2M3WA

Protein structure determination from a set of 4d noesy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Determination of protein structure from a set of 4D NOESY performed with non uniform sampling
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m3wA00
2LLUA 1AJ4A 1SL8A 4AQIA 2JT3A 4PE4A 1CKKA 2WOSA 1DMOA 2JT8A 2LMVA 1IQ3A 1QX2A 3WHTB 1QATA 3AAJA 5F6TA 3KPXA 1DGUA 3JVTC 2QPTA 1F71A 1QIVA 2PALA 1CMGA 2COLB 4NDDA 3CR5X 2OTGB 1SY9A 4U8DA 2K2FA 2L2EA 3SG7A 2M97A 5AANA 1CLLA 1KK7Y 1AVSA 1IG5A 1MWNA 2K7DA 2F2PA 4OKHA 3BUMB 4IL1A 1DJIA 2KNEA 2FCEA 2LV7A 1LVCD 4AQJA 2BKIB 2H2KA 1N2DA 1KCYA 3OB2B 1NX0A 1PRWA 1S5GY 1K90D 1VRKA 3O6BA 1MHOA 1NCXA 1YVLA 1TTXA 1J7PA 2L51A 1NIWA 1BJFA 3PLFB 4L9MA 3BUWB 1A75A 2QACA 1RROA 1W7JB 3PM8A 2I2RE 2P6BB 3BOWA 4YGCB 2M7NA 4ZCVA 2I7AA 4R1EA 1WRLA 3SJSA 3PALA 1Y1AA 2LLTA 1YX7A 1MXEA 2ZNEA 4I5JA 2GGMA 3AKBA 1YVHA 2F3YA 2KAVA 3I5HC 1K8UA 3PN7B 4OV2A 3DVKA 1S3PA 3DVEA 4YGEB 1S26D 1A29A 5HLOA 4ETOA 1A4PA 3CR4X 2KYCA 2JPTA 1XK4C 1JBAA 2KFGA 3I5GB 3NXAA 1A03A 1Y1XA 2L4IA 2BCXA 2F3ZA 2PMYA 1TCFA 2NLNA 5HKWA 1TRFA 4BY5A 1KQMB 1RJVA 1F8HA 2I94A 1CDPA 1EG4A 5BPJA 1S1EA 1AJ5A 5HKYA 2NCPA 2Y1NA 1DJWA 4PALA 2SASA 1RFJA 3TS5B 1DGVA 4CLNA 4YGDB 1ZUZA 4Q04A 3CGAA 1UHKA 1EH2A 1NP8A 1NCYA 3NSKA 3GOFA 2OS8B 2JNFA 2FOTA 1OMDA 3SG4A 1BODA 2RGIA 1IRJA 1JF0A 1B47A 2M9GA 3JTDB 4D1EA 1DF0A 1TNQA 2PSRA 4JQ0D 1J1DA 1XFXO 4UPGA 1DTLA 1X02A 2ZRTA 1QJTA 1GGWA 1B8RA 1CDLA 4WRIA 1L7ZA 1KK8C 2KOTA 3BUNB 2BBMA 2KFHA 1BLQA 1EG3A 1SMGA 3I5FB 4DRWA 1QVIY 5AEQA 4DIRA 5I2OA 1S6CA 2F33A 1UHHA 1S36A 2JXCA 3I5IB 4ICBA 1XVJA 1YUSA 2HPSA 4MZKA 2OPOA 1NCZA 3DD4A 1JC2A 1HQVA 3VROA 4F0ZB 1LXFC 1SR6C 2WNDA 3KHEA 4P2YB 1DT7B 2WORA 4NDCA 3TUYC 1PSRA 1IKUA 1WRZA 1K94A 4USLA 2WCFA 1FI5A 1RWYA 1CFFA 3PFVA 4OR9B 4HRHA 2LVKA 1YRTB 1B7TY 2G2BA 1YUTA 5I2LA 3A4UB 5B8IB 4OVNF 1HT9A 1SYMA 2BE6A 1J7OA 1DJYA 2G9BA 2KGBC 2LAPA 2B1UA 1QX7A 1MXLC 1DJXA 4PHJA 2OTGC 2K7OA 1QASA 2GV5A 2AMIA 5CPVA 1DF0B 1SL7A 2I18A 1JF2A 4XJKA 1ZOTB 1RECA 2F8PA 1OMVA 4NDBA 1AUIB 1N65A 1FPWA 2H61C 4GNKB 2LC5A 1CFDA 4HREE 3D10A 1ZACA 2LCPA 1PSBA 1PVBA 1SW8A 3H4SE 2EC6B 2KSPA 3WHUB 4FTGA 1Y1UA 2MRDA 2CXJA 5CSFA 2AUCA 4GPLB 5G08A 1AP4A 3CR2A 3IQQA 3O4YA 4I5KA 2M49B 1WY9A 1IGVA 1TN4A 1WDCB 1SKTA 2KFFA 1XFVO 2CBLA 1EJ3A 2BE4A 3OHMB 3SG3A 2M1UA 1U5IB 4WQ2A 2LUXA 1K9UA 3DVJA 3IQOA 1UP5A 1NYAA 1XFWO 2AAOA 2BL0B 4N1FA 5CSNA 3WNXB 2PVBA 1GQMA 4MLWA 2LMTA 3SIBA 1B9AA 3VRQA 3SG2A 2K0JA 2MLFC 5CSJA 4DS7A 5CSIA 1FBVA 5HYDA 3NSOA 3LL8B 4I5LB 4BY4A 1QIWA 2JTTA 2MBXA 3JVTB 4PE0A 1OZOA 1NX2A 2PASA 3BUXB 1XK4A 4CPVA 2JT0A 2KYFA 3DF0A 3I5GC 4MRYA 1SBJA 1JFKA 3FWBA 1BMOA 3EVVA 2R2IA 5KU1A 1YR5A 2HQ8A 4FQOA 4ZCUA 5PALA 2L98A 1BOCA 2D8NA 1G4YR 4M2PA 1CDMA 4MEWA 1K93D 4ORCB 5FYXA 2L4HA 1DJGA 4JWQA 4MRXA 5K89A 1AK8A 1PALA 1OOJA 4MN0A 3SG5A 1QX5B 1RTP1 1TOPA 1SRAA 3OB1B 4CFRA 5GQQC 1YUUA 2OS8C 2ZRSA 1C7VA 2Y1MA 3EK8A 1F54A 1CMFA 2O60A 3EK7A 3SIAA 3D0YA 1CLMA 2MHHA 4GGFC 3PATA 5KTYA 2F2OA 1QLSA 1YX8A 2LP2A 1ZFSA 3VRRA 2EGDA 1YURA 1B1GA 3I5FC 1WLZA 1FI6A 5DKRA 4PDZA 2JQ6A 3OX5A 3I5HB 1GJYA 2M29A 3LLEA 5KSZA 1A75B 3AAKA 1MUXA 3I5IC 3EKHA 1W7IB 3BOWB 1F70A 1KQVA 1D1OA 2TN4A 4MBEA 1NWDA 4WQ3A 2FCDA 4I5NB 4N1GA 3EVRA 1SCMB 1IH0A 1J55A 1JSAA 4PHKA 1NSHA 1K96A 1TNWA 3LK0A 1LKJA 1ALVA 4YGBB 1QLKA 1CLBA 4DCKA 2ZKMX 4YI8A 5I8NA 5J3XA 1B8CA 1PVAA 1KK7Z 5HLVA 2MJWB 1JWDA 1KWOB 2DOQA 3EKJA 1R2UA 1KFUL 2HF5A 2KQ6A 3TDIA 2LANA 4JPZB 2MA2A 1S5GZ 1L2OB 3AKAA 1MQ1A 1SK6D 4E68A 4GBAA 5AERA 1SL9A 1V1GA 1M31A 3SG6A 1IJ5A 2MLEC 3CWGA 1IQ5A 2H61A 3NSIA 4TNCA 1NX1A 2KQYA 3D0YB 1H8BA 1N0YA 2IS9A 1UHNA 1XA5A 4C0JA 2KBMA 5ER4X 1F4QA 1TIZA 1E8AA 4ORAB 4MVFA 2K2AA 2JWWA 4GFTA 4A4BA 1XFUO 1WDCC 3EVUA 3C1VA 3E3RA 3NSLA 2KAYA 3CLNA 4DUQA 1NPQA 2NXQA 2ZN8A 3RM1A 2CT9A 1QV0A 4QJ3B 2BL0C 1IWQA 1KSOA 4N5XA 2KHNA 1CDNA 2K7CA 4PCWA 1BU3A 1TNXA 2Y5IA 3OX6A 2CNPA 1C07A 4PE1A 1CFCA 1M45A 2BBNA 1ALWA 3FS7A 3QRXA 3PSRA 2JU0A 2HQWA 1IJ6A 1TNPA 2JRFA 1UWOA 1CM1A 2ZNDA 2EHBA 4GGNA 4XYNA 2ISDA 3VRNA 4GUKA 1QS7A 2K8MB 1J7RA 2KGRA 2KI4B 3KF9A 1WRKA 3MSEB 2M8UA 2V53A 3GK4X 3CZTX 4M2QA 4HSZA 3WXAA 5DKNA 3PN7C 4P5OE 4GAOA 5AXIA 4CFQA 1F4OA 5JJGA 1OMRA 1V1FA 1KFUS 2LP3A 1KFXL 1MR8A 3DVMA 3TDUA 3KO0A 2M1KB 3VGOA 2Y4QA 2LVVA 5JOLA 2JOJA 3ZNIA 1UURA 1R6PA 3KEVA 1QVIZ 2LM5A 2KBIA 1KQMC 2KAXA 4AOMA 4XJKB 3HCMA 3LK1A 2M3WA 1RK9A 3IF7A 1BF5A 4YI9A 2GGZA 1S6IA 1ODBA 2FJUB 2K7BA 4GGFA 4M2OA 3TS5C 1KSMA 1F55A 2ZN9A 1OSAA 2LMUA 1GGZA 1A2XA 4YGAA 1SPYA 1K2HA 2LVIA 3JTDC 1BT6A 1B7TZ 1G8IA 3LCPC 2L50A 4HRGA 3O2PA 4PHNA 3ICBA 4MZLA 5DKQA 1FF1A 1M39A 1NUBA 3RLZA 1B4CA 1PK0D 3BUOB 1SCVA 4OCIA 4CIDA 1SCMC 1B8LA 1G33A 1MF8B 3BYAA 5TNCA 1BG1A 1NX3A 3VRPA 1CB1A 5D69A 2KI6C 2E30A 3O78A 1AHRA 1CFPA 2CTNA 2LLSA 2LHLA 2BECA 3OP0A 2LUCA 1M46A 1JUOA 1QV1A 1Y0VH 2Q4UA 1CNPA 2KI6D 4A4CA 3TDZA 1TCOB 1KWOC 1DVIA 2VRGA 1K9KA 2A4JA 2L5XB 1BR1B 3TZ1A 1JFJA 2SCPA 3DF0B 1L2OC 4NQGA 4YBHB 2NZ0A 1OQPA 5I2QA 2O5GA 1YTZC 1UUSA 5HKZA 1YRUB 2LVJA 3K21A 2L0PA 2LE9B 2ZFDA 4ORBB 1KFXS 3FWCA 2BKHB 3FIAA 1EXRA 1Q80A 1BR4B 1XFZO 2JXLA 4C0KA 1Y6WA 4QJ4B 1K95A 1S6JA 3CS1A 2M0RA 2LHIA 3F45A 1XO5A 1C7WA 3GK2A 2JZIA 3EK4A 1UHJA 4PHMA 1H4BA 1CTRA 1SNLA 2LNKA 2WCBA 3BXKA 2M7LA 2K61A 2MAZA 3M0WA 2E6WA 5AFPA 4MZJA 3A8RA 4C0LA 2CCMA 1KK8B 4QJ5B 1LA3A 1QTXA 3ZWHA 1K9PA 1J1EA 1OE9B 1XYDA 2EC6C 1OZSA 1M63B 1QXPA 1U5IA 4PE7A 2BCAA 4MSPA 4YRUA 1LINA 1ZMZA 2KDHA 2PRUA 1DJZA 2JTZA 2Q91A 2HETA 2JNXA 3BQ3A 2WC8A 2BCBA 1PULA 2JULA 3CTNA 5D7FA 1LA0A 1SR6B 2NCOA 5IBWA 1UHIA 3TUYB 2WCEA 1WLMA 1J7QA 1FW4A 2JC2A 1XFYO 1EL4A 2KI4C 3HX4A 5ER5A 3GK1A 1DJHA 1CM4A
