2M3WA

Protein structure determination from a set of 4d noesy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein S100-A1
publication title Determination of protein structure from a set of 4D NOESY performed with non uniform sampling
rcsb
source organism Homo sapiens
total genus 24
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m3wA00
1PVBA 4ZCVA 4BY4A 2K2FA 2MHHA 2WCFA 2K2AA 1JFKA 3TUYC 1EJ3A 1ZUZA 3EVRA 1F55A 1UUSA 1H4BA 1QX5B 5HKYA 2I94A 2FOTA 3VRPA 1AK8A 2JQ6A 2BBNA 4YGBB 4M2OA 3BQ3A 1MXEA 1XFZO 2KQ6A 1A2XA 4OR9B 1AJ5A 1MHOA 1Q80A 2LC5A 1RWYA 5HYDA 1B9AA 2Y1NA 4DRWA 1C7WA 3CR5X 4GBAA 1HT9A 4JWQA 1QS7A 2Y1MA 5AERA 2V53A 1GGWA 2A4JA 1EG3A 2O60A 1IRJA 4MRYA 1PRWA 2H61A 1FF1A 4YGAA 1YUUA 3BOWA 3DVJA 3LLEA 3PN7C 1S1EA 2JPTA 1R2UA 1LINA 2AAOA 2LVKA 4OKHA 1A29A 1ALWA 4ORBB 5DKQA 2K7CA 1EH2A 2K7OA 2LP2A 4CFRA 1KQMB 1N0YA 4NQGA 2LMUA 1CDNA 4ETOA 3BUMB 3AAJA 1RROA 4N5XA 1HQVA 1WDCC 3O6BA 1CDPA 2CNPA 4HRHA 3ZWHA 1TTXA 2JNXA 2LV7A 4M2QA 1SR6C 4CFQA 2EC6B 1DJHA 1ZACA 1UHNA 3NSIA 2KYCA 2LUCA 4ICBA 4C0LA 2CTNA 1SK6D 2I18A 2KYFA 1K95A 4YI9A 2BECA 1K9PA 2LMVA 1CB1A 3D0YB 5PALA 5HLOA 1QV1A 3GK1A 1QV0A 1RJVA 4QJ4B 4GGFA 2M3WA 1DJWA 4GUKA 2EGDA 1KSMA 5I2OA 1TOPA 2NCPA 2NZ0A 5F6TA 2G2BA 5D7FA 2ZFDA 4WQ3A 1B8LA 5AXIA 4AQIA 2JNFA 4BY5A 3OHMB 2BL0B 1B7TZ 2M29A 1S36A 1QIWA 3TS5B 1C7VA 1NCZA 1FW4A 1SW8A 3CS1A 1BLQA 4PE4A 3CTNA 4XJKA 1Y1AA 1BJFA 1E8AA 2ZN8A 3MSEB 4PCWA 2LHIA 3PSRA 1SL8A 3VROA 4NDCA 1N2DA 4PHNA 1JF0A 4NDDA 4C0JA 4PHKA 3I5FB 4OVNF 1B8CA 2L0PA 1NPQA 3BUWB 2K7BA 3E3RA 1B4CA 1YRTB 3BUNB 1CTRA 4GNKB 4XYNA 2HPSA 3ICBA 2KQYA 3DF0B 2FJUB 4MSPA 3LK0A 3SG6A 1L2OB 1MQ1A 3BYAA 1QX2A 1FI5A 3FS7A 1XK4C 5JJGA 1KQVA 1IJ6A 1SCVA 2KFGA 3EVUA 4ORAB 1BMOA 1BR1B 3ZNIA 4CLNA 1IH0A 1G8IA 1QVIY 4YI8A 1XK4A 3DD4A 1S6IA 3D10A 1OMRA 1M45A 1UHIA 3KHEA 5GQQC 3SIBA 4NDBA 2E30A 5JOLA 4DCKA 3EKHA 1G33A 1UHKA 1KWOC 1CMGA 2LAPA 2MAZA 1NIWA 1XFYO 3SG2A 1RK9A 2KGRA 3TDUA 4DIRA 5I2LA 2M7LA 1ZMZA 1SMGA 4FTGA 3GK4X 1W7JB 1B1GA 1AVSA 1Y0VH 4CIDA 2GV5A 5CSNA 5TNCA 5BPJA 4A4CA 1DJZA 2NXQA 2K7DA 1J7QA 2Y5IA 1K9UA 5ER4X 1CLLA 1S6JA 2CCMA 2JTTA 5I2QA 2K61A 4MRXA 2BKIB 1K2HA 4E68A 1XFWO 2K8MB 3I5HC 1J1DA 3EKJA 1DT7B 2ZNDA 2KHNA 1IKUA 2ZNEA 1YUTA 2BCBA 1CDLA 5B8IB 2F8PA 3LCPC 1D1OA 1BG1A 1TNXA 4USLA 1NP8A 5K89A 1YUSA 1CFPA 2H61C 2JTZA 3I5GB 1WRKA 1EL4A 1EG4A 1C07A 2WNDA 1LA3A 4ORCB 1SL9A 1S26D 1NUBA 3WNXB 1PSBA 1AP4A 1UHHA 1J55A 3WHTB 1U5IB 3FIAA 1DJGA 2KAVA 3OB2B 2PALA 5HLVA 1KFUL 3TUYB 1CMFA 4I5JA 4U8DA 2JU0A 1OSAA 2JXCA 3H4SE 3JTDC 5DKNA 4A4BA 1CDMA 4WRIA 1PVAA 3VRQA 1IJ5A 3O4YA 3DVMA 1WRLA 2WCEA 1PALA 3LK1A 1EXRA 4PALA 1J7RA 1B7TY 2ZRSA 2GGMA 1YRUB 4GGFC 2F33A 1DJXA 1WRZA 3D0YA 4OCIA 3PN7B 4ZCUA 1CNPA 1TCFA 2LNKA 2O5GA 2LLTA 2RGIA 4MLWA 3HCMA 2CXJA 1B8RA 1Y6WA 2OTGC 1JF2A 1JFJA 5HKZA 2BBMA 2M49B 2PMYA 1DF0B 3PATA 4PE0A 2PASA 1SRAA 1WDCB 2L4HA 3GOFA 2JXLA 2F2OA 4MZJA 1SR6B 1Y1XA 4DS7A 3K21A 2MRDA 3BUXB 4MVFA 1IG5A 5AANA 1KFUS 1BU3A 5IBWA 2LP3A 4N1GA 1TN4A 3O2PA 1YX7A 3DVKA 1NX2A 3JVTC 1CLMA 2KI6C 2JC2A 2M0RA 2VRGA 5J3XA 2I7AA 2M97A 5D69A 5G08A 2JT3A 2SASA 5KU1A 4TNCA 2KSPA 2LUXA 1BOCA 1J7PA 1CLBA 1YX8A 2WC8A 3I5IC 3IQQA 1AJ4A 1OQPA 2PRUA 4R1EA 3F45A 2MLEC 4MEWA 2JZIA 1QJTA 1KK7Z 1SYMA 1TNWA 2K0JA 2KFFA 5CSFA 1JUOA 2G9BA 1OMVA 1UP5A 2E6WA 1OZOA 2L51A 1XFXO 5CPVA 4HREE 1CKKA 3O78A 1OMDA 4D1EA 2ZRTA 1NWDA 2PSRA 2KI6D 1SCMC 2M1UA 1DVIA 2JOJA 1A03A 2FCDA 1IGVA 3SG7A 4JPZB 1KK8C 2L4IA 4HRGA 2B1UA 1PULA 1QASA 1TIZA 2KAYA 1Y1UA 1F54A 1DJIA 1JC2A 