3PSRA

Human psoriasin (s100a7) ca2+ bound form (crystal form i)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSORIASIN
publication title Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ef-hand protein
total genus 36
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3psrA00
2JC2A 1C07A 1AVSA 1SBJA 2KFGA 3I5IC 1DMOA 4GGFA 5JOLA 1UUSA 1SRAA 1B7TZ 1TNPA 2KYCA 3BUWB 3LK0A 1JUOA 1MQ1A 1B7TY 2PMYA 1KSOA 2GGMA 3PSRA 1PSRA 3RLZA 3VRNA 4ORBB 1KFUS 4OCIA 1SMGA 4ORAB 4CFQA 1DJYA 2HF5A 2MBXA 3ICBA 5HKZA 2ZKMX 1KCYA 5CSFA 3IF7A 4AQIA 3HX4A 1L7ZA 4GUKA 4ZCUA 2LAPA 5KU1A 1JFKA 1OMVA 2HQWA 2NZ0A 2NLNA 2Q91A 2LVIA 2NCOA 3FS7A 2JT3A 2L5XB 3TUYB 2I18A 1BODA 3C1VA 3CR2A 3LK1A 4WQ2A 2L98A 4N5XA 2M0RA 2SASA 1XK4A 1BU3A 1QIVA 1UWOA 1CDLA 1BR1B 3VRRA 1NCXA 3GK1A 1CFPA 1NX0A 1XK4C 2H61C 3GK4X 3SG5A 3DVEA 3PLFB 1ZFSA 1ALVA 3EVUA 4FQOA 1YVHA 4MEWA 1UHKA 1K95A 2EGDA 4M2PA 1KFUL 3PN7C 1LVCD 1RTP1 1W7IB 1WY9A 1DJXA 3TUYC 1F71A 2CT9A 1PRWA 2LLSA 3DF0A 1KK7Z 1NIWA 3BUOB 1KK7Y 2K61A 1S26D 2E6WA 1DJGA 2VRGA 3FIAA 4GPLB 2O5GA 2CTNA 1RK9A 4C0LA 2LP2A 2WORA 1TCOB 2Y5IA 2BCAA 1BJFA 3OB2B 5JJGA 2LC5A 3VGOA 1NX3A 2FCDA 1SR6C 4C0KA 1C7WA 3A8RA 1WRKA 2OTGC 3WHTB 3M0WA 3SG6A 1S3PA 3D0YA 3NSKA 2G9BA 1PSBA 4PHJA 2BECA 2MAZA 4I5NB 5CPVA 1EJ3A 2WCBA 2HETA 2MLEC 4HRGA 1CFCA 3IQOA 2K8MB 1QV1A 4PE1A 1XVJA 2FOTA 2K2FA 2M49B 4M2OA 1XFWO 1ZOTB 1Y6WA 1ZACA 1XFYO 5PALA 1Y1UA 2JTTA 1K93D 1CB1A 2KAXA 3CZTX 4NDDA 3SG2A 4DCKA 2JPTA 1NUBA 3SG4A 1MHOA 2Y4QA 1FW4A 1TOPA 5KSZA 1BG1A 1KQVA 5DKRA 1QLKA 2KI4B 2WOSA 1MF8B 1CKKA 1DF0B 3I5HB 5KTYA 1XFUO 1MXLC 3OP0A 2K7CA 1QLSA 2KGBC 4OV2A 1DJIA 1JC2A 4GBAA 3H4SE 3BOWB 1EG4A 4YGCB 1CLMA 2KAVA 1QX7A 1J7QA 1VRKA 1S5GZ 1HQVA 3WHUB 1SCMB 1S5GY 5ER4X 5J3XA 1TTXA 2ISDA 2ZN9A 1PULA 1BLQA 3TDUA 1M45A 1QJTA 1CLBA 2JOJA 1OMDA 3EK8A 4PHMA 3O4YA 5CSNA 2KI4C 3CGAA 1HT9A 5I8NA 1EL4A 3I5HC 2KFFA 2M7NA 2KHNA 2JU0A 1UHIA 2BL0B 3F45A 3CLNA 3KF9A 3O78A 1SCMC 3BUXB 2K7OA 3I5FB 1IQ5A 5IBWA 2PSRA 1LINA 4FTGA 2KI6C 2PALA 4USLA 4N1FA 1U5IB 1XA5A 2IS9A 1R6PA 2KI6D 3EK7A 5K89A 2BE4A 2CXJA 1Y1AA 1CLLA 1EH2A 4GGFC 3SIAA 2I2RE 1F55A 3PALA 2BL0C 1KWOC 2ZFDA 4JPZB 2B1UA 3TS5C 1RWYA 2BBMA 1XYDA 3ZNIA 3SG3A 3I5FC 1F70A 4I5KA 1YX7A 1QXPA 2KDHA 1NPQA 2WC8A 1U5IA 4U8DA 1A4PA 2LHIA 2MLFC 1SCVA 1S6CA 4PALA 5G08A 1SW8A 4GGNA 1ODBA 2PVBA 2JNXA 2L0PA 1G4YR 1NYAA 2JWWA 1A29A 5DKNA 4QJ5B 1CDMA 2LLTA 2G2BA 4MZLA 3DF0B 3LLEA 5HLOA 4MVFA 1SL8A 1CMGA 1F4OA 4MZKA 4YI8A 4DUQA 2JQ6A 1F4QA 4C0JA 3E3RA 5GQQC 2COLB 4BY5A 3TDIA 2KBIA 1PVBA 3OHMB 4PE4A 1FI5A 1IG5A 1CDPA 1TN4A 2FJUB 2LCPA 1YRUB 1ZUZA 2H2KA 1JF0A 4IL1A 3EVVA 3D0YB 1LA0A 1D1OA 4HRHA 3TDZA 1CNPA 1DJHA 3OB1B 4ORCB 2A4JA 2LV7A 4DIRA 5HKWA 2M29A 1OZOA 4A4CA 3VROA 1R2UA 5AERA 4ZCVA 2WCEA 4I5JA 1B4CA 2OPOA 1G8IA 3MSEB 5HLVA 4PCWA 4YGBB 1NCZA 1QX5B 1S6JA 1SL9A 1F8HA 3NSLA 1WRZA 1DJZA 3SG7A 2M9GA 1S6IA 1F54A 1J7RA 2F2OA 2KYFA 2LMVA 3BUMB 1X02A 3JVTB 1Q80A 2V53A 1QIWA 5ER5A 1ALWA 4MN0A 4OR9B 2D8NA 2GV5A 1NSHA 2NCPA 1OOJA 1SPYA 2GGZA 2KSPA 4L9MA 1JBAA 1V1GA 2Y1NA 2KGRA 4R1EA 1QATA 2JT8A 1PALA 4CFRA 5AANA 2M8UA 4NDCA 1XO5A 3AAJA 1G33A 2HPSA 2ZN8A 2R2IA 3ZWHA 1IQ3A 1M46A 1UURA 1J7OA 2WCFA 2WNDA 1AP4A 2MRDA 2M7LA 2JXCA 3SIBA 2ZNEA 4GNKB 4N1GA 4AOMA 1CM4A 2KAYA 2M1KB 1K94A 4YRUA 1AHRA 3RM1A 2JZIA 2JTZA 1OSAA 1AK8A 4E68A 2EHBA 1W7JB 1M31A 3IQQA 4GAOA 2LHLA 2PRUA 4QJ3B 1JSAA 4HREE 2SCPA 2TN4A 3PM8A 4XJKB 1UHHA 4D1EA 3FWCA 2L2EA 1XFVO 1UHNA 4NQGA 3LCPC 2KNEA 5BPJA 2JULA 1TNQA 2KOTA 2P6BB 2QACA 3BXKA 3CWGA 4GFTA 2CNPA 1WRLA 3K21A 1LKJA 3JTDB 3O6BA 1UP5A 2PASA 3KHEA 5FYXA 5D69A 3WXAA 2F3ZA 2M1UA 1L2OB 4NDBA 3HCMA 2AMIA 1KFXS 1IRJA 2Y1MA 4XJKA 2KFHA 5DKQA 2BBNA 1WLZA 1YUSA 1IJ5A 1KQMB 2RGIA 2NXQA 4ETOA 1XFZO 1K8UA 1H4BA 1M63B 1BT6A 1A03A 1CDNA 3KEVA 1GGWA 2I94A 3FWBA 1DGUA 1XFXO 1PVAA 4P5OE 1YTZC 1M39A 2EC6B 1RECA 4YGDB 5AFPA 1A75B 1B9AA 2F8PA 1L2OC 1IGVA 2K7DA 2E30A 3D10A 1MUXA 1FBVA 2K2AA 2K0JA 2I7AA 1BF5A 1QX2A 1K2HA 3NXAA 4CPVA 5HYDA 1KQMC 1GJYA 1QV0A 1MXEA 1IWQA 1Y1XA 2LM5A 3CS1A 4WQ3A 2L50A 4MLWA 4PHKA 4CIDA 2BKHB 1A75A 1KFXL 2LMUA 4PHNA 3SJSA 1K90D 1NX2A 2EC6C 3CR5X 1DJWA 1YVLA 1IH0A 4MBEA 1DVIA 1AUIB 1AJ5A 1WDCB 3EK4A 3PN7B 4ICBA 2JNFA 1H8BA 4OVNF 4WRIA 1SKTA 4TNCA 2LUCA 5TNCA 1CFFA 3DVKA 2HQ8A 1TNXA 1B8LA 1YRTB 4HSZA 1OZSA 3LL8B 3BQ3A 4JWQA 4F0ZB 2H61A 3A4UB 1QTXA 5I2LA 4BY4A 1J7PA 1IKUA 1K9PA 1NWDA 3EKHA 2BCXA 1J55A 1K96A 1SL7A 2JXLA 1K9KA 1SR6B 2F33A 3BYAA 3DVJA 1YR5A 2BKIB 1WDCC 2OTGB 3I5GB 4MSPA 1RJVA 2KQ6A 3VRQA 3DD4A 5CSJA 5F6TA 3AAKA 1J1DA 4M2QA 1BOCA 4MRXA 2ZRSA 3EVRA 1EG3A 4AQJA 2JRFA 2QPTA 5I2QA 2LNKA 1PK0D 2LVVA 1SNLA 2LVJA 2ZRTA 1MWNA 1KSMA 1QVIZ 1N0YA 1QVIY 2KBMA 4YBHB 1C7VA 1OMRA 1DGVA 1WLMA 1JWDA 4OKHA 3KO0A 2AAOA 3OX6A 2LANA 2LMTA 4QJ4B 4YI9A 2BCBA 2KQYA 4P2YB 4Q04A 1DT7B 3KPXA 3I5GC 1B8RA 1KK8B 3EKJA 1RROA 1J1EA 5AXIA 3GK2A 2CBLA 2MHHA 4MRYA 2LE9B 4A4BA 3JVTC 1B1GA 2OS8B 4XYNA 1CM1A 1SK6D 5HKYA 1QASA 1ZMZA 2MJWB 2LUXA 1OE9B 1S36A 2JT0A 4MZJA 2L4IA 1B8CA 2CCMA 4PE0A 1YX8A 2LVKA 1SY9A 1V1FA 2Q4UA 3CR4X 3PFVA 1NX1A 5D7FA 3BUNB 4YGEB 2F2PA 1A2XA 4JQ0D 1FPWA 1KK8C 1GQMA 1GGZA 3VRPA 3PATA 1UHJA 1NP8A 2FCEA 3DVMA 5B8IB 2F3YA 1CMFA 1B47A 2OS8C 1YURA 1K9UA 1NCYA 1YUTA 4UPGA 2ZNDA 2BE6A 1RFJA 4YGAA 1TRFA 1CFDA 5CSIA 3GOFA 3NSIA 1N2DA 3TZ1A 2LLUA 1MR8A 4CLNA 3NSOA 3OX5A 1E8AA 2L51A 2L4HA 3QRXA 1EXRA 1LXFC 2AUCA 3I5IB 1DF0A 4DRWA 1IJ6A 1JFJA 3O2PA 2M3WA 1Y0VH 1AJ4A 1FI6A 3BOWA 5I2OA 2M97A 4PE7A 1BMOA 1SYMA 1LA3A 3AKAA 2O60A 1FF1A 4I5LB 2LP3A 1TCFA 1QS7A 1KWOB 3AKBA 3CTNA 4PDZA 2K7BA 1JF2A 3TS5B 4DS7A 3WNXB 1DTLA 2MA2A 5AEQA 1YUUA 1OQPA 1S1EA 2DOQA 1CTRA 1N65A 1TNWA 1BR4B 3JTDC 1TIZA
