3PSRA

Human psoriasin (s100a7) ca2+ bound form (crystal form i)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSORIASIN
publication title Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ef-hand protein
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3psrA00
3WHUB 1AVSA 2JOJA 1DJXA 2BCXA 1NX3A 1JF0A 1C7VA 3A4UB 1S5GY 3O6BA 4MZJA 1MQ1A 4MN0A 1CLLA 1M46A 2LCPA 3IF7A 1NYAA 3CWGA 2JTZA 1G33A 5D69A 5F6TA 3CGAA 1OMDA 1KK7Z 1IGVA 1LINA 2KOTA 3PN7B 4YI8A 1L2OB 5JJGA 2I18A 2NZ0A 1NPQA 1XO5A 5IBWA 3FWBA 4E68A 4XJKA 1CDPA 2JXLA 3PLFB 1IWQA 4HRHA 4YRUA 3SIAA 1F70A 5KTYA 2B1UA 4AOMA 5I8NA 1R6PA 4NDCA 4PDZA 3WNXB 3O4YA 1B1GA 4ORBB 1BF5A 1SL7A 1DJHA 4PHNA 1K8UA 4AQJA 1PVAA 4I5KA 5I2OA 2M3WA 2ZKMX 2BKHB 4GPLB 2M1UA 3OHMB 1XFWO 5G08A 3LK1A 3O2PA 1IRJA 5TNCA 2M0RA 1KCYA 5J3XA 2CTNA 4ZCVA 1JFJA 1Q80A 1RWYA 1UHJA 3LLEA 2AAOA 5HLVA 4CLNA 1OMRA 1XK4C 1EL4A 5KU1A 2WOSA 2QACA 2L51A 5I2QA 2HF5A 3NSKA 1V1GA 1SBJA 3OB2B 1K90D 3C1VA 1AHRA 1CM1A 2JU0A 2KYFA 3BUMB 2LUCA 4JQ0D 3EK8A 4HREE 4C0LA 4A4BA 3IQOA 4MBEA 1UHHA 1S26D 1W7JB 1IJ6A 1WRLA 1QX7A 2BE6A 4UPGA 3GK1A 1EXRA 4PHMA 4N1GA 1C07A 1H8BA 5FYXA 3D0YB 3GK2A 1LXFC 2E30A 1B8CA 1LKJA 2ZFDA 3KF9A 5DKQA 4AQIA 3A8RA 5BPJA 4YI9A 1V1FA 1XK4A 1R2UA 1F55A 2M97A 2KGBC 1HQVA 2EHBA 1BOCA 3O78A 1HT9A 1IG5A 2LMVA 2Y1MA 4HSZA 1U5IB 2BCAA 5HYDA 1CFPA 3PSRA 2CXJA 2LMUA 3I5GC 2MA2A 1BG1A 1WRKA 2K7OA 2EC6C 1XFZO 1MXLC 2KI4B 4USLA 2MBXA 1WLMA 2LAPA 3LL8B 3BUOB 2I2RE 3PFVA 1UP5A 1M63B 4XJKB 1B47A 1TCFA 5I2LA 1K95A 1SYMA 2LM5A 3SG5A 3QRXA 1AK8A 1ZMZA 1CLMA 3CR4X 1A03A 2OPOA 1KQMB 1SW8A 2COLB 1OZOA 1CFDA 1OOJA 3EKHA 5HKYA 1F4OA 1B4CA 2LVVA 4DIRA 1KFUS 1XFUO 5HLOA 2CCMA 3TDZA 4ORAB 2L5XB 4MVFA 1J7OA 1F71A 2ZNDA 1OE9B 3ICBA 1NWDA 2PASA 1TNXA 2M7LA 4WRIA 2FCDA 2JPTA 3NXAA 5JOLA 1LA3A 1QV1A 2K7BA 1PSBA 3CZTX 1SCMB 3BUXB 3D0YA 4GGFC 1S5GZ 1S36A 1K9UA 3SJSA 2K61A 1QTXA 1N65A 4WQ2A 1CMGA 1TRFA 4DUQA 5AERA 2L0PA 1B8LA 1KK8B 4TNCA 3TUYB 1KWOC 2GV5A 2K7CA 2MLFC 2EGDA 1KFUL 1NCYA 2AMIA 2L4IA 2LE9B 4FQOA 4NDDA 1A2XA 1KFXL 1F4QA 2K7DA 4GNKB 1BR1B 1JFKA 1QX5B 2BKIB 2LVKA 1U5IA 2F8PA 4BY5A 3AKAA 5AFPA 3JVTB 1DF0B 1AP4A 1K96A 1TNWA 2PRUA 1MWNA 3IQQA 1K9KA 1ODBA 3PALA 2LP2A 2OS8C 1LVCD 3AAKA 3AAJA 2JT3A 2LMTA 1TCOB 4GGFA 1L7ZA 1E8AA 3TUYC 2LVIA 3SG3A 1YVHA 2Q4UA 1NX1A 2HQWA 1FW4A 2H61A 2M8UA 2Q91A 1CTRA 1XVJA 2KBIA 2FCEA 1J1DA 1Y1AA 2OTGB 3NSIA 4CFRA 1XFVO 3EK7A 2F3YA 2Y5IA 4MLWA 1TNPA 3WHTB 4CFQA 1MUXA 1M31A 2L50A 3JVTC 3H4SE 1NUBA 1X02A 1XFXO 1JSAA 2BL0B 3PN7C 1L2OC 4CPVA 1RFJA 3GK4X 2KQYA 4C0KA 2G2BA 1CLBA 2BECA 5D7FA 1B7TZ 1OZSA 2KAXA 1TTXA 1EG4A 2M1KB 1F54A 4ZCUA 3KO0A 1CFCA 2ZRSA 1MR8A 1YVLA 2D8NA 3CS1A 3PM8A 3M0WA 4OR9B 4PE1A 4QJ3B 1KSOA 1CB1A 1DGVA 2G9BA 3PATA 3F45A 4QJ4B 2K2AA 5HKZA 1QASA 5CPVA 3TDUA 3NSLA 4ORCB 3BXKA 2RGIA 1FI5A 2KI6D 3OP0A 1NIWA 1Y1UA 2BL0C 1SRAA 4P2YB 1N2DA 1UURA 2SCPA 3EVRA 1DF0A 4GBAA 2LANA 1QS7A 4MRYA 1RROA 2KAVA 3HX4A 3LK0A 1QIWA 2MAZA 1QXPA 1M45A 5AEQA 2JNFA 3EVVA 4PALA 4P5OE 2O5GA 2HETA 2HQ8A 3MSEB 3SG6A 4YGBB 2F2PA 1BMOA 1SR6B 2KSPA 5AXIA 1SPYA 3BQ3A 1PVBA 2Y1NA 3E3RA 5CSJA 1OMVA 1GGWA 1OQPA 2MLEC 2P6BB 1NSHA 2TN4A 3TDIA 2KAYA 2MRDA 2LHLA 3TZ1A 4BY4A 1GJYA 4U8DA 1EG3A 1NX2A 4FTGA 3VGOA 3RM1A 1A75B 4M2QA 1SK6D 2MJWB 1CNPA 1D1OA 1UUSA 5KSZA 1QJTA 3ZNIA 3JTDB 1DJGA 2KI6C 1JBAA 5PALA 1G8IA 1S6JA 2NCPA 2QPTA 4L9MA 1SR6C 2JRFA 2PSRA 4Q04A 4JWQA 3CLNA 1AJ4A 1WY9A 2JC2A 1SL8A 4D1EA 1C7WA 1QIVA 1IJ5A 1CDLA 1DJZA 1KFXS 3I5IB 4DS7A 4IL1A 1YX7A 1FF1A 2ZNEA 1A4PA 1QVIY 2KI4C 4PHKA 3JTDC 3K21A 4N5XA 2LHIA 1UHKA 3TS5B 1QATA 4YGDB 2MHHA 1FI6A 1IQ5A 4GAOA 1SL9A 1NCXA 2H61C 1WDCB 1A29A 2NXQA 1KQMC 3VRQA 1TN4A 2JWWA 1J55A 2F3ZA 2PMYA 3FS7A 4XYNA 5CSIA 1UWOA 4YBHB 1Y0VH 3BOWB 1TNQA 1H4BA 2JULA 1S3PA 5DKNA 2KYCA 3BUWB 3KHEA 2WC8A 1ALVA 3SG2A 1PK0D 2M9GA 2JNXA 5CSNA 3RLZA 1WLZA 1DJYA 3AKBA 3EKJA 1ZOTB 3I5HB 1J7QA 1YURA 4QJ5B 1SCMC 1UHNA 3VRPA 1CFFA 1A75A 3NSOA 2L2EA 4MZLA 3DVMA 1EJ3A 1JC2A 1PSRA 2CNPA 1J7RA 1YRUB 2GGMA 1IKUA 1KK8C 1WRZA 2K8MB 4ICBA 5AANA 1PULA 2HPSA 1IQ3A 1YTZC 3SIBA 1IH0A 1NCZA 1UHIA 2JQ6A 2BBMA 1BJFA 1MXEA 4YGEB 1YUTA 2DOQA 4ETOA 1ZUZA 4PE4A 5HKWA 1S6CA 2I7AA 3I5HC 3KPXA 2LC5A 2JZIA 2LUXA 4PE7A 1CKKA 3CR2A 1RK9A 1K9PA 4GGNA 1TIZA 1F8HA 1BR4B 1FBVA 2ISDA 5ER4X 1XA5A 2WORA 4HRGA 4MRXA 1BLQA 1DVIA 1KSMA 3D10A 3OX5A 3SG7A 1QLKA 1SCVA 1FPWA 1PALA 1KQVA 1KK7Y 1AUIB 1Y6WA 2NCOA 2OTGC 3ZWHA 3BOWA 2A4JA 2FJUB 4F0ZB 4PE0A 2M7NA 2WCEA 3SG4A 4M2PA 2PVBA 1QV0A 2R2IA 3DF0A 1RJVA 3FWCA 2JTTA 2JXCA 2LLUA 4NDBA 3VRNA 2CT9A 2KHNA 1K2HA 1BU3A 1GGZA 3I5FB 5K89A 3DD4A 1YRTB 1J7PA 1CM4A 1MF8B 1DTLA 3EVUA 4OKHA 5GQQC 2LP3A 3WXAA 1EH2A 1JWDA 1BT6A 1SY9A 2F2OA 4CIDA 2KFFA 4R1EA 1G4YR 1DJWA 1XYDA 3BUNB 1W7IB 3FIAA 2KQ6A 1B7TY 2BCBA 1OSAA 5B8IB 2I94A 1DT7B 2LLSA 4WQ3A 2F33A 2ZN8A 2GGZA 2KFHA 2KNEA 1YX8A 1YUSA 3I5GB 1S6IA 2CBLA 2BE4A 3DVJA 3HCMA 3I5FC 2EC6B 2VRGA 2M29A 3BYAA 2WCFA 2FOTA 2ZRTA 2KBMA 3CR5X 4DRWA 1K94A 4GFTA 2K2FA 1SNLA 1SMGA 4MSPA 3DVEA 2E6WA 1CDNA 1ZFSA 2V53A 1B9AA 1QVIZ 2PALA 3CTNA 1RTP1 1DJIA 1DMOA 2BBNA 3EK4A 4PHJA 4MZKA 1NX0A 4DCKA 3LCPC 3VROA 1BODA 1J1EA 2JT0A 1VRKA 5ER5A 1Y1XA 1S1EA 1QLSA 2SASA 2K0JA 1ZACA 4I5JA 2L98A 2KFGA 2LVJA 2KDHA 1TOPA 1YUUA 2IS9A 1NP8A 2LV7A 3KEVA 1DGUA 2Y4QA 1N0YA 1RECA 2JT8A 4I5NB 4JPZB 1JF2A 4OV2A 1QX2A 5CSFA 1KWOB 1AJ5A 1B8RA 1XFYO 4A4CA 2L4HA 2WNDA 1GQMA 3I5IC 4N1FA 1SKTA 1CDMA 2H2KA 4NQGA 4PCWA 3DVKA 3GOFA 5DKRA 2AUCA 4I5LB 3OB1B 4GUKA 3DF0B 1JUOA 4YGCB 4OVNF 4C0JA 3VRRA 1MHOA 2LLTA 2WCBA 1K93D 3OX6A 2ZN9A 4M2OA 4OCIA 1YR5A 3TS5C 1CMFA 4YGAA 1LA0A 2O60A 2OS8B 1PRWA 1M39A 1ALWA 1WDCC 2M49B 2LNKA 4MEWA 2NLNA 2KGRA