chains in the Genus database with same CATH superfamily
2LLUA 1AJ4A 1SL8A 4AQIA 2JT3A 4PE4A 1CKKA 2WOSA 1DMOA 2JT8A 2LMVA 3OBVA 1IQ3A 1QX2A 3WHTB 1QATA 3AAJA 3EG5B 5F6TA 1OOHA 3KPXA 1DGUA 3JVTC 2QPTA 1F71A 1QIVA 2PALA 1CMGA 2COLB 4NDDA 3CR5X 2OTGB 1SY9A 4U8DA 2K2FA 2L2EA 3SG7A 2M97A 5AANA 1CLLA 2KLDA 1KK7Y 1AVSA 1IG5A 1MWNA 2K7DA 2F2PA 4OKHA 3BUMB 4IL1A 3CYZA 1DJIA 2KNEA 2FCEA 2LV7A 1LVCD 4AQJA 2BKIB 2H2KA 1N2DA 3B6XA 3O4XA 1KCYA 3OB2B 1NX0A 1PRWA 1S5GY 4PT1A 1K90D 1VRKA 3CABA 3O6BA 3SS4A 1MHOA 1NCXA 3D76A 1YVLA 3L47A 1TTXA 1J7PA 2L51A 1NIWA 1BJFA 3PLFB 4L9MA 3UO9A 3BUWB 1A75A 2QACA 1RROA 1W7JB 3PM8A 2I2RE 2P6BB 3BOWA 4YGCB 2M7NA 4ZCVA 2I7AA 1DC1A 4F7FA 4R1EA 1WRLA 3SJSA 3PALA 1Y1AA 2LLTA 5FI2A 1YX7A 1MXEA 2ZNEA 1P28A 4I5JA 4OZDA 2GGMA 1OOIX 3AKBA 1YVHA 2F3YA 2KAVA 3I5HC 1K8UA 3PN7B 4OV2A 3DVKA 1S3PA 3DVEA 4YGEB 1S26D 4INXA 1A29A 5HLOA 3L4AA 4ETOA 1A4PA 1TUZA 2KYCA 2JPTA 1T14A 3CR4X 1XK4C 3S0AA 1JBAA 2KFGA 3I5GB 3NGVA 3NXAA 1A03A 1Y1XA 2L4IA 1IIOA 2BCXA 2F3ZA 2PMYA 1TCFA 2NLNA 5HKWA 1TRFA 4BY5A 1KQMB 1RJVA 5D3OA 1F8HA 2I94A 1CDPA 1EG4A 3R1VA 5BPJA 1S1EA 1Z4HA 1AJ5A 2KLEA 5HKYA 2NCPA 2Y1NA 1DJWA 1OW4A 4PALA 2SASA 1RFJA 3TS5B 1DGVA 4CLNA 4YGDB 1ZUZA 4Q04A 3CGAA 1UHKA 1EH2A 1NP8A 3R72A 1NCYA 3NSKA 3GOFA 2OS8B 2JNFA 2FOTA 3UNWA 1OMDA 3SG4A 1BODA 1QWVA 2RGIA 1IRJA 1JF0A 1B47A 2M9GA 3JTDB 4D1EA 1DF0A 1TNQA 2PSRA 4JQ0D 1J1DA 1XFXO 4UPGA 1DTLA 1X02A 1TUJA 1QJTA 2ZRTA 1GGWA 1B8RA 1CDLA 4WRIA 4INWA 1L7ZA 1KK8C 2KOTA 3BUNB 1LS8A 2BBMA 2KFHA 1BLQA 3R1OA 1EG3A 1SMGA 3I5FB 4DRWA 1QVIY 5AEQA 4DIRA 5I2OA 1S6CA 2F33A 1UHHA 1S36A 2JXCA 3I5IB 4ICBA 1XVJA 2QEVA 1YUSA 1DQEA 2HPSA 4MZKA 2OPOA 1NCZA 3DD4A 1JC2A 1HQVA 3VROA 2KPHA 4F0ZB 1LXFC 1SR6C 2WNDA 3B87A 3KHEA 4P2YB 1DT7B 2WORA 3K1EA 4NDCA 3TUYC 1PSRA 1IKUA 5I94A 1WRZA 1K94A 4USLA 2WCFA 1FI5A 1RWYA 1CFFA 3PFVA 2BAPA 4OR9B 4HRHA 2LVKA 1YRTB 1B7TY 2G2BA 3D73A 1YUTA 5I2LA 3A4UB 5B8IB 4OVNF 1HT9A 1SYMA 2BE6A 1J7OA 1DJYA 2G9BA 2KGBC 2LAPA 2B1UA 1QX7A 1MXLC 1DJXA 4PHJA 2OTGC 3S0FA 2K7OA 2QEBA 1QASA 2GV5A 2AMIA 3NHTA 5CPVA 1DF0B 1SL7A 2I18A 1JF2A 4XJKA 1ZOTB 1RECA 2F8PA 1OMVA 4NDBA 1AUIB 1N65A 1FPWA 2H61C 4GNKB 2LC5A 1CFDA 4HREE 3D10A 1ZACA 2LCPA 3D77A 1PSBA 1PVBA 1SW8A 3H4SE 3D74A 2EC6B 2KSPA 3WHUB 4FTGA 1Y1UA 2MRDA 2CXJA 2L2CA 2AUCA 4GPLB 5CSFA 5G08A 1AP4A 3CR2A 3IQQA 3O4YA 4I5KA 2M49B 1WY9A 3S0BA 1IGVA 1TN4A 1OOFA 1WDCB 1SKTA 3NHIA 2ERBA 2KFFA 1XFVO 2CBLA 1EJ3A 2BE4A 3OHMB 3SG3A 2M1UA 1U5IB 4WQ2A 2LUXA 1K9UA 3DVJA 3IQOA 1UP5A 1NYAA 1XFWO 2AAOA 3SS5A 2BL0B 4N1FA 5CSNA 3WNXB 2PVBA 1GQMA 1XFRA 2LMTA 4MLWA 1B9AA 3SIBA 3VRQA 3SG2A 2K0JA 2MLFC 5CSJA 4DS7A 5CSIA 1FBVA 5HYDA 3NSOA 3LL8B 4I5LB 2QDIA 4BY4A 5HL1A 1QIWA 2JTTA 2MBXA 3JVTB 4PE0A 1OZOA 1NX2A 2PASA 3BUXB 1XK4A 4CPVA 2JT0A 2KYFA 3DF0A 3I5GC 4MRYA 3VB1A 2QEHA 1SBJA 1JFKA 3B7AA 3FWBA 1BMOA 3EVVA 2R2IA 5KU1A 1YR5A 2HQ8A 4FQOA 4ZCUA 5PALA 2L98A 1BOCA 2D8NA 1G4YR 4M2PA 2L5YA 3Q8IA 1CDMA 4MEWA 1K93D 4ORCB 5FI6A 5FYXA 2L4HA 3B86A 1DJGA 4JWQA 4MRXA 5K89A 1W9ZA 1AK8A 1PALA 1OOJA 4MN0A 3SG5A 1QX5B 1RTP1 1TOPA 1SRAA 3OB1B 4CFRA 5GQQC 1YUUA 2OS8C 2ZRSA 1C7VA 2Y1MA 3EK8A 2WC6A 1F54A 1CMFA 3FE6A 2O60A 3EK7A 3SIAA 3D0YA 1CLMA 2MHHA 4GGFC 3PATA 5KTYA 2F2OA 1QLSA 1YX8A 2LP2A 1ZFSA 3VRRA 2EGDA 1YURA 1B1GA 3I5FC 1WLZA 1FI6A 5DKRA 4PDZA 2JQ6A 3OX5A 3I5HB 1GJYA 2M29A 3LLEA 5KSZA 1A75B 3AAKA 4IJ7A 1MUXA 3I5IC 3EKHA 1W7IB 3BOWB 1F70A 1KQVA 1D1OA 2TN4A 2YGUA 1NWDA 4MBEA 4WQ3A 2FCDA 4I5NB 4N1GA 1H8BA 3EVRA 1SCMB 3S0DA 1IH0A 1J55A 3BFAA 4PHKA 3S0GA 1JSAA 1NSHA 1K96A 1TNWA 3LK0A 3R1PA 1LKJA 1ALVA 4YGBB 1QLKA 1CLBA 4DCKA 2ZKMX 4YI8A 5I8NA 5J3XA 1B8CA 1PVAA 1KK7Z 5DICA 5HLVA 2MJWB 1JWDA 1GM0A 1KWOB 3L4LA 2DOQA 3EKJA 1R2UA 1KFUL 2HF5A 2KQ6A 3TDIA 3S0EA 2LANA 4JPZB 2PYQA 2WCMA 2MA2A 1S5GZ 3IVTA 1L2OB 3AKAA 1MQ1A 1SK6D 3BJHA 3PJIA 3CZ0A 4E68A 1OOGA 4GBAA 5AERA 1SL9A 1V1GA 1M31A 3SG6A 1IJ5A 2MLEC 2JPOA 2H8VA 3CWGA 1IQ5A 2H61A 3BFHA 3NSIA 1NX1A 2KQYA 3D0YB 4TNCA 1N0YA 2IS9A 3V2LA 1UHNA 1XA5A 4C0JA 2KBMA 5ER4X 3RZSA 2BNXA 1F4QA 1TIZA 1E8AA 4ORAB 4MVFA 2K2AA 1Z2CB 2JWWA 1TWOA 4GFTA 4A4BA 1XFUO 1WDCC 3EVUA 2WCJA 3C1VA 2WCLA 3E3RA 3NSLA 2KAYA 3CLNA 2P71A 1NPQA 4DUQA 2NXQA 2ZN8A 3RM1A 2CT9A 1QV0A 4QJ3B 1DEKA 2BL0C 1IWQA 1KSOA 4N5XA 2KHNA 1CDNA 2K7CA 4PCWA 1BU3A 1TNXA 2Y5IA 3OX6A 2CNPA 1C07A 4PE1A 5EL2A 1CFCA 4FQTA 1M45A 2BBNA 1ALWA 3FS7A 3QRXA 3PSRA 2JU0A 2HQWA 1IJ6A 1TNPA 2JRFA 1UWOA 1CM1A 2ZNDA 2EHBA 3FE8A 4GGNA 4XYNA 2ISDA 4GUKA 1QS7A 2K8MB 1J7RA 2KGRA 2KI4B 3DYEA 1WRKA 3KF9A 2M8UA 2V53A 3GK4X 3MSEB 3QMEA 3CZTX 4M2QA 4HSZA 3WXAA 5DKNA 3DXLA 3PN7C 4P5OE 4GAOA 5AXIA 4CFQA 1F4OA 5JJGA 1OMRA 1V1FA 1KFUS 2LP3A 1KFXL 1MR8A 3DVMA 3TDUA 3SS3A 3KO0A 2M1KB 4JD9A 3VGOA 2Y4QA 2LVVA 3CZ2A 2JOJA 5JOLA 3ZNIA 1SSEB 1UURA 1R6PA 3KEVA 3DY9A 1QVIZ 2LM5A 2KBIA 1KQMC 2KAXA 4AOMA 4XJKB 3HCMA 3LK1A 2M3WA 1RK9A 3IF7A 1BF5A 4YI9A 2GGZA 1S6IA 1ODBA 2FJUB 2K7BA 2WC5A 4GGFA 4M2OA 3TS5C 1KSMA 5FI7A 1F55A 2ZN9A 4JKTA 1OSAA 1ORGA 2LMUA 1GGZA 1A2XA 3CDNA 3D75A 4YGAA 2GTEA 1SPYA 1K2HA 2LVIA 2PQLA 3JTDC 1BT6A 1B7TZ 1G8IA 3LCPC 2L50A 4HRGA 3O2PA 4PHNA 