chains in the Genus database with same CATH superfamily
2JC2A 1C07A 4INWA 1AVSA 1SBJA 2KFGA 3I5IC 1DMOA 4GGFA 1Z2CB 5JOLA 1UUSA 1SRAA 1B7TZ 1TNPA 2KYCA 3BUWB 3LK0A 1JUOA 1MQ1A 1B7TY 2PMYA 1KSOA 2GGMA 3PSRA 1PSRA 2YGUA 3RLZA 3VRNA 2ERBA 1KFUS 3OBVA 1SMGA 4OCIA 4ORBB 1DJYA 2HF5A 4ORAB 3ICBA 2MBXA 5HKZA 2ZKMX 3DY9A 1IIOA 3NGVA 1KCYA 5CSFA 2P71A 3IF7A 4AQIA 3HX4A 1L7ZA 4GUKA 4ZCUA 1XFRA 2LAPA 5KU1A 1JFKA 1OMVA 2HQWA 5FI6A 2NZ0A 2NLNA 2Q91A 3SS5A 2LVIA 3QMEA 2L2CA 3NHIA 2NCOA 3FS7A 2JT3A 2L5XB 3TUYB 2I18A 1BODA 1SSEB 3C1VA 3CR2A 3LK1A 4WQ2A 2L98A 4N5XA 3D74A 2M0RA 2SASA 1XK4A 1LS8A 1BU3A 1QIVA 1UWOA 1CDLA 1BR1B 3VRRA 1NCXA 3GK1A 1CFPA 1NX0A 3RZSA 3OGNA 1XK4C 2H61C 2WC6A 3GK4X 2H8VA 3SG5A 3DVEA 3PLFB 1ZFSA 1ALVA 3EVUA 4FQOA 1YVHA 4MEWA 1UHKA 1K95A 2EGDA 4M2PA 1KFUL 3PN7C 3Q8IA 1LVCD 1RTP1 1W7IB 1WY9A 1DJXA 3TUYC 1F71A 2CT9A 1PRWA 2LLSA 3DF0A 2KLEA 1KK7Z 1GM0A 1NIWA 3BUOB 1KK7Y 2K61A 1S26D 2E6WA 1DJGA 2VRGA 3FIAA 4GPLB 2O5GA 2CTNA 1RK9A 4C0LA 2LP2A 2WORA 1TCOB 2Y5IA 1ORGA 2BCAA 1BJFA 1T14A 3OB2B 5JJGA 2LC5A 3VGOA 1NX3A 2FCDA 1SR6C 2WCJA 4C0KA 1C7WA 3A8RA 1WRKA 2OTGC 3WHTB 3M0WA 3SG6A 1S3PA 3D0YA 3NSKA 2G9BA 3CZ2A 1PSBA 4PHJA 2BECA 2MAZA 4I5NB 5CPVA 1EJ3A 2WCBA 2HETA 2MLEC 4HRGA 1CFCA 3IQOA 2K8MB 1QV1A 4FQTA 1TUJA 4PE1A 3IVTA 1XVJA 2FOTA 2K2FA 2M49B 4M2OA 1XFWO 3L47A 1ZOTB 1Y6WA 1ZACA 1XFYO 5PALA 1TWOA 1Y1UA 2JTTA 1K93D 1CB1A 2KAXA 3CZTX 4NDDA 3S0GA 3SG2A 4DCKA 2JPTA 3D75A 1NUBA 3SG4A 1MHOA 2Y4QA 1FW4A 1TOPA 3O4XA 5KSZA 1BG1A 1KQVA 5DKRA 1QLKA 2KI4B 2WOSA 1MF8B 1CKKA 1DF0B 3I5HB 5KTYA 1XFUO 1MXLC 3OP0A 2K7CA 4PT1A 1QLSA 2KGBC 4OV2A 1DJIA 1JC2A 4GBAA 3H4SE 3BOWB 1EG4A 4YGCB 1CLMA 2KAVA 1QX7A 1J7QA 1VRKA 1S5GZ 1HQVA 2JPOA 3WHUB 1SCMB 1S5GY 5ER4X 5J3XA 1TTXA 2ISDA 2ZN9A 1PULA 1BLQA 3TDUA 5DICA 1M45A 1QJTA 1CLBA 5FI2A 2PYQA 2JOJA 1OMDA 3EK8A 1OOIX 4PHMA 3O4YA 5CSNA 2KI4C 3CGAA 1HT9A 5I8NA 1EL4A 3I5HC 2KFFA 1C3ZA 2M7NA 2KHNA 2JU0A 1UHIA 2BL0B 2QEHA 3F45A 3CLNA 3KF9A 3O78A 1SCMC 3BUXB 1TUZA 2K7OA 3FE9A 3I5FB 1IQ5A 5IBWA 2PSRA 1LINA 3L4LA 4FTGA 2KI6C 2PALA 4IJ7A 4USLA 3BFAA 4N1FA 1U5IB 1XA5A 2IS9A 1R6PA 2KI6D 3EK7A 5K89A 2BE4A 2CXJA 1Y1AA 1CLLA 2QEOA 1EH2A 3CDNA 4GGFC 3D77A 3SIAA 2I2RE 2BNXA 1F55A 3PALA 2BL0C 2WCKA 1KWOC 2ZFDA 3R1OA 4JPZB 2B1UA 3TS5C 1RWYA 2BBMA 1XYDA 2WCMA 3ZNIA 3S0BA 3SG3A 3I5FC 1F70A 5EL2A 4I5KA 1C3YA 1YX7A 1QXPA 2KDHA 1NPQA 2WC8A 1U5IA 4U8DA 1A4PA 2LHIA 2MLFC 1SCVA 1S6CA 4PALA 5G08A 1SW8A 4GGNA 1ODBA 2PVBA 2JNXA 2L0PA 1G4YR 1NYAA 2JWWA 1A29A 5DKNA 4QJ5B 1CDMA 3L4AA 2LLTA 2G2BA 4MZLA 3EG5B 3DF0B 3LLEA 5HLOA 4MVFA 1SL8A 1CMGA 1F4OA 4MZKA 4YI8A 3UNWA 2JQ6A 4DUQA 3B88A 1F4QA 4C0JA 3SS3A 3E3RA 5GQQC 2COLB 4BY5A 2P70A 3TDIA 2KBIA 1PVBA 3OHMB 4PE4A 3S0EA 1FI5A 1IG5A 1CDPA 1TN4A 2WCHA 3DYEA 3R1VA 2FJUB 4CFQA 3S0FA 2LCPA 1YRUB 1ZUZA 2WC5A 2H2KA 1JF0A 4IL1A 3EVVA 1QWVA 3D0YB 1LA0A 1D1OA 4HRHA 3TDZA 1CNPA 1DJHA 3OB1B 4ORCB 2A4JA 2LV7A 3D73A 2K60A 5HKWA 4DIRA 2M29A 1OZOA 4A4CA 3VROA 1R2UA 5AERA 4ZCVA 2WCEA 4I5JA 3BFHA 1B4CA 2OPOA 1G8IA 3MSEB 5HLVA 4PCWA 4KYNA 3R1PA 1NCZA 1QX5B 1OOHA 1S6JA 1SL9A 4YGBB 1F8HA 3NSLA 1WRZA 1DJZA 3SG7A 2M9GA 1S6IA 1F54A 1J7RA 2F2OA 2KYFA 2LMVA 3BUMB 1X02A 3N7HA 3JVTB 1Q80A 2V53A 1QIWA 5ER5A 3D76A 1ALWA 3B6XA 4MN0A 4OR9B 2D8NA 2GV5A 1NSHA 2NCPA 1OOJA 1SPYA 2GGZA 2KSPA 2PQLA 2WCLA 4L9MA 1V1GA 3UO9A 1JBAA 2Y1NA 3BJHA 1Z4HA 2KGRA 4R1EA 1QATA 2JT8A 1PALA 4CFRA 5AANA 2M8UA 4NDCA 1XO5A 3AAJA 1G33A 2HPSA 2ZN8A 2R2IA 3ZWHA 1IQ3A 1M46A 1UURA 1J7OA 2WCFA 2WNDA 3CZ1A 1AP4A 2MRDA 2M7LA 2JXCA 3SIBA 2ZNEA 4GNKB 4N1GA 4AOMA 1CM4A 2KAYA 2M1KB 1K94A 4YRUA 1AHRA 3RM1A 2JZIA 2JTZA 1OSAA 1AK8A 4E68A 2EHBA 2KLDA 3K1EA 1W7JB 3CYZA 1M31A 3IQQA 4GAOA 2LHLA 2PRUA 4QJ3B 3B86A 1JSAA 4HREE 2SCPA 2TN4A 3PM8A 4XJKB 1UHHA 4D1EA 3FE8A 3FWCA 2L2EA 1XFVO 1UHNA 3B7AA 3LCPC 2KNEA 4NQGA 5BPJA 2JULA 1TNQA 2KOTA 2P6BB 2QACA 3BXKA 3CWGA 4GFTA 2CNPA 1WRLA 3K21A 1LKJA 3JTDB 3O6BA 1UP5A 2PASA 3KHEA 5FYXA 5D69A 3WXAA 2F3ZA 2M1UA 1L2OB 4NDBA 3HCMA 2AMIA 1KFXS 1IRJA 2Y1MA 3CZ0A 2KFHA 4XJKA 5DKQA 2BBNA 3V2LA 1WLZA 1YUSA 1IJ5A 1KQMB 1W9ZA 2BAPA 2RGIA 2NXQA 4ETOA 1XFZO 3B87A 3CABA 3D78A 1K8UA 3S0AA 1H4BA 1M63B 2QEVA 4JD9A 1BT6A 1A03A 1CDNA 3KEVA 1GGWA 2I94A 3FWBA 1DGUA 1XFXO 1PVAA 4P5OE 1YTZC 1M39A 2EC6B 1RECA 4YGDB 5AFPA 1A75B 3VB1A 1B9AA 2F8PA 1L2OC 1IGVA 2K7DA 2E30A 2QDIA 1MUXA 1FBVA 2K2AA 2K0JA 3D10A 5I94A 2I7AA 1BF5A 1QX2A 1K2HA 3NXAA 4CPVA 5HYDA 1KQMC 4JKTA 1GJYA 1QV0A 1MXEA 1IWQA 1Y1XA 2FJYA 2LM5A 3CS1A 4WQ3A 2L50A 4MLWA 4PHKA 4CIDA 1A75A 1KFXL 2BKHB 2LMUA 4PHNA 3SJSA 1K90D 3BFBA 1NX2A 2EC6C 3CR5X 1DJWA 1YVLA 1IH0A 4MBEA 1DVIA 1AUIB 1AJ5A 1WDCB 3EK4A 3PN7B 4ICBA 2JNFA 3FE6A 1H8BA 4OVNF 4WRIA 1SKTA 4TNCA 2LUCA 5TNCA 1CFFA 3DVKA 2HQ8A 1DELA 1TNXA 1B8LA 1OW4A 1YRTB 4HSZA 1OZSA 3SS4A 3LL8B 3BQ3A 4JWQA 4F0ZB 2H61A 3A4UB 1QTXA 5I2LA 4OZDA 2L5YA 4BY4A 1J7PA 1IKUA 1K9PA 1NWDA 3EKHA 2BCXA 1J55A 1K96A 1SL7A 2JXLA 3PM2A 1K9KA 1SR6B 2F33A 3BYAA 3DVJA 1YR5A 2BKIB 1WDCC 2OTGB 3I5GB 4MSPA 1RJVA 2KQ6A 3VRQA 3DD4A 5CSJA 5F6TA 3AAKA 3S0DA 1J1DA 4M2QA 1BOCA 4MRXA 2ZRSA 3EVRA 1EG3A 