chains in the Genus database with same CATH superfamily
3WHUB 1AVSA 4OZDA 3B86A 3SS4A 2JOJA 1DJXA 2BCXA 1NX3A 1TUZA 1JF0A 1C7VA 3A4UB 1S5GY 3O6BA 4MZJA 1MQ1A 4MN0A 1CLLA 1M46A 2LCPA 3IF7A 1NYAA 3CWGA 2JTZA 1G33A 5D69A 5F6TA 3CGAA 1OMDA 1KK7Z 1IGVA 1LINA 2KOTA 3PN7B 4YI8A 1L2OB 5JJGA 2I18A 2NZ0A 1NPQA 1XO5A 5IBWA 3FWBA 4E68A 4XJKA 1CDPA 2JXLA 3PLFB 1IWQA 4HRHA 4YRUA 3SIAA 1F70A 5KTYA 2B1UA 4AOMA 5I8NA 1R6PA 4NDCA 4PDZA 3WNXB 3O4YA 3PM2A 1B1GA 4ORBB 1BF5A 5I94A 1SL7A 1DJHA 4PHNA 1K8UA 4AQJA 1PVAA 4I5KA 5I2OA 2M3WA 2JPOA 2BKHB 2ZKMX 4GPLB 2KLEA 2M1UA 3OHMB 3CZ1A 4KYNA 1XFWO 5G08A 3LK1A 3O2PA 1IRJA 5TNCA 2M0RA 1KCYA 2BAPA 5J3XA 2CTNA 4ZCVA 1JFJA 1Q80A 1RWYA 1UHJA 3LLEA 2AAOA 5HLVA 4CLNA 1OMRA 1XK4C 1EL4A 5KU1A 2WOSA 2QACA 2L51A 5I2QA 2HF5A 3NSKA 1V1GA 1SBJA 3OB2B 1K90D 3C1VA 1AHRA 1CM1A 2JU0A 2KYFA 3BUMB 2LUCA 4JQ0D 3EK8A 4HREE 3R1VA 4C0LA 4A4BA 3IQOA 3CABA 4MBEA 1UHHA 1S26D 1W7JB 1IJ6A 1WRLA 1QX7A 2BE6A 4UPGA 3GK1A 1EXRA 4PHMA 4N1GA 1C07A 1H8BA 3Q8IA 5FYXA 3D0YB 3GK2A 1LXFC 2E30A 1B8CA 1LKJA 2ZFDA 3KF9A 5DKQA 4AQIA 3A8RA 5BPJA 3NGVA 4YI9A 1V1FA 1XK4A 1R2UA 1F55A 2M97A 2KGBC 1HQVA 2EHBA 1BOCA 3O78A 1DEKA 1HT9A 1IG5A 2LMVA 2Y1MA 4HSZA 1U5IB 2BCAA 5HYDA 1CFPA 3PSRA 2CXJA 2LMUA 3D76A 3I5GC 2MA2A 1BG1A 3B6XA 1WRKA 2K7OA 2EC6C 1XFZO 1MXLC 2KI4B 4USLA 2MBXA 1WLMA 2LAPA 3LL8B 3S0BA 3BUOB 2I2RE 3B88A 3PFVA 1UP5A 1M63B 4XJKB 3CZ2A 1B47A 1OOIX 1TCFA 5I2LA 1K95A 1SYMA 2LM5A 3SG5A 3QRXA 1AK8A 1ZMZA 1CLMA 3CR4X 3FE6A 2OPOA 1A03A 1KQMB 1SW8A 2COLB 1OZOA 1CFDA 1OOJA 3B87A 3EKHA 1F4OA 5HKYA 1B4CA 2LVVA 4DIRA 1KFUS 1XFUO 2BNXA 1GM0A 5HLOA 2CCMA 3B7AA 3TDZA 4ORAB 2PQLA 2L5XB 4MVFA 1J7OA 1F71A 2ZNDA 1OE9B 2L5YA 1NWDA 3ICBA 2PASA 1TNXA 2M7LA 2QDIA 4WRIA 2FCDA 2JPTA 3NXAA 5JOLA 1LA3A 1QV1A 3S0AA 2K7BA 1PSBA 3CZTX 2WC5A 1SCMB 3BUXB 3D0YA 4GGFC 1Z4HA 1S5GZ 1S36A 1K9UA 3SJSA 2K61A 1OOGA 1QTXA 1N65A 4WQ2A 1CMGA 1TRFA 4DUQA 5AERA 2L0PA 1B8LA 1KK8B 4TNCA 3TUYB 1KWOC 2GV5A 2K7CA 2MLFC 2EGDA 1KFUL 1NCYA 2AMIA 2L4IA 2LE9B 3OBVA 4FQOA 4NDDA 1A2XA 1KFXL 1F4QA 2K7DA 3UO9A 4GNKB 1BR1B 1JFKA 1QX5B 2BKIB 2LVKA 1U5IA 3DYEA 2F8PA 4BY5A 2L2CA 3AKAA 5AFPA 3D75A 3JVTB 1DF0B 1AP4A 1K96A 1TNWA 2PRUA 1MWNA 1LS8A 3IQQA 3O4XA 1K9KA 1ODBA 3PALA 2LP2A 2OS8C 1LVCD 3AAKA 3AAJA 2JT3A 2QEOA 2LMTA 1TCOB 4GGFA 1L7ZA 1OOFA 1E8AA 3TUYC 2LVIA 3SG3A 1YVHA 2Q4UA 2P71A 1NX1A 2HQWA 1FW4A 2H61A 5FI2A 2M8UA 2Q91A 1CTRA 1XVJA 2KBIA 2FCEA 1J1DA 1Y1AA 2OTGB 3NSIA 3L4LA 4CFRA 1XFVO 3EK7A 2F3YA 2Y5IA 4MLWA 1TNPA 3WHTB 4CFQA 1OW4A 1MUXA 1M31A 2L50A 3JVTC 3H4SE 1NUBA 1X02A 3D77A 3L47A 1XFXO 1JSAA 2BL0B 3PN7C 1L2OC 4CPVA 1RFJA 3GK4X 2KQYA 4C0KA 2G2BA 1CLBA 2BECA 5D7FA 1B7TZ 1OZSA 2KAXA 1TTXA 1EG4A 2M1KB 1F54A 4ZCUA 3KO0A 1CFCA 2ZRSA 1MR8A 1YVLA 2D8NA 3CS1A 3PM8A 2QEBA 3VB1A 1ORGA 3M0WA 4OR9B 4PE1A 4QJ3B 3PJIA 3NHTA 1KSOA 1CB1A 1IIOA 1DGVA 2G9BA 3PATA 3F45A 4QJ4B 2K2AA 5HKZA 1QASA 5CPVA 3UNWA 3TDUA 3NSLA 4ORCB 3BXKA 2H8VA 2RGIA 1FI5A 2KI6D 3BJHA 2WCLA 1NIWA 3OP0A 1Y1UA 2BL0C 1SRAA 4P2YB 1DELA 1N2DA 1UURA 2SCPA 3EVRA 1DF0A 4GBAA 2LANA 1QS7A 4MRYA 1RROA 2KAVA 3HX4A 3LK0A 1QIWA 2MAZA 1QXPA 3DXLA 5D3OA 3S0DA 1M45A 2ERBA 5AEQA 2JNFA 3EVVA 4PALA 4P5OE 2O5GA 2HETA 3NHIA 1XFRA 2GTEA 2HQ8A 3MSEB 3SG6A 4YGBB 2F2PA 1BMOA 1SR6B 2KSPA 5AXIA 1SPYA 3BQ3A 1TWOA 1PVBA 2Y1NA 3E3RA 5CSJA 1OMVA 3K1EA 1OQPA 2MLEC 1DQEA 2P6BB 1GGWA 1NSHA 2TN4A 3TDIA 2KAYA 2MRDA 2LHLA 3TZ1A 4BY4A 1GJYA 4U8DA 1EG3A 1NX2A 4FTGA 3VGOA 3RM1A 1A75B 3FE9A 4M2QA 1SK6D 2MJWB 1CNPA 1D1OA 1UUSA 2WCHA 5KSZA 1QJTA 3ZNIA 3JTDB 1DJGA 2KI6C 1JBAA 5PALA 1G8IA 1S6JA 2NCPA 2QPTA 4L9MA 1SR6C 2JRFA 2PSRA 4Q04A 4JWQA 3CLNA 1AJ4A 1WY9A 2JC2A 1SL8A 4D1EA 1C7WA 1QIVA 5DICA 1IJ5A 1CDLA 1DJZA 1KFXS 3I5IB 4DS7A 4IL1A 2QEVA 1YX7A 1FF1A 2ZNEA 3S0EA 1A4PA 1QVIY 2KI4C 3BFAA 4PHKA 1C3ZA 3JTDC 3K21A 4N5XA 2LHIA 4IJ7A 1UHKA 3TS5B 1QATA 4YGDB 2MHHA 1FI6A 4INWA 1IQ5A 1Z2CB 4GAOA 3R1OA 1SL9A 1NCXA 2H61C 4JKTA 1WDCB 1A29A 2NXQA 1KQMC 3VRQA 1TN4A 2JWWA 1J55A 2F3ZA 2PMYA 3FE8A 3FS7A 4XYNA 5CSIA 1UWOA 4YBHB 3CYZA 1Y0VH 2KLDA 3BOWB 3EG5B 1TNQA 1H4BA 2JULA 1S3PA 5DKNA 2KYCA 3BUWB 3KHEA 2WC8A 1ALVA 3SG2A 1PK0D 5HL1A 3BFBA 2M9GA 2JNXA 5CSNA 4INXA 3RLZA 1WLZA 1DJYA 3D78A 1OOHA 3AKBA 2WCMA 1ZOTB 3EKJA 3I5HB 3SS3A 1YURA 4QJ5B 1J7QA 1SCMC 1UHNA 3VRPA 1CFFA 1A75A 3NSOA 2L2EA 4MZLA 3DVMA 1EJ3A 4F7FA 1JC2A 1PSRA 2CNPA 1J7RA 1YRUB 2GGMA 1IKUA 5FI6A 1KK8C 3S0GA 1WRZA 2K8MB 4ICBA 5AANA 3R72A 1PULA 2HPSA 1IQ3A 1YTZC 3SIBA 1IH0A 1NCZA 1UHIA 2JQ6A 2BBMA 1BJFA 1MXEA 4YGEB 1YUTA 2DOQA 2FJYA 4ETOA 1ZUZA 4PE4A 5HKWA 1S6CA 2I7AA 3I5HC 3KPXA 2LC5A 2JZIA 2LUXA 4FQTA 4PE7A 1CKKA 3CR2A 1RK9A 1K9PA 4GGNA 1T14A 1TIZA 1F8HA 1BR4B 3BFHA 1FBVA 2ISDA 5ER4X 1XA5A 2WORA 4HRGA 4MRXA 1BLQA 2P70A 1DVIA 1KSMA 3D10A 3OX5A 3SG7A 1QLKA 1SCVA 1FPWA 1PALA 1KQVA 1KK7Y 1AUIB 1Y6WA 2NCOA 2OTGC 2PYQA 3ZWHA 3BOWA 2A4JA 2FJUB 4F0ZB 4PE0A 2M7NA 2WCEA 3SG4A 4M2PA 2PVBA 1QV0A 2R2IA 3DF0A 1RJVA 3FWCA 2JTTA 2JXCA 2LLUA 4NDBA 2WCKA 3VRNA 2WCJA 2CT9A 3CZ0A 2KHNA 1K2HA 1BU3A 1GGZA 3I5FB 3N7HA 5K89A 3DD4A 1YRTB 1J7PA 1CM4A 1MF8B 1DTLA 3EVUA 4OKHA 5GQQC 2LP3A 3WXAA 1EH2A 1JWDA 1BT6A 1SY9A 2F2OA 4CIDA 2KFFA 1P28A 3V2LA 4R1EA 1G4YR 1DJWA 1XYDA 3BUNB 1W7IB 3FIAA 5EL2A 2KQ6A 3QMEA 1B7TY 2BCBA 1OSAA 5B8IB 2QEHA 2I94A 1DT7B 2LLSA 4WQ3A 2F33A 2ZN8A 2GGZA 2KFHA 2KNEA 1YX8A 1YUSA 3I5GB 1S6IA 2CBLA 2BE4A 3DVJA 3HCMA 3I5FC 2EC6B 1TUJA 2M29A 2VRGA 3BYAA 2WCFA 3L4AA 2FOTA 2ZRTA 2KBMA 3CDNA 3CR5X 4DRWA 1K94A 3S0FA 4GFTA 2K2FA 1SNLA 1SMGA 3D73A 1W9ZA 3DVEA 2E6WA 4JD9A 4MSPA 1DC1A 1CDNA 1ZFSA 2V53A 1B9AA 1QVIZ 4PT1A 2PALA 3CTNA 1RTP1 1QWVA 1DJIA 1DMOA 2BBNA 3EK4A 4PHJA 4MZKA 1NX0A 4DCKA 3LCPC 3VROA 1BODA 2K60A 1J1EA 2JT0A 1VRKA 5ER5A 1Y1XA 1S1EA 3RZSA 3OGNA 1QLSA 2SASA 3SS5A 2K0JA 1ZACA 2YGUA 2L98A 4I5JA 2KFGA 2LVJA 2KDHA 1TOPA 1YUUA 2IS9A 1NP8A 2LV7A 3KEVA 1DGUA 2Y4QA 1N0YA 1RECA 3IVTA 2JT8A 4I5NB 5FI7A 4JPZB 1JF2A 4OV2A 1QX2A 5CSFA 1KWOB 1AJ5A 1B8RA 1XFYO 4A4CA 2L4HA 2WNDA 1GQMA 3I5IC 4N1FA 1SKTA 1CDMA 2H2KA 3DY9A 4NQGA 3DVKA 3GOFA 4PCWA 5DKRA 2AUCA 4I5LB 3OB1B 4GUKA 3DF0B 2KPHA 1JUOA 4YGCB 4OVNF 4C0JA 3VRRA 1MHOA 2LLTA 2WCBA 1K93D 3OX6A 1SSEB 2ZN9A 4M2OA 4OCIA 1YR5A 3TS5C 1CMFA 2WC6A 4YGAA 1LA0A 2O60A 2OS8B 1PRWA 3D74A 1M39A 1ALWA 1WDCC 3DZTA 2M49B 3R1PA 1C3YA 2LNKA 4MEWA 2NLNA 2KGRA
chains in the Genus database with same CATH topology
3WHUB 1AVSA 2JOJA 1DJXA 2BCXA 1NX3A 1JF0A 1C7VA 3A4UB 1S5GY 3O6BA 4MZJA 1MQ1A 4MN0A 1CLLA 1M46A 2LCPA 3IF7A 1NYAA 3CWGA 2JTZA 1G33A 5D69A 5F6TA 3CGAA 1OMDA 1KK7Z 1IGVA 1LINA 2KOTA 3PN7B 4YI8A 1L2OB 5JJGA 2I18A 2NZ0A 1NPQA 1XO5A 5IBWA 3FWBA 4E68A 4XJKA 1CDPA 2JXLA 3PLFB 1IWQA 4HRHA 4YRUA 3SIAA 1F70A 5KTYA 2B1UA 4AOMA 5I8NA 1R6PA 4NDCA 4PDZA 3WNXB 3O4YA 1B1GA 4ORBB 1BF5A 1SL7A 1DJHA 4PHNA 1K8UA 4AQJA 1PVAA 4I5KA 5I2OA 2M3WA 2ZKMX 2BKHB 4GPLB 2M1UA 3OHMB 1XFWO 5G08A 3LK1A 3O2PA 1IRJA 5TNCA 2M0RA 1KCYA 5J3XA 2CTNA 4ZCVA 1JFJA 1Q80A 1RWYA 1UHJA 3LLEA 2AAOA 5HLVA 4CLNA 1OMRA 1XK4C 1EL4A 5KU1A 2WOSA 2QACA 2L51A 5I2QA 2HF5A 3NSKA 1V1GA 1SBJA 3OB2B 1K90D 3C1VA 1AHRA 1CM1A 2JU0A 2KYFA 3BUMB 2LUCA 4JQ0D 3EK8A 4HREE 4C0LA 4A4BA 3IQOA 4MBEA 1UHHA 1S26D 1W7JB 1IJ6A 1WRLA 1QX7A 2BE6A 4UPGA 3GK1A 1EXRA 4PHMA 4N1GA 1C07A 1H8BA 5FYXA 3D0YB 3GK2A 1LXFC 2E30A 1B8CA 1LKJA 2ZFDA 3KF9A 5DKQA 4AQIA 3A8RA 5BPJA 4YI9A 1V1FA 1XK4A 1R2UA 1F55A 2M97A 2KGBC 1HQVA 2EHBA 1BOCA 3O78A 1HT9A 1IG5A 2LMVA 2Y1MA 4HSZA 1U5IB 2BCAA 5HYDA 1CFPA 3PSRA 2CXJA 2LMUA 3I5GC 2MA2A 1BG1A 1WRKA 2K7OA 2EC6C 1XFZO 1MXLC 2KI4B 4USLA 2MBXA 1WLMA 2LAPA 3LL8B 3BUOB 2I2RE 3PFVA 1UP5A 1M63B 4XJKB 1B47A 1TCFA 5I2LA 1K95A 1SYMA 2LM5A 3SG5A 3QRXA 1AK8A 1ZMZA 1CLMA 3CR4X 1A03A 2OPOA 1KQMB 1SW8A 2COLB 1OZOA 1CFDA 1OOJA 3EKHA 5HKYA 1F4OA 1B4CA 2LVVA 4DIRA 1KFUS 1XFUO 5HLOA 2CCMA 3TDZA 4ORAB 2L5XB 4MVFA 1J7OA 1F71A 2ZNDA 1OE9B 3ICBA 1NWDA 2PASA 1TNXA 2M7LA 4WRIA 2FCDA 2JPTA 3NXAA 5JOLA 1LA3A 1QV1A 2K7BA 1PSBA 3CZTX 1SCMB 3BUXB 3D0YA 4GGFC 1S5GZ 1S36A 1K9UA 3SJSA 2K61A 1QTXA 1N65A 4WQ2A 1CMGA 1TRFA 4DUQA 5AERA 2L0PA 1B8LA 1KK8B 4TNCA 3TUYB 1KWOC 2GV5A 2K7CA 2MLFC 2EGDA 1KFUL 1NCYA 2AMIA 2L4IA 2LE9B 4FQOA 4NDDA 1A2XA 1KFXL 1F4QA 2K7DA 4GNKB 1BR1B 1JFKA 1QX5B 2BKIB 2LVKA 1U5IA 2F8PA 4BY5A 3AKAA 5AFPA 3JVTB 1DF0B 1AP4A 1K96A 1TNWA 2PRUA 1MWNA 3IQQA 1K9KA 1ODBA 3PALA 2LP2A 2OS8C 1LVCD 3AAKA 3AAJA 2JT3A 2LMTA 1TCOB 4GGFA 1L7ZA 1E8AA 3TUYC 2LVIA 3SG3A 1YVHA 2Q4UA 1NX1A 2HQWA 1FW4A 2H61A 2M8UA 2Q91A 1CTRA 1XVJA 2KBIA 2FCEA 1J1DA 1Y1AA 2OTGB 3NSIA 4CFRA 1XFVO 3EK7A 2F3YA 2Y5IA 4MLWA 1TNPA 3WHTB 4CFQA 1MUXA 1M31A 2L50A 3JVTC 3H4SE 1NUBA 1X02A 1XFXO 1JSAA 2BL0B 3PN7C 1L2OC 4CPVA 1RFJA 3GK4X 2KQYA 4C0KA 2G2BA 1CLBA 2BECA 5D7FA 1B7TZ 1OZSA 2KAXA 1TTXA 1EG4A 2M1KB 1F54A 4ZCUA 3KO0A 1CFCA 2ZRSA 1MR8A 1YVLA 2D8NA 3CS1A 3PM8A 3M0WA 4OR9B 4PE1A 4QJ3B 1KSOA 1CB1A 1DGVA 2G9BA 3PATA 3F45A 4QJ4B 2K2AA 5HKZA 1QASA 5CPVA 3TDUA 3NSLA 4ORCB 3BXKA 2RGIA 1FI5A 2KI6D 3OP0A 1NIWA 1Y1UA 2BL0C 1SRAA 4P2YB 1N2DA 1UURA 2SCPA 3EVRA 1DF0A 4GBAA 2LANA 1QS7A 4MRYA 1RROA 2KAVA 3HX4A 3LK0A 1QIWA 2MAZA 1QXPA 1M45A 5AEQA 2JNFA 3EVVA 4PALA 4P5OE 2O5GA 2HETA 2HQ8A 3MSEB 3SG6A 4YGBB 2F2PA 1BMOA 1SR6B 2KSPA 5AXIA 1SPYA 3BQ3A 1PVBA 2Y1NA 3E3RA 5CSJA 1OMVA 1GGWA 1OQPA 2MLEC 2P6BB 1NSHA 2TN4A 3TDIA 2KAYA 2MRDA 2LHLA 3TZ1A 4BY4A 1GJYA 4U8DA 1EG3A 1NX2A 4FTGA 3VGOA 3RM1A 1A75B 4M2QA 1SK6D 2MJWB 1CNPA 1D1OA 1UUSA 5KSZA 1QJTA 3ZNIA 3JTDB 1DJGA 2KI6C 1JBAA 5PALA 1G8IA 1S6JA 2NCPA 2QPTA 4L9MA 1SR6C 2JRFA 2PSRA 4Q04A 4JWQA 3CLNA 1AJ4A 1WY9A 2JC2A 1SL8A 4D1EA 1C7WA 1QIVA 1IJ5A 1CDLA 1DJZA 1KFXS 3I5IB 4DS7A 4IL1A 1YX7A 1FF1A 2ZNEA 1A4PA 1QVIY 2KI4C 4PHKA 3JTDC 3K21A 4N5XA 2LHIA 1UHKA 3TS5B 1QATA 4YGDB 2MHHA 1FI6A 1IQ5A 4GAOA 1SL9A 1NCXA 2H61C 1WDCB 1A29A 2NXQA 1KQMC 3VRQA 1TN4A 2JWWA 1J55A 2F3ZA 2PMYA 3FS7A 4XYNA 5CSIA 1UWOA 4YBHB 1Y0VH 3BOWB 1TNQA 1H4BA 2JULA 1S3PA 5DKNA 2KYCA 3BUWB 3KHEA 2WC8A 1ALVA 3SG2A 1PK0D 2M9GA 2JNXA 5CSNA 3RLZA 1WLZA 1DJYA 3AKBA 3EKJA 1ZOTB 3I5HB 1J7QA 1YURA 4QJ5B 1SCMC 1UHNA 3VRPA 1CFFA 1A75A 3NSOA 2L2EA 4MZLA 3DVMA 1EJ3A 1JC2A 1PSRA 2CNPA 1J7RA 1YRUB 2GGMA 1IKUA 1KK8C 1WRZA 2K8MB 4ICBA 5AANA 1PULA 2HPSA 1IQ3A 1YTZC 3SIBA 1IH0A 1NCZA 1UHIA 2JQ6A 2BBMA 1BJFA 1MXEA 4YGEB 1YUTA 2DOQA 4ETOA 1ZUZA 4PE4A 5HKWA 1S6CA 2I7AA 3I5HC 3KPXA 2LC5A 2JZIA 2LUXA 4PE7A 1CKKA 3CR2A 1RK9A 1K9PA 4GGNA 1TIZA 1F8HA 1BR4B 1FBVA 2ISDA 5ER4X 1XA5A 2WORA 4HRGA 4MRXA 1BLQA 1DVIA 1KSMA 3D10A 3OX5A 3SG7A 1QLKA 1SCVA 1FPWA 1PALA 1KQVA 1KK7Y 1AUIB 1Y6WA 2NCOA 2OTGC 3ZWHA 3BOWA 