1RFJA 1SNLA 2JRFA 2OPOA 4GGNA 3OX6A 2BCAA 2MA2A 3NXAA 1BF5A 1NX3A 2NCOA 4JQ0D 2ISDA 1BT6A 1LA0A 5CSIA 5CSJA 4QJ5B 1YR5A 2LLSA 1QATA 1UURA 1TNQA 1A75B 2LM5A 1XFUO 3OX5A 1UHJA 1XO5A 1NX1A 1QIVA 3PALA 3SG4A 1SY9A 1DMOA 1V1FA 1NCYA 1XA5A 2IS9A 3SG5A 2KNEA 3DVEA 5ER5A 1CFCA 1QLSA 3FWCA 3SJSA 5AFPA 1GGZA 1BR4B 2F3YA 1KWOB 4I5KA 2F3ZA 5HKWA 3WHUB 4AOMA 2M8UA 1IQ5A 1K9KA 2KBIA 1JBAA 1NCXA 1ODBA 1J1EA 3AAKA 1QVIZ 2M1KB 4GAOA 1FPWA 1V1GA 1WLZA 1M31A 1SBJA 4GFTA 2DOQA 1YTZC 1M46A 2TN4A 3VGOA 1UWOA 2LMTA 1K96A 3NSOA 1W7IB 2LVIA 2M7NA 4L9MA 1K8UA 1S5GZ 2MBXA 3KEVA 4M2PA 3GK2A 1QLKA 1H8BA 1M39A 1DGUA 4MBEA 4I5NB 1KQMC 2WORA 1U5IA 1FBVA 4MN0A 1CFDA 3RLZA 4YBHB 1F4OA 2ZKMX 1YURA 1MR8A 1OOJA 3OB1B 1JSAA 1DJYA 3I5HB 5AEQA 2ZN9A 2F2PA 1ZFSA 2WCBA 2EC6C 1XYDA 2GGZA 2QPTA 3EK7A 2LHLA 3NSKA 5I8NA 4OV2A 2BE4A 1NX0A 2P6BB 3OP0A 3CGAA 3HX4A 3IF7A 1WLMA 1K94A 3BOWB 2KBMA 1CM4A 1MWNA 3PM8A 4PE1A 3VRNA 1YVHA 2BCXA 2LE9B 4P2YB 1M63B 1TCOB 4HSZA 3BUOB 5DKRA 5KTYA 2BL0C 1S6CA 2COLB 4Q04A 3WXAA 3LL8B 1KCYA 3TS5C 1SKTA 4YRUA 5FYXA 3BXKA 2BKHB 1NSHA 1VRKA 2CT9A 3JTDB 3CLNA 1DF0A 2KFHA 3PLFB 3KF9A 1QXPA 2R2IA 1N65A 1BODA 2Q91A 1OE9B 2KGBC 2L98A 3CR4X 2BE6A 1TNPA 2JT8A 4WQ2A 1ALVA 2PVBA 2MJWB 2HF5A 3A8RA 2Y4QA 3I5FC 1K93D 2HETA 2AUCA 2H2KA 2FCEA 2QACA 1KK7Y 4AQJA 1DTLA 2KDHA 1K90D 3SIAA 2L50A 1NYAA 4QJ3B 2OS8C 4MZKA 3EK8A 2NLNA 1LXFC 4MZLA 3CWGA 1RECA 1XVJA 3KO0A 1A4PA 3SG3A 1B47A 2HQWA 3RM1A 2OTGB 4YGCB 1PSRA 4IL1A 3EVVA 1R6PA 1L2OC 4XJKB 2KI4C 2MLFC 1ZOTB 3NSLA 3DF0A 1FI6A 1TRFA 2SCPA 3AKAA 1RTP1 1JWDA 1AUIB 2JWWA 4PHJA 1KFXL 3CZTX 1GJYA 1LKJA 1LVCD 4I5LB 2D8NA 3KPXA 1DGVA 2LANA 3IQOA 4YGDB 2KOTA 1QTXA 3JVTB 4N1FA 1J7OA 3A4UB 1GQMA 1XFVO 3PFVA 2OS8B 4P5OE 1F70A 2M9GA 3TDIA 1AHRA 1OZSA 1S3PA 2Q4UA 2CBLA 3C1VA 2JULA 3EK4A 4F0ZB 2LCPA 2I2RE 1PK0D 1SL7A 4FQOA 1CFFA 3I5IB 3M0WA 4GPLB 4C0KA 2KI4B 1MF8B 1X02A 1F4QA 3QRXA 3TZ1A 1SPYA 5KSZA 2EHBA 2LLUA 2LVJA 2JT0A 4PDZA 4CPVA 1IQ3A 1G4YR 4YGEB 3VRRA 4DUQA 2KAXA 1A75A 4PHMA 1KSOA 4UPGA 3TDZA 1F8HA 2L2EA 2HQ8A 2L5XB 1SCMB 4PE7A 1MXLC 3AKBA 3CR2A 1CM1A 1MUXA 1IWQA 1QX7A 1KK8B 1S5GY 2LVVA 1F71A 1L7ZA 1KFXS 1YVLA 1WY9A 3I5GC 2AMIA 2WOSA 3FWBA
chains in the Genus database with same CATH superfamily
1PVBA 4ZCVA 3Q8IA 4BY4A 2K2FA 2MHHA 2WCFA 2K2AA 1JFKA 3L4AA 3TUYC 1EJ3A 1ZUZA 3EVRA 1F55A 1UUSA 1H4BA 1QX5B 5HKYA 2I94A 2FOTA 1OOIX 2BNXA 3VRPA 1AK8A 2JQ6A 2BBNA 4YGBB 4M2OA 3BQ3A 1MXEA 1XFZO 2KQ6A 1A2XA 3CZ1A 1AJ5A 1MHOA 4OR9B 1Q80A 2LC5A 1RWYA 5HYDA 1B9AA 2Y1NA 4FQTA 4DRWA 1C7WA 3CR5X 4GBAA 1HT9A 4JWQA 3BFBA 1QS7A 2Y1MA 5AERA 2V53A 3S0DA 1GGWA 2A4JA 1EG3A 2O60A 1IRJA 4MRYA 1LS8A 1PRWA 2H61A 1FF1A 4YGAA 1YUUA 3BOWA 3DVJA 3LLEA 3PN7C 1S1EA 1TUJA 2JPTA 1R2UA 1LINA 3CZ0A 2AAOA 2LVKA 4OKHA 1A29A 1ALWA 4ORBB 5DKQA 2K7CA 1TWOA 1EH2A 2K7OA 2LP2A 3FE9A 4CFRA 1KQMB 1N0YA 4NQGA 2LMUA 1CDNA 4ETOA 1DQEA 3AAJA 3BUMB 1RROA 4N5XA 1HQVA 1WDCC 3O6BA 3D73A 3PJIA 3CABA 1CDPA 2CNPA 4HRHA 3ZWHA 1TTXA 2JNXA 2LV7A 4M2QA 1SR6C 4CFQA 2EC6B 1DJHA 2L2CA 3D74A 1ZACA 1UHNA 3L4LA 3NSIA 3FE8A 1P28A 4KYNA 2KYCA 1T14A 2LUCA 4ICBA 4C0LA 2CTNA 1SK6D 2I18A 2KYFA 1K95A 4YI9A 2BECA 1K9PA 2LMVA 1CB1A 3D0YB 5PALA 5HLOA 1QV1A 2WCHA 3GK1A 1QV0A 1RJVA 4QJ4B 4GGFA 2M3WA 1SSEB 1DJWA 4GUKA 4PT1A 2EGDA 1KSMA 5I2OA 1TOPA 2NCPA 2NZ0A 5F6TA 2G2BA 5D7FA 2ZFDA 4WQ3A 1Z4HA 1B8LA 5AXIA 2WC6A 4AQIA 2WCJA 2JNFA 4BY5A 3OHMB 2BL0B 1B7TZ 2M29A 1S36A 1QIWA 3TS5B 2QEOA 3B6XA 1C7VA 1NCZA 1FW4A 1SW8A 3CS1A 1BLQA 4PE4A 3CTNA 4XJKA 3S0GA 1OOHA 1BJFA 1E8AA 1Y1AA 2ZN8A 