2MJW B;  1YUR A;  5D3O A;  2D8N A;  1F71 A;  1SL9 A;  4PDZ A;  1F4O A;  2KBM A;  2LLU A;  4DS7 A;  5AXI A;  1QWV A;  4D1E A;  2JRF A;  1BOD A;  5J3X A; 
#chains in the Genus database with same CATH homology
 3N7H A;  3CAB A;  1OOG A;  1DQE A;  3R1O A;  1OOF A;  1C3Y A;  3VB1 A;  4INX A;  3NHT A;  3V2L A;  3DZT A;  3B86 A;  3R1V A;  1P28 A;  3S0A A;  3K1E A;  2QEH A;  3BFH A;  1GM0 A;  2KPH A;  3L4A A;  3S0D A;  1ORG A;  4PT1 A;  1TWO A;  3BJH A;  3L4L A;  3S0B A;  3S0G A;  1TUJ A;  3DXL A;  2WCJ A;  2WC6 A;  3D73 A;  2QDI A;  3D77 A;  3RZS A;  3D76 A;  1OOH A;  1T14 A;  2PQL A;  3CZ2 A;  1XFR A;  3BFA A;  3B87 A;  3OGN A;  3CDN A;  4OZD A;  3D75 A;  3B88 A;  2QEB A;  1OOI X;  3DYE A;  2JPO A;  3B6X A;  3Q8I A;  3FE8 A;  3FE6 A;  3S0E A;  3R1P A;  4FQT A;  3NHI A;  2WC5 A;  3CYZ A;  2WCM A;  2P71 A;  3FE9 A;  4INW A;  1C3Z A;  2L2C A;  2GTE A;  2QEO A;  3CZ1 A;  5DIC A;  2QEV A;  3QME A;  3D74 A;  4JD9 A;  3L47 A;  3B7A A;  2P70 A;  2H8V A;  5EL2 A;  3CZ0 A;  3R72 A;  3PJI A;  3DY9 A;  1OW4 A;  3NGV A;  1LS8 A;  3S0F A;  3D78 A;  2WCK A;  2WCH A;  2WCL A;  1QWV A;  4F7F A;  2ERB A;  2FJY A;  3BFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...