4AQJA 2JRFA 2QPTA 5I2QA 2LNKA 1PK0D 2LVVA 1SNLA 2LVJA 2ZRTA 1MWNA 1KSMA 1QVIZ 1N0YA 1QVIY 2KBMA 3DXLA 4YBHB 5FI7A 5HL1A 1C7VA 1OMRA 1DGVA 3R72A 1WLMA 1JWDA 4OKHA 3KO0A 2AAOA 3OX6A 2LANA 2LMTA 4QJ4B 4YI9A 2BCBA 2KQYA 4P2YB 4Q04A 1DT7B 3KPXA 3I5GC 1B8RA 1KK8B 3EKJA 1RROA 2GTEA 1J1EA 5AXIA 3GK2A 2CBLA 2MHHA 4MRYA 2LE9B 4A4BA 3JVTC 1B1GA 2OS8B 1DC1A 4XYNA 1CM1A 1DQEA 1SK6D 1P28A 3NHTA 5HKYA 1QASA 1ZMZA 2MJWB 2LUXA 1OE9B 1S36A 2JT0A 4MZJA 2L4IA 1B8CA 2CCMA 4PE0A 1YX8A 2LVKA 1SY9A 1V1FA 2Q4UA 3CR4X 3PFVA 1NX1A 5D7FA 3BUNB 5D3OA 4YGEB 2F2PA 1A2XA 4JQ0D 1FPWA 1KK8C 1GQMA 1GGZA 3VRPA 3PATA 1OOFA 1UHJA 1NP8A 2FCEA 3DVMA 5B8IB 2F3YA 3DZTA 1CMFA 1B47A 2OS8C 1YURA 1K9UA 1NCYA 1YUTA 4UPGA 2ZNDA 2BE6A 1RFJA 4YGAA 1TRFA 1CFDA 5CSIA 3GOFA 3NSIA 1N2DA 3PJIA 2LLUA 1MR8A 3TZ1A 4CLNA 3NSOA 3OX5A 1E8AA 2L51A 2L4HA 3QRXA 1EXRA 1DEKA 1LXFC 2AUCA 1DF0A 3I5IB 1IJ6A 4DRWA 1JFJA 3O2PA 2M3WA 1Y0VH 1AJ4A 1FI6A 3BOWA 5I2OA 2M97A 4INXA 4PE7A 1BMOA 1SYMA 2QEBA 1LA3A 3AKAA 2O60A 1FF1A 4I5LB 2LP3A 1TCFA 1QS7A 1KWOB 3AKBA 3CTNA 4PDZA 2K7BA 1JF2A 3TS5B 4DS7A 2KPHA 3WNXB 1DTLA 2MA2A 1OOGA 5AEQA 1YUUA 1OQPA 1S1EA 2DOQA 1CTRA 1N65A 4F7FA 1TNWA 1BR4B 3JTDC 1TIZA
chains in the Genus database with same CATH topology
2JC2A 1C07A 1AVSA 1SBJA 2KFGA 3I5IC 1DMOA 4GGFA 5JOLA 1UUSA 1SRAA 1B7TZ 1TNPA 2KYCA 3BUWB 3LK0A 1JUOA 1MQ1A 1B7TY 2PMYA 1KSOA 2GGMA 3PSRA 1PSRA 3RLZA 3VRNA 4ORBB 1KFUS 4OCIA 1SMGA 4ORAB 4CFQA 1DJYA 2HF5A 2MBXA 3ICBA 5HKZA 2ZKMX 1KCYA 5CSFA 3IF7A 4AQIA 3HX4A 1L7ZA 4GUKA 4ZCUA 2LAPA 5KU1A 1JFKA 1OMVA 2HQWA 2NZ0A 2NLNA 2Q91A 2LVIA 2NCOA 3FS7A 2JT3A 2L5XB 3TUYB 2I18A 1BODA 3C1VA 3CR2A 3LK1A 4WQ2A 2L98A 4N5XA 2M0RA 2SASA 1XK4A 1BU3A 1QIVA 1UWOA 1CDLA 1BR1B 3VRRA 1NCXA 3GK1A 1CFPA 1NX0A 1XK4C 2H61C 3GK4X 3SG5A 3DVEA 3PLFB 1ZFSA 1ALVA 3EVUA 4FQOA 1YVHA 4MEWA 1UHKA 1K95A 2EGDA 4M2PA 1KFUL 3PN7C 1LVCD 1RTP1 1W7IB 1WY9A 1DJXA 3TUYC 1F71A 2CT9A 1PRWA 2LLSA 3DF0A 1KK7Z 1NIWA 3BUOB 1KK7Y 2K61A 1S26D 2E6WA 1DJGA 2VRGA 3FIAA 4GPLB 2O5GA 2CTNA 1RK9A 4C0LA 2LP2A 2WORA 1TCOB 2Y5IA 2BCAA 1BJFA 3OB2B 5JJGA 2LC5A 3VGOA 1NX3A 2FCDA 1SR6C 4C0KA 1C7WA 3A8RA 1WRKA 2OTGC 3WHTB 3M0WA 3SG6A 1S3PA 3D0YA 3NSKA 2G9BA 1PSBA 4PHJA 2BECA 2MAZA 4I5NB 5CPVA 1EJ3A 2WCBA 2HETA 2MLEC 4HRGA 1CFCA 3IQOA 2K8MB 1QV1A 4PE1A 1XVJA 2FOTA 2K2FA 2M49B 4M2OA 1XFWO 1ZOTB 1Y6WA 1ZACA 1XFYO 5PALA 1Y1UA 2JTTA 1K93D 1CB1A 2KAXA 3CZTX 4NDDA 3SG2A 4DCKA 2JPTA 1NUBA 3SG4A 1MHOA 2Y4QA 1FW4A 1TOPA 5KSZA 1BG1A 1KQVA 5DKRA 1QLKA 2KI4B 2WOSA 1MF8B 1CKKA 1DF0B 3I5HB 5KTYA 1XFUO 1MXLC 3OP0A 2K7CA 1QLSA 2KGBC 4OV2A 1DJIA 1JC2A 4GBAA 3H4SE 3BOWB 1EG4A 4YGCB 1CLMA 2KAVA 1QX7A 1J7QA 1VRKA 1S5GZ 1HQVA 3WHUB 1SCMB 1S5GY 5ER4X 5J3XA 1TTXA 2ISDA 2ZN9A 1PULA 1BLQA 3TDUA 1M45A 1QJTA 1CLBA 2JOJA 1OMDA 3EK8A 4PHMA 3O4YA 5CSNA 2KI4C 3CGAA 1HT9A 5I8NA 1EL4A 3I5HC 2KFFA 2M7NA 2KHNA 2JU0A 1UHIA 2BL0B 3F45A 3CLNA 3KF9A 3O78A 1SCMC 3BUXB 2K7OA 3I5FB 1IQ5A 5IBWA 2PSRA 1LINA 4FTGA 2KI6C 2PALA 4USLA 4N1FA 1U5IB 1XA5A 2IS9A 1R6PA 2KI6D 3EK7A 5K89A 2BE4A 2CXJA 1Y1AA 1CLLA 1EH2A 4GGFC 3SIAA 2I2RE 1F55A 3PALA 2BL0C 1KWOC 2ZFDA 4JPZB 2B1UA 3TS5C 1RWYA 2BBMA 1XYDA 3ZNIA 3SG3A 3I5FC 1F70A 4I5KA 1YX7A 1QXPA 2KDHA 1NPQA 2WC8A 1U5IA 4U8DA 1A4PA 2LHIA 2MLFC 1SCVA 1S6CA 4PALA 5G08A 1SW8A 4GGNA 1ODBA 2PVBA 2JNXA 2L0PA 1G4YR 1NYAA 2JWWA 1A29A 5DKNA 4QJ5B 1CDMA 2LLTA 2G2BA 4MZLA 3DF0B 3LLEA 5HLOA 4MVFA 1SL8A 1CMGA 1F4OA 4MZKA 4YI8A 4DUQA 2JQ6A 1F4QA 4C0JA 3E3RA 5GQQC 2COLB 4BY5A 3TDIA 2KBIA 1PVBA 3OHMB 4PE4A 1FI5A 1IG5A 1CDPA 1TN4A 2FJUB 2LCPA 1YRUB 1ZUZA 2H2KA 1JF0A 4IL1A 3EVVA 3D0YB 1LA0A 1D1OA 4HRHA 3TDZA 1CNPA 1DJHA 3OB1B 4ORCB 2A4JA 2LV7A 4DIRA 5HKWA 2M29A 1OZOA 4A4CA 3VROA 1R2UA 5AERA 4ZCVA 2WCEA 4I5JA 1B4CA 2OPOA 1G8IA 3MSEB 5HLVA 4PCWA 4YGBB 1NCZA 1QX5B 1S6JA 1SL9A 1F8HA 3NSLA 1WRZA 1DJZA 3SG7A 2M9GA 1S6IA 1F54A 1J7RA 2F2OA 2KYFA 2LMVA 3BUMB 1X02A 3JVTB 1Q80A 2V53A 1QIWA 5ER5A 1ALWA 4MN0A 4OR9B 2D8NA 2GV5A 1NSHA 2NCPA 1OOJA 1SPYA 2GGZA 2KSPA 4L9MA 1JBAA 1V1GA 2Y1NA 2KGRA 4R1EA 1QATA 2JT8A 1PALA 4CFRA 5AANA 2M8UA 4NDCA 1XO5A 3AAJA 1G33A 2HPSA 2ZN8A 2R2IA 3ZWHA 1IQ3A 1M46A 1UURA 1J7OA 2WCFA 2WNDA 1AP4A 2MRDA 2M7LA 2JXCA 3SIBA 2ZNEA 4GNKB 4N1GA 4AOMA 1CM4A 2KAYA 2M1KB 1K94A 4YRUA 1AHRA 3RM1A 2JZIA 2JTZA 1OSAA 1AK8A 4E68A 2EHBA 1W7JB 1M31A 3IQQA 4GAOA 2LHLA 2PRUA 4QJ3B 1JSAA 4HREE 2SCPA 2TN4A 3PM8A 4XJKB 1UHHA 4D1EA 3FWCA 2L2EA 1XFVO 1UHNA 4NQGA 3LCPC 2KNEA 5BPJA 2JULA 1TNQA 2KOTA 2P6BB 2QACA 3BXKA 3CWGA 4GFTA 2CNPA 1WRLA 3K21A 1LKJA 3JTDB 3O6BA 1UP5A 2PASA 3KHEA 5FYXA 5D69A 3WXAA 2F3ZA 2M1UA 1L2OB 4NDBA 3HCMA 2AMIA 1KFXS 1IRJA 2Y1MA 4XJKA 2KFHA 5DKQA 2BBNA 1WLZA 1YUSA 1IJ5A 1KQMB 2RGIA 2NXQA 4ETOA 1XFZO 1K8UA 1H4BA 1M63B 1BT6A 1A03A 1CDNA 3KEVA 1GGWA 2I94A 3FWBA 1DGUA 1XFXO 1PVAA 4P5OE 1YTZC 1M39A 2EC6B 1RECA 4YGDB 5AFPA 1A75B 1B9AA 2F8PA 1L2OC 1IGVA 2K7DA 2E30A 3D10A 1MUXA 1FBVA 2K2AA 2K0JA 2I7AA 1BF5A 1QX2A 1K2HA 3NXAA 4CPVA 5HYDA 1KQMC 1GJYA 1QV0A 1MXEA 1IWQA 1Y1XA 2LM5A 3CS1A 4WQ3A 2L50A 4MLWA 4PHKA 4CIDA 2BKHB 1A75A 1KFXL 2LMUA 4PHNA 3SJSA 1K90D 1NX2A 2EC6C 3CR5X 1DJWA 1YVLA 1IH0A 4MBEA 1DVIA 1AUIB 1AJ5A 1WDCB 3EK4A 3PN7B 4ICBA 2JNFA 1H8BA 4OVNF 4WRIA 1SKTA 4TNCA 2LUCA 5TNCA 1CFFA 3DVKA 2HQ8A 1TNXA 1B8LA 1YRTB 4HSZA 1OZSA 3LL8B 3BQ3A 4JWQA 4F0ZB 2H61A 3A4UB 1QTXA 5I2LA 4BY4A 1J7PA 1IKUA 1K9PA 1NWDA 3EKHA 2BCXA 1J55A 1K96A 1SL7A 2JXLA 