3ICBA 4MZLA 5DKQA 1FF1A 1M39A 1NUBA 3RLZA 1B4CA 1PK0D 3BUOB 1SCVA 4OCIA 4CIDA 1SCMC 1B8LA 1G33A 1MF8B 3BYAA 5TNCA 1BG1A 1NX3A 3VRPA 1CB1A 3FE9A 5D69A 2KI6C 2E30A 3O78A 1AHRA 3N7HA 1CFPA 2CTNA 2LLSA 3CZ1A 2LHLA 2BECA 3OP0A 2LUCA 1M46A 1JUOA 1QV1A 1Y0VH 2Q4UA 1CNPA 2KI6D 4A4CA 3TDZA 1TCOB 1KWOC 1DVIA 2VRGA 1K9KA 2A4JA 2L5XB 1BR1B 3TZ1A 1DELA 1JFJA 2SCPA 3DF0B 1C3YA 1L2OC 2P70A 4NQGA 2WCKA 4YBHB 2NZ0A 1OQPA 5I2QA 2O5GA 1YTZC 1UUSA 5HKZA 1YRUB 2LVJA 2QEOA 3K21A 2L0PA 2LE9B 1C3ZA 2ZFDA 4ORBB 1KFXS 3FWCA 2BKHB 3FIAA 1EXRA 1Q80A 1BR4B 1XFZO 2JXLA 3VRNA 1Y6WA 4C0KA 4QJ4B 1K95A 1S6JA 3D78A 3CS1A 2M0RA 2LHIA 3F45A 1XO5A 3B88A 1C7WA 3GK2A 2JZIA 3EK4A 1UHJA 4PHMA 1H4BA 1CTRA 1SNLA 2LNKA 2WCBA 3BXKA 2M7LA 3PM2A 2K61A 2MAZA 3M0WA 2E6WA 3OGNA 5AFPA 4MZJA 3A8RA 4C0LA 2CCMA 1KK8B 4QJ5B 1LA3A 1QTXA 3ZWHA 1K9PA 1J1EA 1OE9B 1XYDA 2EC6C 1OZSA 1M63B 1QXPA 1U5IA 2WCHA 2BCAA 4PE7A 3DZTA 4MSPA 1LINA 4YRUA 1ZMZA 2KDHA 2PRUA 1DJZA 2JTZA 2Q91A 2HETA 2JNXA 3BQ3A 2WC8A 2BCBA 1PULA 2FJYA 2JULA 3CTNA 5D7FA 1LA0A 1SR6B 2K60A 2NCOA 4KYNA 5IBWA 1UHIA 3TUYB 2WCEA 1WLMA 1J7QA 1FW4A 2JC2A 1XFYO 1EL4A 2KI4C 3HX4A 5ER5A 3BFBA 3GK1A 1DJHA 1CM4A
chains in the Genus database with same CATH topology
2LLUA 1AJ4A 1SL8A 4AQIA 2JT3A 4PE4A 1CKKA 2WOSA 1DMOA 2JT8A 2LMVA 1IQ3A 1QX2A 3WHTB 1QATA 3AAJA 5F6TA 3KPXA 1DGUA 3JVTC 2QPTA 1F71A 1QIVA 2PALA 1CMGA 2COLB 4NDDA 3CR5X 2OTGB 1SY9A 4U8DA 2K2FA 2L2EA 3SG7A 2M97A 5AANA 1CLLA 1KK7Y 1AVSA 1IG5A 1MWNA 2K7DA 2F2PA 4OKHA 3BUMB 4IL1A 1DJIA 2KNEA 2FCEA 2LV7A 1LVCD 4AQJA 2BKIB 2H2KA 1N2DA 1KCYA 3OB2B 1NX0A 1PRWA 1S5GY 1K90D 1VRKA 3O6BA 1MHOA 1NCXA 1YVLA 1TTXA 1J7PA 2L51A 1NIWA 1BJFA 3PLFB 4L9MA 3BUWB 1A75A 2QACA 1RROA 1W7JB 3PM8A 2I2RE 2P6BB 3BOWA 4YGCB 2M7NA 4ZCVA 2I7AA 4R1EA 1WRLA 3SJSA 3PALA 1Y1AA 2LLTA 1YX7A 1MXEA 2ZNEA 4I5JA 2GGMA 3AKBA 1YVHA 2F3YA 2KAVA 3I5HC 1K8UA 3PN7B 4OV2A 3DVKA 1S3PA 3DVEA 4YGEB 1S26D 1A29A 5HLOA 4ETOA 1A4PA 3CR4X 2KYCA 2JPTA 1XK4C 1JBAA 2KFGA 3I5GB 3NXAA 1A03A 1Y1XA 2L4IA 2BCXA 2F3ZA 2PMYA 1TCFA 2NLNA 5HKWA 1TRFA 4BY5A 1KQMB 1RJVA 1F8HA 2I94A 1CDPA 1EG4A 5BPJA 1S1EA 1AJ5A 5HKYA 2NCPA 2Y1NA 1DJWA 4PALA 2SASA 1RFJA 3TS5B 1DGVA 4CLNA 4YGDB 1ZUZA 4Q04A 3CGAA 1UHKA 1EH2A 1NP8A 1NCYA 3NSKA 3GOFA 2OS8B 2JNFA 2FOTA 1OMDA 3SG4A 1BODA 2RGIA 1IRJA 1JF0A 1B47A 2M9GA 3JTDB 4D1EA 1DF0A 1TNQA 2PSRA 4JQ0D 1J1DA 1XFXO 4UPGA 1DTLA 1X02A 2ZRTA 1QJTA 1GGWA 1B8RA 1CDLA 4WRIA 1L7ZA 1KK8C 2KOTA 3BUNB 2BBMA 2KFHA 1BLQA 1EG3A 1SMGA 3I5FB 4DRWA 1QVIY 5AEQA 4DIRA 5I2OA 1S6CA 2F33A 1UHHA 1S36A 2JXCA 3I5IB 4ICBA 1XVJA 1YUSA 2HPSA 4MZKA 2OPOA 1NCZA 3DD4A 1JC2A 1HQVA 3VROA 4F0ZB 1LXFC 1SR6C 2WNDA 3KHEA 4P2YB 1DT7B 2WORA 4NDCA 3TUYC 1PSRA 1IKUA 1WRZA 1K94A 4USLA 2WCFA 1FI5A 1RWYA 1CFFA 3PFVA 4OR9B 4HRHA 2LVKA 1YRTB 1B7TY 2G2BA 1YUTA 5I2LA 3A4UB 5B8IB 4OVNF 1HT9A 1SYMA 2BE6A 1J7OA 1DJYA 2G9BA 2KGBC 2LAPA 2B1UA 1QX7A 1MXLC 1DJXA 4PHJA 2OTGC 2K7OA 1QASA 2GV5A 2AMIA 5CPVA 1DF0B 1SL7A 2I18A 1JF2A 4XJKA 1ZOTB 1RECA 2F8PA 1OMVA 4NDBA 1AUIB 1N65A 1FPWA 2H61C 4GNKB 2LC5A 1CFDA 4HREE 3D10A 1ZACA 2LCPA 1PSBA 1PVBA 1SW8A 3H4SE 2EC6B 2KSPA 3WHUB 4FTGA 1Y1UA 2MRDA 2CXJA 5CSFA 2AUCA 4GPLB 5G08A 1AP4A 3CR2A 3IQQA 3O4YA 4I5KA 2M49B 1WY9A 1IGVA 1TN4A 1WDCB 1SKTA 2KFFA 1XFVO 2CBLA 1EJ3A 2BE4A 3OHMB 3SG3A 2M1UA 1U5IB 4WQ2A 2LUXA 1K9UA 3DVJA 3IQOA 1UP5A 1NYAA 1XFWO 2AAOA 2BL0B 4N1FA 5CSNA 3WNXB 2PVBA 1GQMA 4MLWA 2LMTA 3SIBA 1B9AA 3VRQA 3SG2A 2K0JA 2MLFC 5CSJA 4DS7A 5CSIA 1FBVA 5HYDA 3NSOA 3LL8B 4I5LB 4BY4A 1QIWA 2JTTA 2MBXA 3JVTB 4PE0A 1OZOA 1NX2A 2PASA 3BUXB 1XK4A 4CPVA 2JT0A 2KYFA 3DF0A 3I5GC 4MRYA 1SBJA 1JFKA 3FWBA 1BMOA 3EVVA 2R2IA 5KU1A 1YR5A 2HQ8A 4FQOA 4ZCUA 5PALA 2L98A 1BOCA 2D8NA 1G4YR 4M2PA 1CDMA 4MEWA 1K93D 4ORCB 5FYXA 2L4HA 1DJGA 4JWQA 4MRXA 5K89A 1AK8A 1PALA 1OOJA 4MN0A 3SG5A 1QX5B 1RTP1 1TOPA 1SRAA 3OB1B 4CFRA 5GQQC 1YUUA 2OS8C 2ZRSA 1C7VA 2Y1MA 3EK8A 1F54A 1CMFA 2O60A 3EK7A 3SIAA 3D0YA 1CLMA 2MHHA 4GGFC 3PATA 5KTYA 2F2OA 1QLSA 1YX8A 2LP2A 1ZFSA 3VRRA 2EGDA 1YURA 1B1GA 3I5FC 1WLZA 1FI6A 5DKRA 4PDZA 2JQ6A 3OX5A 3I5HB 1GJYA 2M29A 3LLEA 5KSZA 1A75B 3AAKA 1MUXA 3I5IC 3EKHA 1W7IB 3BOWB 1F70A 1KQVA 1D1OA 2TN4A 4MBEA 1NWDA 4WQ3A 2FCDA 4I5NB 4N1GA 3EVRA 1SCMB 1IH0A 1J55A 1JSAA 4PHKA 1NSHA 1K96A 1TNWA 3LK0A 1LKJA 1ALVA 4YGBB 1QLKA 1CLBA 4DCKA 2ZKMX 4YI8A 5I8NA 5J3XA 1B8CA 1PVAA 1KK7Z 5HLVA 2MJWB 1JWDA 1KWOB 2DOQA 3EKJA 1R2UA 1KFUL 2HF5A 2KQ6A 3TDIA 2LANA 4JPZB 2MA2A 1S5GZ 1L2OB 3AKAA 1MQ1A 1SK6D 4E68A 4GBAA 5AERA 1SL9A 1V1GA 1M31A 3SG6A 1IJ5A 2MLEC 3CWGA 1IQ5A 2H61A 3NSIA 4TNCA 1NX1A 2KQYA 3D0YB 1H8BA 1N0YA 2IS9A 1UHNA 1XA5A 4C0JA 2KBMA 5ER4X 1F4QA 1TIZA 1E8AA 4ORAB 4MVFA 2K2AA 2JWWA 4GFTA 4A4BA 1XFUO 1WDCC 3EVUA 3C1VA 3E3RA 3NSLA 2KAYA 3CLNA 4DUQA 1NPQA 2NXQA 2ZN8A 3RM1A 2CT9A 1QV0A 4QJ3B 2BL0C 1IWQA 1KSOA 4N5XA 2KHNA 1CDNA 2K7CA 4PCWA 1BU3A 1TNXA 2Y5IA 3OX6A 2CNPA 1C07A 4PE1A 1CFCA 1M45A 2BBNA 1ALWA 3FS7A 3QRXA 3PSRA 2JU0A 2HQWA 1IJ6A 1TNPA 2JRFA 1UWOA 1CM1A 2ZNDA 2EHBA 4GGNA 4XYNA 2ISDA 3VRNA 4GUKA 1QS7A 2K8MB 1J7RA 2KGRA 2KI4B 3KF9A 1WRKA 3MSEB 2M8UA 2V53A 3GK4X 3CZTX 4M2QA 4HSZA 3WXAA 5DKNA 3PN7C 4P5OE 4GAOA 5AXIA 4CFQA 1F4OA 5JJGA 1OMRA 1V1FA 1KFUS 2LP3A 1KFXL 1MR8A 3DVMA 3TDUA 3KO0A 2M1KB 3VGOA 2Y4QA 2LVVA 5JOLA 2JOJA 3ZNIA 1UURA 1R6PA 3KEVA 1QVIZ 2LM5A 2KBIA 1KQMC 2KAXA 4AOMA 4XJKB 3HCMA 3LK1A 2M3WA 1RK9A 3IF7A 1BF5A 4YI9A 2GGZA 