3PSRA

Human psoriasin (s100a7) ca2+ bound form (crystal form i)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ef-hand protein
molecule keywords PSORIASIN
publication title Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3psrA00
3BXKA 3SJSA 3LK0A 1XVJA 5KSZA 1LA0A 2GV5A 1S26D 3BYAA 4CFRA 1IH0A 1NCZA 2M29A 3BQ3A 2KFGA 4ORCB 1IG5A 1YUUA 4NDBA 3NSOA 4QJ5B 1LXFC 2KAYA 1DJXA 3VRQA 3CR4X 4MZLA 2PMYA 3NSLA 4MN0A 2L5XB 1OZOA 3CGAA 1OSAA 2ZN8A 3PN7C 2CTNA 1KWOC 1A4PA 1NUBA 3JVTB 1B9AA 5DKQA 3FWBA 3CWGA 3KO0A 1V1FA 4DRWA 1A75A 1A2XA 4PE0A 1CTRA 1QX5B 2MA2A 1QLKA 3EVVA 1IKUA 2LMUA 1IQ5A 4PDZA 1TNQA 2OTGC 2PASA 3KHEA 1J7RA 4CIDA 1BLQA 1B1GA 4GGFA 1SNLA 2O60A 4I5KA 1UP5A 2BL0C 1E8AA 2KFFA 2QPTA 2K7DA 1OMDA 4AQIA 2SASA 2O5GA 1MF8B 5BPJA 2KQYA 3D10A 4DCKA 4R1EA 5AFPA 2WC8A 1CMFA 1YVHA 1KK7Z 2M9GA 1SR6C 5AANA 1H4BA 4I5LB 1IGVA 2MJWB 3D0YB 2FJUB 3BOWB 1FF1A 2I94A 2CXJA 2LVVA 1PSRA 4GNKB 2JPTA 1IQ3A 1RJVA 1F54A 3ICBA 1FI6A 2ZRSA 2H61C 5AERA 4WRIA 2H2KA 3KEVA 4ZCVA 3RM1A 4YI9A 2Q4UA 1J7QA 4MLWA 3BUNB 3EVUA 1BF5A 4C0LA 2WCFA 1PVAA 2P6BB 4C0KA 3CZTX 4PALA 4YGAA 2K7CA 3I5FB 1KQMB 3KPXA 5K89A 1DJZA 1SL9A 2BKHB 3AAKA 1Q80A 1DF0B 3AKAA 1OMRA 1DJIA 1DT7B 4PCWA 5I2QA 1NX3A 2BKIB 3AKBA 3I5IB 3I5GB 4MZKA 2EC6C 1NX2A 4CPVA 1WY9A 3NXAA 2OS8B 1QXPA 2K7BA 2BE4A 1BR1B 1CLBA 1JBAA 2LMTA 2K2FA 2WCEA 3AAJA 1YTZC 4OV2A 2K61A 2NCPA 3GK1A 4HSZA 1KSOA 2LC5A 3SG6A 2E6WA 3IF7A 2WCBA 1SCVA 1AK8A 1TCOB 2M97A 2ISDA 4WQ2A 1LINA 2LVJA 5HKZA 1LA3A 2MBXA 1BG1A 2AMIA 2FCDA 1F4OA 1SCMC 2M0RA 5DKRA 4I5NB 2LANA 4HRHA 4IL1A 2JTZA 1KK8B 1BOCA 1A75B 1JUOA 4NQGA 3SG5A 4CFQA 2LVKA 5PALA 5IBWA 3TUYC 3PALA 2JQ6A 1B47A 3CLNA 1TOPA 2F8PA 1YRUB 3VRRA 3O78A 4YGBB 5CSJA 2LMVA 1SY9A 5CSNA 2F2OA 1XFUO 2KI4B 5D69A 1AUIB 3DVJA 1S36A 1WDCC 1YVLA 1RK9A 4JQ0D 1EH2A 2MLEC 1F71A 2L0PA 3OX6A 3WHTB 1Y6WA 1G4YR 1KFUS 1UURA 3PLFB 4NDCA 4MSPA 1PSBA 2ZKMX 1K9PA 2WORA 1QJTA 5HYDA 2GGZA 4BY5A 1M31A 2M1KB 3DF0A 2KNEA 1CB1A 5AEQA 3IQQA 1D1OA 1NCXA 1C7WA 5B8IB 5DKNA 2JT8A 2VRGA 1UHIA 1NIWA 1RWYA 2DOQA 4M2QA 2Y1NA 1TNWA 1U5IA 1KK7Y 2JNFA 3TS5B 3F45A 1ALVA 1KFXS 4YGEB 1MR8A 1UHNA 1V1GA 1CKKA 1CDLA 1MXEA 1K94A 1MUXA 2CT9A 1BT6A 1QV0A 3TZ1A 1L7ZA 2BE6A 1CLMA 2WNDA 2KOTA 3GOFA 1R6PA 3JVTC 5JJGA 1B8CA 4ZCUA 4XYNA 1CM4A 4OVNF 1A29A 1WRLA 1J55A 2CCMA 2JTTA 1G8IA 1L2OB 2KYCA 3VRNA 1F70A 3OB1B 1CM1A 1IRJA 2NXQA 3PM8A 3PN7B 1OOJA 4PHNA 4XJKA 4YI8A 1YURA 2HF5A 1AJ5A 2RGIA 4M2PA 1B8LA 4ORBB 3E3RA 1F8HA 1FBVA 1LKJA 3H4SE 3I5HB 4E68A 3HX4A 3MSEB 2Y4QA 2KI6D 1B7TZ 2KQ6A 2AUCA 4L9MA 1GGWA 3PATA 3CS1A 1MXLC 5KTYA 1B4CA 2JRFA 2SCPA 3SG3A 1M45A 5KU1A 1BJFA 2PRUA 1XFYO 2LNKA 3FWCA 1G33A 3TDIA 1BMOA 1ODBA 2BCAA 2IS9A 2LLUA 1QLSA 1XFWO 2E30A 3WHUB 4BY4A 1XK4C 5I2LA 1XO5A 3OHMB 3I5FC 1KQMC 4A4CA 3TDZA 1K95A 1WRKA 2Q91A 5TNCA 1K8UA 2JZIA 1TIZA 1H8BA 5G08A 1QVIZ 1K9KA 4P2YB 3RLZA 1NYAA 1GGZA 1NCYA 3SG4A 1DGVA 4YGDB 1SL7A 2ZFDA 2LUCA 2L2EA 1DVIA 2KI6C 1RFJA 4F0ZB 4PHJA 2F3ZA 1TNPA 1MHOA 1YX7A 3I5IC 3I5GC 5ER5A 2OS8C 1W7IB 2F3YA 3DD4A 4HREE 1Y1XA 2BBMA 2OPOA 3SIAA 2LM5A 4D1EA 3GK4X 4WQ3A 1KSMA 2HQWA 4NDDA 2JNXA 2M1UA 1OE9B 1RROA 3BUOB 2ZN9A 1K96A 1TRFA 1JF2A 4PE7A 4M2OA 2BCBA 1NSHA 1M63B 2GGMA 4DS7A 2D8NA 1UHJA 2JXLA 2MRDA 1QV1A 2M8UA 1ZACA 1UHHA 2PSRA 2WOSA 3O4YA 1TN4A 2BECA 1J7PA 2LVIA 1K90D 4PHMA 1K2HA 2K0JA 2NCOA 1N2DA 1K9UA 1CDNA 1TTXA 2FOTA 2M3WA 1QIWA 4AOMA 1K93D 1KK8C 1C7VA 1GJYA 4ETOA 2I2RE 2F33A 1W7JB 3FIAA 2H61A 5CSIA 2LHIA 3LK1A 2A4JA 3TDUA 3SG2A 1HQVA 3ZNIA 2LLSA 4GGFC 4YBHB 3CTNA 2JXCA 2KI4C 4A4BA 2JOJA 4JWQA 1IJ6A 4QJ3B 4XJKB 2R2IA 1X02A 3BUXB 1JSAA 1J1EA 5I2OA 1S3PA 4MBEA 4OKHA 3DVEA 2EGDA 1YUTA 1N65A 2KBIA 2MHHA 1S5GY 4GPLB 4GAOA 1CDMA 3WNXB 1ALWA 2L4HA 1MQ1A 2KFHA 3PFVA 3TUYB 2QACA 4UPGA 1A03A 1DJYA 4ORAB 1BODA 2ZNDA 2CBLA 1SW8A 2M7LA 3JTDB 1VRKA 1PVBA 1KFXL 4GFTA 3EK7A 2F2PA 1DJHA 4I5JA 3ZWHA 2KSPA 2NLNA 2LP3A 5ER4X 3TS5C 2LHLA 1JFJA 4FQOA 3EK4A 1PULA 1NP8A 1B7TY 2KGRA 1WLZA 1N0YA 2EHBA 1S6IA 1DMOA 1KQVA 1SRAA 4OR9B 2LUXA 4MEWA 1FI5A 3VGOA 1XFVO 3WXAA 4TNCA 1Y1AA 1JC2A 1QIVA 1S5GZ 2LAPA 3PSRA 5HKWA 1JWDA 3LLEA 4FTGA 3LL8B 2HPSA 1Y0VH 1EXRA 4MVFA 1L2OC 1AHRA 1QS7A 2BBNA 4OCIA 1KWOB 3QRXA 1XA5A 2L51A 2V53A 1WLMA 3OB2B 1QVIY 1SL8A 2HQ8A 1SK6D 1Y1UA 2L98A 3EKJA 2OTGB 3EKHA 2LLTA 1CNPA 4C0JA 4PE4A 1QTXA 3I5HC 4CLNA 2L50A 2KDHA 1ZOTB 3EVRA 3A4UB 1SMGA 1CLLA 2BL0B 3M0WA 1XFXO 5D7FA 4AQJA 1HT9A 4PE1A 1NX0A 2LCPA 1SKTA 1DTLA 1MWNA 1WRZA 1CFDA 3DVKA 1SR6B 1F55A 3K21A 1LVCD 1XFZO 2PVBA 1FPWA 1QX2A 3NSIA 3BUMB 4DIRA 1DJWA 2M49B 5CSFA 2K8MB 1ZUZA 2ZNEA 5AXIA 3A8RA 4N1GA 2NZ0A 1PK0D 1QASA 4YRUA 2COLB 1NWDA 2I18A 4N5XA 1SBJA 3CR2A 2KBMA 3VROA 1F4QA 1GQMA 1UWOA 4MRYA 3CR5X 3DVMA 1AP4A 1UUSA 4DUQA 1XYDA 3HCMA 5HLVA 1M39A 3EK8A 2FCEA 1QATA 1QX7A 2KAXA 3DF0B 4YGCB 1SYMA 1PALA 1UHKA 1ZMZA 1S1EA 2JU0A 1BU3A 4QJ4B 2KYFA 5HKYA 1NX1A 1JFKA 3SG7A 2JWWA 1CDPA 1RTP1 3GK2A 3NSKA 2KGBC 3C1VA 1U5IB 1OQPA 2MLFC 2EC6B 4MRXA 4PHKA 5F6TA 1YUSA 2G2BA 2PALA 1M46A 1OMVA 2L4IA 1J1DA 2G9BA 2LV7A 1AJ4A 4USLA 5J3XA 3SIBA 2LP2A 1DGUA 1PRWA 3IQOA 4GUKA 2CNPA 1CFPA 1DJGA 3VRPA 1CFFA 3D0YA 4U8DA 3BOWA 1FW4A 1S6CA 3OX5A 1BR4B 4ICBA 1EL4A 4MZJA 2Y1MA 4HRGA 1J7OA 4Q04A 1KFUL 5FYXA 1IJ5A 1OZSA 2KHNA 3FS7A 3KF9A 1TNXA 1SCMB 2ZRTA 3OP0A 1JF0A 2AAOA 1B8RA 1EG4A 1YR5A 1KCYA 1XK4A 2B1UA 5JOLA 1RECA 3BUWB 1IWQA 4N1FA 1ZFSA 2BCXA 1CFCA 2JT0A 5I8NA 1YX8A 5CPVA 1AVSA 2LE9B 3LCPC 1NPQA 1SPYA 3O2PA 4P5OE 1C07A 2K7OA 1R2UA 1YRTB 2MAZA 1DF0A 2K2AA 2JULA 1WDCB 2JT3A 5HLOA 2JC2A 4GGNA 2I7AA 1EJ3A 3O6BA 3JTDC 1S6JA 2KAVA 2HETA 2Y5IA 1TCFA 5GQQC 4JPZB 1EG3A 1CMGA 2TN4A 2M7NA 4GBAA