3MSEB 4PCWA 2LHIA 3PSRA 1SL8A 3VROA 4NDCA 1N2DA 4PHNA 1JF0A 4NDDA 2ERBA 4C0JA 4PHKA 3RZSA 3I5FB 4OVNF 1B8CA 2L0PA 1NPQA 3BUWB 2K7BA 3E3RA 1B4CA 1YRTB 3V2LA 3BUNB 1CTRA 4OZDA 4GNKB 4XYNA 2HPSA 3ICBA 3IVTA 1TUZA 2KQYA 3DF0B 2FJUB 4MSPA 3LK0A 3S0EA 3SG6A 1L2OB 1MQ1A 3BYAA 1QX2A 1FI5A 3FS7A 5GQQC 3B88A 1XK4C 5JJGA 1KQVA 3O4XA 1IJ6A 1SCVA 2KFGA 3EVUA 4ORAB 1BMOA 1BR1B 3ZNIA 4CLNA 1IH0A 1G8IA 1QVIY 4YI8A 1XK4A 3DD4A 1S6IA 3D10A 1OMRA 1M45A 1UHIA 1Z2CB 3KHEA 3SIBA 3N7HA 2E30A 4NDBA 5JOLA 4DCKA 3EKHA 1G33A 1UHKA 1KWOC 1CMGA 2LAPA 3PM2A 2MAZA 1NIWA 1XFYO 3SG2A 1RK9A 2KGRA 3TDUA 4DIRA 5I2LA 2M7LA 1ZMZA 1SMGA 4FTGA 3GK4X 1W7JB 1B1GA 1AVSA 1Y0VH 4CIDA 2GV5A 2WCKA 5CSNA 5TNCA 5BPJA 4A4CA 1DJZA 2NXQA 3SS4A 2K7DA 1J7QA 2Y5IA 1K9UA 5ER4X 1CLLA 1S6JA 2CCMA 2JTTA 2WCMA 2K61A 5I2QA 4MRXA 2BKIB 3BJHA 1K2HA 4E68A 1OW4A 1XFWO 2K8MB 3I5HC 1J1DA 3EKJA 1DT7B 2ZNDA 2KHNA 1DEKA 1IKUA 2ZNEA 1YUTA 1DELA 1CDLA 2BCBA 5B8IB 2F8PA 3LCPC 1D1OA 3L47A 3NGVA 1BG1A 1TNXA 4USLA 1NP8A 5K89A 1YUSA 2QDIA 1CFPA 2H61C 2JTZA 3I5GB 1WRKA 1EL4A 1EG4A 1C07A 2WNDA 1LA3A 4ORCB 1SL9A 3NHIA 1S26D 1NUBA 3WNXB 1PSBA 1AP4A 1UHHA 1J55A 1IIOA 3WHTB 1U5IB 3FIAA 1DJGA 2KAVA 3OB2B 2PALA 5HLVA 1KFUL 3TUYB 1CMFA 4I5JA 4U8DA 2JU0A 1OSAA 2JXCA 3H4SE 3JTDC 5DKNA 4A4BA 1CDMA 4WRIA 1PVAA 3VRQA 1IJ5A 2BAPA 3DVMA 3O4YA 1WRLA 2WCEA 1PALA 3LK1A 1EXRA 4INXA 4PALA 1J7RA 1B7TY 2ZRSA 2P71A 2GGMA 1YRUB 2H8VA 4GGFC 3DYEA 2WC5A 2F33A 1DJXA 5HL1A 1WRZA 3D0YA 4OCIA 3PN7B 4ZCUA 1CNPA 1TCFA 2LNKA 2O5GA 2LLTA 2RGIA 3S0AA 4MLWA 3HCMA 2CXJA 1B8RA 1Y6WA 2OTGC 1JF2A 1JFJA 5HKZA 2BBMA 2M49B 2PMYA 1DF0B 3PATA 4PE0A 5DICA 2PASA 1SRAA 1WDCB 2L4HA 3GOFA 3R1PA 2JPOA 2JXLA 2F2OA 4MZJA 2WCLA 1SR6B 1Y1XA 3D77A 4DS7A 4F7FA 3K21A 2MRDA 3BUXB 4MVFA 1IG5A 5AANA 1KFUS 1BU3A 5IBWA 5FI2A 2LP3A 4N1GA 1TN4A 3O2PA 1YX7A 3DVKA 1NX2A 3JVTC 1CLMA 2KI6C 2JC2A 2M0RA 2VRGA 2K60A 5J3XA 2I7AA 2M97A 5I94A 3CZ2A 5D69A 5G08A 3CDNA 3S0BA 2JT3A 2SASA 5KU1A 4TNCA 2KSPA 2LUXA 1BOCA 1ORGA 1J7PA 1CLBA 1YX8A 2WC8A 3I5IC 3IQQA 1AJ4A 3UO9A 2QEVA 1OQPA 2PRUA 1C3YA 3FE6A 4R1EA 3F45A 2MLEC 4MEWA 2JZIA 3VB1A 1QJTA 1KK7Z 1SYMA 1TNWA 2K0JA 2KFFA 2QEHA 1JUOA 5CSFA 2G9BA 1OMVA 1UP5A 2KLDA 2PQLA 2YGUA 2E6WA 1OZOA 2L51A 1XFXO 5CPVA 4HREE 1CKKA 3O78A 1OMDA 4D1EA 2ZRTA 1NWDA 2PSRA 2KI6D 1SCMC 3BFAA 2M1UA 1DVIA 2JOJA 5D3OA 1A03A 2FCDA 1IGVA 3SG7A 4JPZB 1KK8C 2L4IA 4HRGA 2B1UA 1PULA 1QASA 1C3ZA 1TIZA 2KAYA 1Y1UA 1F54A 1DJIA 1JC2A 1RFJA 1SNLA 2JRFA 2OPOA 4GGNA 3OX6A 3D75A 2BCAA 2MA2A 3NXAA 1BF5A 1NX3A 1OOGA 2NCOA 4JQ0D 2ISDA 1BT6A 1LA0A 5CSIA 5CSJA 4QJ5B 1YR5A 2LLSA 1QATA 1UURA 1TNQA 1A75B 2LM5A 1XFUO 3OX5A 1UHJA 1XO5A 1NX1A 1QIVA 2P70A 3PALA 1SY9A 3SG4A 1V1FA 1DMOA 1NCYA 1XA5A 2IS9A 3SG5A 2KNEA 3DVEA 5ER5A 1CFCA 1QLSA 3FWCA 3SJSA 5AFPA 1GGZA 1BR4B 2F3YA 1KWOB 4I5KA 2F3ZA 5HKWA 3WHUB 4AOMA 3BFHA 2M8UA 1IQ5A 1K9KA 2KBIA 1JBAA 1NCXA 1ODBA 1J1EA 3AAKA 1QVIZ 2M1KB 4GAOA 1W9ZA 1FPWA 1V1GA 1WLZA 4INWA 1M31A 1SBJA 4GFTA 4JKTA 2DOQA 1YTZC 1M46A 2TN4A 3VGOA 1UWOA 2LMTA 1K96A 3NSOA 1W7IB 2LVIA 2M7NA 4L9MA 1K8UA 1S5GZ 2MBXA 3KEVA 4M2PA 3GK2A 2FJYA 1QLKA 3UNWA 1M39A 1H8BA 1DGUA 4MBEA 1OOFA 1KQMC 4I5NB 2WORA 1U5IA 1FBVA 4MN0A 1CFDA 3RLZA 4YBHB 1F4OA 2ZKMX 1YURA 1MR8A 1OOJA 3OB1B 1JSAA 1DJYA 3I5HB 5AEQA 2ZN9A 3SS5A 2F2PA 1ZFSA 2WCBA 2EC6C 1XYDA 4JD9A 2GGZA 2QPTA 3EK7A 2LHLA 3NSKA 5I8NA 1XFRA 4OV2A 2BE4A 1NX0A 2P6BB 3DZTA 3EG5B 3OP0A 3CGAA 3HX4A 3IF7A 5FI7A 1WLMA 1K94A 3BOWB 2KBMA 1CM4A 1MWNA 3PM8A 4PE1A 3VRNA 1YVHA 2BCXA 2LE9B 4P2YB 3OGNA 1M63B 1TCOB 