1S6IA 1ODBA 2FJUB 2K7BA 4GGFA 4M2OA 3TS5C 1KSMA 1F55A 2ZN9A 1OSAA 2LMUA 1GGZA 1A2XA 4YGAA 1SPYA 1K2HA 2LVIA 3JTDC 1BT6A 1B7TZ 1G8IA 3LCPC 2L50A 4HRGA 3O2PA 4PHNA 3ICBA 4MZLA 5DKQA 1FF1A 1M39A 1NUBA 3RLZA 1B4CA 1PK0D 3BUOB 1SCVA 4OCIA 4CIDA 1SCMC 1B8LA 1G33A 1MF8B 3BYAA 5TNCA 1BG1A 1NX3A 3VRPA 1CB1A 5D69A 2KI6C 2E30A 3O78A 1AHRA 1CFPA 2CTNA 2LLSA 2LHLA 2BECA 3OP0A 2LUCA 1M46A 1JUOA 1QV1A 1Y0VH 2Q4UA 1CNPA 2KI6D 4A4CA 3TDZA 1TCOB 1KWOC 1DVIA 2VRGA 1K9KA 2A4JA 2L5XB 1BR1B 3TZ1A 1JFJA 2SCPA 3DF0B 1L2OC 4NQGA 4YBHB 2NZ0A 1OQPA 5I2QA 2O5GA 1YTZC 1UUSA 5HKZA 1YRUB 2LVJA 3K21A 2L0PA 2LE9B 2ZFDA 4ORBB 1KFXS 3FWCA 2BKHB 3FIAA 1EXRA 1Q80A 1BR4B 1XFZO 2JXLA 4C0KA 1Y6WA 4QJ4B 1K95A 1S6JA 3CS1A 2M0RA 2LHIA 3F45A 1XO5A 1C7WA 3GK2A 2JZIA 3EK4A 1UHJA 4PHMA 1H4BA 1CTRA 1SNLA 2LNKA 2WCBA 3BXKA 2M7LA 2K61A 2MAZA 3M0WA 2E6WA 5AFPA 4MZJA 3A8RA 4C0LA 2CCMA 1KK8B 4QJ5B 1LA3A 1QTXA 3ZWHA 1K9PA 1J1EA 1OE9B 1XYDA 2EC6C 1OZSA 1M63B 1QXPA 1U5IA 4PE7A 2BCAA 4MSPA 4YRUA 1LINA 1ZMZA 2KDHA 2PRUA 1DJZA 2JTZA 2Q91A 2HETA 2JNXA 3BQ3A 2WC8A 2BCBA 1PULA 2JULA 3CTNA 5D7FA 1LA0A 1SR6B 2NCOA 5IBWA 1UHIA 3TUYB 2WCEA 1WLMA 1J7QA 1FW4A 2JC2A 1XFYO 1EL4A 2KI4C 3HX4A 5ER5A 3GK1A 1DJHA 1CM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLU A;  1AJ4 A;  1SL8 A;  4AQI A;  2JT3 A;  4PE4 A;  1CKK A;  2WOS A;  1DMO A;  2JT8 A;  2LMV A;  1IQ3 A;  1QX2 A;  3WHT B;  1QAT A;  3AAJ A;  5F6T A;  3KPX A;  1DGU A;  3JVT C;  2QPT A;  1F71 A;  1QIV A;  2PAL A;  1CMG A;  2COL B;  4NDD A;  3CR5 X;  2OTG B;  1SY9 A;  4U8D A;  2K2F A;  2L2E A;  3SG7 A;  2M97 A;  5AAN A;  1CLL A;  1KK7 Y;  1AVS A;  1IG5 A;  1MWN A;  2K7D A;  2F2P A;  4OKH A;  3BUM B;  4IL1 A;  1DJI A;  2KNE A;  2FCE A;  2LV7 A;  1LVC D;  4AQJ A;  2BKI B;  2H2K A;  1N2D A;  1KCY A;  3OB2 B;  1NX0 A;  1PRW A;  1S5G Y;  1K90 D;  1VRK A;  3O6B A;  1MHO A;  1NCX A;  1YVL A;  1TTX A;  1J7P A;  2L51 A;  1NIW A;  1BJF A;  3PLF B;  4L9M A;  3BUW B;  1A75 A;  2QAC A;  1RRO A;  1W7J B;  3PM8 A;  2I2R E;  2P6B B;  3BOW A;  4YGC B;  2M7N A;  4ZCV A;  2I7A A;  4R1E A;  1WRL A;  3SJS A;  3PAL A;  1Y1A A;  2LLT A;  1YX7 A;  1MXE A;  2ZNE A;  4I5J A;  2GGM A;  3AKB A;  1YVH A;  2F3Y A;  2KAV A;  3I5H C;  1K8U A;  3PN7 B;  4OV2 A;  3DVK A;  1S3P A;  3DVE A;  4YGE B;  1S26 D;  1A29 A;  5HLO A;  4ETO A;  1A4P A;  3CR4 X;  2KYC A;  2JPT A;  1XK4 C;  1JBA A;  2KFG A;  3I5G B;  3NXA A;  1A03 A;  1Y1X A;  2L4I A;  2BCX A;  2F3Z A;  2PMY A;  1TCF A;  2NLN A;  5HKW A;  1TRF A;  4BY5 A;  1KQM B;  1RJV A;  1F8H A;  2I94 A;  1CDP A;  1EG4 A;  5BPJ A;  1S1E A;  1AJ5 A;  5HKY A;  2NCP A;  2Y1N A;  1DJW A;  4PAL A;  2SAS A;  1RFJ A;  3TS5 B;  1DGV A;  4CLN A;  4YGD B;  1ZUZ A;  4Q04 A;  3CGA A;  1UHK A;  1EH2 A;  1NP8 A;  1NCY A;  3NSK A;  3GOF A;  2OS8 B;  2JNF A;  2FOT A;  1OMD A;  3SG4 A;  1BOD A;  2RGI A;  1IRJ A;  1JF0 A;  1B47 A;  2M9G A;  3JTD B;  4D1E A;  1DF0 A;  1TNQ A;  2PSR A;  4JQ0 D;  1J1D A;  1XFX O;  4UPG A;  1DTL A;  1X02 A;  2ZRT A;  1QJT A;  1GGW A;  1B8R A;  1CDL A;  4WRI A;  1L7Z A;  1KK8 C;  2KOT A;  3BUN B;  2BBM A;  2KFH A;  1BLQ A;  1EG3 A;  1SMG A;  3I5F B;  4DRW A;  1QVI Y;  5AEQ A;  4DIR A;  5I2O A;  1S6C A;  2F33 A;  1UHH A;  1S36 A;  2JXC A;  3I5I B;  4ICB A;  1XVJ A;  1YUS A;  2HPS A;  4MZK A;  2OPO A;  1NCZ A;  3DD4 A;  1JC2 A;  1HQV A;  3VRO A;  4F0Z B;  1LXF C;  1SR6 C;  2WND A;  3KHE A;  4P2Y B;  1DT7 B;  2WOR A;  4NDC A;  3TUY C;  1PSR A;  1IKU A;  1WRZ A;  1K94 A;  4USL A;  2WCF A;  1FI5 A;  1RWY A;  1CFF A;  3PFV A;  4OR9 B;  4HRH A;  2LVK A;  1YRT B;  1B7T Y;  2G2B A;  1YUT A;  5I2L A;  3A4U B;  5B8I B;  4OVN F;  1HT9 A;  1SYM A;  2BE6 A;  1J7O A;  1DJY A;  2G9B A;  2KGB C;  2LAP A;  2B1U A;  1QX7 A;  1MXL C;  1DJX A;  4PHJ A;  2OTG C;  2K7O A;  1QAS A;  2GV5 A;  2AMI A;  5CPV A;  1DF0 B;  1SL7 A;  2I18 A;  1JF2 A;  4XJK A;  1ZOT B;  1REC A;  2F8P A;  1OMV A;  4NDB A;  1AUI B;  1N65 A;  1FPW A;  2H61 C;  4GNK B;  2LC5 A;  1CFD A;  4HRE E;  3D10 A;  1ZAC A;  2LCP A;  1PSB A;  1PVB A;  1SW8 A;  3H4S E;  2EC6 B;  2KSP A;  3WHU B;  4FTG A;  1Y1U A;  2MRD A;  2CXJ A;  5CSF A;  2AUC A;  4GPL B;  5G08 A;  1AP4 A;  3CR2 A;  3IQQ A;  3O4Y A;  4I5K A;  2M49 B;  1WY9 A;  1IGV A;  1TN4 A;  1WDC B;  1SKT A;  2KFF A;  1XFV O;  2CBL A;  1EJ3 A;  2BE4 A;  3OHM B;  3SG3 A;  2M1U A;  1U5I B;  4WQ2 A;  2LUX A;  1K9U A;  3DVJ A;  3IQO A;  1UP5 A;  1NYA A;  1XFW O;  2AAO A;  2BL0 B;  4N1F A;  5CSN A;  3WNX B;  2PVB A;  1GQM A;  4MLW A;  2LMT A;  3SIB A;  1B9A A;  3VRQ A;  3SG2 A;  2K0J A;  2MLF C;  5CSJ A;  4DS7 A;  5CSI A;  1FBV A;  5HYD A;  3NSO A;  3LL8 B;  4I5L B;  4BY4 A;  1QIW A;  2JTT A;  2MBX A;  3JVT B;  4PE0 A;  1OZO A;  1NX2 A;  2PAS A;  3BUX B;  1XK4 A;  4CPV A;  2JT0 A;  2KYF A;  3DF0 A;  3I5G C;  4MRY A;  1SBJ A;  1JFK A;  3FWB A;  1BMO A;  3EVV A;  2R2I A;  5KU1 A;  1YR5 A;  2HQ8 A;  4FQO A;  4ZCU A;  5PAL A;  2L98 A;  1BOC A;  2D8N A;  1G4Y R;  4M2P A;  1CDM A;  4MEW A;  1K93 D;  4ORC B;  5FYX A;  2L4H A;  1DJG A;  4JWQ A;  4MRX A;  5K89 A;  1AK8 A;  1PAL A;  1OOJ A;  4MN0 A;  3SG5 A;  1QX5 B;  1RTP 1;  1TOP A;  1SRA A;  3OB1 B;  4CFR A;  5GQQ C;  1YUU A;  2OS8 C;  2ZRS A;  1C7V A;  2Y1M A;  3EK8 A;  1F54 A;  1CMF A;  2O60 A;  3EK7 A;  3SIA A;  3D0Y A;  1CLM A;  2MHH A;  4GGF C;  3PAT A;  5KTY A;  2F2O