chains in the Genus database with same CATH superfamily
1QWVA 3BXKA 3SJSA 3LK0A 1XVJA 4INWA 3B6XA 1LA0A 5KSZA 2GV5A 1S26D 2KLDA 3BYAA 4CFRA 2QEHA 3EG5B 1IH0A 1NCZA 1IIOA 2M29A 3BQ3A 2KFGA 5FI7A 4ORCB 1IG5A 1YUUA 4NDBA 3NSOA 1Z2CB 1LXFC 4QJ5B 2KAYA 1DJXA 3VRQA 3CR4X 4MZLA 1TWOA 2PMYA 3NSLA 4MN0A 2L5XB 1OZOA 3CGAA 1OSAA 2ZN8A 2H8VA 3PN7C 2CTNA 2WCLA 1KWOC 1A4PA 1NUBA 3JVTB 1B9AA 5DKQA 3FWBA 3CWGA 3KO0A 1V1FA 4DRWA 1DELA 1A2XA 1A75A 4PE0A 1CTRA 1QX5B 2MA2A 1QLKA 3B7AA 3EVVA 3D75A 1IKUA 2LMUA 1IQ5A 4PDZA 1TNQA 2OTGC 2PASA 3KHEA 1J7RA 4CIDA 1BLQA 1B1GA 4GGFA 1SNLA 2O60A 4I5KA 1UP5A 2BL0C 1E8AA 2KFFA 2QPTA 2K7DA 1OMDA 3CZ0A 4AQIA 2SASA 2O5GA 1MF8B 5BPJA 2KQYA 3D10A 4DCKA 2WCHA 4R1EA 2WC8A 5AFPA 1CMFA 1YVHA 1KK7Z 2M9GA 1SR6C 1W9ZA 5AANA 1H4BA 4I5LB 1IGVA 2MJWB 3FE9A 3D0YB 2FJUB 2QDIA 3BOWB 2I94A 2CXJA 1FF1A 2LVVA 1PSRA 3DZTA 4GNKB 2JPTA 1IQ3A 1RJVA 1F54A 3ICBA 1FI6A 2ZRSA 1OOGA 2H61C 3K1EA 2ERBA 5AERA 2P71A 4WRIA 2H2KA 3KEVA 4ZCVA 3RM1A 3BFBA 4YI9A 2Q4UA 1J7QA 1Z4HA 4MLWA 3BUNB 3EVUA 1BF5A 3OGNA 4C0LA 2WCFA 1PVAA 2P6BB 4C0KA 3CZTX 4PALA 4YGAA 2K7CA 3I5FB 1KQMB 3KPXA 5K89A 1GM0A 1TUJA 1DJZA 1SL9A 2BKHB 3AAKA 1Q80A 1DF0B 3AKAA 1OMRA 1DJIA 1DT7B 2YGUA 4PCWA 5I2QA 1NX3A 3S0AA 3CDNA 3S0BA 2BKIB 3AKBA 4JKTA 2WCKA 3I5IB 3I5GB 4MZKA 2EC6C 1NX2A 4CPVA 1WY9A 3NXAA 2OS8B 1QXPA 2K7BA 2BE4A 1BR1B 1CLBA 1JBAA 2LMTA 2K2FA 2WCEA 3AAJA 1YTZC 4OV2A 2K61A 2NCPA 3GK1A 4HSZA 1KSOA 2LC5A 3SG6A 2E6WA 3IF7A 2WCBA 1SCVA 1AK8A 1TCOB 2M97A 2ISDA 2FJYA 4WQ2A 1OW4A 1LINA 2LVJA 5HKZA 1LA3A 2MBXA 1BG1A 3IVTA 2AMIA 2FCDA 1F4OA 3RZSA 1SCMC 4F7FA 2M0RA 5DKRA 4I5NB 2LANA 4HRHA 4IL1A 2JTZA 1KK8B 5EL2A 1A75B 1JUOA 4NQGA 1BOCA 3SG5A 4CFQA 2PYQA 2LVKA 5PALA 5IBWA 3TUYC 3PALA 2JQ6A 1B47A 3CLNA 1TOPA 2F8PA 1YRUB 3VRRA 3O78A 4YGBB 5CSJA 2LMVA 1SY9A 5CSNA 2F2OA 1XFUO 2KI4B 3BFHA 5D69A 1AUIB 3DVJA 5D3OA 5DICA 1S36A 1WDCC 1YVLA 1XFRA 1RK9A 4JQ0D 1EH2A 2MLEC 1F71A 2L0PA 3OX6A 3WHTB 3CZ1A 1DEKA 1Y6WA 1G4YR 1KFUS 1UURA 3PLFB 4NDCA 4MSPA 1PSBA 2ZKMX 3DXLA 1K9PA 2WORA 1QJTA 3UNWA 5HYDA 2GGZA 3CZ2A 5I94A 4BY5A 1M31A 2M1KB 3DF0A 2KNEA 1C3YA 5AEQA 1CB1A 3IQQA 3B87A 1D1OA 1NCXA 1C7WA 5B8IB 5DKNA 2JT8A 2VRGA 1UHIA 1NIWA 1RWYA 2DOQA 4M2QA 2Y1NA 1TNWA 1U5IA 1KK7Y 2JNFA 3TS5B 3F45A 1ALVA 1KFXS 4YGEB 1MR8A 1UHNA 1V1GA 3OBVA 1CKKA 1CDLA 1MXEA 3R72A 1K94A 1MUXA 2CT9A 1BT6A 1QV0A 3TZ1A 1L7ZA 2BE6A 2WCMA 1CLMA 2WNDA 2KOTA 3GOFA 1R6PA 3JVTC 5JJGA 1B8CA 4ZCUA 4OZDA 4XYNA 1CM4A 4OVNF 1A29A 1WRLA 1J55A 2CCMA 2JTTA 1G8IA 1L2OB 2KPHA 2KYCA 3VRNA 1F70A 2BNXA 3OB1B 1CM1A 1IRJA 2L2CA 2NXQA 3PM8A 1OOJA 3PN7B 4PHNA 3B88A 4XJKA 1ORGA 4YI8A 1YURA 2HF5A 1AJ5A 2RGIA 3VB1A 4M2PA 1B8LA 3SS5A 4ORBB 3E3RA 1F8HA 1FBVA 1LKJA 3H4SE 3I5HB 4E68A 3HX4A 3MSEB 2Y4QA 2BAPA 1B7TZ 2KI6D 2KQ6A 1DC1A 2AUCA 4L9MA 1GGWA 3PATA 3QMEA 3CS1A 1MXLC 5KTYA 1B4CA 2JRFA 2SCPA 3SG3A 3NGVA 1M45A 5KU1A 1BJFA 2PRUA 1XFYO 2LNKA 3B86A 1G33A 3FWCA 3TDIA 1BMOA 1ODBA 2BCAA 2IS9A 3UO9A 2LLUA 1QLSA 1XFWO 2E30A 3WHUB 4BY4A 1XK4C 4FQTA 5I2LA 3DYEA 1XO5A 3OHMB 3BJHA 3I5FC 1KQMC 4A4CA 3TDZA 1K95A 1WRKA 2Q91A 5TNCA 1K8UA 2JZIA 1TIZA 1H8BA 5G08A 1QVIZ 1K9KA 4P2YB 3RLZA 1NYAA 1GGZA 1NCYA 3SG4A 1DGVA 4YGDB 1SL7A 2ZFDA 2LUCA 2L2EA 1DVIA 2KI6C 1RFJA 3CYZA 4PHJA 4F0ZB 2F3ZA 2JPOA 1TNPA 1MHOA 1YX7A 3I5IC 3I5GC 5ER5A 2OS8C 1W7IB 2F3YA 3DD4A 4HREE 3D74A 1Y1XA 2BBMA 2OPOA 3SIAA 2LM5A 4D1EA 3GK4X 3O4XA 4WQ3A 1KSMA 3L4AA 2HQWA 4NDDA 2JNXA 2M1UA 1OE9B 1RROA 3BUOB 3D77A 2ZN9A 1K96A 1TRFA 1JF2A 4PE7A 4M2OA 2BCBA 1NSHA 1M63B 2GGMA 4DS7A 2D8NA 1UHJA 2JXLA 3BFAA 2MRDA 1QV1A 2M8UA 1ZACA 1UHHA 2PSRA 2WOSA 3O4YA 1TN4A 2BECA 1J7PA 2LVIA 1K90D 3D76A 4PHMA 2K0JA 1K2HA 2NCOA 1N2DA 3V2LA 1K9UA 1CDNA 1TTXA 2FOTA 2M3WA 1QIWA 4AOMA 2WC5A 1K93D 1KK8C 1C7VA 1GJYA 4ETOA 4INXA 2I2RE 2F33A 1W7JB 3FIAA 2H61A 5CSIA 2LHIA 3LK1A 2A4JA 3TDUA 3SG2A 1HQVA 3ZNIA 2LLSA 4GGFC 4YBHB 2KLEA 3CTNA 5FI2A 2JXCA 2KI4C 4JD9A 4A4BA 2JOJA 4JWQA 1IJ6A 4QJ3B 4XJKB 2R2IA 1X02A 3BUXB 3CABA 1J1EA 1JSAA 5I2OA 1S3PA 4MBEA 4OKHA 1SSEB 3DVEA 2EGDA 1YUTA 1N65A 2KBIA 2MHHA 1S5GY 4GPLB 4GAOA 1CDMA 3WNXB 3NHTA 3S0FA 1ALWA 2L4HA 1MQ1A 2KFHA 3PFVA 3TUYB 2QACA 4UPGA 1A03A 1DJYA 4ORAB 1BODA 2ZNDA 2CBLA 1SW8A 2M7LA 3JTDB 1VRKA 1PVBA 1KFXL 4GFTA 3EK7A 2F2PA 1DJHA 4I5JA 3ZWHA 2KSPA 2NLNA 2LP3A 5ER4X 3TS5C 2LHLA 1JFJA 4FQOA 2GTEA 3EK4A 1PULA 1NP8A 1B7TY 2KGRA 3NHIA 1WLZA 1N0YA 2EHBA 1LS8A 1S6IA 1DMOA 1KQVA 1SRAA 4OR9B 2LUXA 4MEWA 1FI5A 3VGOA 1XFVO 3WXAA 4TNCA 1Y1AA 1JC2A 1QIVA 1S5GZ 2LAPA 3PSRA 5HKWA 1JWDA 3LLEA 1OOHA 4FTGA 3LL8B 2HPSA 1Y0VH 1EXRA 1OOFA 4MVFA 1L2OC 1AHRA 1QS7A 2BBNA 4OCIA 1KWOB 3QRXA 1XA5A 2L51A 2V53A 1WLMA 3S0EA 5FI6A 3OB2B 1QVIY 1SL8A 2HQ8A 1SK6D 1Y1UA 2L98A 3EKJA 2OTGB 3EKHA 2LLTA 2P70A 1CNPA 4C0JA 4PE4A 1QTXA 3I5HC 4CLNA 2L50A 3SS4A 2KDHA 1ZOTB 3EVRA 3A4UB 1SMGA 1CLLA 2BL0B 3M0WA 1XFXO 4PT1A 5D7FA 4AQJA 1P28A 1HT9A 3D78A 4PE1A 1NX0A 2LCPA 1SKTA 1DTLA 1MWNA 1WRZA 1CFDA 3DVKA 1SR6B 1F55A 1OOIX 3K21A 3PJIA 1LVCD 1XFZO 2PVBA 1FPWA 1QX2A 3NSIA 3BUMB 4DIRA 1DJWA 2M49B 2QEOA 5CSFA 1DQEA 2K8MB 1ZUZA 2ZNEA 3L47A 3A8RA 4N1GA 2NZ0A 5AXIA 1PK0D 1QASA 3S0DA 2QEBA 4YRUA 