1K9KA 1SR6B 2F33A 3BYAA 3DVJA 1YR5A 2BKIB 1WDCC 2OTGB 3I5GB 4MSPA 1RJVA 2KQ6A 3VRQA 3DD4A 5CSJA 5F6TA 3AAKA 1J1DA 4M2QA 1BOCA 4MRXA 2ZRSA 3EVRA 1EG3A 4AQJA 2JRFA 2QPTA 5I2QA 2LNKA 1PK0D 2LVVA 1SNLA 2LVJA 2ZRTA 1MWNA 1KSMA 1QVIZ 1N0YA 1QVIY 2KBMA 4YBHB 1C7VA 1OMRA 1DGVA 1WLMA 1JWDA 4OKHA 3KO0A 2AAOA 3OX6A 2LANA 2LMTA 4QJ4B 4YI9A 2BCBA 2KQYA 4P2YB 4Q04A 1DT7B 3KPXA 3I5GC 1B8RA 1KK8B 3EKJA 1RROA 1J1EA 5AXIA 3GK2A 2CBLA 2MHHA 4MRYA 2LE9B 4A4BA 3JVTC 1B1GA 2OS8B 4XYNA 1CM1A 1SK6D 5HKYA 1QASA 1ZMZA 2MJWB 2LUXA 1OE9B 1S36A 2JT0A 4MZJA 2L4IA 1B8CA 2CCMA 4PE0A 1YX8A 2LVKA 1SY9A 1V1FA 2Q4UA 3CR4X 3PFVA 1NX1A 5D7FA 3BUNB 4YGEB 2F2PA 1A2XA 4JQ0D 1FPWA 1KK8C 1GQMA 1GGZA 3VRPA 3PATA 1UHJA 1NP8A 2FCEA 3DVMA 5B8IB 2F3YA 1CMFA 1B47A 2OS8C 1YURA 1K9UA 1NCYA 1YUTA 4UPGA 2ZNDA 2BE6A 1RFJA 4YGAA 1TRFA 1CFDA 5CSIA 3GOFA 3NSIA 1N2DA 3TZ1A 2LLUA 1MR8A 4CLNA 3NSOA 3OX5A 1E8AA 2L51A 2L4HA 3QRXA 1EXRA 1LXFC 2AUCA 3I5IB 1DF0A 4DRWA 1IJ6A 1JFJA 3O2PA 2M3WA 1Y0VH 1AJ4A 1FI6A 3BOWA 5I2OA 2M97A 4PE7A 1BMOA 1SYMA 1LA3A 3AKAA 2O60A 1FF1A 4I5LB 2LP3A 1TCFA 1QS7A 1KWOB 3AKBA 3CTNA 4PDZA 2K7BA 1JF2A 3TS5B 4DS7A 3WNXB 1DTLA 2MA2A 5AEQA 1YUUA 1OQPA 1S1EA 2DOQA 1CTRA 1N65A 1TNWA 1BR4B 3JTDC 1TIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC2 A;  1C07 A;  1AVS A;  1SBJ A;  2KFG A;  3I5I C;  1DMO A;  4GGF A;  5JOL A;  1UUS A;  1SRA A;  1B7T Z;  1TNP A;  2KYC A;  3BUW B;  3LK0 A;  1JUO A;  1MQ1 A;  1B7T Y;  2PMY A;  1KSO A;  2GGM A;  3PSR A;  1PSR A;  3RLZ A;  3VRN A;  4ORB B;  1KFU S;  4OCI A;  1SMG A;  4ORA B;  4CFQ A;  1DJY A;  2HF5 A;  2MBX A;  3ICB A;  5HKZ A;  2ZKM X;  1KCY A;  5CSF A;  3IF7 A;  4AQI A;  3HX4 A;  1L7Z A;  4GUK A;  4ZCU A;  2LAP A;  5KU1 A;  1JFK A;  1OMV A;  2HQW A;  2NZ0 A;  2NLN A;  2Q91 A;  2LVI A;  2NCO A;  3FS7 A;  2JT3 A;  2L5X B;  3TUY B;  2I18 A;  1BOD A;  3C1V A;  3CR2 A;  3LK1 A;  4WQ2 A;  2L98 A;  4N5X A;  2M0R A;  2SAS A;  1XK4 A;  1BU3 A;  1QIV A;  1UWO A;  1CDL A;  1BR1 B;  3VRR A;  1NCX A;  3GK1 A;  1CFP A;  1NX0 A;  1XK4 C;  2H61 C;  3GK4 X;  3SG5 A;  3DVE A;  3PLF B;  1ZFS A;  1ALV A;  3EVU A;  4FQO A;  1YVH A;  4MEW A;  1UHK A;  1K95 A;  2EGD A;  4M2P A;  1KFU L;  3PN7 C;  1LVC D;  1RTP 1;  1W7I B;  1WY9 A;  1DJX A;  3TUY C;  1F71 A;  2CT9 A;  1PRW A;  2LLS A;  3DF0 A;  1KK7 Z;  1NIW A;  3BUO B;  1KK7 Y;  2K61 A;  1S26 D;  2E6W A;  1DJG A;  2VRG A;  3FIA A;  4GPL B;  2O5G A;  2CTN A;  1RK9 A;  4C0L A;  2LP2 A;  2WOR A;  1TCO B;  2Y5I A;  2BCA A;  1BJF A;  3OB2 B;  5JJG A;  2LC5 A;  3VGO A;  1NX3 A;  2FCD A;  1SR6 C;  4C0K A;  1C7W A;  3A8R A;  1WRK A;  2OTG C;  3WHT B;  3M0W A;  3SG6 A;  1S3P A;  3D0Y A;  3NSK A;  2G9B A;  1PSB A;  4PHJ A;  2BEC A;  2MAZ A;  4I5N B;  5CPV A;  1EJ3 A;  2WCB A;  2HET A;  2MLE C;  4HRG A;  1CFC A;  3IQO A;  2K8M B;  1QV1 A;  4PE1 A;  1XVJ A;  2FOT A;  2K2F A;  2M49 B;  4M2O A;  1XFW O;  1ZOT B;  1Y6W A;  1ZAC A;  1XFY O;  5PAL A;  1Y1U A;  2JTT A;  1K93 D;  1CB1 A;  2KAX A;  3CZT X;  4NDD A;  3SG2 A;  4DCK A;  2JPT A;  1NUB A;  3SG4 A;  1MHO A;  2Y4Q A;  1FW4 A;  1TOP A;  5KSZ A;  1BG1 A;  1KQV A;  5DKR A;  1QLK A;  2KI4 B;  2WOS A;  1MF8 B;  1CKK A;  1DF0 B;  3I5H B;  5KTY A;  1XFU O;  1MXL C;  3OP0 A;  2K7C A;  1QLS A;  2KGB C;  4OV2 A;  1DJI A;  1JC2 A;  4GBA A;  3H4S E;  3BOW B;  1EG4 A;  4YGC B;  1CLM A;  2KAV A;  1QX7 A;  1J7Q A;  1VRK A;  1S5G Z;  1HQV A;  3WHU B;  1SCM B;  1S5G Y;  5ER4 X;  5J3X A;  1TTX A;  2ISD A;  2ZN9 A;  1PUL A;  1BLQ A;  3TDU A;  1M45 A;  1QJT A;  1CLB A;  2JOJ A;  1OMD A;  3EK8 A;  4PHM A;  3O4Y A;  5CSN A;  2KI4 C;  3CGA A;  1HT9 A;  5I8N A;  1EL4 A;  3I5H C;  2KFF A;  2M7N A;  2KHN A;  2JU0 A;  1UHI A;  2BL0 B;  3F45 A;  3CLN A;  3KF9 A;  3O78 A;  1SCM C;  3BUX B;  2K7O A;  3I5F B;  1IQ5 A;  5IBW A;  2PSR A;  1LIN A;  4FTG A;  2KI6 C;  2PAL A;  4USL A;  4N1F A;  1U5I B;  1XA5 A;  2IS9 A;  1R6P A;  2KI6 D;  3EK7 A;  5K89 A;  2BE4 A;  2CXJ A;  1Y1A A;  1CLL A;  1EH2 A;  4GGF C;  3SIA A;  2I2R E;  1F55 A;  3PAL A;  2BL0 C;  1KWO C;  2ZFD A;  4JPZ B;  2B1U A;  3TS5 C;  1RWY A;  2BBM A;  1XYD A;  3ZNI A;  3SG3 A;  3I5F C;  1F70 A;  4I5K A;  1YX7 A;  1QXP A;  2KDH A;  1NPQ A;  2WC8 A;  1U5I A;  4U8D A;  1A4P A;  2LHI A;  2MLF C;  1SCV A;  1S6C A;  4PAL A;  5G08 A;  1SW8 A;  4GGN A;  1ODB A;  2PVB A;  2JNX A;  2L0P A;  1G4Y R;  1NYA A;  2JWW A;  1A29 A;  5DKN A;  4QJ5 B;  1CDM A;  2LLT A;  2G2B A;  4MZL A;  3DF0 B;  3LLE A;  5HLO A;  4MVF A;  1SL8 A;  1CMG A;  1F4O A;  4MZK A;  4YI8 A;  4DUQ A;  2JQ6 A;  1F4Q A;  4C0J A;  3E3R A;  5GQQ C;  2COL B;  4BY5 A;  3TDI A;  2KBI A;  1PVB A;  3OHM B;  4PE4 A;  1FI5 A;  1IG5 A;  1CDP A;  1TN4 A;  2FJU B;  2LCP A;  1YRU B;  1ZUZ A;  2H2K A;  1JF0 A;  4IL1 A;  3EVV A;  3D0Y B;  1LA0 A;  1D1O A;  4HRH A;  3TDZ A;  1CNP A;  1DJH A;  3OB1 B;  4ORC B;  2A4J A;  2LV7 A;  4DIR A;  5HKW A;  2M29 A;  1OZO A;  4A4C A;  3VRO A;  1R2U A;  5AER A;  4ZCV A;  2WCE A;  4I5J A;  1B4C A;  2OPO A;  1G8I A;  3MSE B;  5HLV A;  4PCW A;  4YGB B;  1NCZ A;  1QX5 B;  1S6J A;  1SL9 A;  1F8H A;  3NSL A;  1WRZ A;  1DJZ A;  3SG7 A;  2M9G A;  1S6I A;  1F54 A;  1J7R A;  2F2O A;  2KYF A;  2LMV A;  3BUM B;  1X02 A;  3JVT B;  1Q80 A;  2V53 A;  1QIW A;  5ER5 A;  1ALW A;  4MN0 A;  4OR9 B;  2D8N A;  2GV5 A;  1NSH A;  2NCP A;  1OOJ A;  1SPY A;  2GGZ A;  2KSP A;  4L9M A;  1JBA A;  1V1G A;  2Y1N A;  2KGR A;  4R1E A;  1QAT A;  2JT8 A;  1PAL A;  4CFR A;  5AAN A;  2M8U A;  4NDC A;  1XO5 A;  3AAJ A;  1G33 A;  2HPS A;  2ZN8 A;  2R2I A;  3ZWH A;  1IQ3 A;  1M46 A;  1UUR A;  1J7O A;  2WCF A;  2WND A;  1AP4 A;  2MRD A;  2M7L A;  2JXC A;  3SIB A;  2ZNE A;  4GNK B;  4N1G A;  4AOM A;  1CM4 A;  2KAY A;  2M1K B;  1K94 A;  4YRU A;  1AHR A;  3RM1 A;  2JZI A;  2JTZ A;  1OSA A;  1AK8 A;  4E68 A;  2EHB A;  1W7J B;  1M31 A;  3IQQ A;  4GAO A;  2LHL A;  2PRU A;  4QJ3 B;  1JSA A;  4HRE E;  2SCP A;  2TN4 A;  3PM8 A;  4XJK B;  1UHH A;  4D1E A;  3FWC A;  2L2E A;  1XFV O;  1UHN A;  4NQG A;  3LCP C;  2KNE A;  5BPJ A;  2JUL A;  1TNQ A;  2KOT A;  2P6B B;  2QAC A;  3BXK A;  3CWG A;  4GFT A;  2CNP A;  1WRL A;  3K21 A;  1LKJ A;  3JTD B;  3O6B A;  1UP5 A;  2PAS A;  3KHE A;  5FYX A;  5D69 A;  3WXA A;  2F3Z A;  2M1U A;  1L2O B;  4NDB A;  3HCM A;  2AMI A;  1KFX S;  1IRJ A;  2Y1M A;  4XJK A;  2KFH A;  5DKQ A;  2BBN A;  1WLZ A;  1YUS A;  1IJ5 A;  1KQM B;  2RGI A;  2NXQ A;  4ETO A;  1XFZ O;  1K8U A;  1H4B A;  1M63 B;  1BT6 A;  1A03 A;  1CDN A;  3KEV A;  1GGW A;  2I94 A;  3FWB A;  1DGU A;  1XFX O;  1PVA A;  4P5O E;  1YTZ C;  1M39 A;  2EC6 B;  1REC A;  4YGD B;  5AFP A;  1A75 B;  1B9A A;  2F8P A;  1L2O C;  1IGV A;  2K7D A;  2E30 A;  3D10 A;  1MUX A;  1FBV A;  2K2A A;  2K0J A;  2I7A A;  1BF5 A;  1QX2 A;  1K2H A;  3NXA A;  4CPV A;  5HYD A;  1KQM C;  1GJY A;  1QV0 A;  1MXE A;  1IWQ A;  1Y1X A;  2LM5 A;  3CS1 A;  4WQ3 A;  2L50 A;  4MLW A;  4PHK A;  4CID A;  2BKH B;  1A75 A;  1KFX L;  2LMU A;  4PHN A;  3SJS A;  1K90 D;  1NX2 A;  2EC6 C;  3CR5 X;  1DJW A;  1YVL A;  1IH0 A;  4MBE A;  1DVI A;  1AUI B;  1AJ5 A;  1WDC B;  3EK4 A;  3PN7 B;  4ICB A;  2JNF A;  1H8B A;  4OVN F;  4WRI A;  1SKT A;  4TNC A;  2LUC A;  5TNC A;  1CFF A;  3DVK A;  2HQ8 A;  1TNX A;  1B8L A;  1YRT B;  4HSZ A;  1OZS A;  3LL8 B;  3BQ3 A;  4JWQ A;  4F0Z B;  2H61 A;  3A4U B;  1QTX A;  5I2L A;  4BY4 A;  1J7P A;  1IKU A;  1K9P A;  1NWD A;  3EKH A;  2BCX A;  1J55 A;  1K96 A;  1SL7 A;  2JXL A;  1K9K A;  1SR6 B;  2F33 A;  3BYA A;  3DVJ A;  1YR5 A;  2BKI B;  1WDC C;  2OTG B;  3I5G B;  4MSP A;  1RJV A;  2KQ6 A;  3VRQ A;  3DD4 A;  5CSJ A;  5F6T A;  3AAK A;  1J1D A;  4M2Q A;  1BOC A;  4MRX A;  2ZRS A;  3EVR A;  1EG3 A;  4AQJ A;  2JRF A;  2QPT A;  5I2Q A;  2LNK A;  1PK0 D;  2LVV A;  1SNL A;  2LVJ A;  2ZRT A;  1MWN A;  1KSM A;  1QVI Z;  1N0Y A;  1QVI Y;  2KBM A;  4YBH B;  1C7V A;  1OMR A;  1DGV A;  1WLM A;  1JWD A;  4OKH A;  3KO0 A;  2AAO A;  3OX6 A;  2LAN A;  2LMT A;  4QJ4 B;  4YI9 A;  2BCB A;  2KQY A;  4P2Y B;  4Q04 A;  1DT7 B;  3KPX A;  3I5G C;  1B8R A;  1KK8 B;  3EKJ A;  1RRO A;  1J1E A;  5AXI A;  3GK2 A;  2CBL A;  2MHH A;  4MRY A;  2LE9 B;  4A4B A;  3JVT C;  1B1G A;  2OS8 B;  4XYN A;  1CM1 A;  1SK6 D;  5HKY A;  1QAS A;  1ZMZ A;  2MJW B;  2LUX A;  1OE9 B;  1S36 A;  2JT0 A;  4MZJ A;  2L4I A;  1B8C A;  2CCM A;  4PE0 A;  1YX8 A;  2LVK A;  1SY9 A;  1V1F A;  2Q4U A;  3CR4 X;  3PFV A;  1NX1 A;  5D7F A;  3BUN B;  4YGE B;  2F2P A;  1A2X A;  4JQ0 D;  1FPW A;  1KK8 C;  1GQM A;  1GGZ A;  3VRP A;  3PAT A;  1UHJ A;  1NP8 A;  2FCE A;  3DVM A;  5B8I B;  2F3Y A;  1CMF A;  1B47 A;  2OS8 C;  1YUR A;  1K9U A;  1NCY A;  1YUT A;  4UPG A;  2ZND A;  2BE6 A;  1RFJ A;  4YGA A;  1TRF A;  1CFD A;  5CSI A;  3GOF A;  3NSI A;  1N2D A;  3TZ1 A;  2LLU A;  1MR8 A;  4CLN A;  3NSO A;  3OX5 A;  1E8A A;  2L51 A;  2L4H A;  3QRX A;  1EXR A;  1LXF C;  2AUC A;  3I5I B;  1DF0 A;  4DRW A;  1IJ6 A;  1JFJ A;  3O2P A;  2M3W A;  1Y0V H;  1AJ4 A;  1FI6 A;  3BOW A;  5I2O A;  2M97 A;  4PE7 A;  1BMO A;  1SYM A;  1LA3 A;  3AKA A;  2O60 A;  1FF1 A;  4I5L B;  2LP3 A;  1TCF A;  1QS7 A;  1KWO B;  3AKB A;  3CTN A;  4PDZ A;  2K7B A;  1JF2 A;  3TS5 B;  4DS7 A;  3WNX B;  1DTL A;  2MA2 A;  5AEQ A;  1YUU A;  1OQP A;  1S1E A;  2DOQ A;  1CTR A;  1N65 A;  1TNW A;  1BR4 B;  3JTD C;  1TIZ A; 
#chains in the Genus database with same CATH topology
 2JC2 A;  1C07 A;  4INW A;  1AVS A;  1SBJ A;  2KFG A;  3I5I C;  1DMO A;  4GGF A;  1Z2C B;  5JOL A;  1UUS A;  1SRA A;  1B7T Z;  1TNP A;  2KYC A;  3BUW B;  3LK0 A;  1JUO A;  1MQ1 A;  1B7T Y;  2PMY A;  1KSO A;  2GGM A;  3PSR A;  1PSR A;  2YGU A;  3RLZ A;  3VRN A;  2ERB A;  1KFU S;  3OBV A;  1SMG A;  4OCI A;  4ORB B;  1DJY A;  2HF5 A;  4ORA B;  3ICB A;  2MBX A;  5HKZ A;  2ZKM X;  3DY9 A;  1IIO A;  3NGV A;  1KCY A;  5CSF A;  2P71 A;  3IF7 A;  4AQI A;  3HX4 A;  1L7Z A;  4GUK A;  4ZCU A;  1XFR A;  2LAP A;  5KU1 A;  1JFK A;  1OMV A;  2HQW A;  5FI6 A;  2NZ0 A;  2NLN A;  2Q91 A;  3SS5 A;  2LVI A;  3QME A;  2L2C A;  3NHI A;  2NCO A;  3FS7 A;  2JT3 A;  2L5X B;  3TUY B;  2I18 A;  1BOD A;  1SSE B;  3C1V A;  3CR2 A;  3LK1 A;  4WQ2 A;  2L98 A;  4N5X A;  3D74 A;  2M0R A;  2SAS A;  1XK4 A;  1LS8 A;  1BU3 A;  1QIV A;  1UWO A;  1CDL A;  1BR1 B;  3VRR A;  1NCX A;  3GK1 A;  1CFP A;  1NX0 A;  3RZS A;  3OGN A;  1XK4 C;  2H61 C;  2WC6 A;  3GK4 X;  2H8V A;  3SG5 A;  3DVE A;  3PLF B;  1ZFS A;  1ALV A;  3EVU A;  4FQO A;  1YVH A;  4MEW A;  1UHK A;  1K95 A;  2EGD A;  4M2P A;  1KFU L;  3PN7 C;  3Q8I A;  1LVC D;  1RTP 1;  1W7I B;  1WY9 A;  1DJX A;  3TUY C;  1F71 A;  2CT9 A;  1PRW A;  2LLS A;  3DF0 A;  2KLE A;  1KK7 Z;  1GM0 A;  1NIW A;  3BUO B;  1KK7 Y;  2K61 A;  1S26 D;  2E6W A;  1DJG A;  2VRG A;  3FIA A;  