A;  1QLS A;  1YX8 A;  2LP2 A;  1ZFS A;  3VRR A;  2EGD A;  1YUR A;  1B1G A;  3I5F C;  1WLZ A;  1FI6 A;  5DKR A;  4PDZ A;  2JQ6 A;  3OX5 A;  3I5H B;  1GJY A;  2M29 A;  3LLE A;  5KSZ A;  1A75 B;  3AAK A;  1MUX A;  3I5I C;  3EKH A;  1W7I B;  3BOW B;  1F70 A;  1KQV A;  1D1O A;  2TN4 A;  4MBE A;  1NWD A;  4WQ3 A;  2FCD A;  4I5N B;  4N1G A;  3EVR A;  1SCM B;  1IH0 A;  1J55 A;  1JSA A;  4PHK A;  1NSH A;  1K96 A;  1TNW A;  3LK0 A;  1LKJ A;  1ALV A;  4YGB B;  1QLK A;  1CLB A;  4DCK A;  2ZKM X;  4YI8 A;  5I8N A;  5J3X A;  1B8C A;  1PVA A;  1KK7 Z;  5HLV A;  2MJW B;  1JWD A;  1KWO B;  2DOQ A;  3EKJ A;  1R2U A;  1KFU L;  2HF5 A;  2KQ6 A;  3TDI A;  2LAN A;  4JPZ B;  2MA2 A;  1S5G Z;  1L2O B;  3AKA A;  1MQ1 A;  1SK6 D;  4E68 A;  4GBA A;  5AER A;  1SL9 A;  1V1G A;  1M31 A;  3SG6 A;  1IJ5 A;  2MLE C;  3CWG A;  1IQ5 A;  2H61 A;  3NSI A;  4TNC A;  1NX1 A;  2KQY A;  3D0Y B;  1H8B A;  1N0Y A;  2IS9 A;  1UHN A;  1XA5 A;  4C0J A;  2KBM A;  5ER4 X;  1F4Q A;  1TIZ A;  1E8A A;  4ORA B;  4MVF A;  2K2A A;  2JWW A;  4GFT A;  4A4B A;  1XFU O;  1WDC C;  3EVU A;  3C1V A;  3E3R A;  3NSL A;  2KAY A;  3CLN A;  4DUQ A;  1NPQ A;  2NXQ A;  2ZN8 A;  3RM1 A;  2CT9 A;  1QV0 A;  4QJ3 B;  2BL0 C;  1IWQ A;  1KSO A;  4N5X A;  2KHN A;  1CDN A;  2K7C A;  4PCW A;  1BU3 A;  1TNX A;  2Y5I A;  3OX6 A;  2CNP A;  1C07 A;  4PE1 A;  1CFC A;  1M45 A;  2BBN A;  1ALW A;  3FS7 A;  3QRX A;  3PSR A;  2JU0 A;  2HQW A;  1IJ6 A;  1TNP A;  2JRF A;  1UWO A;  1CM1 A;  2ZND A;  2EHB A;  4GGN A;  4XYN A;  2ISD A;  3VRN A;  4GUK A;  1QS7 A;  2K8M B;  1J7R A;  2KGR A;  2KI4 B;  3KF9 A;  1WRK A;  3MSE B;  2M8U A;  2V53 A;  3GK4 X;  3CZT X;  4M2Q A;  4HSZ A;  3WXA A;  5DKN A;  3PN7 C;  4P5O E;  4GAO A;  5AXI A;  4CFQ A;  1F4O A;  5JJG A;  1OMR A;  1V1F A;  1KFU S;  2LP3 A;  1KFX L;  1MR8 A;  3DVM A;  3TDU A;  3KO0 A;  2M1K B;  3VGO A;  2Y4Q A;  2LVV A;  5JOL A;  2JOJ A;  3ZNI A;  1UUR A;  1R6P A;  3KEV A;  1QVI Z;  2LM5 A;  2KBI A;  1KQM C;  2KAX A;  4AOM A;  4XJK B;  3HCM A;  3LK1 A;  2M3W A;  1RK9 A;  3IF7 A;  1BF5 A;  4YI9 A;  2GGZ A;  1S6I A;  1ODB A;  2FJU B;  2K7B A;  4GGF A;  4M2O A;  3TS5 C;  1KSM A;  1F55 A;  2ZN9 A;  1OSA A;  2LMU A;  1GGZ A;  1A2X A;  4YGA A;  1SPY A;  1K2H A;  2LVI A;  3JTD C;  1BT6 A;  1B7T Z;  1G8I A;  3LCP C;  2L50 A;  4HRG A;  3O2P A;  4PHN A;  3ICB A;  4MZL A;  5DKQ A;  1FF1 A;  1M39 A;  1NUB A;  3RLZ A;  1B4C A;  1PK0 D;  3BUO B;  1SCV A;  4OCI A;  4CID A;  1SCM C;  1B8L A;  1G33 A;  1MF8 B;  3BYA A;  5TNC A;  1BG1 A;  1NX3 A;  3VRP A;  1CB1 A;  5D69 A;  2KI6 C;  2E30 A;  3O78 A;  1AHR A;  1CFP A;  2CTN A;  2LLS A;  2LHL A;  2BEC A;  3OP0 A;  2LUC A;  1M46 A;  1JUO A;  1QV1 A;  1Y0V H;  2Q4U A;  1CNP A;  2KI6 D;  4A4C A;  3TDZ A;  1TCO B;  1KWO C;  1DVI A;  2VRG A;  1K9K A;  2A4J A;  2L5X B;  1BR1 B;  3TZ1 A;  1JFJ A;  2SCP A;  3DF0 B;  1L2O C;  4NQG A;  4YBH B;  2NZ0 A;  1OQP A;  5I2Q A;  2O5G A;  1YTZ C;  1UUS A;  5HKZ A;  1YRU B;  2LVJ A;  3K21 A;  2L0P A;  2LE9 B;  2ZFD A;  4ORB B;  1KFX S;  3FWC A;  2BKH B;  3FIA A;  1EXR A;  1Q80 A;  1BR4 B;  1XFZ O;  2JXL A;  4C0K A;  1Y6W A;  4QJ4 B;  1K95 A;  1S6J A;  3CS1 A;  2M0R A;  2LHI A;  3F45 A;  1XO5 A;  1C7W A;  3GK2 A;  2JZI A;  3EK4 A;  1UHJ A;  4PHM A;  1H4B A;  1CTR A;  1SNL A;  2LNK A;  2WCB A;  3BXK A;  2M7L A;  2K61 A;  2MAZ A;  3M0W A;  2E6W A;  5AFP A;  4MZJ A;  3A8R A;  4C0L A;  2CCM A;  1KK8 B;  4QJ5 B;  1LA3 A;  1QTX A;  3ZWH A;  1K9P A;  1J1E A;  1OE9 B;  1XYD A;  2EC6 C;  1OZS A;  1M63 B;  1QXP A;  1U5I A;  4PE7 A;  2BCA A;  4MSP A;  4YRU A;  1LIN A;  1ZMZ A;  2KDH A;  2PRU A;  1DJZ A;  2JTZ A;  2Q91 A;  2HET A;  2JNX A;  3BQ3 A;  2WC8 A;  2BCB A;  1PUL A;  2JUL A;  3CTN A;  5D7F A;  1LA0 A;  1SR6 B;  2NCO A;  5IBW A;  1UHI A;  3TUY B;  2WCE A;  1WLM A;  1J7Q A;  1FW4 A;  2JC2 A;  1XFY O;  1EL4 A;  2KI4 C;  3HX4 A;  5ER5 A;  3GK1 A;  1DJH A;  1CM4 A; 
#chains in the Genus database with same CATH topology
 2LLU A;  1AJ4 A;  1SL8 A;  4AQI A;  2JT3 A;  4PE4 A;  1CKK A;  2WOS A;  1DMO A;  2JT8 A;  2LMV A;  3OBV A;  1IQ3 A;  1QX2 A;  3WHT B;  1QAT A;  3AAJ A;  3EG5 B;  5F6T A;  1OOH A;  3KPX A;  1DGU A;  3JVT C;  2QPT A;  1F71 A;  1QIV A;  2PAL A;  1CMG A;  2COL B;  4NDD A;  3CR5 X;  2OTG B;  1SY9 A;  4U8D A;  2K2F A;  2L2E A;  3SG7 A;  2M97 A;  5AAN A;  1CLL A;  2KLD A;  1KK7 Y;  1AVS A;  1IG5 A;  1MWN A;  2K7D A;  2F2P A;  4OKH A;  3BUM B;  4IL1 A;  3CYZ A;  1DJI A;  2KNE A;  2FCE A;  2LV7 A;  1LVC D;  4AQJ A;  2BKI B;  2H2K A;  1N2D A;  3B6X A;  3O4X A;  1KCY A;  3OB2 B;  1NX0 A;  1PRW A;  1S5G Y;  4PT1 A;  1K90 D;  1VRK A;  3CAB A;  3O6B A;  3SS4 A;  1MHO A;  1NCX A;  3D76 A;  1YVL A;  3L47 A;  1TTX A;  1J7P A;  2L51 A;  1NIW A;  1BJF A;  3PLF B;  4L9M A;  3UO9 A;  3BUW B;  1A75 A;  2QAC A;  1RRO A;  1W7J B;  3PM8 A;  2I2R E;  2P6B B;  3BOW A;  4YGC B;  2M7N A;  4ZCV A;  2I7A A;  1DC1 A;  4F7F A;  4R1E A;  1WRL A;  3SJS A;  3PAL A;  1Y1A A;  2LLT A;  5FI2 A;  1YX7 A;  1MXE A;  2ZNE A;  1P28 A;  4I5J A;  4OZD A;  2GGM A;  1OOI X;  3AKB A;  1YVH A;  2F3Y A;  2KAV A;  3I5H C;  1K8U A;  3PN7 B;  4OV2 A;  3DVK A;  1S3P A;  3DVE A;  4YGE B;  1S26 D;  4INX A;  1A29 A;  5HLO A;  3L4A A;  4ETO A;  1A4P A;  1TUZ A;  2KYC A;  2JPT A;  1T14 A;  3CR4 X;  1XK4 C;  3S0A A;  1JBA A;  2KFG A;  3I5G B;  