2GTEA 4HSZA 3BUOB 5DKRA 4IJ7A 5KTYA 2BL0C 1S6CA 2COLB 2PYQA 4Q04A 3LL8B 3WXAA 1KCYA 3TS5C 1SKTA 4YRUA 5FYXA 3BXKA 2BKHB 1NSHA 3B87A 1VRKA 2CT9A 3CYZA 3JTDB 3K1EA 3CLNA 1DF0A 2KFHA 3PLFB 3KF9A 1QXPA 2R2IA 1N65A 1BODA 2Q91A 1OE9B 2KGBC 2L98A 3CR4X 2QEBA 2BE6A 1TNPA 2JT8A 4WQ2A 1ALVA 2PVBA 3B86A 2MJWB 2HF5A 3A8RA 2Y4QA 3I5FC 1K93D 2HETA 2AUCA 2H2KA 2FCEA 2QACA 1KK7Y 4AQJA 1DTLA 2KDHA 1K90D 3SIAA 2L50A 1NYAA 3R72A 4QJ3B 2OS8C 4MZKA 3EK8A 2NLNA 1LXFC 4MZLA 3CWGA 1RECA 1XVJA 3D76A 1A4PA 3KO0A 3R1OA 3SS3A 1B47A 2HQWA 3SG3A 3RM1A 2OTGB 3QMEA 4YGCB 1PSRA 4IL1A 3EVVA 3DY9A 1R6PA 1L2OC 4XJKB 5FI6A 2KI4C 2MLFC 1ZOTB 3NSLA 3DF0A 1FI6A 1TRFA 2SCPA 3AKAA 1RTP1 1JWDA 1AUIB 2JWWA 4PHJA 1KFXL 3CZTX 1GJYA 1LKJA 1LVCD 4I5LB 2D8NA 3KPXA 1DGVA 3B7AA 2LANA 3IQOA 4YGDB 2KOTA 1QTXA 3JVTB 4N1FA 1J7OA 3A4UB 3R1VA 1GQMA 1XFVO 3PFVA 2OS8B 4P5OE 1F70A 2M9GA 3TDIA 1AHRA 1OZSA 1S3PA 2Q4UA 5EL2A 2CBLA 3C1VA 2JULA 1QWVA 3EK4A 4F0ZB 2LCPA 3DXLA 2I2RE 1PK0D 3S0FA 1SL7A 4FQOA 1CFFA 3I5IB 3M0WA 4GPLB 4C0KA 2KI4B 2KPHA 1MF8B 1X02A 1F4QA 3QRXA 3TZ1A 1SPYA 5KSZA 2EHBA 2LLUA 2LVJA 2JT0A 4PDZA 4CPVA 1IQ3A 1G4YR 4YGEB 3VRRA 4DUQA 2KAXA 1A75A 4PHMA 1KSOA 4UPGA 3TDZA 1GM0A 1F8HA 2L2EA 1DC1A 2HQ8A 2L5XB 1SCMB 4PE7A 1MXLC 2KLEA 3AKBA 3CR2A 1CM1A 1MUXA 1IWQA 1QX7A 1KK8B 1S5GY 2LVVA 1F71A 3NHTA 1L7ZA 1KFXS 1YVLA 1WY9A 3I5GC 2L5YA 2AMIA 2WOSA 3OBVA 3D78A 3FWBA
chains in the Genus database with same CATH topology
1PVBA 4ZCVA 4BY4A 2K2FA 2MHHA 2WCFA 2K2AA 1JFKA 3TUYC 1EJ3A 1ZUZA 3EVRA 1F55A 1UUSA 1H4BA 1QX5B 5HKYA 2I94A 2FOTA 3VRPA 1AK8A 2JQ6A 2BBNA 4YGBB 4M2OA 3BQ3A 1MXEA 1XFZO 2KQ6A 1A2XA 4OR9B 1AJ5A 1MHOA 1Q80A 2LC5A 1RWYA 5HYDA 1B9AA 2Y1NA 4DRWA 1C7WA 3CR5X 4GBAA 1HT9A 4JWQA 1QS7A 2Y1MA 5AERA 2V53A 1GGWA 2A4JA 1EG3A 2O60A 1IRJA 4MRYA 1PRWA 2H61A 1FF1A 4YGAA 1YUUA 3BOWA 3DVJA 3LLEA 3PN7C 1S1EA 2JPTA 1R2UA 1LINA 2AAOA 2LVKA 4OKHA 1A29A 1ALWA 4ORBB 5DKQA 2K7CA 1EH2A 2K7OA 2LP2A 4CFRA 1KQMB 1N0YA 4NQGA 2LMUA 1CDNA 4ETOA 3BUMB 3AAJA 1RROA 4N5XA 1HQVA 1WDCC 3O6BA 1CDPA 2CNPA 4HRHA 3ZWHA 1TTXA 2JNXA 2LV7A 4M2QA 1SR6C 4CFQA 2EC6B 1DJHA 1ZACA 1UHNA 3NSIA 2KYCA 2LUCA 4ICBA 4C0LA 2CTNA 1SK6D 2I18A 2KYFA 1K95A 4YI9A 2BECA 1K9PA 2LMVA 1CB1A 3D0YB 5PALA 5HLOA 1QV1A 3GK1A 1QV0A 1RJVA 4QJ4B 4GGFA 2M3WA 1DJWA 4GUKA 2EGDA 1KSMA 5I2OA 1TOPA 2NCPA 2NZ0A 5F6TA 2G2BA 5D7FA 2ZFDA 4WQ3A 1B8LA 5AXIA 4AQIA 2JNFA 4BY5A 3OHMB 2BL0B 1B7TZ 2M29A 1S36A 1QIWA 3TS5B 1C7VA 1NCZA 1FW4A 1SW8A 3CS1A 1BLQA 4PE4A 3CTNA 4XJKA 1Y1AA 1BJFA 1E8AA 2ZN8A 3MSEB 4PCWA 2LHIA 3PSRA 1SL8A 3VROA 4NDCA 1N2DA 4PHNA 1JF0A 4NDDA 4C0JA 4PHKA 3I5FB 4OVNF 1B8CA 2L0PA 1NPQA 3BUWB 2K7BA 3E3RA 1B4CA 1YRTB 3BUNB 1CTRA 4GNKB 4XYNA 2HPSA 3ICBA 2KQYA 3DF0B 2FJUB 4MSPA 3LK0A 3SG6A 1L2OB 1MQ1A 3BYAA 1QX2A 1FI5A 3FS7A 1XK4C 5JJGA 1KQVA 1IJ6A 1SCVA 2KFGA 3EVUA 4ORAB 1BMOA 1BR1B 3ZNIA 4CLNA 1IH0A 1G8IA 1QVIY 4YI8A 1XK4A 3DD4A 1S6IA 3D10A 1OMRA 1M45A 1UHIA 3KHEA 5GQQC 3SIBA 4NDBA 2E30A 5JOLA 4DCKA 3EKHA 1G33A 1UHKA 1KWOC 1CMGA 2LAPA 2MAZA 1NIWA 1XFYO 3SG2A 1RK9A 2KGRA 3TDUA 4DIRA 5I2LA 2M7LA 1ZMZA 1SMGA 4FTGA 3GK4X 1W7JB 1B1GA 1AVSA 1Y0VH 4CIDA 2GV5A 5CSNA 5TNCA 5BPJA 4A4CA 1DJZA 2NXQA 2K7DA 1J7QA 2Y5IA 1K9UA 5ER4X 1CLLA 1S6JA 2CCMA 2JTTA 5I2QA 2K61A 4MRXA 2BKIB 1K2HA 4E68A 1XFWO 2K8MB 3I5HC 1J1DA 3EKJA 1DT7B 2ZNDA 2KHNA 1IKUA 2ZNEA 1YUTA 2BCBA 1CDLA 5B8IB 2F8PA 3LCPC 1D1OA 1BG1A 1TNXA 4USLA 1NP8A 5K89A 1YUSA 1CFPA 2H61C 2JTZA 3I5GB 1WRKA 1EL4A 1EG4A 1C07A 2WNDA 1LA3A 4ORCB 1SL9A 1S26D 1NUBA 3WNXB 1PSBA 1AP4A 1UHHA 