2COLB 3L4LA 1NWDA 2I18A 4N5XA 1SBJA 2K60A 3CR2A 3R1OA 2KBMA 3VROA 1F4QA 1GQMA 1UWOA 4MRYA 3CR5X 3DVMA 1AP4A 2PQLA 1UUSA 4DUQA 1XYDA 3HCMA 5HLVA 1M39A 3EK8A 2FCEA 1QATA 1QX7A 2KAXA 3DF0B 4YGCB 1SYMA 2QEVA 1PALA 1UHKA 1ZMZA 1S1EA 2JU0A 2WC6A 1BU3A 4QJ4B 2KYFA 5HL1A 5HKYA 1NX1A 1JFKA 3SG7A 2JWWA 1CDPA 1RTP1 3GK2A 3NSKA 2KGBC 3C1VA 1U5IB 1OQPA 2MLFC 2EC6B 4MRXA 4PHKA 5F6TA 3SS3A 1YUSA 3DY9A 2G2BA 2PALA 1M46A 3R1PA 1OMVA 2L4IA 1J1DA 2G9BA 2LV7A 1AJ4A 4USLA 5J3XA 3SIBA 2LP2A 1DGUA 1PRWA 3IQOA 4GUKA 2CNPA 1CFPA 1DJGA 3VRPA 1CFFA 3D0YA 4U8DA 3BOWA 1FW4A 1S6CA 2WCJA 3OX5A 1BR4B 4ICBA 1EL4A 1T14A 2Y1MA 4KYNA 4HRGA 4MZJA 1J7OA 3R1VA 4Q04A 1KFUL 5FYXA 3PM2A 1IJ5A 1OZSA 2KHNA 3FE6A 3FS7A 1TNXA 1SCMB 3KF9A 2ZRTA 3S0GA 3OP0A 1JF0A 2AAOA 1B8RA 1EG4A 1YR5A 1KCYA 1XK4A 2B1UA 5JOLA 1RECA 3BUWB 1IWQA 4N1FA 1ZFSA 2BCXA 1CFCA 2JT0A 5I8NA 1YX8A 5CPVA 1AVSA 2LE9B 3LCPC 1NPQA 1SPYA 3O2PA 4P5OE 1C07A 1TUZA 3Q8IA 2K7OA 1R2UA 1YRTB 2MAZA 1DF0A 2K2AA 2JULA 1WDCB 2JT3A 2L5YA 5HLOA 2JC2A 4GGNA 2I7AA 1EJ3A 3O6BA 3JTDC 1S6JA 2KAVA 2HETA 2Y5IA 1TCFA 3D73A 4JPZB 5GQQC 3N7HA 1EG3A 1CMGA 1C3ZA 4IJ7A 3FE8A 2TN4A 2M7NA 4GBAA
chains in the Genus database with same CATH topology
3BXKA 3SJSA 3LK0A 1XVJA 5KSZA 1LA0A 2GV5A 1S26D 3BYAA 4CFRA 1IH0A 1NCZA 2M29A 3BQ3A 2KFGA 4ORCB 1IG5A 1YUUA 4NDBA 3NSOA 4QJ5B 1LXFC 2KAYA 1DJXA 3VRQA 3CR4X 4MZLA 2PMYA 3NSLA 4MN0A 2L5XB 1OZOA 3CGAA 1OSAA 2ZN8A 3PN7C 2CTNA 1KWOC 1A4PA 1NUBA 3JVTB 1B9AA 5DKQA 3FWBA 3CWGA 3KO0A 1V1FA 4DRWA 1A75A 1A2XA 4PE0A 1CTRA 1QX5B 2MA2A 1QLKA 3EVVA 1IKUA 2LMUA 1IQ5A 4PDZA 1TNQA 2OTGC 2PASA 3KHEA 1J7RA 4CIDA 1BLQA 1B1GA 4GGFA 1SNLA 2O60A 4I5KA 1UP5A 2BL0C 1E8AA 2KFFA 2QPTA 2K7DA 1OMDA 4AQIA 2SASA 2O5GA 1MF8B 5BPJA 2KQYA 3D10A 4DCKA 4R1EA 5AFPA 2WC8A 1CMFA 1YVHA 1KK7Z 2M9GA 1SR6C 5AANA 1H4BA 4I5LB 1IGVA 2MJWB 3D0YB 2FJUB 3BOWB 1FF1A 2I94A 2CXJA 2LVVA 1PSRA 4GNKB 2JPTA 1IQ3A 1RJVA 1F54A 3ICBA 1FI6A 2ZRSA 2H61C 5AERA 4WRIA 2H2KA 3KEVA 4ZCVA 3RM1A 4YI9A 2Q4UA 1J7QA 4MLWA 3BUNB 3EVUA 1BF5A 4C0LA 2WCFA 1PVAA 2P6BB 4C0KA 3CZTX 4PALA 4YGAA 2K7CA 3I5FB 1KQMB 3KPXA 5K89A 1DJZA 1SL9A 2BKHB 3AAKA 1Q80A 1DF0B 3AKAA 1OMRA 1DJIA 1DT7B 4PCWA 5I2QA 1NX3A 2BKIB 3AKBA 3I5IB 3I5GB 4MZKA 2EC6C 1NX2A 4CPVA 1WY9A 3NXAA 2OS8B 1QXPA 2K7BA 2BE4A 1BR1B 1CLBA 1JBAA 2LMTA 2K2FA 2WCEA 3AAJA 1YTZC 4OV2A 2K61A 2NCPA 3GK1A 4HSZA 1KSOA 2LC5A 3SG6A 2E6WA 3IF7A 2WCBA 1SCVA 1AK8A 1TCOB 2M97A 2ISDA 4WQ2A 1LINA 2LVJA 5HKZA 1LA3A 2MBXA 1BG1A 2AMIA 2FCDA 1F4OA 1SCMC 2M0RA 5DKRA 4I5NB 2LANA 4HRHA 4IL1A 2JTZA 1KK8B 1BOCA 1A75B 1JUOA 4NQGA 3SG5A 4CFQA 2LVKA 5PALA 5IBWA 3TUYC 3PALA 2JQ6A 1B47A 3CLNA 1TOPA 2F8PA 1YRUB 3VRRA 3O78A 4YGBB 5CSJA 2LMVA 1SY9A 5CSNA 2F2OA 1XFUO 2KI4B 5D69A 1AUIB 3DVJA 1S36A 1WDCC 1YVLA 1RK9A 4JQ0D 1EH2A 2MLEC 1F71A 2L0PA 3OX6A 3WHTB 1Y6WA 1G4YR 1KFUS 1UURA 3PLFB 4NDCA 4MSPA 1PSBA 2ZKMX 1K9PA 2WORA 1QJTA 5HYDA 2GGZA 4BY5A 1M31A 2M1KB 3DF0A 2KNEA 1CB1A 5AEQA 3IQQA 1D1OA 1NCXA 1C7WA 5B8IB 5DKNA 2JT8A 2VRGA 1UHIA 1NIWA 1RWYA 2DOQA 4M2QA 2Y1NA 1TNWA 1U5IA 1KK7Y 2JNFA 3TS5B 3F45A 1ALVA 1KFXS 4YGEB 1MR8A 1UHNA 1V1GA 1CKKA 1CDLA 1MXEA 1K94A 1MUXA 2CT9A 1BT6A 1QV0A 3TZ1A 1L7ZA 2BE6A 1CLMA 2WNDA 2KOTA 3GOFA 1R6PA 3JVTC 5JJGA 1B8CA 4ZCUA 4XYNA 1CM4A 4OVNF 1A29A 1WRLA 1J55A 2CCMA 2JTTA 1G8IA 1L2OB 2KYCA 3VRNA 1F70A 3OB1B 1CM1A 1IRJA 2NXQA 3PM8A 3PN7B 1OOJA 4PHNA 4XJKA 4YI8A 1YURA 2HF5A 1AJ5A 2RGIA 4M2PA 1B8LA 4ORBB 3E3RA 1F8HA 1FBVA 1LKJA 3H4SE 3I5HB 4E68A 3HX4A 3MSEB 2Y4QA 2KI6D 1B7TZ 2KQ6A 2AUCA 4L9MA 1GGWA 3PATA 3CS1A 1MXLC 5KTYA 1B4CA 2JRFA 2SCPA 3SG3A 1M45A 5KU1A 1BJFA 2PRUA 1XFYO 2LNKA 3FWCA 1G33A 3TDIA 1BMOA 1ODBA 2BCAA 2IS9A 2LLUA 1QLSA 1XFWO 2E30A 3WHUB 4BY4A 1XK4C 5I2LA 1XO5A 3OHMB 3I5FC 1KQMC 4A4CA 3TDZA 1K95A 1WRKA 2Q91A 5TNCA 1K8UA 2JZIA 1TIZA 1H8BA 5G08A 1QVIZ 1K9KA 4P2YB 3RLZA 1NYAA 1GGZA 1NCYA 3SG4A 1DGVA 4YGDB 1SL7A 2ZFDA 2LUCA 2L2EA 1DVIA 2KI6C 1RFJA 4F0ZB 4PHJA 2F3ZA 1TNPA 1MHOA 1YX7A 3I5IC 3I5GC 5ER5A 2OS8C 1W7IB 2F3YA 3DD4A 4HREE 1Y1XA 2BBMA 2OPOA 3SIAA 2LM5A 4D1EA 3GK4X 4WQ3A 1KSMA 2HQWA 4NDDA 2JNXA 2M1UA 1OE9B 1RROA 3BUOB 2ZN9A 1K96A 1TRFA 1JF2A 4PE7A 4M2OA 2BCBA 1NSHA 1M63B 2GGMA 4DS7A 2D8NA 1UHJA 2JXLA 2MRDA 1QV1A 2M8UA 1ZACA 1UHHA 2PSRA 2WOSA 3O4YA 1TN4A 2BECA 1J7PA 2LVIA 1K90D 4PHMA 1K2HA 2K0JA 2NCOA 1N2DA 1K9UA 1CDNA 1TTXA 2FOTA 2M3WA 1QIWA 4AOMA 1K93D 1KK8C 1C7VA 1GJYA 4ETOA 2I2RE 2F33A 1W7JB 3FIAA 2H61A 5CSIA 2LHIA 3LK1A 2A4JA 3TDUA 3SG2A 1HQVA 3ZNIA 2LLSA 4GGFC 4YBHB 3CTNA 2JXCA 2KI4C 4A4BA 2JOJA 4JWQA 1IJ6A 4QJ3B 4XJKB 2R2IA 1X02A 3BUXB 1JSAA 1J1EA 5I2OA 1S3PA 4MBEA 4OKHA 3DVEA 2EGDA 1YUTA 1N65A 2KBIA 2MHHA 1S5GY 4GPLB 4GAOA 1CDMA 3WNXB 1ALWA 2L4HA 1MQ1A 2KFHA 3PFVA 3TUYB 2QACA 4UPGA 1A03A 1DJYA 4ORAB 1BODA 2ZNDA 2CBLA 1SW8A 2M7LA 3JTDB 1VRKA 1PVBA 1KFXL 4GFTA 3EK7A 2F2PA 1DJHA 4I5JA 3ZWHA 2KSPA 2NLNA 2LP3A 5ER4X 3TS5C 2LHLA 1JFJA 4FQOA 3EK4A 1PULA 1NP8A 1B7TY 2KGRA 1WLZA 1N0YA 2EHBA 1S6IA 1DMOA 1KQVA 1SRAA 4OR9B 2LUXA 4MEWA 1FI5A 3VGOA 1XFVO 3WXAA 4TNCA 1Y1AA 1JC2A 1QIVA 1S5GZ 2LAPA 3PSRA 5HKWA 1JWDA 3LLEA 4FTGA 3LL8B 2HPSA 1Y0VH 1EXRA 4MVFA 1L2OC 1AHRA 1QS7A 2BBNA 4OCIA 1KWOB 3QRXA 1XA5A 2L51A 2V53A 1WLMA 3OB2B 1QVIY 1SL8A 2HQ8A 1SK6D 1Y1UA 2L98A 3EKJA 2OTGB 3EKHA 2LLTA 1CNPA 4C0JA 4PE4A 1QTXA 3I5HC 4CLNA 2L50A 2KDHA 1ZOTB 3EVRA 3A4UB 1SMGA 1CLLA 2BL0B 3M0WA 1XFXO 5D7FA 4AQJA 1HT9A 4PE1A 