3NGV A;  3NXA A;  1A03 A;  1Y1X A;  2L4I A;  1IIO A;  2BCX A;  2F3Z A;  2PMY A;  1TCF A;  2NLN A;  5HKW A;  1TRF A;  4BY5 A;  1KQM B;  1RJV A;  5D3O A;  1F8H A;  2I94 A;  1CDP A;  1EG4 A;  3R1V A;  5BPJ A;  1S1E A;  1Z4H A;  1AJ5 A;  2KLE A;  5HKY A;  2NCP A;  2Y1N A;  1DJW A;  1OW4 A;  4PAL A;  2SAS A;  1RFJ A;  3TS5 B;  1DGV A;  4CLN A;  4YGD B;  1ZUZ A;  4Q04 A;  3CGA A;  1UHK A;  1EH2 A;  1NP8 A;  3R72 A;  1NCY A;  3NSK A;  3GOF A;  2OS8 B;  2JNF A;  2FOT A;  3UNW A;  1OMD A;  3SG4 A;  1BOD A;  1QWV A;  2RGI A;  1IRJ A;  1JF0 A;  1B47 A;  2M9G A;  3JTD B;  4D1E A;  1DF0 A;  1TNQ A;  2PSR A;  4JQ0 D;  1J1D A;  1XFX O;  4UPG A;  1DTL A;  1X02 A;  1TUJ A;  1QJT A;  2ZRT A;  1GGW A;  1B8R A;  1CDL A;  4WRI A;  4INW A;  1L7Z A;  1KK8 C;  2KOT A;  3BUN B;  1LS8 A;  2BBM A;  2KFH A;  1BLQ A;  3R1O A;  1EG3 A;  1SMG A;  3I5F B;  4DRW A;  1QVI Y;  5AEQ A;  4DIR A;  5I2O A;  1S6C A;  2F33 A;  1UHH A;  1S36 A;  2JXC A;  3I5I B;  4ICB A;  1XVJ A;  2QEV A;  1YUS A;  1DQE A;  2HPS A;  4MZK A;  2OPO A;  1NCZ A;  3DD4 A;  1JC2 A;  1HQV A;  3VRO A;  2KPH A;  4F0Z B;  1LXF C;  1SR6 C;  2WND A;  3B87 A;  3KHE A;  4P2Y B;  1DT7 B;  2WOR A;  3K1E A;  4NDC A;  3TUY C;  1PSR A;  1IKU A;  5I94 A;  1WRZ A;  1K94 A;  4USL A;  2WCF A;  1FI5 A;  1RWY A;  1CFF A;  3PFV A;  2BAP A;  4OR9 B;  4HRH A;  2LVK A;  1YRT B;  1B7T Y;  2G2B A;  3D73 A;  1YUT A;  5I2L A;  3A4U B;  5B8I B;  4OVN F;  1HT9 A;  1SYM A;  2BE6 A;  1J7O A;  1DJY A;  2G9B A;  2KGB C;  2LAP A;  2B1U A;  1QX7 A;  1MXL C;  1DJX A;  4PHJ A;  2OTG C;  3S0F A;  2K7O A;  2QEB A;  1QAS A;  2GV5 A;  2AMI A;  3NHT A;  5CPV A;  1DF0 B;  1SL7 A;  2I18 A;  1JF2 A;  4XJK A;  1ZOT B;  1REC A;  2F8P A;  1OMV A;  4NDB A;  1AUI B;  1N65 A;  1FPW A;  2H61 C;  4GNK B;  2LC5 A;  1CFD A;  4HRE E;  3D10 A;  1ZAC A;  2LCP A;  3D77 A;  1PSB A;  1PVB A;  1SW8 A;  3H4S E;  3D74 A;  2EC6 B;  2KSP A;  3WHU B;  4FTG A;  1Y1U A;  2MRD A;  2CXJ A;  2L2C A;  2AUC A;  4GPL B;  5CSF A;  5G08 A;  1AP4 A;  3CR2 A;  3IQQ A;  3O4Y A;  4I5K A;  2M49 B;  1WY9 A;  3S0B A;  1IGV A;  1TN4 A;  1OOF A;  1WDC B;  1SKT A;  3NHI A;  2ERB A;  2KFF A;  1XFV O;  2CBL A;  1EJ3 A;  2BE4 A;  3OHM B;  3SG3 A;  2M1U A;  1U5I B;  4WQ2 A;  2LUX A;  1K9U A;  3DVJ A;  3IQO A;  1UP5 A;  1NYA A;  1XFW O;  2AAO A;  3SS5 A;  2BL0 B;  4N1F A;  5CSN A;  3WNX B;  2PVB A;  1GQM A;  1XFR A;  2LMT A;  4MLW A;  1B9A A;  3SIB A;  3VRQ A;  3SG2 A;  2K0J A;  2MLF C;  5CSJ A;  4DS7 A;  5CSI A;  1FBV A;  5HYD A;  3NSO A;  3LL8 B;  4I5L B;  2QDI A;  4BY4 A;  5HL1 A;  1QIW A;  2JTT A;  2MBX A;  3JVT B;  4PE0 A;  1OZO A;  1NX2 A;  2PAS A;  3BUX B;  1XK4 A;  4CPV A;  2JT0 A;  2KYF A;  3DF0 A;  3I5G C;  4MRY A;  3VB1 A;  2QEH A;  1SBJ A;  1JFK A;  3B7A A;  3FWB A;  1BMO A;  3EVV A;  2R2I A;  5KU1 A;  1YR5 A;  2HQ8 A;  4FQO A;  4ZCU A;  5PAL A;  2L98 A;  1BOC A;  2D8N A;  1G4Y R;  4M2P A;  2L5Y A;  3Q8I A;  1CDM A;  4MEW A;  1K93 D;  4ORC B;  5FI6 A;  5FYX A;  2L4H A;  3B86 A;  1DJG A;  4JWQ A;  4MRX A;  5K89 A;  1W9Z A;  1AK8 A;  1PAL A;  1OOJ A;  4MN0 A;  3SG5 A;  1QX5 B;  1RTP 1;  1TOP A;  1SRA A;  3OB1 B;  4CFR A;  5GQQ C;  1YUU A;  2OS8 C;  2ZRS A;  1C7V A;  2Y1M A;  3EK8 A;  2WC6 A;  1F54 A;  1CMF A;  3FE6 A;  2O60 A;  3EK7 A;  3SIA A;  3D0Y A;  1CLM A;  2MHH A;  4GGF C;  3PAT A;  5KTY A;  2F2O A;  1QLS A;  1YX8 A;  2LP2 A;  1ZFS A;  3VRR A;  2EGD A;  1YUR A;  1B1G A;  3I5F C;  1WLZ A;  1FI6 A;  5DKR A;  4PDZ A;  2JQ6 A;  3OX5 A;  3I5H B;  1GJY A;  2M29 A;  3LLE A;  5KSZ A;  1A75 B;  3AAK A;  4IJ7 A;  1MUX A;  3I5I C;  3EKH A;  1W7I B;  3BOW B;  1F70 A;  1KQV A;  1D1O A;  2TN4 A;  2YGU A;  1NWD A;  4MBE A;  4WQ3 A;  2FCD A;  4I5N B;  4N1G A;  1H8B A;  3EVR A;  1SCM B;  3S0D A;  1IH0 A;  1J55 A;  3BFA A;  4PHK A;  3S0G A;  1JSA A;  1NSH A;  1K96 A;  1TNW A;  3LK0 A;  3R1P A;  1LKJ A;  1ALV A;  4YGB B;  1QLK A;  1CLB A;  4DCK A;  2ZKM X;  4YI8 A;  5I8N A;  5J3X A;  1B8C A;  1PVA A;  1KK7 Z;  5DIC A;  5HLV A;  2MJW B;  1JWD A;  1GM0 A;  1KWO B;  3L4L A;  2DOQ A;  3EKJ A;  1R2U A;  1KFU L;  2HF5 A;  2KQ6 A;  3TDI A;  3S0E A;  2LAN A;  4JPZ B;  2PYQ A;  2WCM A;  2MA2 A;  1S5G Z;  3IVT A;  1L2O B;  3AKA A;  1MQ1 A;  1SK6 D;  3BJH A;  3PJI A;  3CZ0 A;  4E68 A;  1OOG A;  4GBA A;  5AER A;  1SL9 A;  1V1G A;  1M31 A;  3SG6 A;  1IJ5 A;  2MLE C;  2JPO A;  2H8V A;  3CWG A;  1IQ5 A;  2H61 A;  3BFH A;  3NSI A;  1NX1 A;  2KQY A;  3D0Y B;  4TNC A;  1N0Y A;  2IS9 A;  3V2L A;  1UHN A;  1XA5 A;  4C0J A;  2KBM A;  5ER4 X;  3RZS A;  2BNX A;  1F4Q A;  1TIZ A;  1E8A A;  4ORA B;  4MVF A;  2K2A A;  1Z2C B;  2JWW A;  1TWO A;  4GFT A;  4A4B A;  1XFU O;  1WDC C;  3EVU A;  2WCJ A;  3C1V A;  2WCL A;  3E3R A;  3NSL A;  2KAY A;  3CLN A;  2P71 A;  1NPQ A;  4DUQ A;  2NXQ A;  2ZN8 A;  3RM1 A;  2CT9 A;  1QV0 A;  4QJ3 B;  1DEK A;  2BL0 C;  1IWQ A;  1KSO A;  4N5X A;  2KHN A;  1CDN A;  2K7C A;  4PCW A;  1BU3 A;  1TNX A;  2Y5I A;  3OX6 A;  2CNP A;  1C07 A;  4PE1 A;  5EL2 A;  1CFC A;  4FQT A;  1M45 A;  2BBN A;  1ALW A;  3FS7 A;  3QRX A;  3PSR A;  2JU0 A;  2HQW A;  1IJ6 A;  1TNP A;  2JRF A;  1UWO A;  1CM1 A;  2ZND A;  2EHB A;  3FE8 A;  4GGN A;  4XYN A;  2ISD A;  4GUK A;  1QS7 A;  2K8M B;  1J7R A;  2KGR A;  2KI4 B;  3DYE A;  1WRK A;  3KF9 A;  2M8U A;  2V53 A;  3GK4 X;  3MSE B;  3QME A;  