2A4JA 2FJUB 4F0ZB 4PE0A 2M7NA 2WCEA 3SG4A 4M2PA 2PVBA 1QV0A 2R2IA 3DF0A 1RJVA 3FWCA 2JTTA 2JXCA 2LLUA 4NDBA 3VRNA 2CT9A 2KHNA 1K2HA 1BU3A 1GGZA 3I5FB 5K89A 3DD4A 1YRTB 1J7PA 1CM4A 1MF8B 1DTLA 3EVUA 4OKHA 5GQQC 2LP3A 3WXAA 1EH2A 1JWDA 1BT6A 1SY9A 2F2OA 4CIDA 2KFFA 4R1EA 1G4YR 1DJWA 1XYDA 3BUNB 1W7IB 3FIAA 2KQ6A 1B7TY 2BCBA 1OSAA 5B8IB 2I94A 1DT7B 2LLSA 4WQ3A 2F33A 2ZN8A 2GGZA 2KFHA 2KNEA 1YX8A 1YUSA 3I5GB 1S6IA 2CBLA 2BE4A 3DVJA 3HCMA 3I5FC 2EC6B 2VRGA 2M29A 3BYAA 2WCFA 2FOTA 2ZRTA 2KBMA 3CR5X 4DRWA 1K94A 4GFTA 2K2FA 1SNLA 1SMGA 4MSPA 3DVEA 2E6WA 1CDNA 1ZFSA 2V53A 1B9AA 1QVIZ 2PALA 3CTNA 1RTP1 1DJIA 1DMOA 2BBNA 3EK4A 4PHJA 4MZKA 1NX0A 4DCKA 3LCPC 3VROA 1BODA 1J1EA 2JT0A 1VRKA 5ER5A 1Y1XA 1S1EA 1QLSA 2SASA 2K0JA 1ZACA 4I5JA 2L98A 2KFGA 2LVJA 2KDHA 1TOPA 1YUUA 2IS9A 1NP8A 2LV7A 3KEVA 1DGUA 2Y4QA 1N0YA 1RECA 2JT8A 4I5NB 4JPZB 1JF2A 4OV2A 1QX2A 5CSFA 1KWOB 1AJ5A 1B8RA 1XFYO 4A4CA 2L4HA 2WNDA 1GQMA 3I5IC 4N1FA 1SKTA 1CDMA 2H2KA 4NQGA 4PCWA 3DVKA 3GOFA 5DKRA 2AUCA 4I5LB 3OB1B 4GUKA 3DF0B 1JUOA 4YGCB 4OVNF 4C0JA 3VRRA 1MHOA 2LLTA 2WCBA 1K93D 3OX6A 2ZN9A 4M2OA 4OCIA 1YR5A 3TS5C 1CMFA 4YGAA 1LA0A 2O60A 2OS8B 1PRWA 1M39A 1ALWA 1WDCC 2M49B 2LNKA 4MEWA 2NLNA 2KGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHU B;  1AVS A;  2JOJ A;  1DJX A;  2BCX A;  1NX3 A;  1JF0 A;  1C7V A;  3A4U B;  1S5G Y;  3O6B A;  4MZJ A;  1MQ1 A;  4MN0 A;  1CLL A;  1M46 A;  2LCP A;  3IF7 A;  1NYA A;  3CWG A;  2JTZ A;  1G33 A;  5D69 A;  5F6T A;  3CGA A;  1OMD A;  1KK7 Z;  1IGV A;  1LIN A;  2KOT A;  3PN7 B;  4YI8 A;  1L2O B;  5JJG A;  2I18 A;  2NZ0 A;  1NPQ A;  1XO5 A;  5IBW A;  3FWB A;  4E68 A;  4XJK A;  1CDP A;  2JXL A;  3PLF B;  1IWQ A;  4HRH A;  4YRU A;  3SIA A;  1F70 A;  5KTY A;  2B1U A;  4AOM A;  5I8N A;  1R6P A;  4NDC A;  4PDZ A;  3WNX B;  3O4Y A;  1B1G A;  4ORB B;  1BF5 A;  1SL7 A;  1DJH A;  4PHN A;  1K8U A;  4AQJ A;  1PVA A;  4I5K A;  5I2O A;  2M3W A;  2ZKM X;  2BKH B;  4GPL B;  2M1U A;  3OHM B;  1XFW O;  5G08 A;  3LK1 A;  3O2P A;  1IRJ A;  5TNC A;  2M0R A;  1KCY A;  5J3X A;  2CTN A;  4ZCV A;  1JFJ A;  1Q80 A;  1RWY A;  1UHJ A;  3LLE A;  2AAO A;  5HLV A;  4CLN A;  1OMR A;  1XK4 C;  1EL4 A;  5KU1 A;  2WOS A;  2QAC A;  2L51 A;  5I2Q A;  2HF5 A;  3NSK A;  1V1G A;  1SBJ A;  3OB2 B;  1K90 D;  3C1V A;  1AHR A;  1CM1 A;  2JU0 A;  2KYF A;  3BUM B;  2LUC A;  4JQ0 D;  3EK8 A;  4HRE E;  4C0L A;  4A4B A;  3IQO A;  4MBE A;  1UHH A;  1S26 D;  1W7J B;  1IJ6 A;  1WRL A;  1QX7 A;  2BE6 A;  4UPG A;  3GK1 A;  1EXR A;  4PHM A;  4N1G A;  1C07 A;  1H8B A;  5FYX A;  3D0Y B;  3GK2 A;  1LXF C;  2E30 A;  1B8C A;  1LKJ A;  2ZFD A;  3KF9 A;  5DKQ A;  4AQI A;  3A8R A;  5BPJ A;  4YI9 A;  1V1F A;  1XK4 A;  1R2U A;  1F55 A;  2M97 A;  2KGB C;  1HQV A;  2EHB A;  1BOC A;  3O78 A;  1HT9 A;  1IG5 A;  2LMV A;  2Y1M A;  4HSZ A;  1U5I B;  2BCA A;  5HYD A;  1CFP A;  3PSR A;  2CXJ A;  2LMU A;  3I5G C;  2MA2 A;  1BG1 A;  1WRK A;  2K7O A;  2EC6 C;  1XFZ O;  1MXL C;  2KI4 B;  4USL A;  2MBX A;  1WLM A;  2LAP A;  3LL8 B;  3BUO B;  2I2R E;  3PFV A;  1UP5 A;  1M63 B;  4XJK B;  1B47 A;  1TCF A;  5I2L A;  1K95 A;  1SYM A;  2LM5 A;  3SG5 A;  3QRX A;  1AK8 A;  1ZMZ A;  1CLM A;  3CR4 X;  1A03 A;  2OPO A;  1KQM B;  1SW8 A;  2COL B;  1OZO A;  1CFD A;  1OOJ A;  3EKH A;  5HKY A;  1F4O A;  1B4C A;  2LVV A;  4DIR A;  1KFU S;  1XFU O;  5HLO A;  2CCM A;  3TDZ A;  4ORA B;  2L5X B;  4MVF A;  1J7O A;  1F71 A;  2ZND A;  1OE9 B;  3ICB A;  1NWD A;  2PAS A;  1TNX A;  2M7L A;  4WRI A;  2FCD A;  2JPT A;  3NXA A;  5JOL A;  1LA3 A;  1QV1 A;  2K7B A;  1PSB A;  3CZT X;  1SCM B;  3BUX B;  3D0Y A;  4GGF C;  1S5G Z;  1S36 A;  1K9U A;  3SJS A;  2K61 A;  1QTX A;  1N65 A;  4WQ2 A;  1CMG A;  1TRF A;  4DUQ A;  5AER A;  2L0P A;  1B8L A;  1KK8 B;  4TNC A;  3TUY B;  1KWO C;  2GV5 A;  2K7C A;  2MLF C;  2EGD A;  1KFU L;  1NCY A;  2AMI A;  2L4I A;  2LE9 B;  4FQO A;  4NDD A;  1A2X A;  1KFX L;  1F4Q A;  2K7D A;  4GNK B;  1BR1 B;  1JFK A;  1QX5 B;  2BKI B;  2LVK A;  1U5I A;  2F8P A;  4BY5 A;  3AKA A;  5AFP A;  3JVT B;  1DF0 B;  1AP4 A;  1K96 A;  1TNW A;  2PRU A;  1MWN A;  3IQQ A;  1K9K A;  1ODB A;  3PAL A;  2LP2 A;  2OS8 C;  1LVC D;  3AAK A;  3AAJ A;  2JT3 A;  2LMT A;  1TCO B;  4GGF A;  1L7Z A;  1E8A A;  3TUY C;  2LVI A;  3SG3 A;  1YVH A;  2Q4U A;  1NX1 A;  2HQW A;  1FW4 A;  2H61 A;  2M8U A;  2Q91 A;  1CTR A;  1XVJ A;  2KBI A;  2FCE A;  1J1D A;  1Y1A A;  2OTG B;  3NSI A;  4CFR A;  1XFV O;  3EK7 A;  2F3Y A;  2Y5I A;  4MLW A;  1TNP A;  3WHT B;  4CFQ A;  1MUX A;  1M31 A;  2L50 A;  3JVT C;  3H4S E;  1NUB A;  1X02 A;  1XFX O;  1JSA A;  2BL0 B;  3PN7 C;  1L2O C;  4CPV A;  1RFJ A;  3GK4 X;  2KQY A;  4C0K A;  2G2B A;  1CLB A;  2BEC A;  5D7F A;  1B7T Z;  1OZS A;  2KAX A;  1TTX A;  1EG4 A;  2M1K B;  1F54 A;  4ZCU A;  3KO0 A;  1CFC A;  2ZRS A;  1MR8 A;  1YVL A;  2D8N A;  3CS1 A;  3PM8 A;  3M0W A;  4OR9 B;  4PE1 A;  4QJ3 B;  1KSO A;  1CB1 A;  1DGV A;  2G9B A;  3PAT A;  3F45 A;  4QJ4 B;  2K2A A;  5HKZ A;  1QAS A;  5CPV A;  3TDU A;  3NSL A;  4ORC B;  3BXK A;  2RGI A;  1FI5 A;  2KI6 D;  3OP0 A;  1NIW A;  1Y1U A;  2BL0 C;  1SRA A;  4P2Y B;  1N2D A;  1UUR A;  2SCP A;  3EVR A;  1DF0 A;  4GBA A;  2LAN A;  1QS7 A;  4MRY A;  1RRO A;  2KAV A;  3HX4 A;  3LK0 A;  1QIW A;  2MAZ A;  1QXP A;  1M45 A;  5AEQ A;  2JNF A;  3EVV A;  4PAL A;  4P5O E;  2O5G A;  2HET