1J55A 3WHTB 1U5IB 3FIAA 1DJGA 2KAVA 3OB2B 2PALA 5HLVA 1KFUL 3TUYB 1CMFA 4I5JA 4U8DA 2JU0A 1OSAA 2JXCA 3H4SE 3JTDC 5DKNA 4A4BA 1CDMA 4WRIA 1PVAA 3VRQA 1IJ5A 3O4YA 3DVMA 1WRLA 2WCEA 1PALA 3LK1A 1EXRA 4PALA 1J7RA 1B7TY 2ZRSA 2GGMA 1YRUB 4GGFC 2F33A 1DJXA 1WRZA 3D0YA 4OCIA 3PN7B 4ZCUA 1CNPA 1TCFA 2LNKA 2O5GA 2LLTA 2RGIA 4MLWA 3HCMA 2CXJA 1B8RA 1Y6WA 2OTGC 1JF2A 1JFJA 5HKZA 2BBMA 2M49B 2PMYA 1DF0B 3PATA 4PE0A 2PASA 1SRAA 1WDCB 2L4HA 3GOFA 2JXLA 2F2OA 4MZJA 1SR6B 1Y1XA 4DS7A 3K21A 2MRDA 3BUXB 4MVFA 1IG5A 5AANA 1KFUS 1BU3A 5IBWA 2LP3A 4N1GA 1TN4A 3O2PA 1YX7A 3DVKA 1NX2A 3JVTC 1CLMA 2KI6C 2JC2A 2M0RA 2VRGA 5J3XA 2I7AA 2M97A 5D69A 5G08A 2JT3A 2SASA 5KU1A 4TNCA 2KSPA 2LUXA 1BOCA 1J7PA 1CLBA 1YX8A 2WC8A 3I5IC 3IQQA 1AJ4A 1OQPA 2PRUA 4R1EA 3F45A 2MLEC 4MEWA 2JZIA 1QJTA 1KK7Z 1SYMA 1TNWA 2K0JA 2KFFA 5CSFA 1JUOA 2G9BA 1OMVA 1UP5A 2E6WA 1OZOA 2L51A 1XFXO 5CPVA 4HREE 1CKKA 3O78A 1OMDA 4D1EA 2ZRTA 1NWDA 2PSRA 2KI6D 1SCMC 2M1UA 1DVIA 2JOJA 1A03A 2FCDA 1IGVA 3SG7A 4JPZB 1KK8C 2L4IA 4HRGA 2B1UA 1PULA 1QASA 1TIZA 2KAYA 1Y1UA 1F54A 1DJIA 1JC2A 1RFJA 1SNLA 2JRFA 2OPOA 4GGNA 3OX6A 2BCAA 2MA2A 3NXAA 1BF5A 1NX3A 2NCOA 4JQ0D 2ISDA 1BT6A 1LA0A 5CSIA 5CSJA 4QJ5B 1YR5A 2LLSA 1QATA 1UURA 1TNQA 1A75B 2LM5A 1XFUO 3OX5A 1UHJA 1XO5A 1NX1A 1QIVA 3PALA 3SG4A 1SY9A 1DMOA 1V1FA 1NCYA 1XA5A 2IS9A 3SG5A 2KNEA 3DVEA 5ER5A 1CFCA 1QLSA 3FWCA 3SJSA 5AFPA 1GGZA 1BR4B 2F3YA 1KWOB 4I5KA 2F3ZA 5HKWA 3WHUB 4AOMA 2M8UA 1IQ5A 1K9KA 2KBIA 1JBAA 1NCXA 1ODBA 1J1EA 3AAKA 1QVIZ 2M1KB 4GAOA 1FPWA 1V1GA 1WLZA 1M31A 1SBJA 4GFTA 2DOQA 1YTZC 1M46A 2TN4A 3VGOA 1UWOA 2LMTA 1K96A 3NSOA 1W7IB 2LVIA 2M7NA 4L9MA 1K8UA 1S5GZ 2MBXA 3KEVA 4M2PA 3GK2A 1QLKA 1H8BA 1M39A 1DGUA 4MBEA 4I5NB 1KQMC 2WORA 1U5IA 1FBVA 4MN0A 1CFDA 3RLZA 4YBHB 1F4OA 2ZKMX 1YURA 1MR8A 1OOJA 3OB1B 1JSAA 1DJYA 3I5HB 5AEQA 2ZN9A 2F2PA 1ZFSA 2WCBA 2EC6C 1XYDA 2GGZA 2QPTA 3EK7A 2LHLA 3NSKA 5I8NA 4OV2A 2BE4A 1NX0A 2P6BB 3OP0A 3CGAA 3HX4A 3IF7A 1WLMA 1K94A 3BOWB 2KBMA 1CM4A 1MWNA 3PM8A 4PE1A 3VRNA 1YVHA 2BCXA 2LE9B 4P2YB 1M63B 1TCOB 4HSZA 3BUOB 5DKRA 5KTYA 2BL0C 1S6CA 2COLB 4Q04A 3WXAA 3LL8B 1KCYA 3TS5C 1SKTA 4YRUA 5FYXA 3BXKA 2BKHB 1NSHA 1VRKA 2CT9A 3JTDB 3CLNA 1DF0A 2KFHA 3PLFB 3KF9A 1QXPA 2R2IA 1N65A 1BODA 2Q91A 1OE9B 2KGBC 2L98A 3CR4X 2BE6A 1TNPA 2JT8A 4WQ2A 1ALVA 2PVBA 2MJWB 2HF5A 3A8RA 2Y4QA 3I5FC 1K93D 2HETA 2AUCA 2H2KA 2FCEA 2QACA 1KK7Y 4AQJA 1DTLA 2KDHA 1K90D 3SIAA 2L50A 1NYAA 4QJ3B 2OS8C 4MZKA 3EK8A 2NLNA 1LXFC 4MZLA 3CWGA 1RECA 1XVJA 3KO0A 1A4PA 3SG3A 1B47A 2HQWA 3RM1A 2OTGB 4YGCB 1PSRA 4IL1A 3EVVA 1R6PA 1L2OC 4XJKB 2KI4C 2MLFC 1ZOTB 3NSLA 3DF0A 1FI6A 1TRFA 2SCPA 3AKAA 1RTP1 1JWDA 1AUIB 2JWWA 4PHJA 1KFXL 3CZTX 1GJYA 1LKJA 1LVCD 4I5LB 2D8NA 3KPXA 1DGVA 2LANA 3IQOA 4YGDB 2KOTA 1QTXA 3JVTB 4N1FA 1J7OA 3A4UB 1GQMA 1XFVO 3PFVA 2OS8B 4P5OE 1F70A 2M9GA 3TDIA 1AHRA 1OZSA 1S3PA 2Q4UA 2CBLA 3C1VA 2JULA 3EK4A 4F0ZB 2LCPA 2I2RE 1PK0D 1SL7A 4FQOA 1CFFA 3I5IB 3M0WA 4GPLB 4C0KA 2KI4B 1MF8B 1X02A 1F4QA 3QRXA 3TZ1A 1SPYA 5KSZA 2EHBA 2LLUA 2LVJA 2JT0A 4PDZA 4CPVA 1IQ3A 1G4YR 4YGEB 3VRRA 4DUQA 2KAXA 1A75A 4PHMA 1KSOA 4UPGA 3TDZA 1F8HA 2L2EA 2HQ8A 2L5XB 1SCMB 4PE7A 1MXLC 3AKBA 3CR2A 1CM1A 1MUXA 1IWQA 1QX7A 1KK8B 1S5GY 2LVVA 1F71A 1L7ZA 1KFXS 1YVLA 1WY9A 3I5GC 2AMIA 2WOSA 3FWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVB A;  4ZCV A;  4BY4 A;  2K2F A;  2MHH A;  2WCF A;  2K2A A;  1JFK A;  3TUY C;  1EJ3 A;  1ZUZ A;  3EVR A;  1F55 A;  1UUS A;  1H4B A;  1QX5 B;  5HKY A;  2I94 A;  2FOT A;  3VRP A;  1AK8 A;  2JQ6 