1NX0A 2LCPA 1SKTA 1DTLA 1MWNA 1WRZA 1CFDA 3DVKA 1SR6B 1F55A 3K21A 1LVCD 1XFZO 2PVBA 1FPWA 1QX2A 3NSIA 3BUMB 4DIRA 1DJWA 2M49B 5CSFA 2K8MB 1ZUZA 2ZNEA 5AXIA 3A8RA 4N1GA 2NZ0A 1PK0D 1QASA 4YRUA 2COLB 1NWDA 2I18A 4N5XA 1SBJA 3CR2A 2KBMA 3VROA 1F4QA 1GQMA 1UWOA 4MRYA 3CR5X 3DVMA 1AP4A 1UUSA 4DUQA 1XYDA 3HCMA 5HLVA 1M39A 3EK8A 2FCEA 1QATA 1QX7A 2KAXA 3DF0B 4YGCB 1SYMA 1PALA 1UHKA 1ZMZA 1S1EA 2JU0A 1BU3A 4QJ4B 2KYFA 5HKYA 1NX1A 1JFKA 3SG7A 2JWWA 1CDPA 1RTP1 3GK2A 3NSKA 2KGBC 3C1VA 1U5IB 1OQPA 2MLFC 2EC6B 4MRXA 4PHKA 5F6TA 1YUSA 2G2BA 2PALA 1M46A 1OMVA 2L4IA 1J1DA 2G9BA 2LV7A 1AJ4A 4USLA 5J3XA 3SIBA 2LP2A 1DGUA 1PRWA 3IQOA 4GUKA 2CNPA 1CFPA 1DJGA 3VRPA 1CFFA 3D0YA 4U8DA 3BOWA 1FW4A 1S6CA 3OX5A 1BR4B 4ICBA 1EL4A 4MZJA 2Y1MA 4HRGA 1J7OA 4Q04A 1KFUL 5FYXA 1IJ5A 1OZSA 2KHNA 3FS7A 3KF9A 1TNXA 1SCMB 2ZRTA 3OP0A 1JF0A 2AAOA 1B8RA 1EG4A 1YR5A 1KCYA 1XK4A 2B1UA 5JOLA 1RECA 3BUWB 1IWQA 4N1FA 1ZFSA 2BCXA 1CFCA 2JT0A 5I8NA 1YX8A 5CPVA 1AVSA 2LE9B 3LCPC 1NPQA 1SPYA 3O2PA 4P5OE 1C07A 2K7OA 1R2UA 1YRTB 2MAZA 1DF0A 2K2AA 2JULA 1WDCB 2JT3A 5HLOA 2JC2A 4GGNA 2I7AA 1EJ3A 3O6BA 3JTDC 1S6JA 2KAVA 2HETA 2Y5IA 1TCFA 5GQQC 4JPZB 1EG3A 1CMGA 2TN4A 2M7NA 4GBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXK A;  3SJS A;  3LK0 A;  1XVJ A;  5KSZ A;  1LA0 A;  2GV5 A;  1S26 D;  3BYA A;  4CFR A;  1IH0 A;  1NCZ A;  2M29 A;  3BQ3 A;  2KFG A;  4ORC B;  1IG5 A;  1YUU A;  4NDB A;  3NSO A;  4QJ5 B;  1LXF C;  2KAY A;  1DJX A;  3VRQ A;  3CR4 X;  4MZL A;  2PMY A;  3NSL A;  4MN0 A;  2L5X B;  1OZO A;  3CGA A;  1OSA A;  2ZN8 A;  3PN7 C;  2CTN A;  1KWO C;  1A4P A;  1NUB A;  3JVT B;  1B9A A;  5DKQ A;  3FWB A;  3CWG A;  3KO0 A;  1V1F A;  4DRW A;  1A75 A;  1A2X A;  4PE0 A;  1CTR A;  1QX5 B;  2MA2 A;  1QLK A;  3EVV A;  1IKU A;  2LMU A;  1IQ5 A;  4PDZ A;  1TNQ A;  2OTG C;  2PAS A;  3KHE A;  1J7R A;  4CID A;  1BLQ A;  1B1G A;  4GGF A;  1SNL A;  2O60 A;  4I5K A;  1UP5 A;  2BL0 C;  1E8A A;  2KFF A;  2QPT A;  2K7D A;  1OMD A;  4AQI A;  2SAS A;  2O5G A;  1MF8 B;  5BPJ A;  2KQY A;  3D10 A;  4DCK A;  4R1E A;  5AFP A;  2WC8 A;  1CMF A;  1YVH A;  1KK7 Z;  2M9G A;  1SR6 C;  5AAN A;  1H4B A;  4I5L B;  1IGV A;  2MJW B;  3D0Y B;  2FJU B;  3BOW B;  1FF1 A;  2I94 A;  2CXJ A;  2LVV A;  1PSR A;  4GNK B;  2JPT A;  1IQ3 A;  1RJV A;  1F54 A;  3ICB A;  1FI6 A;  2ZRS A;  2H61 C;  5AER A;  4WRI A;  2H2K A;  3KEV A;  4ZCV A;  3RM1 A;  4YI9 A;  2Q4U A;  1J7Q A;  4MLW A;  3BUN B;  3EVU A;  1BF5 A;  4C0L A;  2WCF A;  1PVA A;  2P6B B;  4C0K A;  3CZT X;  4PAL A;  4YGA A;  2K7C A;  3I5F B;  1KQM B;  3KPX A;  5K89 A;  1DJZ A;  1SL9 A;  2BKH B;  3AAK A;  1Q80 A;  1DF0 B;  3AKA A;  1OMR A;  1DJI A;  1DT7 B;  4PCW A;  5I2Q A;  1NX3 A;  2BKI B;  3AKB A;  3I5I B;  3I5G B;  4MZK A;  2EC6 C;  1NX2 A;  4CPV A;  1WY9 A;  3NXA A;  2OS8 B;  1QXP A;  2K7B A;  2BE4 A;  1BR1 B;  1CLB A;  1JBA A;  2LMT A;  2K2F A;  2WCE A;  3AAJ A;  1YTZ C;  4OV2 A;  2K61 A;  2NCP A;  3GK1 A;  4HSZ A;  1KSO A;  2LC5 A;  3SG6 A;  2E6W A;  3IF7 A;  2WCB A;  1SCV A;  1AK8 A;  1TCO B;  2M97 A;  2ISD A;  4WQ2 A;  1LIN A;  2LVJ A;  5HKZ A;  1LA3 A;  2MBX A;  1BG1 A;  2AMI A;  2FCD A;  1F4O A;  1SCM C;  2M0R A;  5DKR A;  4I5N B;  2LAN A;  4HRH A;  4IL1 A;  2JTZ A;  1KK8 B;  1BOC A;  1A75 B;  1JUO A;  4NQG A;  3SG5 A;  4CFQ A;  2LVK A;  5PAL A;  5IBW A;  3TUY C;  3PAL A;  2JQ6 A;  1B47 A;  3CLN A;  1TOP A;  2F8P A;  1YRU B;  3VRR A;  3O78 A;  4YGB B;  5CSJ A;  2LMV A;  1SY9 A;  5CSN A;  2F2O A;  1XFU O;  2KI4 B;  5D69 A;  1AUI B;  3DVJ A;  1S36 A;  1WDC C;  1YVL A;  1RK9 A;  4JQ0 D;  1EH2 A;  2MLE C;  1F71 A;  2L0P A;  3OX6 A;  3WHT B;  1Y6W A;  1G4Y R;  1KFU S;  1UUR A;  3PLF B;  4NDC A;  4MSP A;  1PSB A;  2ZKM X;  1K9P A;  2WOR A;  1QJT A;  5HYD A;  2GGZ A;  4BY5 A;  1M31 A;  2M1K B;  3DF0 A;  2KNE A;  1CB1 A;  5AEQ A;  3IQQ A;  1D1O A;  1NCX A;  1C7W A;  5B8I B;  5DKN A;  2JT8 A;  2VRG A;  1UHI A;  1NIW A;  1RWY A;  2DOQ A;  4M2Q A;  2Y1N A;  1TNW A;  1U5I A;  1KK7 Y;  2JNF A;  3TS5 B;  3F45 A;  1ALV A;  1KFX S;  4YGE B;  1MR8 A;  1UHN A;  1V1G A;  1CKK A;  1CDL A;  1MXE A;  1K94 A;  1MUX A;  2CT9 A;  1BT6 A;  1QV0 A;  3TZ1 A;  1L7Z A;  2BE6 A;  1CLM A;  2WND A;  2KOT A;  3GOF A;  1R6P A;  3JVT C;  5JJG A;  1B8C A;  4ZCU A;  4XYN A;  1CM4 A;  4OVN F;  1A29 A;  1WRL A;  1J55 A;  2CCM A;  2JTT A;  1G8I A;  1L2O B;  2KYC A;  3VRN A;  1F70 A;  3OB1 B;  1CM1 A;  1IRJ A;  2NXQ A;  3PM8 A;  3PN7 B;  1OOJ A;  4PHN A;  4XJK A;  4YI8 A;  1YUR A;  2HF5 A;  1AJ5 A;  2RGI A;  4M2P A;  1B8L A;  4ORB B;  3E3R A;  1F8H A;  1FBV A;  1LKJ A;  3H4S E;  3I5H B;  4E68 A;  3HX4 A;  3MSE B;  2Y4Q A;  2KI6 D;  1B7T Z;  2KQ6 A;  2AUC A;  4L9M A;  1GGW A;  3PAT A;  3CS1 A;  1MXL C;  5KTY A;  1B4C A;  2JRF A;  2SCP A;  3SG3 A;  1M45 A;  5KU1 A;  1BJF A;  2PRU A;  1XFY O;  2LNK A;  3FWC A;  1G33 A;  3TDI A;  1BMO A;  1ODB A;  2BCA A;  2IS9 A;  2LLU A;  1QLS A;  1XFW O;  2E30 A;  3WHU B;  4BY4 A;  1XK4 C;  5I2L A;  1XO5 A;  3OHM B;  3I5F C;  1KQM C;  4A4C A;  3TDZ A;  1K95 A;  1WRK A;  2Q91 A;  5TNC A;  1K8U A;  2JZI A;  1TIZ A;  1H8B A;  5G08 A;  1QVI Z;  1K9K A;  4P2Y B;  3RLZ A;  1NYA A;  1GGZ A;  1NCY A;  3SG4 A;  1DGV A;  4YGD B;  1SL7 A;  2ZFD A;  2LUC A;  2L2E A;  1DVI A;  2KI6 C;  1RFJ A;  4F0Z B;  4PHJ A;  2F3Z A;  1TNP A;  1MHO A;  1YX7 A;  