A;  2HQ8 A;  3MSE B;  3SG6 A;  4YGB B;  2F2P A;  1BMO A;  1SR6 B;  2KSP A;  5AXI A;  1SPY A;  3BQ3 A;  1PVB A;  2Y1N A;  3E3R A;  5CSJ A;  1OMV A;  1GGW A;  1OQP A;  2MLE C;  2P6B B;  1NSH A;  2TN4 A;  3TDI A;  2KAY A;  2MRD A;  2LHL A;  3TZ1 A;  4BY4 A;  1GJY A;  4U8D A;  1EG3 A;  1NX2 A;  4FTG A;  3VGO A;  3RM1 A;  1A75 B;  4M2Q A;  1SK6 D;  2MJW B;  1CNP A;  1D1O A;  1UUS A;  5KSZ A;  1QJT A;  3ZNI A;  3JTD B;  1DJG A;  2KI6 C;  1JBA A;  5PAL A;  1G8I A;  1S6J A;  2NCP A;  2QPT A;  4L9M A;  1SR6 C;  2JRF A;  2PSR A;  4Q04 A;  4JWQ A;  3CLN A;  1AJ4 A;  1WY9 A;  2JC2 A;  1SL8 A;  4D1E A;  1C7W A;  1QIV A;  1IJ5 A;  1CDL A;  1DJZ A;  1KFX S;  3I5I B;  4DS7 A;  4IL1 A;  1YX7 A;  1FF1 A;  2ZNE A;  1A4P A;  1QVI Y;  2KI4 C;  4PHK A;  3JTD C;  3K21 A;  4N5X A;  2LHI A;  1UHK A;  3TS5 B;  1QAT A;  4YGD B;  2MHH A;  1FI6 A;  1IQ5 A;  4GAO A;  1SL9 A;  1NCX A;  2H61 C;  1WDC B;  1A29 A;  2NXQ A;  1KQM C;  3VRQ A;  1TN4 A;  2JWW A;  1J55 A;  2F3Z A;  2PMY A;  3FS7 A;  4XYN A;  5CSI A;  1UWO A;  4YBH B;  1Y0V H;  3BOW B;  1TNQ A;  1H4B A;  2JUL A;  1S3P A;  5DKN A;  2KYC A;  3BUW B;  3KHE A;  2WC8 A;  1ALV A;  3SG2 A;  1PK0 D;  2M9G A;  2JNX A;  5CSN A;  3RLZ A;  1WLZ A;  1DJY A;  3AKB A;  3EKJ A;  1ZOT B;  3I5H B;  1J7Q A;  1YUR A;  4QJ5 B;  1SCM C;  1UHN A;  3VRP A;  1CFF A;  1A75 A;  3NSO A;  2L2E A;  4MZL A;  3DVM A;  1EJ3 A;  1JC2 A;  1PSR A;  2CNP A;  1J7R A;  1YRU B;  2GGM A;  1IKU A;  1KK8 C;  1WRZ A;  2K8M B;  4ICB A;  5AAN A;  1PUL A;  2HPS A;  1IQ3 A;  1YTZ C;  3SIB A;  1IH0 A;  1NCZ A;  1UHI A;  2JQ6 A;  2BBM A;  1BJF A;  1MXE A;  4YGE B;  1YUT A;  2DOQ A;  4ETO A;  1ZUZ A;  4PE4 A;  5HKW A;  1S6C A;  2I7A A;  3I5H C;  3KPX A;  2LC5 A;  2JZI A;  2LUX A;  4PE7 A;  1CKK A;  3CR2 A;  1RK9 A;  1K9P A;  4GGN A;  1TIZ A;  1F8H A;  1BR4 B;  1FBV A;  2ISD A;  5ER4 X;  1XA5 A;  2WOR A;  4HRG A;  4MRX A;  1BLQ A;  1DVI A;  1KSM A;  3D10 A;  3OX5 A;  3SG7 A;  1QLK A;  1SCV A;  1FPW A;  1PAL A;  1KQV A;  1KK7 Y;  1AUI B;  1Y6W A;  2NCO A;  2OTG C;  3ZWH A;  3BOW A;  2A4J A;  2FJU B;  4F0Z B;  4PE0 A;  2M7N A;  2WCE A;  3SG4 A;  4M2P A;  2PVB A;  1QV0 A;  2R2I A;  3DF0 A;  1RJV A;  3FWC A;  2JTT A;  2JXC A;  2LLU A;  4NDB A;  3VRN A;  2CT9 A;  2KHN A;  1K2H A;  1BU3 A;  1GGZ A;  3I5F B;  5K89 A;  3DD4 A;  1YRT B;  1J7P A;  1CM4 A;  1MF8 B;  1DTL A;  3EVU A;  4OKH A;  5GQQ C;  2LP3 A;  3WXA A;  1EH2 A;  1JWD A;  1BT6 A;  1SY9 A;  2F2O A;  4CID A;  2KFF A;  4R1E A;  1G4Y R;  1DJW A;  1XYD A;  3BUN B;  1W7I B;  3FIA A;  2KQ6 A;  1B7T Y;  2BCB A;  1OSA A;  5B8I B;  2I94 A;  1DT7 B;  2LLS A;  4WQ3 A;  2F33 A;  2ZN8 A;  2GGZ A;  2KFH A;  2KNE A;  1YX8 A;  1YUS A;  3I5G B;  1S6I A;  2CBL A;  2BE4 A;  3DVJ A;  3HCM A;  3I5F C;  2EC6 B;  2VRG A;  2M29 A;  3BYA A;  2WCF A;  2FOT A;  2ZRT A;  2KBM A;  3CR5 X;  4DRW A;  1K94 A;  4GFT A;  2K2F A;  1SNL A;  1SMG A;  4MSP A;  3DVE A;  2E6W A;  1CDN A;  1ZFS A;  2V53 A;  1B9A A;  1QVI Z;  2PAL A;  3CTN A;  1RTP 1;  1DJI A;  1DMO A;  2BBN A;  3EK4 A;  4PHJ A;  4MZK A;  1NX0 A;  4DCK A;  3LCP C;  3VRO A;  1BOD A;  1J1E A;  2JT0 A;  1VRK A;  5ER5 A;  1Y1X A;  1S1E A;  1QLS A;  2SAS A;  2K0J A;  1ZAC A;  4I5J A;  2L98 A;  2KFG A;  2LVJ A;  2KDH A;  1TOP A;  1YUU A;  2IS9 A;  1NP8 A;  2LV7 A;  3KEV A;  1DGU A;  2Y4Q A;  1N0Y A;  1REC A;  2JT8 A;  4I5N B;  4JPZ B;  1JF2 A;  4OV2 A;  1QX2 A;  5CSF A;  1KWO B;  1AJ5 A;  1B8R A;  1XFY O;  4A4C A;  2L4H A;  2WND A;  1GQM A;  3I5I C;  4N1F A;  1SKT A;  1CDM A;  2H2K A;  4NQG A;  4PCW A;  3DVK A;  3GOF A;  5DKR A;  2AUC A;  4I5L B;  3OB1 B;  4GUK A;  3DF0 B;  1JUO A;  4YGC B;  4OVN F;  4C0J A;  3VRR A;  1MHO A;  2LLT A;  2WCB A;  1K93 D;  3OX6 A;  2ZN9 A;  4M2O A;  4OCI A;  1YR5 A;  3TS5 C;  1CMF A;  4YGA A;  1LA0 A;  2O60 A;  2OS8 B;  1PRW A;  1M39 A;  1ALW A;  1WDC C;  2M49 B;  2LNK A;  4MEW A;  2NLN A;  2KGR A; 
#chains in the Genus database with same CATH topology
 3WHU B;  1AVS A;  4OZD A;  3B86 A;  3SS4 A;  2JOJ A;  1DJX A;  2BCX A;  1NX3 A;  1TUZ A;  1JF0 A;  1C7V A;  3A4U B;  1S5G Y;  3O6B A;  4MZJ A;  1MQ1 A;  4MN0 A;  1CLL A;  1M46 A;  2LCP A;  3IF7 A;  1NYA A;  3CWG A;  2JTZ A;  1G33 A;  5D69 A;  5F6T A;  3CGA A;  1OMD A;  1KK7 Z;  1IGV A;  1LIN A;  2KOT A;  3PN7 B;  4YI8 A;  1L2O B;  5JJG A;  2I18 A;  2NZ0 A;  1NPQ A;  1XO5 A;  5IBW A;  3FWB A;  4E68 A;  4XJK A;  1CDP A;  2JXL A;  3PLF B;  1IWQ A;  4HRH A;  4YRU A;  3SIA A;  1F70 A;  5KTY A;  2B1U A;  4AOM A;  5I8N A;  1R6P A;  4NDC A;  4PDZ A;  3WNX B;  3O4Y A;  3PM2 A;  1B1G A;  4ORB B;  1BF5 A;  5I94 A;  1SL7 A;  1DJH A;  4PHN A;  1K8U A;  4AQJ A;  1PVA A;  4I5K A;  5I2O A;  2M3W A;  2JPO A;  2BKH B;  2ZKM X;  4GPL B;  2KLE A;  2M1U A;  3OHM B;  3CZ1 A;  4KYN A;  1XFW O;  5G08 A;  3LK1 A;  3O2P A;  1IRJ A;  5TNC A;  2M0R A;  1KCY A;  2BAP A;  5J3X A;  2CTN A;  4ZCV A;  1JFJ A;  1Q80 A;  1RWY A;  1UHJ A;  3LLE A;  2AAO A;  5HLV A;  4CLN A;  1OMR A;  1XK4 C;  1EL4 A;  5KU1 A;  2WOS A;  2QAC A;  2L51 A;  5I2Q A;  2HF5 A;  3NSK A;  1V1G A;  1SBJ A;  3OB2 B;  1K90 D;  3C1V A;  1AHR A;  1CM1 A;  2JU0 A;  2KYF A;  3BUM B;  2LUC A;  4JQ0 D;  3EK8 A;  4HRE E;  3R1V A;  4C0L A;  4A4B A;  3IQO A;  3CAB A;  4MBE A;  1UHH A;  1S26 D;  1W7J B;  1IJ6 A;  1WRL A;  1QX7 A;  2BE6 A;  4UPG A;  3GK1 