A;  2BBN A;  4YGB B;  4M2O A;  3BQ3 A;  1MXE A;  1XFZ O;  2KQ6 A;  1A2X A;  4OR9 B;  1AJ5 A;  1MHO A;  1Q80 A;  2LC5 A;  1RWY A;  5HYD A;  1B9A A;  2Y1N A;  4DRW A;  1C7W A;  3CR5 X;  4GBA A;  1HT9 A;  4JWQ A;  1QS7 A;  2Y1M A;  5AER A;  2V53 A;  1GGW A;  2A4J A;  1EG3 A;  2O60 A;  1IRJ A;  4MRY A;  1PRW A;  2H61 A;  1FF1 A;  4YGA A;  1YUU A;  3BOW A;  3DVJ A;  3LLE A;  3PN7 C;  1S1E A;  2JPT A;  1R2U A;  1LIN A;  2AAO A;  2LVK A;  4OKH A;  1A29 A;  1ALW A;  4ORB B;  5DKQ A;  2K7C A;  1EH2 A;  2K7O A;  2LP2 A;  4CFR A;  1KQM B;  1N0Y A;  4NQG A;  2LMU A;  1CDN A;  4ETO A;  3BUM B;  3AAJ A;  1RRO A;  4N5X A;  1HQV A;  1WDC C;  3O6B A;  1CDP A;  2CNP A;  4HRH A;  3ZWH A;  1TTX A;  2JNX A;  2LV7 A;  4M2Q A;  1SR6 C;  4CFQ A;  2EC6 B;  1DJH A;  1ZAC A;  1UHN A;  3NSI A;  2KYC A;  2LUC A;  4ICB A;  4C0L A;  2CTN A;  1SK6 D;  2I18 A;  2KYF A;  1K95 A;  4YI9 A;  2BEC A;  1K9P A;  2LMV A;  1CB1 A;  3D0Y B;  5PAL A;  5HLO A;  1QV1 A;  3GK1 A;  1QV0 A;  1RJV A;  4QJ4 B;  4GGF A;  2M3W A;  1DJW A;  4GUK A;  2EGD A;  1KSM A;  5I2O A;  1TOP A;  2NCP A;  2NZ0 A;  5F6T A;  2G2B A;  5D7F A;  2ZFD A;  4WQ3 A;  1B8L A;  5AXI A;  4AQI A;  2JNF A;  4BY5 A;  3OHM B;  2BL0 B;  1B7T Z;  2M29 A;  1S36 A;  1QIW A;  3TS5 B;  1C7V A;  1NCZ A;  1FW4 A;  1SW8 A;  3CS1 A;  1BLQ A;  4PE4 A;  3CTN A;  4XJK A;  1Y1A A;  1BJF A;  1E8A A;  2ZN8 A;  3MSE B;  4PCW A;  2LHI A;  3PSR A;  1SL8 A;  3VRO A;  4NDC A;  1N2D A;  4PHN A;  1JF0 A;  4NDD A;  4C0J A;  4PHK A;  3I5F B;  4OVN F;  1B8C A;  2L0P A;  1NPQ A;  3BUW B;  2K7B A;  3E3R A;  1B4C A;  1YRT B;  3BUN B;  1CTR A;  4GNK B;  4XYN A;  2HPS A;  3ICB A;  2KQY A;  3DF0 B;  2FJU B;  4MSP A;  3LK0 A;  3SG6 A;  1L2O B;  1MQ1 A;  3BYA A;  1QX2 A;  1FI5 A;  3FS7 A;  1XK4 C;  5JJG A;  1KQV A;  1IJ6 A;  1SCV A;  2KFG A;  3EVU A;  4ORA B;  1BMO A;  1BR1 B;  3ZNI A;  4CLN A;  1IH0 A;  1G8I A;  1QVI Y;  4YI8 A;  1XK4 A;  3DD4 A;  1S6I A;  3D10 A;  1OMR A;  1M45 A;  1UHI A;  3KHE A;  5GQQ C;  3SIB A;  4NDB A;  2E30 A;  5JOL A;  4DCK A;  3EKH A;  1G33 A;  1UHK A;  1KWO C;  1CMG A;  2LAP A;  2MAZ A;  1NIW A;  1XFY O;  3SG2 A;  1RK9 A;  2KGR A;  3TDU A;  4DIR A;  5I2L A;  2M7L A;  1ZMZ A;  1SMG A;  4FTG A;  3GK4 X;  1W7J B;  1B1G A;  1AVS A;  1Y0V H;  4CID A;  2GV5 A;  5CSN A;  5TNC A;  5BPJ A;  4A4C A;  1DJZ A;  2NXQ A;  2K7D A;  1J7Q A;  2Y5I A;  1K9U A;  5ER4 X;  1CLL A;  1S6J A;  2CCM A;  2JTT A;  5I2Q A;  2K61 A;  4MRX A;  2BKI B;  1K2H A;  4E68 A;  1XFW O;  2K8M B;  3I5H C;  1J1D A;  3EKJ A;  1DT7 B;  2ZND A;  2KHN A;  1IKU A;  2ZNE A;  1YUT A;  2BCB A;  1CDL A;  5B8I B;  2F8P A;  3LCP C;  1D1O A;  1BG1 A;  1TNX A;  4USL A;  1NP8 A;  5K89 A;  1YUS A;  1CFP A;  2H61 C;  2JTZ A;  3I5G B;  1WRK A;  1EL4 A;  1EG4 A;  1C07 A;  2WND A;  1LA3 A;  4ORC B;  1SL9 A;  1S26 D;  1NUB A;  3WNX B;  1PSB A;  1AP4 A;  1UHH A;  1J55 A;  3WHT B;  1U5I B;  3FIA A;  1DJG A;  2KAV A;  3OB2 B;  2PAL A;  5HLV A;  1KFU L;  3TUY B;  1CMF A;  4I5J A;  4U8D A;  2JU0 A;  1OSA A;  2JXC A;  3H4S E;  3JTD C;  5DKN A;  4A4B A;  1CDM A;  4WRI A;  1PVA A;  3VRQ A;  1IJ5 A;  3O4Y A;  3DVM A;  1WRL A;  2WCE A;  1PAL A;  3LK1 A;  1EXR A;  4PAL A;  1J7R A;  1B7T Y;  2ZRS A;  2GGM A;  1YRU B;  4GGF C;  2F33 A;  1DJX A;  1WRZ A;  3D0Y A;  4OCI A;  3PN7 B;  4ZCU A;  1CNP A;  1TCF A;  2LNK A;  2O5G A;  2LLT A;  2RGI A;  4MLW A;  3HCM A;  2CXJ A;  1B8R A;  1Y6W A;  2OTG C;  1JF2 A;  1JFJ A;  5HKZ A;  2BBM A;  2M49 B;  2PMY A;  1DF0 B;  