3I5I C;  3I5G C;  5ER5 A;  2OS8 C;  1W7I B;  2F3Y A;  3DD4 A;  4HRE E;  1Y1X A;  2BBM A;  2OPO A;  3SIA A;  2LM5 A;  4D1E A;  3GK4 X;  4WQ3 A;  1KSM A;  2HQW A;  4NDD A;  2JNX A;  2M1U A;  1OE9 B;  1RRO A;  3BUO B;  2ZN9 A;  1K96 A;  1TRF A;  1JF2 A;  4PE7 A;  4M2O A;  2BCB A;  1NSH A;  1M63 B;  2GGM A;  4DS7 A;  2D8N A;  1UHJ A;  2JXL A;  2MRD A;  1QV1 A;  2M8U A;  1ZAC A;  1UHH A;  2PSR A;  2WOS A;  3O4Y A;  1TN4 A;  2BEC A;  1J7P A;  2LVI A;  1K90 D;  4PHM A;  1K2H A;  2K0J A;  2NCO A;  1N2D A;  1K9U A;  1CDN A;  1TTX A;  2FOT A;  2M3W A;  1QIW A;  4AOM A;  1K93 D;  1KK8 C;  1C7V A;  1GJY A;  4ETO A;  2I2R E;  2F33 A;  1W7J B;  3FIA A;  2H61 A;  5CSI A;  2LHI A;  3LK1 A;  2A4J A;  3TDU A;  3SG2 A;  1HQV A;  3ZNI A;  2LLS A;  4GGF C;  4YBH B;  3CTN A;  2JXC A;  2KI4 C;  4A4B A;  2JOJ A;  4JWQ A;  1IJ6 A;  4QJ3 B;  4XJK B;  2R2I A;  1X02 A;  3BUX B;  1JSA A;  1J1E A;  5I2O A;  1S3P A;  4MBE A;  4OKH A;  3DVE A;  2EGD A;  1YUT A;  1N65 A;  2KBI A;  2MHH A;  1S5G Y;  4GPL B;  4GAO A;  1CDM A;  3WNX B;  1ALW A;  2L4H A;  1MQ1 A;  2KFH A;  3PFV A;  3TUY B;  2QAC A;  4UPG A;  1A03 A;  1DJY A;  4ORA B;  1BOD A;  2ZND A;  2CBL A;  1SW8 A;  2M7L A;  3JTD B;  1VRK A;  1PVB A;  1KFX L;  4GFT A;  3EK7 A;  2F2P A;  1DJH A;  4I5J A;  3ZWH A;  2KSP A;  2NLN A;  2LP3 A;  5ER4 X;  3TS5 C;  2LHL A;  1JFJ A;  4FQO A;  3EK4 A;  1PUL A;  1NP8 A;  1B7T Y;  2KGR A;  1WLZ A;  1N0Y A;  2EHB A;  1S6I A;  1DMO A;  1KQV A;  1SRA A;  4OR9 B;  2LUX A;  4MEW A;  1FI5 A;  3VGO A;  1XFV O;  3WXA A;  4TNC A;  1Y1A A;  1JC2 A;  1QIV A;  1S5G Z;  2LAP A;  3PSR A;  5HKW A;  1JWD A;  3LLE A;  4FTG A;  3LL8 B;  2HPS A;  1Y0V H;  1EXR A;  4MVF A;  1L2O C;  1AHR A;  1QS7 A;  2BBN A;  4OCI A;  1KWO B;  3QRX A;  1XA5 A;  2L51 A;  2V53 A;  1WLM A;  3OB2 B;  1QVI Y;  1SL8 A;  2HQ8 A;  1SK6 D;  1Y1U A;  2L98 A;  3EKJ A;  2OTG B;  3EKH A;  2LLT A;  1CNP A;  4C0J A;  4PE4 A;  1QTX A;  3I5H C;  4CLN A;  2L50 A;  2KDH A;  1ZOT B;  3EVR A;  3A4U B;  1SMG A;  1CLL A;  2BL0 B;  3M0W A;  1XFX O;  5D7F A;  4AQJ A;  1HT9 A;  4PE1 A;  1NX0 A;  2LCP A;  1SKT A;  1DTL A;  1MWN A;  1WRZ A;  1CFD A;  3DVK A;  1SR6 B;  1F55 A;  3K21 A;  1LVC D;  1XFZ O;  2PVB A;  1FPW A;  1QX2 A;  3NSI A;  3BUM B;  4DIR A;  1DJW A;  2M49 B;  5CSF A;  2K8M B;  1ZUZ A;  2ZNE A;  5AXI A;  3A8R A;  4N1G A;  2NZ0 A;  1PK0 D;  1QAS A;  4YRU A;  2COL B;  1NWD A;  2I18 A;  4N5X A;  1SBJ A;  3CR2 A;  2KBM A;  3VRO A;  1F4Q A;  1GQM A;  1UWO A;  4MRY A;  3CR5 X;  3DVM A;  1AP4 A;  1UUS A;  4DUQ A;  1XYD A;  3HCM A;  5HLV A;  1M39 A;  3EK8 A;  2FCE A;  1QAT A;  1QX7 A;  2KAX A;  3DF0 B;  4YGC B;  1SYM A;  1PAL A;  1UHK A;  1ZMZ A;  1S1E A;  2JU0 A;  1BU3 A;  4QJ4 B;  2KYF A;  5HKY A;  1NX1 A;  1JFK A;  3SG7 A;  2JWW A;  1CDP A;  1RTP 1;  3GK2 A;  3NSK A;  2KGB C;  3C1V A;  1U5I B;  1OQP A;  2MLF C;  2EC6 B;  4MRX A;  4PHK A;  5F6T A;  1YUS A;  2G2B A;  2PAL A;  1M46 A;  1OMV A;  2L4I A;  1J1D A;  2G9B A;  2LV7 A;  1AJ4 A;  4USL A;  5J3X A;  3SIB A;  2LP2 A;  1DGU A;  1PRW A;  3IQO A;  4GUK A;  2CNP A;  1CFP A;  1DJG A;  3VRP A;  1CFF A;  3D0Y A;  4U8D A;  3BOW A;  1FW4 A;  1S6C A;  3OX5 A;  1BR4 B;  4ICB A;  1EL4 A;  4MZJ A;  2Y1M A;  4HRG A;  1J7O A;  4Q04 A;  1KFU L;  5FYX A;  1IJ5 A;  1OZS A;  2KHN A;  3FS7 A;  3KF9 A;  1TNX A;  1SCM B;  2ZRT A;  3OP0 A;  1JF0 A;  2AAO A;  1B8R A;  1EG4 A;  1YR5 A;  1KCY A;  1XK4 A;  2B1U A;  5JOL A;  1REC A;  3BUW B;  1IWQ A;  4N1F A;  1ZFS A;  2BCX A;  1CFC A;  2JT0 A;  5I8N A;  1YX8 A;  5CPV A;  1AVS A;  2LE9 B;  3LCP C;  1NPQ A;  1SPY A;  3O2P A;  4P5O E;  1C07 A;  2K7O A;  1R2U A;  1YRT B;  2MAZ A;  1DF0 A;  2K2A A;  2JUL A;  1WDC B;  2JT3 A;  5HLO A;  2JC2 A;  4GGN A;  2I7A A;  1EJ3 A;  3O6B A;  3JTD C;  1S6J A;  2KAV A;  2HET A;  2Y5I A;  1TCF A;  5GQQ C;  4JPZ B;  1EG3 A;  1CMG A;  2TN4 A;  2M7N A;  4GBA A; 
#chains in the Genus database with same CATH topology
 1QWV A;  3BXK A;  3SJS A;  3LK0 A;  1XVJ A;  4INW A;  3B6X A;  1LA0 A;  5KSZ A;  2GV5 A;  1S26 D;  2KLD A;  3BYA A;  4CFR A;  2QEH A;  3EG5 B;  1IH0 A;  1NCZ A;  1IIO A;  2M29 A;  3BQ3 A;  2KFG A;  5FI7 A;  4ORC B;  1IG5 A;  1YUU A;  4NDB A;  3NSO A;  1Z2C B;  1LXF C;  4QJ5 B;  2KAY A;  1DJX A;  3VRQ A;  3CR4 X;  4MZL A;  1TWO A;  2PMY A;  3NSL A;  4MN0 A;  2L5X B;  1OZO A;  3CGA A;  1OSA A;  2ZN8 A;  2H8V A;  3PN7 C;  2CTN A;  2WCL A;  1KWO C;  1A4P A;  1NUB A;  3JVT B;  1B9A A;  5DKQ A;  3FWB A;  3CWG A;  3KO0 A;  1V1F A;  4DRW A;  1DEL A;  1A2X A;  1A75 A;  4PE0 A;  1CTR A;  1QX5 B;  2MA2 A;  1QLK A;  3B7A A;  3EVV A;  3D75 A;  1IKU A;  2LMU A;  1IQ5 A;  4PDZ A;  1TNQ A;  2OTG C;  2PAS A;  3KHE A;  1J7R A;  4CID A;  1BLQ A;  1B1G A;  4GGF A;  1SNL A;  2O60 A;  4I5K A;  1UP5 A;  2BL0 C;  1E8A A;  2KFF A;  2QPT A;  2K7D A;  1OMD A;  3CZ0 A;  4AQI A;  2SAS A;  2O5G A;  1MF8 B;  5BPJ A;  2KQY A;  3D10 A;  4DCK A;  2WCH A;  4R1E A;  2WC8 A;  5AFP A;  1CMF A;  1YVH A;  1KK7 Z;  2M9G A;  1SR6 C;  1W9Z A;  5AAN A;  1H4B A;  4I5L B;  1IGV A;  2MJW B;  3FE9 A;  3D0Y B;  2FJU B;  2QDI A;  3BOW B;  2I94 A;  2CXJ A;  1FF1 A;  2LVV A;  1PSR A;  3DZT A;  4GNK B;  2JPT A;  1IQ3 A;  1RJV A;  1F54 A;  3ICB A;  1FI6 A;  2ZRS A;  1OOG A;  2H61 C;  3K1E A;  2ERB A;  5AER A;  2P71 A;  4WRI A;  2H2K A;  3KEV A;  