A;  1EXR A;  4PHM A;  4N1G A;  1C07 A;  1H8B A;  3Q8I A;  5FYX A;  3D0Y B;  3GK2 A;  1LXF C;  2E30 A;  1B8C A;  1LKJ A;  2ZFD A;  3KF9 A;  5DKQ A;  4AQI A;  3A8R A;  5BPJ A;  3NGV A;  4YI9 A;  1V1F A;  1XK4 A;  1R2U A;  1F55 A;  2M97 A;  2KGB C;  1HQV A;  2EHB A;  1BOC A;  3O78 A;  1DEK A;  1HT9 A;  1IG5 A;  2LMV A;  2Y1M A;  4HSZ A;  1U5I B;  2BCA A;  5HYD A;  1CFP A;  3PSR A;  2CXJ A;  2LMU A;  3D76 A;  3I5G C;  2MA2 A;  1BG1 A;  3B6X A;  1WRK A;  2K7O A;  2EC6 C;  1XFZ O;  1MXL C;  2KI4 B;  4USL A;  2MBX A;  1WLM A;  2LAP A;  3LL8 B;  3S0B A;  3BUO B;  2I2R E;  3B88 A;  3PFV A;  1UP5 A;  1M63 B;  4XJK B;  3CZ2 A;  1B47 A;  1OOI X;  1TCF A;  5I2L A;  1K95 A;  1SYM A;  2LM5 A;  3SG5 A;  3QRX A;  1AK8 A;  1ZMZ A;  1CLM A;  3CR4 X;  3FE6 A;  2OPO A;  1A03 A;  1KQM B;  1SW8 A;  2COL B;  1OZO A;  1CFD A;  1OOJ A;  3B87 A;  3EKH A;  1F4O A;  5HKY A;  1B4C A;  2LVV A;  4DIR A;  1KFU S;  1XFU O;  2BNX A;  1GM0 A;  5HLO A;  2CCM A;  3B7A A;  3TDZ A;  4ORA B;  2PQL A;  2L5X B;  4MVF A;  1J7O A;  1F71 A;  2ZND A;  1OE9 B;  2L5Y A;  1NWD A;  3ICB A;  2PAS A;  1TNX A;  2M7L A;  2QDI A;  4WRI A;  2FCD A;  2JPT A;  3NXA A;  5JOL A;  1LA3 A;  1QV1 A;  3S0A A;  2K7B A;  1PSB A;  3CZT X;  2WC5 A;  1SCM B;  3BUX B;  3D0Y A;  4GGF C;  1Z4H A;  1S5G Z;  1S36 A;  1K9U A;  3SJS A;  2K61 A;  1OOG A;  1QTX A;  1N65 A;  4WQ2 A;  1CMG A;  1TRF A;  4DUQ A;  5AER A;  2L0P A;  1B8L A;  1KK8 B;  4TNC A;  3TUY B;  1KWO C;  2GV5 A;  2K7C A;  2MLF C;  2EGD A;  1KFU L;  1NCY A;  2AMI A;  2L4I A;  2LE9 B;  3OBV A;  4FQO A;  4NDD A;  1A2X A;  1KFX L;  1F4Q A;  2K7D A;  3UO9 A;  4GNK B;  1BR1 B;  1JFK A;  1QX5 B;  2BKI B;  2LVK A;  1U5I A;  3DYE A;  2F8P A;  4BY5 A;  2L2C A;  3AKA A;  5AFP A;  3D75 A;  3JVT B;  1DF0 B;  1AP4 A;  1K96 A;  1TNW A;  2PRU A;  1MWN A;  1LS8 A;  3IQQ A;  3O4X A;  1K9K A;  1ODB A;  3PAL A;  2LP2 A;  2OS8 C;  1LVC D;  3AAK A;  3AAJ A;  2JT3 A;  2QEO A;  2LMT A;  1TCO B;  4GGF A;  1L7Z A;  1OOF A;  1E8A A;  3TUY C;  2LVI A;  3SG3 A;  1YVH A;  2Q4U A;  2P71 A;  1NX1 A;  2HQW A;  1FW4 A;  2H61 A;  5FI2 A;  2M8U A;  2Q91 A;  1CTR A;  1XVJ A;  2KBI A;  2FCE A;  1J1D A;  1Y1A A;  2OTG B;  3NSI A;  3L4L A;  4CFR A;  1XFV O;  3EK7 A;  2F3Y A;  2Y5I A;  4MLW A;  1TNP A;  3WHT B;  4CFQ A;  1OW4 A;  1MUX A;  1M31 A;  2L50 A;  3JVT C;  3H4S E;  1NUB A;  1X02 A;  3D77 A;  3L47 A;  1XFX O;  1JSA A;  2BL0 B;  3PN7 C;  1L2O C;  4CPV A;  1RFJ A;  3GK4 X;  2KQY A;  4C0K A;  2G2B A;  1CLB A;  2BEC A;  5D7F A;  1B7T Z;  1OZS A;  2KAX A;  1TTX A;  1EG4 A;  2M1K B;  1F54 A;  4ZCU A;  3KO0 A;  1CFC A;  2ZRS A;  1MR8 A;  1YVL A;  2D8N A;  3CS1 A;  3PM8 A;  2QEB A;  3VB1 A;  1ORG A;  3M0W A;  4OR9 B;  4PE1 A;  4QJ3 B;  3PJI A;  3NHT A;  1KSO A;  1CB1 A;  1IIO A;  1DGV A;  2G9B A;  3PAT A;  3F45 A;  4QJ4 B;  2K2A A;  5HKZ A;  1QAS A;  5CPV A;  3UNW A;  3TDU A;  3NSL A;  4ORC B;  3BXK A;  2H8V A;  2RGI A;  1FI5 A;  2KI6 D;  3BJH A;  2WCL A;  1NIW A;  3OP0 A;  1Y1U A;  2BL0 C;  1SRA A;  4P2Y B;  1DEL A;  1N2D A;  1UUR A;  2SCP A;  3EVR A;  1DF0 A;  4GBA A;  2LAN A;  1QS7 A;  4MRY A;  1RRO A;  2KAV A;  3HX4 A;  3LK0 A;  1QIW A;  2MAZ A;  1QXP A;  3DXL A;  5D3O A;  3S0D A;  1M45 A;  2ERB A;  5AEQ A;  2JNF A;  3EVV A;  4PAL A;  4P5O E;  2O5G A;  2HET A;  3NHI A;  1XFR A;  2GTE A;  2HQ8 A;  3MSE B;  3SG6 A;  4YGB B;  2F2P A;  1BMO A;  1SR6 B;  2KSP A;  5AXI A;  1SPY A;  3BQ3 A;  1TWO A;  1PVB A;  2Y1N A;  3E3R A;  5CSJ A;  1OMV A;  3K1E A;  1OQP A;  2MLE C;  1DQE A;  2P6B B;  1GGW A;  1NSH A;  2TN4 A;  3TDI A;  2KAY A;  2MRD A;  2LHL A;  3TZ1 A;  4BY4 A;  1GJY A;  4U8D A;  1EG3 A;  1NX2 A;  4FTG A;  3VGO A;  3RM1 A;  1A75 B;  3FE9 A;  4M2Q A;  1SK6 D;  2MJW B;  1CNP A;  1D1O A;  1UUS A;  2WCH A;  5KSZ A;  1QJT A;  3ZNI A;  3JTD B;  1DJG A;  2KI6 C;  1JBA A;  5PAL A;  1G8I A;  1S6J A;  2NCP A;  2QPT A;  4L9M A;  1SR6 C;  2JRF A;  2PSR A;  4Q04 A;  4JWQ A;  3CLN A;  1AJ4 A;  1WY9 A;  2JC2 A;  1SL8 A;  4D1E A;  1C7W A;  1QIV A;  5DIC A;  1IJ5 A;  1CDL A;  1DJZ A;  1KFX S;  3I5I B;  4DS7 A;  4IL1 A;  2QEV A;  1YX7 A;  1FF1 A;  2ZNE A;  3S0E A;  1A4P A;  1QVI Y;  2KI4 C;  3BFA A;  4PHK A;  1C3Z A;  3JTD C;  3K21 A;  4N5X A;  2LHI A;  4IJ7 A;  1UHK A;  3TS5 B;  1QAT A;  4YGD B;  2MHH A;  1FI6 A;  4INW A;  1IQ5 A;  1Z2C B;  4GAO A;  3R1O A;  1SL9 A;  1NCX A;  2H61 C;  4JKT A;  1WDC B;  1A29 A;  2NXQ A;  1KQM C;  3VRQ A;  1TN4 A;  2JWW A;  1J55 A;  2F3Z A;  2PMY A;  3FE8 A;  3FS7 A;  4XYN A;  5CSI A;  1UWO A;  4YBH B;  3CYZ A;  1Y0V H;  2KLD A;  3BOW B;  3EG5 B;  1TNQ A;  1H4B A;  2JUL A;  1S3P A;  5DKN A;  2KYC A;  3BUW B;  3KHE A;  2WC8 A;  1ALV A;  3SG2 A;  1PK0 D;  5HL1 A;  3BFB A;  2M9G A;  2JNX A;  5CSN A;  4INX A;  3RLZ A;  1WLZ A;  1DJY A;  3D78 A;  1OOH A;  3AKB A;  2WCM A;  1ZOT B;  3EKJ A;  3I5H B;  3SS3 A;  1YUR A;  4QJ5 B;  1J7Q A;  1SCM C;  1UHN A;  3VRP A;  1CFF A;  1A75 A;  3NSO A;  2L2E A;  4MZL A;  3DVM A;  1EJ3 A;  4F7F A;  1JC2 A;  1PSR A;  2CNP A;  1J7R A;  1YRU B;  2GGM A;  1IKU A;  5FI6 A;  1KK8 C;  3S0G A;  1WRZ A;  2K8M B;  4ICB A;  5AAN A;  3R72 A;  1PUL A;  2HPS A;  1IQ3 A;  1YTZ C;  3SIB A;  1IH0 A;  1NCZ A;  1UHI A;  2JQ6 A;  2BBM A;  1BJF A;  1MXE A;  4YGE B;  1YUT A;  2DOQ A;  2FJY A;  4ETO A;  1ZUZ A;  4PE4 A;  5HKW A;  1S6C A;  