3CZT X;  4M2Q A;  4HSZ A;  3WXA A;  5DKN A;  3DXL A;  3PN7 C;  4P5O E;  4GAO A;  5AXI A;  4CFQ A;  1F4O A;  5JJG A;  1OMR A;  1V1F A;  1KFU S;  2LP3 A;  1KFX L;  1MR8 A;  3DVM A;  3TDU A;  3SS3 A;  3KO0 A;  2M1K B;  4JD9 A;  3VGO A;  2Y4Q A;  2LVV A;  3CZ2 A;  2JOJ A;  5JOL A;  3ZNI A;  1SSE B;  1UUR A;  1R6P A;  3KEV A;  3DY9 A;  1QVI Z;  2LM5 A;  2KBI A;  1KQM C;  2KAX A;  4AOM A;  4XJK B;  3HCM A;  3LK1 A;  2M3W A;  1RK9 A;  3IF7 A;  1BF5 A;  4YI9 A;  2GGZ A;  1S6I A;  1ODB A;  2FJU B;  2K7B A;  2WC5 A;  4GGF A;  4M2O A;  3TS5 C;  1KSM A;  5FI7 A;  1F55 A;  2ZN9 A;  4JKT A;  1OSA A;  1ORG A;  2LMU A;  1GGZ A;  1A2X A;  3CDN A;  3D75 A;  4YGA A;  2GTE A;  1SPY A;  1K2H A;  2LVI A;  2PQL A;  3JTD C;  1BT6 A;  1B7T Z;  1G8I A;  3LCP C;  2L50 A;  4HRG A;  3O2P A;  4PHN A;  3ICB A;  4MZL A;  5DKQ A;  1FF1 A;  1M39 A;  1NUB A;  3RLZ A;  1B4C A;  1PK0 D;  3BUO B;  1SCV A;  4OCI A;  4CID A;  1SCM C;  1B8L A;  1G33 A;  1MF8 B;  3BYA A;  5TNC A;  1BG1 A;  1NX3 A;  3VRP A;  1CB1 A;  3FE9 A;  5D69 A;  2KI6 C;  2E30 A;  3O78 A;  1AHR A;  3N7H A;  1CFP A;  2CTN A;  2LLS A;  3CZ1 A;  2LHL A;  2BEC A;  3OP0 A;  2LUC A;  1M46 A;  1JUO A;  1QV1 A;  1Y0V H;  2Q4U A;  1CNP A;  2KI6 D;  4A4C A;  3TDZ A;  1TCO B;  1KWO C;  1DVI A;  2VRG A;  1K9K A;  2A4J A;  2L5X B;  1BR1 B;  3TZ1 A;  1DEL A;  1JFJ A;  2SCP A;  3DF0 B;  1C3Y A;  1L2O C;  2P70 A;  4NQG A;  2WCK A;  4YBH B;  2NZ0 A;  1OQP A;  5I2Q A;  2O5G A;  1YTZ C;  1UUS A;  5HKZ A;  1YRU B;  2LVJ A;  2QEO A;  3K21 A;  2L0P A;  2LE9 B;  1C3Z A;  2ZFD A;  4ORB B;  1KFX S;  3FWC A;  2BKH B;  3FIA A;  1EXR A;  1Q80 A;  1BR4 B;  1XFZ O;  2JXL A;  3VRN A;  1Y6W A;  4C0K A;  4QJ4 B;  1K95 A;  1S6J A;  3D78 A;  3CS1 A;  2M0R A;  2LHI A;  3F45 A;  1XO5 A;  3B88 A;  1C7W A;  3GK2 A;  2JZI A;  3EK4 A;  1UHJ A;  4PHM A;  1H4B A;  1CTR A;  1SNL A;  2LNK A;  2WCB A;  3BXK A;  2M7L A;  3PM2 A;  2K61 A;  2MAZ A;  3M0W A;  2E6W A;  3OGN A;  5AFP A;  4MZJ A;  3A8R A;  4C0L A;  2CCM A;  1KK8 B;  4QJ5 B;  1LA3 A;  1QTX A;  3ZWH A;  1K9P A;  1J1E A;  1OE9 B;  1XYD A;  2EC6 C;  1OZS A;  1M63 B;  1QXP A;  1U5I A;  2WCH A;  2BCA A;  4PE7 A;  3DZT A;  4MSP A;  1LIN A;  4YRU A;  1ZMZ A;  2KDH A;  2PRU A;  1DJZ A;  2JTZ A;  2Q91 A;  2HET A;  2JNX A;  3BQ3 A;  2WC8 A;  2BCB A;  1PUL A;  2FJY A;  2JUL A;  3CTN A;  5D7F A;  1LA0 A;  1SR6 B;  2K60 A;  2NCO A;  4KYN A;  5IBW A;  1UHI A;  3TUY B;  2WCE A;  1WLM A;  1J7Q A;  1FW4 A;  2JC2 A;  1XFY O;  1EL4 A;  2KI4 C;  3HX4 A;  5ER5 A;  3BFB A;  3GK1 A;  1DJH A;  1CM4 A; 
#chains in the Genus database with same CATH homology
 2LLU A;  1AJ4 A;  1SL8 A;  4AQI A;  2JT3 A;  4PE4 A;  1CKK A;  2WOS A;  1DMO A;  2JT8 A;  2LMV A;  1IQ3 A;  1QX2 A;  3WHT B;  1QAT A;  3AAJ A;  5F6T A;  3KPX A;  1DGU A;  3JVT C;  2QPT A;  1F71 A;  1QIV A;  2PAL A;  1CMG A;  2COL B;  4NDD A;  3CR5 X;  2OTG B;  1SY9 A;  4U8D A;  2K2F A;  2L2E A;  3SG7 A;  2M97 A;  5AAN A;  1CLL A;  1KK7 Y;  1AVS A;  1IG5 A;  1MWN A;  2K7D A;  2F2P A;  4OKH A;  3BUM B;  4IL1 A;  1DJI A;  2KNE A;  2FCE A;  2LV7 A;  1LVC D;  4AQJ A;  2BKI B;  2H2K A;  1N2D A;  1KCY A;  3OB2 B;  1NX0 A;  1PRW A;  1S5G Y;  1K90 D;  1VRK A;  3O6B A;  1MHO A;  1NCX A;  1YVL A;  1TTX A;  1J7P A;  2L51 A;  1NIW A;  1BJF A;  3PLF B;  4L9M A;  3BUW B;  1A75 A;  2QAC A;  1RRO A;  1W7J B;  3PM8 A;  2I2R E;  2P6B B;  3BOW A;  4YGC B;  2M7N A;  4ZCV A;  2I7A A;  4R1E A;  1WRL A;  3SJS A;  3PAL A;  1Y1A A;  2LLT A;  1YX7 A;  1MXE A;  2ZNE A;  4I5J A;  2GGM A;  3AKB A;  1YVH A;  2F3Y A;  2KAV A;  3I5H C;  1K8U A;  3PN7 B;  4OV2 A;  3DVK A;  1S3P A;  3DVE A;  4YGE B;  1S26 D;  1A29 A;  5HLO A;  4ETO A;  1A4P A;  3CR4 X;  2KYC A;  2JPT A;  1XK4 C;  1JBA A;  2KFG A;  3I5G B;  3NXA A;  1A03 A;  1Y1X A;  2L4I A;  2BCX A;  2F3Z A;  2PMY A;  1TCF A;  2NLN A;  5HKW A;  1TRF A;  4BY5 A;  1KQM B;  1RJV A;  1F8H A;  2I94 A;  1CDP A;  1EG4 A;  5BPJ A;  1S1E A;  1AJ5 A;  5HKY A;  2NCP A;  2Y1N A;  1DJW A;  4PAL A;  2SAS A;  1RFJ A;  3TS5 B;  1DGV A;  4CLN A;  4YGD B;  1ZUZ A;  4Q04 A;  3CGA A;  1UHK A;  1EH2 A;  1NP8 A;  1NCY A;  3NSK A;  3GOF A;  2OS8 B;  2JNF A;  2FOT A;  1OMD A;  3SG4 A;  1BOD A;  2RGI A;  1IRJ A;  1JF0 A;  1B47 A;  2M9G A;  3JTD B;  4D1E A;  1DF0 A;  1TNQ A;  2PSR A;  4JQ0 D;  1J1D A;  1XFX O;  4UPG A;  1DTL A;  1X02 A;  2ZRT A;  1QJT A;  1GGW A;  1B8R A;  1CDL A;  4WRI A;  1L7Z A;  1KK8 C;  2KOT A;  3BUN B;  2BBM A;  2KFH A;  1BLQ A;  1EG3 A;  1SMG A;  3I5F B;  4DRW A;  1QVI Y;  5AEQ A;  4DIR A;  5I2O A;  1S6C A;  2F33 A;  1UHH A;  1S36 A;  2JXC A;  3I5I B;  4ICB A;  1XVJ A;  1YUS A;  2HPS A;  4MZK A;  2OPO A;  1NCZ A;  3DD4 A;  1JC2 A;  1HQV A;  3VRO A;  4F0Z B;  1LXF C;  1SR6 C;  2WND A;  3KHE A;  4P2Y B;  1DT7 B;  2WOR A;  4NDC A;  3TUY C;  1PSR A;  1IKU A;  1WRZ A;  1K94 A;  4USL A;  2WCF A;  1FI5 A;  1RWY A;  1CFF A;  3PFV A;  4OR9 B;  4HRH A;  2LVK A;  1YRT B;  1B7T Y;  2G2B A;  1YUT A;  5I2L A;  3A4U B;  5B8I B;  4OVN F;  1HT9 A;  1SYM A;  2BE6 A;  1J7O A;  1DJY A;  2G9B A;  2KGB C;  2LAP A;  2B1U A;  1QX7 A;  1MXL C;  1DJX A;  4PHJ A;  2OTG C;  2K7O A;  1QAS A;  2GV5 A;  2AMI A;  5CPV A;  1DF0 B;  1SL7 A;  2I18 A;  1JF2 A;  4XJK A;  1ZOT B;  1REC A;  2F8P A;  1OMV A;  4NDB A;  1AUI B;  1N65 A;  1FPW A;  2H61 C;  4GNK B;  