4GPL B;  2O5G A;  2CTN A;  1RK9 A;  4C0L A;  2LP2 A;  2WOR A;  1TCO B;  2Y5I A;  1ORG A;  2BCA A;  1BJF A;  1T14 A;  3OB2 B;  5JJG A;  2LC5 A;  3VGO A;  1NX3 A;  2FCD A;  1SR6 C;  2WCJ A;  4C0K A;  1C7W A;  3A8R A;  1WRK A;  2OTG C;  3WHT B;  3M0W A;  3SG6 A;  1S3P A;  3D0Y A;  3NSK A;  2G9B A;  3CZ2 A;  1PSB A;  4PHJ A;  2BEC A;  2MAZ A;  4I5N B;  5CPV A;  1EJ3 A;  2WCB A;  2HET A;  2MLE C;  4HRG A;  1CFC A;  3IQO A;  2K8M B;  1QV1 A;  4FQT A;  1TUJ A;  4PE1 A;  3IVT A;  1XVJ A;  2FOT A;  2K2F A;  2M49 B;  4M2O A;  1XFW O;  3L47 A;  1ZOT B;  1Y6W A;  1ZAC A;  1XFY O;  5PAL A;  1TWO A;  1Y1U A;  2JTT A;  1K93 D;  1CB1 A;  2KAX A;  3CZT X;  4NDD A;  3S0G A;  3SG2 A;  4DCK A;  2JPT A;  3D75 A;  1NUB A;  3SG4 A;  1MHO A;  2Y4Q A;  1FW4 A;  1TOP A;  3O4X A;  5KSZ A;  1BG1 A;  1KQV A;  5DKR A;  1QLK A;  2KI4 B;  2WOS A;  1MF8 B;  1CKK A;  1DF0 B;  3I5H B;  5KTY A;  1XFU O;  1MXL C;  3OP0 A;  2K7C A;  4PT1 A;  1QLS A;  2KGB C;  4OV2 A;  1DJI A;  1JC2 A;  4GBA A;  3H4S E;  3BOW B;  1EG4 A;  4YGC B;  1CLM A;  2KAV A;  1QX7 A;  1J7Q A;  1VRK A;  1S5G Z;  1HQV A;  2JPO A;  3WHU B;  1SCM B;  1S5G Y;  5ER4 X;  5J3X A;  1TTX A;  2ISD A;  2ZN9 A;  1PUL A;  1BLQ A;  3TDU A;  5DIC A;  1M45 A;  1QJT A;  1CLB A;  5FI2 A;  2PYQ A;  2JOJ A;  1OMD A;  3EK8 A;  1OOI X;  4PHM A;  3O4Y A;  5CSN A;  2KI4 C;  3CGA A;  1HT9 A;  5I8N A;  1EL4 A;  3I5H C;  2KFF A;  1C3Z A;  2M7N A;  2KHN A;  2JU0 A;  1UHI A;  2BL0 B;  2QEH A;  3F45 A;  3CLN A;  3KF9 A;  3O78 A;  1SCM C;  3BUX B;  1TUZ A;  2K7O A;  3FE9 A;  3I5F B;  1IQ5 A;  5IBW A;  2PSR A;  1LIN A;  3L4L A;  4FTG A;  2KI6 C;  2PAL A;  4IJ7 A;  4USL A;  3BFA A;  4N1F A;  1U5I B;  1XA5 A;  2IS9 A;  1R6P A;  2KI6 D;  3EK7 A;  5K89 A;  2BE4 A;  2CXJ A;  1Y1A A;  1CLL A;  2QEO A;  1EH2 A;  3CDN A;  4GGF C;  3D77 A;  3SIA A;  2I2R E;  2BNX A;  1F55 A;  3PAL A;  2BL0 C;  2WCK A;  1KWO C;  2ZFD A;  3R1O A;  4JPZ B;  2B1U A;  3TS5 C;  1RWY A;  2BBM A;  1XYD A;  2WCM A;  3ZNI A;  3S0B A;  3SG3 A;  3I5F C;  1F70 A;  5EL2 A;  4I5K A;  1C3Y A;  1YX7 A;  1QXP A;  2KDH A;  1NPQ A;  2WC8 A;  1U5I A;  4U8D A;  1A4P A;  2LHI A;  2MLF C;  1SCV A;  1S6C A;  4PAL A;  5G08 A;  1SW8 A;  4GGN A;  1ODB A;  2PVB A;  2JNX A;  2L0P A;  1G4Y R;  1NYA A;  2JWW A;  1A29 A;  5DKN A;  4QJ5 B;  1CDM A;  3L4A A;  2LLT A;  2G2B A;  4MZL A;  3EG5 B;  3DF0 B;  3LLE A;  5HLO A;  4MVF A;  1SL8 A;  1CMG A;  1F4O A;  4MZK A;  4YI8 A;  3UNW A;  2JQ6 A;  4DUQ A;  3B88 A;  1F4Q A;  4C0J A;  3SS3 A;  3E3R A;  5GQQ C;  2COL B;  4BY5 A;  2P70 A;  3TDI A;  2KBI A;  1PVB A;  3OHM B;  4PE4 A;  3S0E A;  1FI5 A;  1IG5 A;  1CDP A;  1TN4 A;  2WCH A;  3DYE A;  3R1V A;  2FJU B;  4CFQ A;  3S0F A;  2LCP A;  1YRU B;  1ZUZ A;  2WC5 A;  2H2K A;  1JF0 A;  4IL1 A;  3EVV A;  1QWV A;  3D0Y B;  1LA0 A;  1D1O A;  4HRH A;  3TDZ A;  1CNP A;  1DJH A;  3OB1 B;  4ORC B;  2A4J A;  2LV7 A;  3D73 A;  2K60 A;  5HKW A;  4DIR A;  2M29 A;  1OZO A;  4A4C A;  3VRO A;  1R2U A;  5AER A;  4ZCV A;  2WCE A;  4I5J A;  3BFH A;  1B4C A;  2OPO A;  1G8I A;  3MSE B;  5HLV A;  4PCW A;  4KYN A;  3R1P A;  1NCZ A;  1QX5 B;  1OOH A;  1S6J A;  1SL9 A;  4YGB B;  1F8H A;  3NSL A;  1WRZ A;  1DJZ A;  3SG7 A;  2M9G A;  1S6I A;  1F54 A;  1J7R A;  2F2O A;  2KYF A;  2LMV A;  3BUM B;  1X02 A;  3N7H A;  3JVT B;  1Q80 A;  2V53 A;  1QIW A;  5ER5 A;  3D76 A;  1ALW A;  3B6X A;  4MN0 A;  4OR9 B;  2D8N A;  2GV5 A;  1NSH A;  2NCP A;  1OOJ A;  1SPY A;  2GGZ A;  2KSP A;  2PQL A;  2WCL A;  4L9M A;  1V1G A;  3UO9 A;  1JBA A;  2Y1N A;  3BJH A;  1Z4H A;  2KGR A;  4R1E A;  1QAT A;  2JT8 A;  1PAL A;  4CFR A;  5AAN A;  2M8U A;  4NDC A;  1XO5 A;  3AAJ A;  1G33 A;  2HPS A;  2ZN8 A;  2R2I A;  3ZWH A;  1IQ3 A;  1M46 A;  1UUR A;  1J7O A;  2WCF A;  2WND A;  3CZ1 A;  1AP4 A;  2MRD A;  2M7L A;  2JXC A;  3SIB A;  2ZNE A;  4GNK B;  4N1G A;  4AOM A;  1CM4 A;  2KAY A;  2M1K B;  1K94 A;  4YRU A;  1AHR A;  3RM1 A;  2JZI A;  2JTZ A;  1OSA A;  1AK8 A;  4E68 A;  2EHB A;  2KLD A;  3K1E A;  1W7J B;  3CYZ A;  1M31 A;  3IQQ A;  4GAO A;  2LHL A;  2PRU A;  4QJ3 B;  3B86 A;  1JSA A;  4HRE E;  2SCP A;  2TN4 A;  3PM8 A;  4XJK B;  1UHH A;  4D1E A;  3FE8 A;  3FWC A;  2L2E A;  1XFV O;  1UHN A;  3B7A A;  3LCP C;  2KNE A;  4NQG A;  5BPJ A;  2JUL A;  1TNQ A;  2KOT A;  2P6B B;  2QAC A;  3BXK A;  3CWG A;  4GFT A;  2CNP A;  1WRL A;  3K21 A;  1LKJ A;  3JTD B;  3O6B A;  1UP5 A;  2PAS A;  3KHE A;  5FYX A;  5D69 A;  3WXA A;  2F3Z A;  2M1U A;  1L2O B;  4NDB A;  3HCM A;  2AMI A;  1KFX S;  1IRJ A;  2Y1M A;  3CZ0 A;  2KFH A;  4XJK A;  5DKQ A;  2BBN A;  3V2L A;  1WLZ A;  1YUS A;  1IJ5 A;  1KQM B;  1W9Z A;  2BAP A;  2RGI A;  2NXQ A;  4ETO A;  1XFZ O;  3B87 A;  3CAB A;  3D78 A;  1K8U A;  3S0A A;  1H4B A;  1M63 B;  2QEV A;  4JD9 A;  1BT6 A;  1A03 A;  1CDN A;  3KEV A;  1GGW A;  2I94 A;  3FWB A;  1DGU A;  1XFX O;  1PVA A;  4P5O E;  1YTZ C;  1M39 A;  2EC6 B;  1REC A;  4YGD B;  5AFP A;  1A75 B;  3VB1 A;  1B9A A;  2F8P A;  1L2O C;  1IGV A;  2K7D A;  2E30 A;  2QDI A;  1MUX A;  1FBV A;  2K2A A;  2K0J A;  3D10 A;  5I94 A;  2I7A A;  1BF5 A;  1QX2 A;  1K2H A;  3NXA A;  4CPV A;  5HYD A;  1KQM C;  4JKT A;  1GJY A;  1QV0 A;  1MXE A;  1IWQ A;  1Y1X A;  2FJY A;  2LM5 A;  3CS1 A;  4WQ3 A;  2L50 A;  4MLW A;  4PHK A;  4CID A;  1A75 A;  1KFX L;  2BKH B;  2LMU A;  4PHN A;  3SJS