4ZCV A;  3RM1 A;  3BFB A;  4YI9 A;  2Q4U A;  1J7Q A;  1Z4H A;  4MLW A;  3BUN B;  3EVU A;  1BF5 A;  3OGN A;  4C0L A;  2WCF A;  1PVA A;  2P6B B;  4C0K A;  3CZT X;  4PAL A;  4YGA A;  2K7C A;  3I5F B;  1KQM B;  3KPX A;  5K89 A;  1GM0 A;  1TUJ A;  1DJZ A;  1SL9 A;  2BKH B;  3AAK A;  1Q80 A;  1DF0 B;  3AKA A;  1OMR A;  1DJI A;  1DT7 B;  2YGU A;  4PCW A;  5I2Q A;  1NX3 A;  3S0A A;  3CDN A;  3S0B A;  2BKI B;  3AKB A;  4JKT A;  2WCK A;  3I5I B;  3I5G B;  4MZK A;  2EC6 C;  1NX2 A;  4CPV A;  1WY9 A;  3NXA A;  2OS8 B;  1QXP A;  2K7B A;  2BE4 A;  1BR1 B;  1CLB A;  1JBA A;  2LMT A;  2K2F A;  2WCE A;  3AAJ A;  1YTZ C;  4OV2 A;  2K61 A;  2NCP A;  3GK1 A;  4HSZ A;  1KSO A;  2LC5 A;  3SG6 A;  2E6W A;  3IF7 A;  2WCB A;  1SCV A;  1AK8 A;  1TCO B;  2M97 A;  2ISD A;  2FJY A;  4WQ2 A;  1OW4 A;  1LIN A;  2LVJ A;  5HKZ A;  1LA3 A;  2MBX A;  1BG1 A;  3IVT A;  2AMI A;  2FCD A;  1F4O A;  3RZS A;  1SCM C;  4F7F A;  2M0R A;  5DKR A;  4I5N B;  2LAN A;  4HRH A;  4IL1 A;  2JTZ A;  1KK8 B;  5EL2 A;  1A75 B;  1JUO A;  4NQG A;  1BOC A;  3SG5 A;  4CFQ A;  2PYQ A;  2LVK A;  5PAL A;  5IBW A;  3TUY C;  3PAL A;  2JQ6 A;  1B47 A;  3CLN A;  1TOP A;  2F8P A;  1YRU B;  3VRR A;  3O78 A;  4YGB B;  5CSJ A;  2LMV A;  1SY9 A;  5CSN A;  2F2O A;  1XFU O;  2KI4 B;  3BFH A;  5D69 A;  1AUI B;  3DVJ A;  5D3O A;  5DIC A;  1S36 A;  1WDC C;  1YVL A;  1XFR A;  1RK9 A;  4JQ0 D;  1EH2 A;  2MLE C;  1F71 A;  2L0P A;  3OX6 A;  3WHT B;  3CZ1 A;  1DEK A;  1Y6W A;  1G4Y R;  1KFU S;  1UUR A;  3PLF B;  4NDC A;  4MSP A;  1PSB A;  2ZKM X;  3DXL A;  1K9P A;  2WOR A;  1QJT A;  3UNW A;  5HYD A;  2GGZ A;  3CZ2 A;  5I94 A;  4BY5 A;  1M31 A;  2M1K B;  3DF0 A;  2KNE A;  1C3Y A;  5AEQ A;  1CB1 A;  3IQQ A;  3B87 A;  1D1O A;  1NCX A;  1C7W A;  5B8I B;  5DKN A;  2JT8 A;  2VRG A;  1UHI A;  1NIW A;  1RWY A;  2DOQ A;  4M2Q A;  2Y1N A;  1TNW A;  1U5I A;  1KK7 Y;  2JNF A;  3TS5 B;  3F45 A;  1ALV A;  1KFX S;  4YGE B;  1MR8 A;  1UHN A;  1V1G A;  3OBV A;  1CKK A;  1CDL A;  1MXE A;  3R72 A;  1K94 A;  1MUX A;  2CT9 A;  1BT6 A;  1QV0 A;  3TZ1 A;  1L7Z A;  2BE6 A;  2WCM A;  1CLM A;  2WND A;  2KOT A;  3GOF A;  1R6P A;  3JVT C;  5JJG A;  1B8C A;  4ZCU A;  4OZD A;  4XYN A;  1CM4 A;  4OVN F;  1A29 A;  1WRL A;  1J55 A;  2CCM A;  2JTT A;  1G8I A;  1L2O B;  2KPH A;  2KYC A;  3VRN A;  1F70 A;  2BNX A;  3OB1 B;  1CM1 A;  1IRJ A;  2L2C A;  2NXQ A;  3PM8 A;  1OOJ A;  3PN7 B;  4PHN A;  3B88 A;  4XJK A;  1ORG A;  4YI8 A;  1YUR A;  2HF5 A;  1AJ5 A;  2RGI A;  3VB1 A;  4M2P A;  1B8L A;  3SS5 A;  4ORB B;  3E3R A;  1F8H A;  1FBV A;  1LKJ A;  3H4S E;  3I5H B;  4E68 A;  3HX4 A;  3MSE B;  2Y4Q A;  2BAP A;  1B7T Z;  2KI6 D;  2KQ6 A;  1DC1 A;  2AUC A;  4L9M A;  1GGW A;  3PAT A;  3QME A;  3CS1 A;  1MXL C;  5KTY A;  1B4C A;  2JRF A;  2SCP A;  3SG3 A;  3NGV A;  1M45 A;  5KU1 A;  1BJF A;  2PRU A;  1XFY O;  2LNK A;  3B86 A;  1G33 A;  3FWC A;  3TDI A;  1BMO A;  1ODB A;  2BCA A;  2IS9 A;  3UO9 A;  2LLU A;  1QLS A;  1XFW O;  2E30 A;  3WHU B;  4BY4 A;  1XK4 C;  4FQT A;  5I2L A;  3DYE A;  1XO5 A;  3OHM B;  3BJH A;  3I5F C;  1KQM C;  4A4C A;  3TDZ A;  1K95 A;  1WRK A;  2Q91 A;  5TNC A;  1K8U A;  2JZI A;  1TIZ A;  1H8B A;  5G08 A;  1QVI Z;  1K9K A;  4P2Y B;  3RLZ A;  1NYA A;  1GGZ A;  1NCY A;  3SG4 A;  1DGV A;  4YGD B;  1SL7 A;  2ZFD A;  2LUC A;  2L2E A;  1DVI A;  2KI6 C;  1RFJ A;  3CYZ A;  4PHJ A;  4F0Z B;  2F3Z A;  2JPO A;  1TNP A;  1MHO A;  1YX7 A;  3I5I C;  3I5G C;  5ER5 A;  2OS8 C;  1W7I B;  2F3Y A;  3DD4 A;  4HRE E;  3D74 A;  1Y1X A;  2BBM A;  2OPO A;  3SIA A;  2LM5 A;  4D1E A;  3GK4 X;  3O4X A;  4WQ3 A;  1KSM A;  3L4A A;  2HQW A;  4NDD A;  2JNX A;  2M1U A;  1OE9 B;  1RRO A;  3BUO B;  3D77 A;  2ZN9 A;  1K96 A;  1TRF A;  1JF2 A;  4PE7 A;  4M2O A;  2BCB A;  1NSH A;  1M63 B;  2GGM A;  4DS7 A;  2D8N A;  1UHJ A;  2JXL A;  3BFA A;  2MRD A;  1QV1 A;  2M8U A;  1ZAC A;  1UHH A;  2PSR A;  2WOS A;  3O4Y A;  1TN4 A;  2BEC A;  1J7P A;  2LVI A;  1K90 D;  3D76 A;  4PHM A;  2K0J A;  1K2H A;  2NCO A;  1N2D A;  3V2L A;  1K9U A;  1CDN A;  1TTX A;  2FOT A;  2M3W A;  1QIW A;  4AOM A;  2WC5 A;  1K93 D;  1KK8 C;  1C7V A;  1GJY A;  4ETO A;  4INX A;  2I2R E;  2F33 A;  1W7J B;  3FIA A;  2H61 A;  5CSI A;  2LHI A;  3LK1 A;  2A4J A;  3TDU A;  3SG2 A;  1HQV A;  3ZNI A;  2LLS A;  4GGF C;  4YBH B;  2KLE A;  3CTN A;  5FI2 A;  2JXC A;  2KI4 C;  4JD9 A;  4A4B A;  2JOJ A;  4JWQ A;  1IJ6 A;  4QJ3 B;  4XJK B;  2R2I A;  1X02 A;  3BUX B;  3CAB A;  1J1E A;  1JSA A;  5I2O A;  1S3P A;  4MBE A;  4OKH A;  1SSE B;  3DVE A;  2EGD A;  1YUT A;  1N65 A;  2KBI A;  2MHH A;  1S5G Y;  4GPL B;  4GAO A;  1CDM A;  3WNX B;  3NHT A;  3S0F A;  1ALW A;  2L4H A;  1MQ1 A;  2KFH A;  3PFV A;  3TUY B;  2QAC A;  4UPG A;  1A03 A;  1DJY A;  4ORA B;  1BOD A;  2ZND A;  2CBL A;  1SW8 A;  2M7L A;  3JTD B;  1VRK A;  1PVB A;  1KFX L;  4GFT A;  3EK7 A;  2F2P A;  1DJH A;  4I5J A;  3ZWH A;  2KSP A;  2NLN A;  2LP3 A;  5ER4 X;  3TS5 C;  2LHL A;  1JFJ A;  4FQO A;  2GTE A;  3EK4 A;  1PUL A;  1NP8 A;  1B7T Y;  2KGR A;  3NHI A;  1WLZ A;  1N0Y A;  2EHB A;  1LS8 A;  1S6I A;  1DMO A;  1KQV A;  1SRA A;  4OR9 B;  2LUX A;  4MEW A;  1FI5 A;  3VGO A;  1XFV O;  3WXA A;  4TNC A;  1Y1A A;  1JC2 A;  1QIV A;  1S5G Z;  2LAP A;  3PSR A;  5HKW A;  1JWD A;  3LLE A;  1OOH A;  4FTG A;  3LL8 B;  2HPS A;  1Y0V H;  1EXR A;  1OOF A;  