2LC5 A;  1CFD A;  4HRE E;  3D10 A;  1ZAC A;  2LCP A;  1PSB A;  1PVB A;  1SW8 A;  3H4S E;  2EC6 B;  2KSP A;  3WHU B;  4FTG A;  1Y1U A;  2MRD A;  2CXJ A;  5CSF A;  2AUC A;  4GPL B;  5G08 A;  1AP4 A;  3CR2 A;  3IQQ A;  3O4Y A;  4I5K A;  2M49 B;  1WY9 A;  1IGV A;  1TN4 A;  1WDC B;  1SKT A;  2KFF A;  1XFV O;  2CBL A;  1EJ3 A;  2BE4 A;  3OHM B;  3SG3 A;  2M1U A;  1U5I B;  4WQ2 A;  2LUX A;  1K9U A;  3DVJ A;  3IQO A;  1UP5 A;  1NYA A;  1XFW O;  2AAO A;  2BL0 B;  4N1F A;  5CSN A;  3WNX B;  2PVB A;  1GQM A;  4MLW A;  2LMT A;  3SIB A;  1B9A A;  3VRQ A;  3SG2 A;  2K0J A;  2MLF C;  5CSJ A;  4DS7 A;  5CSI A;  1FBV A;  5HYD A;  3NSO A;  3LL8 B;  4I5L B;  4BY4 A;  1QIW A;  2JTT A;  2MBX A;  3JVT B;  4PE0 A;  1OZO A;  1NX2 A;  2PAS A;  3BUX B;  1XK4 A;  4CPV A;  2JT0 A;  2KYF A;  3DF0 A;  3I5G C;  4MRY A;  1SBJ A;  1JFK A;  3FWB A;  1BMO A;  3EVV A;  2R2I A;  5KU1 A;  1YR5 A;  2HQ8 A;  4FQO A;  4ZCU A;  5PAL A;  2L98 A;  1BOC A;  2D8N A;  1G4Y R;  4M2P A;  1CDM A;  4MEW A;  1K93 D;  4ORC B;  5FYX A;  2L4H A;  1DJG A;  4JWQ A;  4MRX A;  5K89 A;  1AK8 A;  1PAL A;  1OOJ A;  4MN0 A;  3SG5 A;  1QX5 B;  1RTP 1;  1TOP A;  1SRA A;  3OB1 B;  4CFR A;  5GQQ C;  1YUU A;  2OS8 C;  2ZRS A;  1C7V A;  2Y1M A;  3EK8 A;  1F54 A;  1CMF A;  2O60 A;  3EK7 A;  3SIA A;  3D0Y A;  1CLM A;  2MHH A;  4GGF C;  3PAT A;  5KTY A;  2F2O A;  1QLS A;  1YX8 A;  2LP2 A;  1ZFS A;  3VRR A;  2EGD A;  1YUR A;  1B1G A;  3I5F C;  1WLZ A;  1FI6 A;  5DKR A;  4PDZ A;  2JQ6 A;  3OX5 A;  3I5H B;  1GJY A;  2M29 A;  3LLE A;  5KSZ A;  1A75 B;  3AAK A;  1MUX A;  3I5I C;  3EKH A;  1W7I B;  3BOW B;  1F70 A;  1KQV A;  1D1O A;  2TN4 A;  4MBE A;  1NWD A;  4WQ3 A;  2FCD A;  4I5N B;  4N1G A;  3EVR A;  1SCM B;  1IH0 A;  1J55 A;  1JSA A;  4PHK A;  1NSH A;  1K96 A;  1TNW A;  3LK0 A;  1LKJ A;  1ALV A;  4YGB B;  1QLK A;  1CLB A;  4DCK A;  2ZKM X;  4YI8 A;  5I8N A;  5J3X A;  1B8C A;  1PVA A;  1KK7 Z;  5HLV A;  2MJW B;  1JWD A;  1KWO B;  2DOQ A;  3EKJ A;  1R2U A;  1KFU L;  2HF5 A;  2KQ6 A;  3TDI A;  2LAN A;  4JPZ B;  2MA2 A;  1S5G Z;  1L2O B;  3AKA A;  1MQ1 A;  1SK6 D;  4E68 A;  4GBA A;  5AER A;  1SL9 A;  1V1G A;  1M31 A;  3SG6 A;  1IJ5 A;  2MLE C;  3CWG A;  1IQ5 A;  2H61 A;  3NSI A;  4TNC A;  1NX1 A;  2KQY A;  3D0Y B;  1H8B A;  1N0Y A;  2IS9 A;  1UHN A;  1XA5 A;  4C0J A;  2KBM A;  5ER4 X;  1F4Q A;  1TIZ A;  1E8A A;  4ORA B;  4MVF A;  2K2A A;  2JWW A;  4GFT A;  4A4B A;  1XFU O;  1WDC C;  3EVU A;  3C1V A;  3E3R A;  3NSL A;  2KAY A;  3CLN A;  4DUQ A;  1NPQ A;  2NXQ A;  2ZN8 A;  3RM1 A;  2CT9 A;  1QV0 A;  4QJ3 B;  2BL0 C;  1IWQ A;  1KSO A;  4N5X A;  2KHN A;  1CDN A;  2K7C A;  4PCW A;  1BU3 A;  1TNX A;  2Y5I A;  3OX6 A;  2CNP A;  1C07 A;  4PE1 A;  1CFC A;  1M45 A;  2BBN A;  1ALW A;  3FS7 A;  3QRX A;  3PSR A;  2JU0 A;  2HQW A;  1IJ6 A;  1TNP A;  2JRF A;  1UWO A;  1CM1 A;  2ZND A;  2EHB A;  4GGN A;  4XYN A;  2ISD A;  3VRN A;  4GUK A;  1QS7 A;  2K8M B;  1J7R A;  2KGR A;  2KI4 B;  3KF9 A;  1WRK A;  3MSE B;  2M8U A;  2V53 A;  3GK4 X;  3CZT X;  4M2Q A;  4HSZ A;  3WXA A;  5DKN A;  3PN7 C;  4P5O E;  4GAO A;  5AXI A;  4CFQ A;  1F4O A;  5JJG A;  1OMR A;  1V1F A;  1KFU S;  2LP3 A;  1KFX L;  1MR8 A;  3DVM A;  3TDU A;  3KO0 A;  2M1K B;  3VGO A;  2Y4Q A;  2LVV A;  5JOL A;  2JOJ A;  3ZNI A;  1UUR A;  1R6P A;  3KEV A;  1QVI Z;  2LM5 A;  2KBI A;  1KQM C;  2KAX A;  4AOM A;  4XJK B;  3HCM A;  3LK1 A;  2M3W A;  1RK9 A;  3IF7 A;  1BF5 A;  4YI9 A;  2GGZ A;  1S6I A;  1ODB A;  2FJU B;  2K7B A;  4GGF A;  4M2O A;  3TS5 C;  1KSM A;  1F55 A;  2ZN9 A;  1OSA A;  2LMU A;  1GGZ A;  1A2X A;  4YGA A;  1SPY A;  1K2H A;  2LVI A;  3JTD C;  1BT6 A;  1B7T Z;  1G8I A;  3LCP C;  2L50 A;  4HRG A;  3O2P A;  4PHN A;  3ICB A;  4MZL A;  5DKQ A;  1FF1 A;  1M39 A;  1NUB A;  3RLZ A;  1B4C A;  1PK0 D;  3BUO B;  1SCV A;  4OCI A;  4CID A;  1SCM C;  1B8L A;  1G33 A;  1MF8 B;  3BYA A;  5TNC A;  1BG1 A;  1NX3 A;  3VRP A;  1CB1 A;  5D69 A;  2KI6 C;  2E30 A;  3O78 A;  1AHR A;  1CFP A;  2CTN A;  2LLS A;  2LHL A;  2BEC A;  3OP0 A;  2LUC A;  1M46 A;  1JUO A;  1QV1 A;  1Y0V H;  2Q4U A;  1CNP A;  2KI6 D;  4A4C A;  3TDZ A;  1TCO B;  1KWO C;  1DVI A;  2VRG A;  1K9K A;  2A4J A;  2L5X B;  1BR1 B;  3TZ1 A;  1JFJ A;  2SCP A;  3DF0 B;  1L2O C;  4NQG A;  4YBH B;  2NZ0 A;  1OQP A;  5I2Q A;  2O5G A;  1YTZ C;  1UUS A;  5HKZ A;  1YRU B;  2LVJ A;  3K21 A;  2L0P A;  2LE9 B;  2ZFD A;  4ORB B;  1KFX S;  3FWC A;  2BKH B;  3FIA A;  1EXR A;  1Q80 A;  1BR4 B;  1XFZ O;  2JXL A;  4C0K A;  1Y6W A;  4QJ4 B;  1K95 A;  1S6J A;  3CS1 A;  2M0R A;  2LHI A;  3F45 A;  1XO5 A;  1C7W A;  3GK2 A;  2JZI A;  3EK4 A;  1UHJ A;  4PHM A;  1H4B A;  1CTR A;  1SNL A;  2LNK A;  2WCB A;  3BXK A;  2M7L A;  2K61 A;  2MAZ A;  3M0W A;  2E6W A;  5AFP A;  4MZJ A;  3A8R A;  4C0L A;  2CCM A;  1KK8 B;  4QJ5 B;  1LA3 A;  1QTX A;  3ZWH A;  1K9P A;  1J1E A;  1OE9 B;  1XYD A;  2EC6 C;  1OZS A;  1M63 B;  1QXP A;  1U5I A;  4PE7 A;  2BCA A;  4MSP A;  4YRU A;  1LIN A;  1ZMZ A;  2KDH A;  2PRU A;  1DJZ A;  2JTZ A;  2Q91 A;  2HET A;  2JNX A;  3BQ3 A;  2WC8 A;  2BCB A;  1PUL A;  2JUL A;  3CTN A;  5D7F A;  1LA0 A;  1SR6 B;  2NCO A;  5IBW A;  1UHI A;  3TUY B;  2WCE A;  1WLM A;  1J7Q A;  1FW4 A;  2JC2 A;  1XFY O;  1EL4 A;  2KI4 C;  3HX4 A;  5ER5 A;  3GK1 A;  1DJH A;  1CM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...