3PAT A;  4PE0 A;  2PAS A;  1SRA A;  1WDC B;  2L4H A;  3GOF A;  2JXL A;  2F2O A;  4MZJ A;  1SR6 B;  1Y1X A;  4DS7 A;  3K21 A;  2MRD A;  3BUX B;  4MVF A;  1IG5 A;  5AAN A;  1KFU S;  1BU3 A;  5IBW A;  2LP3 A;  4N1G A;  1TN4 A;  3O2P A;  1YX7 A;  3DVK A;  1NX2 A;  3JVT C;  1CLM A;  2KI6 C;  2JC2 A;  2M0R A;  2VRG A;  5J3X A;  2I7A A;  2M97 A;  5D69 A;  5G08 A;  2JT3 A;  2SAS A;  5KU1 A;  4TNC A;  2KSP A;  2LUX A;  1BOC A;  1J7P A;  1CLB A;  1YX8 A;  2WC8 A;  3I5I C;  3IQQ A;  1AJ4 A;  1OQP A;  2PRU A;  4R1E A;  3F45 A;  2MLE C;  4MEW A;  2JZI A;  1QJT A;  1KK7 Z;  1SYM A;  1TNW A;  2K0J A;  2KFF A;  5CSF A;  1JUO A;  2G9B A;  1OMV A;  1UP5 A;  2E6W A;  1OZO A;  2L51 A;  1XFX O;  5CPV A;  4HRE E;  1CKK A;  3O78 A;  1OMD A;  4D1E A;  2ZRT A;  1NWD A;  2PSR A;  2KI6 D;  1SCM C;  2M1U A;  1DVI A;  2JOJ A;  1A03 A;  2FCD A;  1IGV A;  3SG7 A;  4JPZ B;  1KK8 C;  2L4I A;  4HRG A;  2B1U A;  1PUL A;  1QAS A;  1TIZ A;  2KAY A;  1Y1U A;  1F54 A;  1DJI A;  1JC2 A;  1RFJ A;  1SNL A;  2JRF A;  2OPO A;  4GGN A;  3OX6 A;  2BCA A;  2MA2 A;  3NXA A;  1BF5 A;  1NX3 A;  2NCO A;  4JQ0 D;  2ISD A;  1BT6 A;  1LA0 A;  5CSI A;  5CSJ A;  4QJ5 B;  1YR5 A;  2LLS A;  1QAT A;  1UUR A;  1TNQ A;  1A75 B;  2LM5 A;  1XFU O;  3OX5 A;  1UHJ A;  1XO5 A;  1NX1 A;  1QIV A;  3PAL A;  3SG4 A;  1SY9 A;  1DMO A;  1V1F A;  1NCY A;  1XA5 A;  2IS9 A;  3SG5 A;  2KNE A;  3DVE A;  5ER5 A;  1CFC A;  1QLS A;  3FWC A;  3SJS A;  5AFP A;  1GGZ A;  1BR4 B;  2F3Y A;  1KWO B;  4I5K A;  2F3Z A;  5HKW A;  3WHU B;  4AOM A;  2M8U A;  1IQ5 A;  1K9K A;  2KBI A;  1JBA A;  1NCX A;  1ODB A;  1J1E A;  3AAK A;  1QVI Z;  2M1K B;  4GAO A;  1FPW A;  1V1G A;  1WLZ A;  1M31 A;  1SBJ A;  4GFT A;  2DOQ A;  1YTZ C;  1M46 A;  2TN4 A;  3VGO A;  1UWO A;  2LMT A;  1K96 A;  3NSO A;  1W7I B;  2LVI A;  2M7N A;  4L9M A;  1K8U A;  1S5G Z;  2MBX A;  3KEV A;  4M2P A;  3GK2 A;  1QLK A;  1H8B A;  1M39 A;  1DGU A;  4MBE A;  4I5N B;  1KQM C;  2WOR A;  1U5I A;  1FBV A;  4MN0 A;  1CFD A;  3RLZ A;  4YBH B;  1F4O A;  2ZKM X;  1YUR A;  1MR8 A;  1OOJ A;  3OB1 B;  1JSA A;  1DJY A;  3I5H B;  5AEQ A;  2ZN9 A;  2F2P A;  1ZFS A;  2WCB A;  2EC6 C;  1XYD A;  2GGZ A;  2QPT A;  3EK7 A;  2LHL A;  3NSK A;  5I8N A;  4OV2 A;  2BE4 A;  1NX0 A;  2P6B B;  3OP0 A;  3CGA A;  3HX4 A;  3IF7 A;  1WLM A;  1K94 A;  3BOW B;  2KBM A;  1CM4 A;  1MWN A;  3PM8 A;  4PE1 A;  3VRN A;  1YVH A;  2BCX A;  2LE9 B;  4P2Y B;  1M63 B;  1TCO B;  4HSZ A;  3BUO B;  5DKR A;  5KTY A;  2BL0 C;  1S6C A;  2COL B;  4Q04 A;  3WXA A;  3LL8 B;  1KCY A;  3TS5 C;  1SKT A;  4YRU A;  5FYX A;  3BXK A;  2BKH B;  1NSH A;  1VRK A;  2CT9 A;  3JTD B;  3CLN A;  1DF0 A;  2KFH A;  3PLF B;  3KF9 A;  1QXP A;  2R2I A;  1N65 A;  1BOD A;  2Q91 A;  1OE9 B;  2KGB C;  2L98 A;  3CR4 X;  2BE6 A;  1TNP A;  2JT8 A;  4WQ2 A;  1ALV A;  2PVB A;  2MJW B;  2HF5 A;  3A8R A;  2Y4Q A;  3I5F C;  1K93 D;  2HET A;  2AUC A;  2H2K A;  2FCE A;  2QAC A;  1KK7 Y;  4AQJ A;  1DTL A;  2KDH A;  1K90 D;  3SIA A;  2L50 A;  1NYA A;  4QJ3 B;  2OS8 C;  4MZK A;  3EK8 A;  2NLN A;  1LXF C;  4MZL A;  3CWG A;  1REC A;  1XVJ A;  3KO0 A;  1A4P A;  3SG3 A;  1B47 A;  2HQW A;  3RM1 A;  2OTG B;  4YGC B;  1PSR A;  4IL1 A;  3EVV A;  1R6P A;  1L2O C;  4XJK B;  2KI4 C;  2MLF C;  1ZOT B;  3NSL A;  3DF0 A;  1FI6 A;  1TRF A;  2SCP A;  3AKA A;  1RTP 1;  1JWD A;  1AUI B;  2JWW A;  4PHJ A;  1KFX L;  3CZT X;  1GJY A;  1LKJ A;  1LVC D;  4I5L B;  2D8N A;  3KPX A;  1DGV A;  2LAN A;  3IQO A;  4YGD B;  2KOT A;  1QTX A;  3JVT