4MVF A;  1L2O C;  1AHR A;  1QS7 A;  2BBN A;  4OCI A;  1KWO B;  3QRX A;  1XA5 A;  2L51 A;  2V53 A;  1WLM A;  3S0E A;  5FI6 A;  3OB2 B;  1QVI Y;  1SL8 A;  2HQ8 A;  1SK6 D;  1Y1U A;  2L98 A;  3EKJ A;  2OTG B;  3EKH A;  2LLT A;  2P70 A;  1CNP A;  4C0J A;  4PE4 A;  1QTX A;  3I5H C;  4CLN A;  2L50 A;  3SS4 A;  2KDH A;  1ZOT B;  3EVR A;  3A4U B;  1SMG A;  1CLL A;  2BL0 B;  3M0W A;  1XFX O;  4PT1 A;  5D7F A;  4AQJ A;  1P28 A;  1HT9 A;  3D78 A;  4PE1 A;  1NX0 A;  2LCP A;  1SKT A;  1DTL A;  1MWN A;  1WRZ A;  1CFD A;  3DVK A;  1SR6 B;  1F55 A;  1OOI X;  3K21 A;  3PJI A;  1LVC D;  1XFZ O;  2PVB A;  1FPW A;  1QX2 A;  3NSI A;  3BUM B;  4DIR A;  1DJW A;  2M49 B;  2QEO A;  5CSF A;  1DQE A;  2K8M B;  1ZUZ A;  2ZNE A;  3L47 A;  3A8R A;  4N1G A;  2NZ0 A;  5AXI A;  1PK0 D;  1QAS A;  3S0D A;  2QEB A;  4YRU A;  2COL B;  3L4L A;  1NWD A;  2I18 A;  4N5X A;  1SBJ A;  2K60 A;  3CR2 A;  3R1O A;  2KBM A;  3VRO A;  1F4Q A;  1GQM A;  1UWO A;  4MRY A;  3CR5 X;  3DVM A;  1AP4 A;  2PQL A;  1UUS A;  4DUQ A;  1XYD A;  3HCM A;  5HLV A;  1M39 A;  3EK8 A;  2FCE A;  1QAT A;  1QX7 A;  2KAX A;  3DF0 B;  4YGC B;  1SYM A;  2QEV A;  1PAL A;  1UHK A;  1ZMZ A;  1S1E A;  2JU0 A;  2WC6 A;  1BU3 A;  4QJ4 B;  2KYF A;  5HL1 A;  5HKY A;  1NX1 A;  1JFK A;  3SG7 A;  2JWW A;  1CDP A;  1RTP 1;  3GK2 A;  3NSK A;  2KGB C;  3C1V A;  1U5I B;  1OQP A;  2MLF C;  2EC6 B;  4MRX A;  4PHK A;  5F6T A;  3SS3 A;  1YUS A;  3DY9 A;  2G2B A;  2PAL A;  1M46 A;  3R1P A;  1OMV A;  2L4I A;  1J1D A;  2G9B A;  2LV7 A;  1AJ4 A;  4USL A;  5J3X A;  3SIB A;  2LP2 A;  1DGU A;  1PRW A;  3IQO A;  4GUK A;  2CNP A;  1CFP A;  1DJG A;  3VRP A;  1CFF A;  3D0Y A;  4U8D A;  3BOW A;  1FW4 A;  1S6C A;  2WCJ A;  3OX5 A;  1BR4 B;  4ICB A;  1EL4 A;  1T14 A;  2Y1M A;  4KYN A;  4HRG A;  4MZJ A;  1J7O A;  3R1V A;  4Q04 A;  1KFU L;  5FYX A;  3PM2 A;  1IJ5 A;  1OZS A;  2KHN A;  3FE6 A;  3FS7 A;  1TNX A;  1SCM B;  3KF9 A;  2ZRT A;  3S0G A;  3OP0 A;  1JF0 A;  2AAO A;  1B8R A;  1EG4 A;  1YR5 A;  1KCY A;  1XK4 A;  2B1U A;  5JOL A;  1REC A;  3BUW B;  1IWQ A;  4N1F A;  1ZFS A;  2BCX A;  1CFC A;  2JT0 A;  5I8N A;  1YX8 A;  5CPV A;  1AVS A;  2LE9 B;  3LCP C;  1NPQ A;  1SPY A;  3O2P A;  4P5O E;  1C07 A;  1TUZ A;  3Q8I A;  2K7O A;  1R2U A;  1YRT B;  2MAZ A;  1DF0 A;  2K2A A;  2JUL A;  1WDC B;  2JT3 A;  2L5Y A;  5HLO A;  2JC2 A;  4GGN A;  2I7A A;  1EJ3 A;  3O6B A;  3JTD C;  1S6J A;  2KAV A;  2HET A;  2Y5I A;  1TCF A;  3D73 A;  4JPZ B;  5GQQ C;  3N7H A;  1EG3 A;  1CMG A;  1C3Z A;  4IJ7 A;  3FE8 A;  2TN4 A;  2M7N A;  4GBA A; 
#chains in the Genus database with same CATH homology
 3BXK A;  3SJS A;  3LK0 A;  1XVJ A;  5KSZ A;  1LA0 A;  2GV5 A;  1S26 D;  3BYA A;  4CFR A;  1IH0 A;  1NCZ A;  2M29 A;  3BQ3 A;  2KFG A;  4ORC B;  1IG5 A;  1YUU A;  4NDB A;  3NSO A;  4QJ5 B;  1LXF C;  2KAY A;  1DJX A;  3VRQ A;  3CR4 X;  4MZL A;  2PMY A;  3NSL A;  4MN0 A;  2L5X B;  1OZO A;  3CGA A;  1OSA A;  2ZN8 A;  3PN7 C;  2CTN A;  1KWO C;  1A4P A;  1NUB A;  3JVT B;  1B9A A;  5DKQ A;  3FWB A;  3CWG A;  3KO0 A;  1V1F A;  4DRW A;  1A75 A;  1A2X A;  4PE0 A;  1CTR A;  1QX5 B;  2MA2 A;  1QLK A;  3EVV A;  1IKU A;  2LMU A;  1IQ5 A;  4PDZ A;  1TNQ A;  2OTG C;  2PAS A;  3KHE A;  1J7R A;  4CID A;  1BLQ A;  1B1G A;  4GGF A;  1SNL A;  2O60 A;  4I5K A;  1UP5 A;  2BL0 C;  1E8A A;  2KFF A;  2QPT A;  2K7D A;  1OMD A;  4AQI A;  2SAS A;  2O5G A;  1MF8 B;  5BPJ A;  2KQY A;  3D10 A;  4DCK A;  4R1E A;  5AFP A;  2WC8 A;  1CMF A;  1YVH A;  1KK7 Z;  2M9G A;  1SR6 C;  5AAN A;  1H4B A;  4I5L B;  1IGV A;  2MJW B;  3D0Y B;  2FJU B;  3BOW B;  1FF1 A;  2I94 A;  2CXJ A;  2LVV A;  1PSR A;  4GNK B;  2JPT A;  1IQ3 A;  1RJV A;  1F54 A;  3ICB A;  1FI6 A;  2ZRS A;  2H61 C;  5AER A;  4WRI A;  2H2K A;  3KEV A;  4ZCV A;  3RM1 A;  4YI9 A;  2Q4U A;  1J7Q A;  4MLW A;  3BUN B;  3EVU A;  1BF5 A;  4C0L A;  2WCF A;  1PVA A;  2P6B B;  4C0K A;  3CZT X;  4PAL A;  4YGA A;  2K7C A;  3I5F B;  1KQM B;  3KPX A;  5K89 A;  1DJZ A;  1SL9 A;  2BKH B;  3AAK A;  1Q80 A;  1DF0 B;  3AKA A;  1OMR A;  1DJI A;  1DT7 B;  4PCW A;  5I2Q A;  1NX3 A;  2BKI B;  3AKB A;  3I5I B;  3I5G B;  4MZK A;  2EC6 C;  1NX2 A;  4CPV A;  1WY9 A;  3NXA A;  2OS8 B;  1QXP A;  2K7B A;  2BE4 A;  1BR1 B;  1CLB A;  1JBA A;  2LMT A;  2K2F A;  2WCE A;  3AAJ A;  1YTZ C;  4OV2 A;  2K61 A;  2NCP A;  3GK1 A;  4HSZ A;  1KSO A;  2LC5 A;  3SG6 A;  2E6W A;  3IF7 A;  2WCB A;  1SCV A;  1AK8 A;  1TCO B;  2M97 A;  2ISD A;  4WQ2 A;  1LIN A;  2LVJ A;  5HKZ A;  1LA3 A;  2MBX A;  1BG1 A;  2AMI A;  2FCD A;  1F4O A;  1SCM C;  2M0R A;  5DKR A;  4I5N B;  2LAN A;  4HRH A;  4IL1 A;  2JTZ A;  1KK8 B;  1BOC A;  1A75 B;  1JUO A;  4NQG A;  3SG5 A;  4CFQ A;  2LVK A;  5PAL A;  5IBW A;  3TUY C;  3PAL A;  2JQ6 A;  1B47 A;  3CLN A;  1TOP A;  2F8P A;  1YRU B;  3VRR A;  3O78 A;  4YGB B;  5CSJ A;  2LMV A;  1SY9 A;  5CSN A;  2F2O A;  1XFU O;  2KI4 B;  5D69 A;  1AUI B;  3DVJ A;  1S36 A;  1WDC C;  1YVL A;  1RK9 A;  4JQ0 D;  1EH2 A;  2MLE C;  1F71 A;  2L0P A;  3OX6 A;  3WHT B;  1Y6W A;  1G4Y R;  1KFU S;  1UUR A;  3PLF B;  4NDC A;  4MSP A;  1PSB A;  2ZKM X;  1K9P A;  2WOR A;  1QJT A;  5HYD A;  2GGZ A;  4BY5 A;  1M31 A;  2M1K B;  3DF0 A;  2KNE A;  1CB1 A;  5AEQ A;  3IQQ A;  1D1O A;  1NCX A;  1C7W A;  5B8I B;  5DKN A;  2JT8 A;  2VRG A;  1UHI A;  1NIW A;  1RWY A;  2DOQ A;  4M2Q