2I7A A;  3I5H C;  3KPX A;  2LC5 A;  2JZI A;  2LUX A;  4FQT A;  4PE7 A;  1CKK A;  3CR2 A;  1RK9 A;  1K9P A;  4GGN A;  1T14 A;  1TIZ A;  1F8H A;  1BR4 B;  3BFH A;  1FBV A;  2ISD A;  5ER4 X;  1XA5 A;  2WOR A;  4HRG A;  4MRX A;  1BLQ A;  2P70 A;  1DVI A;  1KSM A;  3D10 A;  3OX5 A;  3SG7 A;  1QLK A;  1SCV A;  1FPW A;  1PAL A;  1KQV A;  1KK7 Y;  1AUI B;  1Y6W A;  2NCO A;  2OTG C;  2PYQ A;  3ZWH A;  3BOW A;  2A4J A;  2FJU B;  4F0Z B;  4PE0 A;  2M7N A;  2WCE A;  3SG4 A;  4M2P A;  2PVB A;  1QV0 A;  2R2I A;  3DF0 A;  1RJV A;  3FWC A;  2JTT A;  2JXC A;  2LLU A;  4NDB A;  2WCK A;  3VRN A;  2WCJ A;  2CT9 A;  3CZ0 A;  2KHN A;  1K2H A;  1BU3 A;  1GGZ A;  3I5F B;  3N7H A;  5K89 A;  3DD4 A;  1YRT B;  1J7P A;  1CM4 A;  1MF8 B;  1DTL A;  3EVU A;  4OKH A;  5GQQ C;  2LP3 A;  3WXA A;  1EH2 A;  1JWD A;  1BT6 A;  1SY9 A;  2F2O A;  4CID A;  2KFF A;  1P28 A;  3V2L A;  4R1E A;  1G4Y R;  1DJW A;  1XYD A;  3BUN B;  1W7I B;  3FIA A;  5EL2 A;  2KQ6 A;  3QME A;  1B7T Y;  2BCB A;  1OSA A;  5B8I B;  2QEH A;  2I94 A;  1DT7 B;  2LLS A;  4WQ3 A;  2F33 A;  2ZN8 A;  2GGZ A;  2KFH A;  2KNE A;  1YX8 A;  1YUS A;  3I5G B;  1S6I A;  2CBL A;  2BE4 A;  3DVJ A;  3HCM A;  3I5F C;  2EC6 B;  1TUJ A;  2M29 A;  2VRG A;  3BYA A;  2WCF A;  3L4A A;  2FOT A;  2ZRT A;  2KBM A;  3CDN A;  3CR5 X;  4DRW A;  1K94 A;  3S0F A;  4GFT A;  2K2F A;  1SNL A;  1SMG A;  3D73 A;  1W9Z A;  3DVE A;  2E6W A;  4JD9 A;  4MSP A;  1DC1 A;  1CDN A;  1ZFS A;  2V53 A;  1B9A A;  1QVI Z;  4PT1 A;  2PAL A;  3CTN A;  1RTP 1;  1QWV A;  1DJI A;  1DMO A;  2BBN A;  3EK4 A;  4PHJ A;  4MZK A;  1NX0 A;  4DCK A;  3LCP C;  3VRO A;  1BOD A;  2K60 A;  1J1E A;  2JT0 A;  1VRK A;  5ER5 A;  1Y1X A;  1S1E A;  3RZS A;  3OGN A;  1QLS A;  2SAS A;  3SS5 A;  2K0J A;  1ZAC A;  2YGU A;  2L98 A;  4I5J A;  2KFG A;  2LVJ A;  2KDH A;  1TOP A;  1YUU A;  2IS9 A;  1NP8 A;  2LV7 A;  3KEV A;  1DGU A;  2Y4Q A;  1N0Y A;  1REC A;  3IVT A;  2JT8 A;  4I5N B;  5FI7 A;  4JPZ B;  1JF2 A;  4OV2 A;  1QX2 A;  5CSF A;  1KWO B;  1AJ5 A;  1B8R A;  1XFY O;  4A4C A;  2L4H A;  2WND A;  1GQM A;  3I5I C;  4N1F A;  1SKT A;  1CDM A;  2H2K A;  3DY9 A;  4NQG A;  3DVK A;  3GOF A;  4PCW A;  5DKR A;  2AUC A;  4I5L B;  3OB1 B;  4GUK A;  3DF0 B;  2KPH A;  1JUO A;  4YGC B;  4OVN F;  4C0J A;  3VRR A;  1MHO A;  2LLT A;  2WCB A;  1K93 D;  3OX6 A;  1SSE B;  2ZN9 A;  4M2O A;  4OCI A;  1YR5 A;  3TS5 C;  1CMF A;  2WC6 A;  4YGA A;  1LA0 A;  2O60 A;  2OS8 B;  1PRW A;  3D74 A;  1M39 A;  1ALW A;  1WDC C;  3DZT A;  2M49 B;  3R1P A;  1C3Y A;  2LNK A;  4MEW A;  2NLN A;  2KGR A; 
#chains in the Genus database with same CATH homology
 3WHU B;  1AVS A;  2JOJ A;  1DJX A;  2BCX A;  1NX3 A;  1JF0 A;  1C7V A;  3A4U B;  1S5G Y;  3O6B A;  4MZJ A;  1MQ1 A;  4MN0 A;  1CLL A;  1M46 A;  2LCP A;  3IF7 A;  1NYA A;  3CWG A;  2JTZ A;  1G33 A;  5D69 A;  5F6T A;  3CGA A;  1OMD A;  1KK7 Z;  1IGV A;  1LIN A;  2KOT A;  3PN7 B;  4YI8 A;  1L2O B;  5JJG A;  2I18 A;  2NZ0 A;  1NPQ A;  1XO5 A;  5IBW A;  3FWB A;  4E68 A;  4XJK A;  1CDP A;  2JXL A;  3PLF B;  1IWQ A;  4HRH A;  4YRU A;  3SIA A;  1F70 A;  5KTY A;  2B1U A;  4AOM A;  5I8N A;  1R6P A;  4NDC A;  4PDZ A;  3WNX B;  3O4Y A;  1B1G A;  4ORB B;  1BF5 A;  1SL7 A;  1DJH A;  4PHN A;  1K8U A;  4AQJ A;  1PVA A;  4I5K A;  5I2O A;  2M3W A;  2ZKM X;  2BKH B;  4GPL B;  2M1U A;  3OHM B;  1XFW O;  5G08 A;  3LK1 A;  3O2P A;  1IRJ A;  5TNC A;  2M0R A;  1KCY A;  5J3X A;  2CTN A;  4ZCV A;  1JFJ A;  1Q80 A;  1RWY A;  1UHJ A;  3LLE A;  2AAO A;  5HLV A;  4CLN A;  1OMR A;  1XK4 C;  1EL4 A;  5KU1 A;  2WOS A;  2QAC A;  2L51 A;  5I2Q A;  2HF5 A;  3NSK A;  1V1G A;  1SBJ A;  3OB2 B;  1K90 D;  3C1V A;  1AHR A;  1CM1 A;  2JU0 A;  2KYF A;  3BUM B;  2LUC A;  4JQ0 D;  3EK8 A;  4HRE E;  4C0L A;  4A4B A;  3IQO A;  4MBE A;  1UHH A;  1S26 D;  1W7J B;  1IJ6 A;  1WRL A;  1QX7 A;  2BE6 A;  4UPG A;  3GK1 A;  1EXR A;  4PHM A;  4N1G A;  1C07 A;  1H8B A;  5FYX A;  3D0Y B;  3GK2 A;  1LXF C;  2E30 A;  1B8C A;  1LKJ A;  2ZFD A;  3KF9 A;  5DKQ A;  4AQI A;  3A8R A;  5BPJ A;  4YI9 A;  1V1F A;  1XK4 A;  1R2U A;  1F55 A;  2M97 A;  2KGB C;  1HQV A;  2EHB A;  1BOC A;  3O78 A;  1HT9 A;  1IG5 A;  2LMV A;  2Y1M A;  4HSZ A;  1U5I B;  2BCA A;  5HYD A;  1CFP A;  3PSR A;  2CXJ A;  2LMU A;  3I5G C;  2MA2 A;  1BG1 A;  1WRK A;  2K7O A;  2EC6 C;  1XFZ O;  1MXL C;  2KI4 B;  4USL A;  2MBX A;  1WLM A;  2LAP A;  3LL8 B;  3BUO B;  2I2R E;  3PFV A;  1UP5 A;  1M63 B;  4XJK B;  1B47 A;  1TCF A;  5I2L A;  1K95 A;  1SYM A;  2LM5 A;  3SG5 A;  3QRX A;  1AK8 A;  1ZMZ A;  1CLM A;  3CR4 X;  1A03 A;  2OPO A;  1KQM B;  1SW8 A;  2COL B;  1OZO A;  1CFD A;  1OOJ A;  3EKH A;  5HKY A;  1F4O A;  1B4C A;  2LVV A;  4DIR A;  1KFU S;  1XFU O;  5HLO A;  2CCM A;  3TDZ A;  4ORA B;  2L5X B;  4MVF A;  1J7O A;  1F71 A;  2ZND A;  1OE9 B;  3ICB A;  1NWD A;  2PAS A;  1TNX A;  2M7L A;  4WRI A;  2FCD A;  2JPT A;  3NXA A;  5JOL A;  1LA3 A;  1QV1 A;  2K7B A;  1PSB A;  3CZT X;  1SCM B;  3BUX B;  3D0Y A;  4GGF C;  1S5G Z;  1S36 A;  1K9U A;  3SJS A;  2K61 A;  1QTX A;  1N65 A;  4WQ2 A;  1CMG A;  1TRF A;  4DUQ A;  5AER A;  2L0P A;  1B8L A;  1KK8 B;  4TNC A;  3TUY B;  1KWO C;  2GV5 A;  2K7C A;  2MLF C;  2EGD A;  1KFU L;  1NCY A;  2AMI A;  2L4I A;  2LE9 B;  4FQO A;  4NDD A;  1A2X A;  1KFX L;  1F4Q A;  2K7D A;  4GNK B;  1BR1 B;  1JFK A;  1QX5 B;  