A;  1K90 D;  3BFB A;  1NX2 A;  2EC6 C;  3CR5 X;  1DJW A;  1YVL A;  1IH0 A;  4MBE A;  1DVI A;  1AUI B;  1AJ5 A;  1WDC B;  3EK4 A;  3PN7 B;  4ICB A;  2JNF A;  3FE6 A;  1H8B A;  4OVN F;  4WRI A;  1SKT A;  4TNC A;  2LUC A;  5TNC A;  1CFF A;  3DVK A;  2HQ8 A;  1DEL A;  1TNX A;  1B8L A;  1OW4 A;  1YRT B;  4HSZ A;  1OZS A;  3SS4 A;  3LL8 B;  3BQ3 A;  4JWQ A;  4F0Z B;  2H61 A;  3A4U B;  1QTX A;  5I2L A;  4OZD A;  2L5Y A;  4BY4 A;  1J7P A;  1IKU A;  1K9P A;  1NWD A;  3EKH A;  2BCX A;  1J55 A;  1K96 A;  1SL7 A;  2JXL A;  3PM2 A;  1K9K A;  1SR6 B;  2F33 A;  3BYA A;  3DVJ A;  1YR5 A;  2BKI B;  1WDC C;  2OTG B;  3I5G B;  4MSP A;  1RJV A;  2KQ6 A;  3VRQ A;  3DD4 A;  5CSJ A;  5F6T A;  3AAK A;  3S0D A;  1J1D A;  4M2Q A;  1BOC A;  4MRX A;  2ZRS A;  3EVR A;  1EG3 A;  4AQJ A;  2JRF A;  2QPT A;  5I2Q A;  2LNK A;  1PK0 D;  2LVV A;  1SNL A;  2LVJ A;  2ZRT A;  1MWN A;  1KSM A;  1QVI Z;  1N0Y A;  1QVI Y;  2KBM A;  3DXL A;  4YBH B;  5FI7 A;  5HL1 A;  1C7V A;  1OMR A;  1DGV A;  3R72 A;  1WLM A;  1JWD A;  4OKH A;  3KO0 A;  2AAO A;  3OX6 A;  2LAN A;  2LMT A;  4QJ4 B;  4YI9 A;  2BCB A;  2KQY A;  4P2Y B;  4Q04 A;  1DT7 B;  3KPX A;  3I5G C;  1B8R A;  1KK8 B;  3EKJ A;  1RRO A;  2GTE A;  1J1E A;  5AXI A;  3GK2 A;  2CBL A;  2MHH A;  4MRY A;  2LE9 B;  4A4B A;  3JVT C;  1B1G A;  2OS8 B;  1DC1 A;  4XYN A;  1CM1 A;  1DQE A;  1SK6 D;  1P28 A;  3NHT A;  5HKY A;  1QAS A;  1ZMZ A;  2MJW B;  2LUX A;  1OE9 B;  1S36 A;  2JT0 A;  4MZJ A;  2L4I A;  1B8C A;  2CCM A;  4PE0 A;  1YX8 A;  2LVK A;  1SY9 A;  1V1F A;  2Q4U A;  3CR4 X;  3PFV A;  1NX1 A;  5D7F A;  3BUN B;  5D3O A;  4YGE B;  2F2P A;  1A2X A;  4JQ0 D;  1FPW A;  1KK8 C;  1GQM A;  1GGZ A;  3VRP A;  3PAT A;  1OOF A;  1UHJ A;  1NP8 A;  2FCE A;  3DVM A;  5B8I B;  2F3Y A;  3DZT A;  1CMF A;  1B47 A;  2OS8 C;  1YUR A;  1K9U A;  1NCY A;  1YUT A;  4UPG A;  2ZND A;  2BE6 A;  1RFJ A;  4YGA A;  1TRF A;  1CFD A;  5CSI A;  3GOF A;  3NSI A;  1N2D A;  3PJI A;  2LLU A;  1MR8 A;  3TZ1 A;  4CLN A;  3NSO A;  3OX5 A;  1E8A A;  2L51 A;  2L4H A;  3QRX A;  1EXR A;  1DEK A;  1LXF C;  2AUC A;  1DF0 A;  3I5I B;  1IJ6 A;  4DRW A;  1JFJ A;  3O2P A;  2M3W A;  1Y0V H;  1AJ4 A;  1FI6 A;  3BOW A;  5I2O A;  2M97 A;  4INX A;  4PE7 A;  1BMO A;  1SYM A;  2QEB A;  1LA3 A;  3AKA A;  2O60 A;  1FF1 A;  4I5L B;  2LP3 A;  1TCF A;  1QS7 A;  1KWO B;  3AKB A;  3CTN A;  4PDZ A;  2K7B A;  1JF2 A;  3TS5 B;  4DS7 A;  2KPH A;  3WNX B;  1DTL A;  2MA2 A;  1OOG A;  5AEQ A;  1YUU A;  1OQP A;  1S1E A;  2DOQ A;  1CTR A;  1N65 A;  4F7F A;  1TNW A;  1BR4 B;  3JTD C;  1TIZ A; 
#chains in the Genus database with same CATH homology
 2JC2 A;  1C07 A;  1AVS A;  1SBJ A;  2KFG A;  3I5I C;  1DMO A;  4GGF A;  5JOL A;  1UUS A;  1SRA A;  1B7T Z;  1TNP A;  2KYC A;  3BUW B;  3LK0 A;  1JUO A;  1MQ1 A;  1B7T Y;  2PMY A;  1KSO A;  2GGM A;  3PSR A;  1PSR A;  3RLZ A;  3VRN A;  4ORB B;  1KFU S;  4OCI A;  1SMG A;  4ORA B;  4CFQ A;  1DJY A;  2HF5 A;  2MBX A;  3ICB A;  5HKZ A;  2ZKM X;  1KCY A;  5CSF A;  3IF7 A;  4AQI A;  3HX4 A;  1L7Z A;  4GUK A;  4ZCU A;  2LAP A;  5KU1 A;  1JFK A;  1OMV A;  2HQW A;  2NZ0 A;  2NLN A;  2Q91 A;  2LVI A;  2NCO A;  3FS7 A;  2JT3 A;  2L5X B;  3TUY B;  2I18 A;  1BOD A;  3C1V A;  3CR2 A;  3LK1 A;  4WQ2 A;  2L98 A;  4N5X A;  2M0R A;  2SAS A;  1XK4 A;  1BU3 A;  1QIV A;  1UWO A;  1CDL A;  1BR1 B;  3VRR A;  1NCX A;  3GK1 A;  1CFP A;  1NX0 A;  1XK4 C;  2H61 C;  3GK4 X;  3SG5 A;  3DVE A;  3PLF B;  1ZFS A;  1ALV A;  3EVU A;  4FQO A;  1YVH A;  4MEW A;  1UHK A;  1K95 A;  2EGD A;  4M2P A;  1KFU L;  3PN7 C;  1LVC D;  1RTP 1;  1W7I B;  1WY9 A;  1DJX A;  3TUY C;  1F71 A;  2CT9 A;  1PRW A;  2LLS A;  3DF0 A;  1KK7 Z;  1NIW A;  3BUO B;  1KK7 Y;  2K61 A;  1S26 D;  2E6W A;  1DJG A;  2VRG A;  3FIA A;  4GPL B;  2O5G A;  2CTN A;  1RK9 A;  4C0L A;  2LP2 A;  2WOR A;  1TCO B;  2Y5I A;  2BCA A;  1BJF A;  3OB2 B;  5JJG A;  2LC5 A;  3VGO A;  1NX3 A;  2FCD A;  1SR6 C;  4C0K A;  1C7W A;  3A8R A;  1WRK A;  2OTG C;  3WHT B;  3M0W A;  3SG6 A;  1S3P A;  3D0Y A;  3NSK A;  2G9B A;  1PSB A;  4PHJ A;  2BEC A;  2MAZ A;  4I5N B;  5CPV A;  1EJ3 A;  2WCB A;  2HET A;  2MLE C;  4HRG A;  1CFC A;  3IQO A;  2K8M B;  1QV1 A;  4PE1 A;  1XVJ A;  2FOT A;  2K2F A;  2M49 B;  4M2O A;  1XFW O;  1ZOT B;  1Y6W A;  1ZAC A;  1XFY O;  5PAL A;  1Y1U A;  2JTT A;  1K93 D;  1CB1 A;  2KAX A;  3CZT X;  4NDD A;  3SG2 A;  4DCK A;  2JPT A;  1NUB A;  3SG4 A;  1MHO A;  2Y4Q A;  1FW4 A;  1TOP A;  5KSZ A;  1BG1 A;  1KQV A;  5DKR A;  1QLK A;  2KI4 B;  2WOS A;  1MF8 B;  1CKK A;  1DF0 B;  3I5H B;  5KTY A;  1XFU O;  1MXL C;  3OP0 A;  2K7C A;  1QLS A;  2KGB C;  4OV2 A;  1DJI A;  1JC2 A;  4GBA A;  3H4S E;  3BOW B;  1EG4 A;  4YGC B;  1CLM A;  2KAV A;  1QX7 A;  1J7Q A;  1VRK A;  1S5G Z;  1HQV A;  3WHU B;  1SCM B;  1S5G Y;  5ER4 X;  5J3X A;  1TTX A;  2ISD A;  2ZN9 A;  1PUL A;  1BLQ A;  3TDU A;  1M45 A;  1QJT A;  1CLB A;  2JOJ A;  1OMD A;  3EK8 A;  4PHM A;  3O4Y A;  5CSN A;  2KI4 C;  3CGA A;  1HT9 A;  5I8N A;  1EL4 A;  3I5H C;  2KFF A;  2M7N A;  2KHN A;  2JU0 A;  1UHI A;  2BL0 B;  3F45 A;  3CLN A;  3KF9 A;  3O78 A;  1SCM C;  3BUX B;  2K7O A;  3I5F B;  1IQ5 A;  5IBW A;  2PSR A;  1LIN A;  4FTG A;  2KI6 C;  2PAL A;  4USL A;  4N1F A;  1U5I B;  1XA5 A;  2IS9 A;  1R6P A;  2KI6 D;  3EK7 A;  5K89 A;  2BE4 A;  2CXJ A;  1Y1A A;  1CLL A;  1EH2 A;  