A;  2Y1N A;  1TNW A;  1U5I A;  1KK7 Y;  2JNF A;  3TS5 B;  3F45 A;  1ALV A;  1KFX S;  4YGE B;  1MR8 A;  1UHN A;  1V1G A;  1CKK A;  1CDL A;  1MXE A;  1K94 A;  1MUX A;  2CT9 A;  1BT6 A;  1QV0 A;  3TZ1 A;  1L7Z A;  2BE6 A;  1CLM A;  2WND A;  2KOT A;  3GOF A;  1R6P A;  3JVT C;  5JJG A;  1B8C A;  4ZCU A;  4XYN A;  1CM4 A;  4OVN F;  1A29 A;  1WRL A;  1J55 A;  2CCM A;  2JTT A;  1G8I A;  1L2O B;  2KYC A;  3VRN A;  1F70 A;  3OB1 B;  1CM1 A;  1IRJ A;  2NXQ A;  3PM8 A;  3PN7 B;  1OOJ A;  4PHN A;  4XJK A;  4YI8 A;  1YUR A;  2HF5 A;  1AJ5 A;  2RGI A;  4M2P A;  1B8L A;  4ORB B;  3E3R A;  1F8H A;  1FBV A;  1LKJ A;  3H4S E;  3I5H B;  4E68 A;  3HX4 A;  3MSE B;  2Y4Q A;  2KI6 D;  1B7T Z;  2KQ6 A;  2AUC A;  4L9M A;  1GGW A;  3PAT A;  3CS1 A;  1MXL C;  5KTY A;  1B4C A;  2JRF A;  2SCP A;  3SG3 A;  1M45 A;  5KU1 A;  1BJF A;  2PRU A;  1XFY O;  2LNK A;  3FWC A;  1G33 A;  3TDI A;  1BMO A;  1ODB A;  2BCA A;  2IS9 A;  2LLU A;  1QLS A;  1XFW O;  2E30 A;  3WHU B;  4BY4 A;  1XK4 C;  5I2L A;  1XO5 A;  3OHM B;  3I5F C;  1KQM C;  4A4C A;  3TDZ A;  1K95 A;  1WRK A;  2Q91 A;  5TNC A;  1K8U A;  2JZI A;  1TIZ A;  1H8B A;  5G08 A;  1QVI Z;  1K9K A;  4P2Y B;  3RLZ A;  1NYA A;  1GGZ A;  1NCY A;  3SG4 A;  1DGV A;  4YGD B;  1SL7 A;  2ZFD A;  2LUC A;  2L2E A;  1DVI A;  2KI6 C;  1RFJ A;  4F0Z B;  4PHJ A;  2F3Z A;  1TNP A;  1MHO A;  1YX7 A;  3I5I C;  3I5G C;  5ER5 A;  2OS8 C;  1W7I B;  2F3Y A;  3DD4 A;  4HRE E;  1Y1X A;  2BBM A;  2OPO A;  3SIA A;  2LM5 A;  4D1E A;  3GK4 X;  4WQ3 A;  1KSM A;  2HQW A;  4NDD A;  2JNX A;  2M1U A;  1OE9 B;  1RRO A;  3BUO B;  2ZN9 A;  1K96 A;  1TRF A;  1JF2 A;  4PE7 A;  4M2O A;  2BCB A;  1NSH A;  1M63 B;  2GGM A;  4DS7 A;  2D8N A;  1UHJ A;  2JXL A;  2MRD A;  1QV1 A;  2M8U A;  1ZAC A;  1UHH A;  2PSR A;  2WOS A;  3O4Y A;  1TN4 A;  2BEC A;  1J7P A;  2LVI A;  1K90 D;  4PHM A;  1K2H A;  2K0J A;  2NCO A;  1N2D A;  1K9U A;  1CDN A;  1TTX A;  2FOT A;  2M3W A;  1QIW A;  4AOM A;  1K93 D;  1KK8 C;  1C7V A;  1GJY A;  4ETO A;  2I2R E;  2F33 A;  1W7J B;  3FIA A;  2H61 A;  5CSI A;  2LHI A;  3LK1 A;  2A4J A;  3TDU A;  3SG2 A;  1HQV A;  3ZNI A;  2LLS A;  4GGF C;  4YBH B;  3CTN A;  2JXC A;  2KI4 C;  4A4B A;  2JOJ A;  4JWQ A;  1IJ6 A;  4QJ3 B;  4XJK B;  2R2I A;  1X02 A;  3BUX B;  1JSA A;  1J1E A;  5I2O A;  1S3P A;  4MBE A;  4OKH A;  3DVE A;  2EGD A;  1YUT A;  1N65 A;  2KBI A;  2MHH A;  1S5G Y;  4GPL B;  4GAO A;  1CDM A;  3WNX B;  1ALW A;  2L4H A;  1MQ1 A;  2KFH A;  3PFV A;  3TUY B;  2QAC A;  4UPG A;  1A03 A;  1DJY A;  4ORA B;  1BOD A;  2ZND A;  2CBL A;  1SW8 A;  2M7L A;  3JTD B;  1VRK A;  1PVB A;  1KFX L;  4GFT A;  3EK7 A;  2F2P A;  1DJH A;  4I5J A;  3ZWH A;  2KSP A;  2NLN A;  2LP3 A;  5ER4 X;  3TS5 C;  2LHL A;  1JFJ A;  4FQO A;  3EK4 A;  1PUL A;  1NP8 A;  1B7T Y;  2KGR A;  1WLZ A;  1N0Y A;  2EHB A;  1S6I A;  1DMO A;  1KQV A;  1SRA A;  4OR9 B;  2LUX A;  4MEW A;  1FI5 A;  3VGO A;  1XFV O;  3WXA A;  4TNC A;  1Y1A A;  1JC2 A;  1QIV A;  1S5G Z;  2LAP A;  3PSR A;  5HKW A;  1JWD A;  3LLE A;  4FTG A;  3LL8 B;  2HPS A;  1Y0V H;  1EXR A;  4MVF A;  1L2O C;  1AHR A;  1QS7 A;  2BBN A;  4OCI A;  1KWO B;  3QRX A;  1XA5 A;  2L51 A;  2V53 A;  1WLM A;  3OB2 B;  1QVI Y;  1SL8 A;  2HQ8 A;  1SK6 D;  1Y1U A;  2L98 A;  3EKJ A;  2OTG B;  3EKH A;  2LLT A;  1CNP A;  4C0J A;  4PE4 A;  1QTX A;  3I5H C;  4CLN A;  2L50 A;  2KDH A;  1ZOT B;  3EVR A;  3A4U B;  1SMG A;  1CLL A;  2BL0 B;  3M0W A;  1XFX O;  5D7F A;  4AQJ A;  1HT9 A;  4PE1 A;  1NX0 A;  2LCP A;  1SKT A;  1DTL A;  1MWN A;  1WRZ A;  1CFD A;  3DVK A;  1SR6 B;  1F55 A;  3K21 A;  1LVC D;  1XFZ O;  2PVB A;  1FPW A;  1QX2 A;  3NSI A;  3BUM B;  4DIR A;  1DJW A;  2M49 B;  5CSF A;  2K8M B;  1ZUZ A;  2ZNE A;  5AXI A;  3A8R A;  4N1G A;  2NZ0 A;  1PK0 D;  1QAS A;  4YRU A;  2COL B;  1NWD A;  2I18 A;  4N5X A;  1SBJ A;  3CR2 A;  2KBM A;  3VRO A;  1F4Q A;  1GQM A;  1UWO A;  4MRY A;  3CR5 X;  3DVM A;  1AP4 A;  1UUS A;  4DUQ A;  1XYD A;  3HCM A;  5HLV A;  1M39 A;  3EK8 A;  2FCE A;  1QAT A;  1QX7 A;  2KAX A;  3DF0 B;  4YGC B;  1SYM A;  1PAL A;  1UHK A;  1ZMZ A;  1S1E A;  2JU0 A;  1BU3 A;  4QJ4 B;  2KYF A;  5HKY A;  1NX1 A;  1JFK A;  3SG7 A;  2JWW A;  1CDP A;  1RTP 1;  3GK2 A;  3NSK A;  2KGB C;  3C1V A;  1U5I B;  1OQP A;  2MLF C;  2EC6 B;  4MRX A;  4PHK A;  5F6T A;  1YUS A;  2G2B A;  2PAL A;  1M46 A;  1OMV A;  2L4I A;  1J1D A;  2G9B A;  2LV7 A;  1AJ4 A;  4USL A;  5J3X A;  3SIB A;  2LP2 A;  1DGU A;  1PRW A;  3IQO A;  4GUK A;  2CNP A;  1CFP A;  1DJG A;  3VRP A;  1CFF A;  3D0Y A;  4U8D A;  3BOW A;  1FW4 A;  1S6C A;  3OX5 A;  1BR4 B;  4ICB A;  1EL4 A;  4MZJ A;  2Y1M A;  4HRG A;  1J7O A;  4Q04 A;  1KFU L;  5FYX A;  1IJ5 A;  1OZS A;  2KHN A;  3FS7 A;  3KF9 A;  1TNX A;  1SCM B;  2ZRT A;  3OP0 A;  1JF0 A;  2AAO A;  1B8R A;  1EG4 A;  1YR5 A;  1KCY A;  1XK4 A;  2B1U A;  5JOL A;  1REC A;  3BUW B;  1IWQ A;  4N1F A;  1ZFS A;  2BCX A;  1CFC A;  2JT0 A;  5I8N A;  1YX8 A;  5CPV A;  1AVS A;  2LE9 B;  3LCP C;  1NPQ A;  1SPY A;  3O2P A;  4P5O E;  1C07 A;  2K7O A;  1R2U A;  1YRT B;  2MAZ A;  1DF0 A;  2K2A A;  2JUL A;  1WDC B;  2JT3 A;  5HLO A;  2JC2 A;  4GGN A;  2I7A A;  1EJ3 A;  3O6B A;  3JTD C;  1S6J A;  2KAV A;  2HET A;  2Y5I A;  1TCF A;  5GQQ C;  4JPZ B;  1EG3 A;  1CMG A;  2TN4 A;  2M7N A;  4GBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...