2BKI B;  2LVK A;  1U5I A;  2F8P A;  4BY5 A;  3AKA A;  5AFP A;  3JVT B;  1DF0 B;  1AP4 A;  1K96 A;  1TNW A;  2PRU A;  1MWN A;  3IQQ A;  1K9K A;  1ODB A;  3PAL A;  2LP2 A;  2OS8 C;  1LVC D;  3AAK A;  3AAJ A;  2JT3 A;  2LMT A;  1TCO B;  4GGF A;  1L7Z A;  1E8A A;  3TUY C;  2LVI A;  3SG3 A;  1YVH A;  2Q4U A;  1NX1 A;  2HQW A;  1FW4 A;  2H61 A;  2M8U A;  2Q91 A;  1CTR A;  1XVJ A;  2KBI A;  2FCE A;  1J1D A;  1Y1A A;  2OTG B;  3NSI A;  4CFR A;  1XFV O;  3EK7 A;  2F3Y A;  2Y5I A;  4MLW A;  1TNP A;  3WHT B;  4CFQ A;  1MUX A;  1M31 A;  2L50 A;  3JVT C;  3H4S E;  1NUB A;  1X02 A;  1XFX O;  1JSA A;  2BL0 B;  3PN7 C;  1L2O C;  4CPV A;  1RFJ A;  3GK4 X;  2KQY A;  4C0K A;  2G2B A;  1CLB A;  2BEC A;  5D7F A;  1B7T Z;  1OZS A;  2KAX A;  1TTX A;  1EG4 A;  2M1K B;  1F54 A;  4ZCU A;  3KO0 A;  1CFC A;  2ZRS A;  1MR8 A;  1YVL A;  2D8N A;  3CS1 A;  3PM8 A;  3M0W A;  4OR9 B;  4PE1 A;  4QJ3 B;  1KSO A;  1CB1 A;  1DGV A;  2G9B A;  3PAT A;  3F45 A;  4QJ4 B;  2K2A A;  5HKZ A;  1QAS A;  5CPV A;  3TDU A;  3NSL A;  4ORC B;  3BXK A;  2RGI A;  1FI5 A;  2KI6 D;  3OP0 A;  1NIW A;  1Y1U A;  2BL0 C;  1SRA A;  4P2Y B;  1N2D A;  1UUR A;  2SCP A;  3EVR A;  1DF0 A;  4GBA A;  2LAN A;  1QS7 A;  4MRY A;  1RRO A;  2KAV A;  3HX4 A;  3LK0 A;  1QIW A;  2MAZ A;  1QXP A;  1M45 A;  5AEQ A;  2JNF A;  3EVV A;  4PAL A;  4P5O E;  2O5G A;  2HET A;  2HQ8 A;  3MSE B;  3SG6 A;  4YGB B;  2F2P A;  1BMO A;  1SR6 B;  2KSP A;  5AXI A;  1SPY A;  3BQ3 A;  1PVB A;  2Y1N A;  3E3R A;  5CSJ A;  1OMV A;  1GGW A;  1OQP A;  2MLE C;  2P6B B;  1NSH A;  2TN4 A;  3TDI A;  2KAY A;  2MRD A;  2LHL A;  3TZ1 A;  4BY4 A;  1GJY A;  4U8D A;  1EG3 A;  1NX2 A;  4FTG A;  3VGO A;  3RM1 A;  1A75 B;  4M2Q A;  1SK6 D;  2MJW B;  1CNP A;  1D1O A;  1UUS A;  5KSZ A;  1QJT A;  3ZNI A;  3JTD B;  1DJG A;  2KI6 C;  1JBA A;  5PAL A;  1G8I A;  1S6J A;  2NCP A;  2QPT A;  4L9M A;  1SR6 C;  2JRF A;  2PSR A;  4Q04 A;  4JWQ A;  3CLN A;  1AJ4 A;  1WY9 A;  2JC2 A;  1SL8 A;  4D1E A;  1C7W A;  1QIV A;  1IJ5 A;  1CDL A;  1DJZ A;  1KFX S;  3I5I B;  4DS7 A;  4IL1 A;  1YX7 A;  1FF1 A;  2ZNE A;  1A4P A;  1QVI Y;  2KI4 C;  4PHK A;  3JTD C;  3K21 A;  4N5X A;  2LHI A;  1UHK A;  3TS5 B;  1QAT A;  4YGD B;  2MHH A;  1FI6 A;  1IQ5 A;  4GAO A;  1SL9 A;  1NCX A;  2H61 C;  1WDC B;  1A29 A;  2NXQ A;  1KQM C;  3VRQ A;  1TN4 A;  2JWW A;  1J55 A;  2F3Z A;  2PMY A;  3FS7 A;  4XYN A;  5CSI A;  1UWO A;  4YBH B;  1Y0V H;  3BOW B;  1TNQ A;  1H4B A;  2JUL A;  1S3P A;  5DKN A;  2KYC A;  3BUW B;  3KHE A;  2WC8 A;  1ALV A;  3SG2 A;  1PK0 D;  2M9G A;  2JNX A;  5CSN A;  3RLZ A;  1WLZ A;  1DJY A;  3AKB A;  3EKJ A;  1ZOT B;  3I5H B;  1J7Q A;  1YUR A;  4QJ5 B;  1SCM C;  1UHN A;  3VRP A;  1CFF A;  1A75 A;  3NSO A;  2L2E A;  4MZL A;  3DVM A;  1EJ3 A;  1JC2 A;  1PSR A;  2CNP A;  1J7R A;  1YRU B;  2GGM A;  1IKU A;  1KK8 C;  1WRZ A;  2K8M B;  4ICB A;  5AAN A;  1PUL A;  2HPS A;  1IQ3 A;  1YTZ C;  3SIB A;  1IH0 A;  1NCZ A;  1UHI A;  2JQ6 A;  2BBM A;  1BJF A;  1MXE A;  4YGE B;  1YUT A;  2DOQ A;  4ETO A;  1ZUZ A;  4PE4 A;  5HKW A;  1S6C A;  2I7A A;  3I5H C;  3KPX A;  2LC5 A;  2JZI A;  2LUX A;  4PE7 A;  1CKK A;  3CR2 A;  1RK9 A;  1K9P A;  4GGN A;  1TIZ A;  1F8H A;  1BR4 B;  1FBV A;  2ISD A;  5ER4 X;  1XA5 A;  2WOR A;  4HRG A;  4MRX A;  1BLQ A;  1DVI A;  1KSM A;  3D10 A;  3OX5 A;  3SG7 A;  1QLK A;  1SCV A;  1FPW A;  1PAL A;  1KQV A;  1KK7 Y;  1AUI B;  1Y6W A;  2NCO A;  2OTG C;  3ZWH A;  3BOW A;  2A4J A;  2FJU B;  4F0Z B;  4PE0 A;  2M7N A;  2WCE A;  3SG4 A;  4M2P A;  2PVB A;  1QV0 A;  2R2I A;  3DF0 A;  1RJV A;  3FWC A;  2JTT A;  2JXC A;  2LLU A;  4NDB A;  3VRN A;  2CT9 A;  2KHN A;  1K2H A;  1BU3 A;  1GGZ A;  3I5F B;  5K89 A;  3DD4 A;  1YRT B;  1J7P A;  1CM4 A;  1MF8 B;  1DTL A;  3EVU A;  4OKH A;  5GQQ C;  2LP3 A;  3WXA A;  1EH2 A;  1JWD A;  1BT6 A;  1SY9 A;  2F2O A;  4CID A;  2KFF A;  4R1E A;  1G4Y R;  1DJW A;  1XYD A;  3BUN B;  1W7I B;  3FIA A;  2KQ6 A;  1B7T Y;  2BCB A;  1OSA A;  5B8I B;  2I94 A;  1DT7 B;  2LLS A;  4WQ3 A;  2F33 A;  2ZN8 A;  2GGZ A;  2KFH A;  2KNE A;  1YX8 A;  1YUS A;  3I5G B;  1S6I A;  2CBL A;  2BE4 A;  3DVJ A;  3HCM A;  3I5F C;  2EC6 B;  2VRG A;  2M29 A;  3BYA A;  2WCF A;  2FOT A;  2ZRT A;  2KBM A;  3CR5 X;  4DRW A;  1K94 A;  4GFT A;  2K2F A;  1SNL A;  1SMG A;  4MSP A;  3DVE A;  2E6W A;  1CDN A;  1ZFS A;  2V53 A;  1B9A A;  1QVI Z;  2PAL A;  3CTN A;  1RTP 1;  1DJI A;  1DMO A;  2BBN A;  3EK4 A;  4PHJ A;  4MZK A;  1NX0 A;  4DCK A;  3LCP C;  3VRO A;  1BOD A;  1J1E A;  2JT0 A;  1VRK A;  5ER5 A;  1Y1X A;  1S1E A;  1QLS A;  2SAS A;  2K0J A;  1ZAC A;  4I5J A;  2L98 A;  2KFG A;  2LVJ A;  2KDH A;  1TOP A;  1YUU A;  2IS9 A;  1NP8 A;  2LV7 A;  3KEV A;  1DGU A;  2Y4Q A;  1N0Y A;  1REC A;  2JT8 A;  4I5N B;  4JPZ B;  1JF2 A;  4OV2 A;  1QX2 A;  5CSF A;  1KWO B;  1AJ5 A;  1B8R A;  1XFY O;  4A4C A;  2L4H A;  2WND A;  1GQM A;  3I5I C;  4N1F A;  1SKT A;  1CDM A;  2H2K A;  4NQG A;  4PCW A;  3DVK A;  3GOF A;  5DKR A;  2AUC A;  4I5L B;  3OB1 B;  4GUK A;  3DF0 B;  1JUO A;  4YGC B;  4OVN F;  4C0J A;  3VRR A;  1MHO A;  2LLT A;  2WCB A;  1K93 D;  3OX6 A;  2ZN9 A;  4M2O A;  4OCI A;  1YR5 A;  3TS5 C;  1CMF A;  4YGA A;  1LA0 A;  2O60 A;  2OS8 B;  1PRW A;  1M39 A;  1ALW A;  1WDC C;  2M49 B;  2LNK A;  4MEW A;  2NLN A;  2KGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...