4GGF C;  3SIA A;  2I2R E;  1F55 A;  3PAL A;  2BL0 C;  1KWO C;  2ZFD A;  4JPZ B;  2B1U A;  3TS5 C;  1RWY A;  2BBM A;  1XYD A;  3ZNI A;  3SG3 A;  3I5F C;  1F70 A;  4I5K A;  1YX7 A;  1QXP A;  2KDH A;  1NPQ A;  2WC8 A;  1U5I A;  4U8D A;  1A4P A;  2LHI A;  2MLF C;  1SCV A;  1S6C A;  4PAL A;  5G08 A;  1SW8 A;  4GGN A;  1ODB A;  2PVB A;  2JNX A;  2L0P A;  1G4Y R;  1NYA A;  2JWW A;  1A29 A;  5DKN A;  4QJ5 B;  1CDM A;  2LLT A;  2G2B A;  4MZL A;  3DF0 B;  3LLE A;  5HLO A;  4MVF A;  1SL8 A;  1CMG A;  1F4O A;  4MZK A;  4YI8 A;  4DUQ A;  2JQ6 A;  1F4Q A;  4C0J A;  3E3R A;  5GQQ C;  2COL B;  4BY5 A;  3TDI A;  2KBI A;  1PVB A;  3OHM B;  4PE4 A;  1FI5 A;  1IG5 A;  1CDP A;  1TN4 A;  2FJU B;  2LCP A;  1YRU B;  1ZUZ A;  2H2K A;  1JF0 A;  4IL1 A;  3EVV A;  3D0Y B;  1LA0 A;  1D1O A;  4HRH A;  3TDZ A;  1CNP A;  1DJH A;  3OB1 B;  4ORC B;  2A4J A;  2LV7 A;  4DIR A;  5HKW A;  2M29 A;  1OZO A;  4A4C A;  3VRO A;  1R2U A;  5AER A;  4ZCV A;  2WCE A;  4I5J A;  1B4C A;  2OPO A;  1G8I A;  3MSE B;  5HLV A;  4PCW A;  4YGB B;  1NCZ A;  1QX5 B;  1S6J A;  1SL9 A;  1F8H A;  3NSL A;  1WRZ A;  1DJZ A;  3SG7 A;  2M9G A;  1S6I A;  1F54 A;  1J7R A;  2F2O A;  2KYF A;  2LMV A;  3BUM B;  1X02 A;  3JVT B;  1Q80 A;  2V53 A;  1QIW A;  5ER5 A;  1ALW A;  4MN0 A;  4OR9 B;  2D8N A;  2GV5 A;  1NSH A;  2NCP A;  1OOJ A;  1SPY A;  2GGZ A;  2KSP A;  4L9M A;  1JBA A;  1V1G A;  2Y1N A;  2KGR A;  4R1E A;  1QAT A;  2JT8 A;  1PAL A;  4CFR A;  5AAN A;  2M8U A;  4NDC A;  1XO5 A;  3AAJ A;  1G33 A;  2HPS A;  2ZN8 A;  2R2I A;  3ZWH A;  1IQ3 A;  1M46 A;  1UUR A;  1J7O A;  2WCF A;  2WND A;  1AP4 A;  2MRD A;  2M7L A;  2JXC A;  3SIB A;  2ZNE A;  4GNK B;  4N1G A;  4AOM A;  1CM4 A;  2KAY A;  2M1K B;  1K94 A;  4YRU A;  1AHR A;  3RM1 A;  2JZI A;  2JTZ A;  1OSA A;  1AK8 A;  4E68 A;  2EHB A;  1W7J B;  1M31 A;  3IQQ A;  4GAO A;  2LHL A;  2PRU A;  4QJ3 B;  1JSA A;  4HRE E;  2SCP A;  2TN4 A;  3PM8 A;  4XJK B;  1UHH A;  4D1E A;  3FWC A;  2L2E A;  1XFV O;  1UHN A;  4NQG A;  3LCP C;  2KNE A;  5BPJ A;  2JUL A;  1TNQ A;  2KOT A;  2P6B B;  2QAC A;  3BXK A;  3CWG A;  4GFT A;  2CNP A;  1WRL A;  3K21 A;  1LKJ A;  3JTD B;  3O6B A;  1UP5 A;  2PAS A;  3KHE A;  5FYX A;  5D69 A;  3WXA A;  2F3Z A;  2M1U A;  1L2O B;  4NDB A;  3HCM A;  2AMI A;  1KFX S;  1IRJ A;  2Y1M A;  4XJK A;  2KFH A;  5DKQ A;  2BBN A;  1WLZ A;  1YUS A;  1IJ5 A;  1KQM B;  2RGI A;  2NXQ A;  4ETO A;  1XFZ O;  1K8U A;  1H4B A;  1M63 B;  1BT6 A;  1A03 A;  1CDN A;  3KEV A;  1GGW A;  2I94 A;  3FWB A;  1DGU A;  1XFX O;  1PVA A;  4P5O E;  1YTZ C;  1M39 A;  2EC6 B;  1REC A;  4YGD B;  5AFP A;  1A75 B;  1B9A A;  2F8P A;  1L2O C;  1IGV A;  2K7D A;  2E30 A;  3D10 A;  1MUX A;  1FBV A;  2K2A A;  2K0J A;  2I7A A;  1BF5 A;  1QX2 A;  1K2H A;  3NXA A;  4CPV A;  5HYD A;  1KQM C;  1GJY A;  1QV0 A;  1MXE A;  1IWQ A;  1Y1X A;  2LM5 A;  3CS1 A;  4WQ3 A;  2L50 A;  4MLW A;  4PHK A;  4CID A;  2BKH B;  1A75 A;  1KFX L;  2LMU A;  4PHN A;  3SJS A;  1K90 D;  1NX2 A;  2EC6 C;  3CR5 X;  1DJW A;  1YVL A;  1IH0 A;  4MBE A;  1DVI A;  1AUI B;  1AJ5 A;  1WDC B;  3EK4 A;  3PN7 B;  4ICB A;  2JNF A;  1H8B A;  4OVN F;  4WRI A;  1SKT A;  4TNC A;  2LUC A;  5TNC A;  1CFF A;  3DVK A;  2HQ8 A;  1TNX A;  1B8L A;  1YRT B;  4HSZ A;  1OZS A;  3LL8 B;  3BQ3 A;  4JWQ A;  4F0Z B;  2H61 A;  3A4U B;  1QTX A;  5I2L A;  4BY4 A;  1J7P A;  1IKU A;  1K9P A;  1NWD A;  3EKH A;  2BCX A;  1J55 A;  1K96 A;  1SL7 A;  2JXL A;  1K9K A;  1SR6 B;  2F33 A;  3BYA A;  3DVJ A;  1YR5 A;  2BKI B;  1WDC C;  2OTG B;  3I5G B;  4MSP A;  1RJV A;  2KQ6 A;  3VRQ A;  3DD4 A;  5CSJ A;  5F6T A;  3AAK A;  1J1D A;  4M2Q A;  1BOC A;  4MRX A;  2ZRS A;  3EVR A;  1EG3 A;  4AQJ A;  2JRF A;  2QPT A;  5I2Q A;  2LNK A;  1PK0 D;  2LVV A;  1SNL A;  2LVJ A;  2ZRT A;  1MWN A;  1KSM A;  1QVI Z;  1N0Y A;  1QVI Y;  2KBM A;  4YBH B;  1C7V A;  1OMR A;  1DGV A;  1WLM A;  1JWD A;  4OKH A;  3KO0 A;  2AAO A;  3OX6 A;  2LAN A;  2LMT A;  4QJ4 B;  4YI9 A;  2BCB A;  2KQY A;  4P2Y B;  4Q04 A;  1DT7 B;  3KPX A;  3I5G C;  1B8R A;  1KK8 B;  3EKJ A;  1RRO A;  1J1E A;  5AXI A;  3GK2 A;  2CBL A;  2MHH A;  4MRY A;  2LE9 B;  4A4B A;  3JVT C;  1B1G A;  2OS8 B;  4XYN A;  1CM1 A;  1SK6 D;  5HKY A;  1QAS A;  1ZMZ A;  2MJW B;  2LUX A;  1OE9 B;  1S36 A;  2JT0 A;  4MZJ A;  2L4I A;  1B8C A;  2CCM A;  4PE0 A;  1YX8 A;  2LVK A;  1SY9 A;  1V1F A;  2Q4U A;  3CR4 X;  3PFV A;  1NX1 A;  5D7F A;  3BUN B;  4YGE B;  2F2P A;  1A2X A;  4JQ0 D;  1FPW A;  1KK8 C;  1GQM A;  1GGZ A;  3VRP A;  3PAT A;  1UHJ A;  1NP8 A;  2FCE A;  3DVM A;  5B8I B;  2F3Y A;  1CMF A;  1B47 A;  2OS8 C;  1YUR A;  1K9U A;  1NCY A;  1YUT A;  4UPG A;  2ZND A;  2BE6 A;  1RFJ A;  4YGA A;  1TRF A;  1CFD A;  5CSI A;  3GOF A;  3NSI A;  1N2D A;  3TZ1 A;  2LLU A;  1MR8 A;  4CLN A;  3NSO A;  3OX5 A;  1E8A A;  2L51 A;  2L4H A;  3QRX A;  1EXR A;  1LXF C;  2AUC A;  3I5I B;  1DF0 A;  4DRW A;  1IJ6 A;  1JFJ A;  3O2P A;  2M3W A;  1Y0V H;  1AJ4 A;  1FI6 A;  3BOW A;  5I2O A;  2M97 A;  4PE7 A;  1BMO A;  1SYM A;  1LA3 A;  3AKA A;  2O60 A;  1FF1 A;  4I5L B;  2LP3 A;  1TCF A;  1QS7 A;  1KWO B;  3AKB A;  3CTN A;  4PDZ A;  2K7B A;  1JF2 A;  3TS5 B;  4DS7 A;  3WNX B;  1DTL A;  2MA2 A;  5AEQ A;  1YUU A;  1OQP A;  1S1E A;  2DOQ A;  1CTR A;  1N65 A;  1TNW A;  1BR4 B;  3JTD C;  1TIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...