B;  4N1F A;  1J7O A;  3A4U B;  1GQM A;  1XFV O;  3PFV A;  2OS8 B;  4P5O E;  1F70 A;  2M9G A;  3TDI A;  1AHR A;  1OZS A;  1S3P A;  2Q4U A;  2CBL A;  3C1V A;  2JUL A;  3EK4 A;  4F0Z B;  2LCP A;  2I2R E;  1PK0 D;  1SL7 A;  4FQO A;  1CFF A;  3I5I B;  3M0W A;  4GPL B;  4C0K A;  2KI4 B;  1MF8 B;  1X02 A;  1F4Q A;  3QRX A;  3TZ1 A;  1SPY A;  5KSZ A;  2EHB A;  2LLU A;  2LVJ A;  2JT0 A;  4PDZ A;  4CPV A;  1IQ3 A;  1G4Y R;  4YGE B;  3VRR A;  4DUQ A;  2KAX A;  1A75 A;  4PHM A;  1KSO A;  4UPG A;  3TDZ A;  1F8H A;  2L2E A;  2HQ8 A;  2L5X B;  1SCM B;  4PE7 A;  1MXL C;  3AKB A;  3CR2 A;  1CM1 A;  1MUX A;  1IWQ A;  1QX7 A;  1KK8 B;  1S5G Y;  2LVV A;  1F71 A;  1L7Z A;  1KFX S;  1YVL A;  1WY9 A;  3I5G C;  2AMI A;  2WOS A;  3FWB A; 
#chains in the Genus database with same CATH topology
 1PVB A;  4ZCV A;  3Q8I A;  4BY4 A;  2K2F A;  2MHH A;  2WCF A;  2K2A A;  1JFK A;  3L4A A;  3TUY C;  1EJ3 A;  1ZUZ A;  3EVR A;  1F55 A;  1UUS A;  1H4B A;  1QX5 B;  5HKY A;  2I94 A;  2FOT A;  1OOI X;  2BNX A;  3VRP A;  1AK8 A;  2JQ6 A;  2BBN A;  4YGB B;  4M2O A;  3BQ3 A;  1MXE A;  1XFZ O;  2KQ6 A;  1A2X A;  3CZ1 A;  1AJ5 A;  1MHO A;  4OR9 B;  1Q80 A;  2LC5 A;  1RWY A;  5HYD A;  1B9A A;  2Y1N A;  4FQT A;  4DRW A;  1C7W A;  3CR5 X;  4GBA A;  1HT9 A;  4JWQ A;  3BFB A;  1QS7 A;  2Y1M A;  5AER A;  2V53 A;  3S0D A;  1GGW A;  2A4J A;  1EG3 A;  2O60 A;  1IRJ A;  4MRY A;  1LS8 A;  1PRW A;  2H61 A;  1FF1 A;  4YGA A;  1YUU A;  3BOW A;  3DVJ A;  3LLE A;  3PN7 C;  1S1E A;  1TUJ A;  2JPT A;  1R2U A;  1LIN A;  3CZ0 A;  2AAO A;  2LVK A;  4OKH A;  1A29 A;  1ALW A;  4ORB B;  5DKQ A;  2K7C A;  1TWO A;  1EH2 A;  2K7O A;  2LP2 A;  3FE9 A;  4CFR A;  1KQM B;  1N0Y A;  4NQG A;  2LMU A;  1CDN A;  4ETO A;  1DQE A;  3AAJ A;  3BUM B;  1RRO A;  4N5X A;  1HQV A;  1WDC C;  3O6B A;  3D73 A;  3PJI A;  3CAB A;  1CDP A;  2CNP A;  4HRH A;  3ZWH A;  1TTX A;  2JNX A;  2LV7 A;  4M2Q A;  1SR6 C;  4CFQ A;  2EC6 B;  1DJH A;  2L2C A;  3D74 A;  1ZAC A;  1UHN A;  3L4L A;  3NSI A;  3FE8 A;  1P28 A;  4KYN A;  2KYC A;  1T14 A;  2LUC A;  4ICB A;  4C0L A;  2CTN A;  1SK6 D;  2I18 A;  2KYF A;  1K95 A;  4YI9 A;  2BEC A;  1K9P A;  2LMV A;  1CB1 A;  3D0Y B;  5PAL A;  5HLO A;  1QV1 A;  2WCH A;  3GK1 A;  1QV0 A;  1RJV A;  4QJ4 B;  4GGF A;  2M3W A;  1SSE B;  1DJW A;  4GUK A;  4PT1 A;  2EGD A;  1KSM A;  5I2O A;  1TOP A;  2NCP A;  2NZ0 A;  5F6T A;  2G2B A;  5D7F A;  2ZFD A;  4WQ3 A;  1Z4H A;  1B8L A;  5AXI A;  2WC6 A;  4AQI A;  2WCJ A;  2JNF A;  4BY5 A;  3OHM B;  2BL0 B;  1B7T Z;  2M29 A;  1S36 A;  1QIW A;  3TS5 B;  2QEO A;  3B6X A;  1C7V A;  1NCZ A;  1FW4 A;  1SW8 A;  3CS1 A;  1BLQ A;  4PE4 A;  3CTN A;  4XJK A;  3S0G A;  1OOH A;  1BJF A;  1E8A A;  1Y1A A;  2ZN8 A;  3MSE B;  4PCW A;  2LHI A;  3PSR A;  1SL8 A;  3VRO A;  4NDC A;  1N2D A;  4PHN A;  1JF0 A;  4NDD A;  2ERB A;  4C0J A;  4PHK A;  3RZS A;  3I5F B;  4OVN F;  1B8C A;  2L0P A;  1NPQ A;  3BUW B;  2K7B A;  3E3R A;  1B4C A;  1YRT B;  3V2L A;  3BUN B;  1CTR A;  4OZD A;  4GNK B;  4XYN A;  2HPS A;  3ICB A;  3IVT A;  1TUZ A;  2KQY A;  3DF0 B;  2FJU B;  4MSP A;  3LK0 A;  3S0E A;  3SG6 A;  1L2O B;  1MQ1 A;  3BYA A;  1QX2 A;  1FI5 A;  3FS7 A;  5GQQ C;  3B88 A;  1XK4 C;  5JJG A;  1KQV A;  3O4X A;  1IJ6 A;  1SCV A;  2KFG A;  3EVU A;  4ORA B;  1BMO A;  1BR1 B;  3ZNI A;  4CLN A;  1IH0 A;  1G8I A;  1QVI Y;  4YI8 A;  1XK4 A;  3DD4 A;  1S6I A;  3D10 A;  1OMR A;  1M45 A;  1UHI A;  1Z2C B;  3KHE A;  3SIB A;  3N7H A;  2E30 A;  4NDB A;  5JOL A;  4DCK A;  3EKH A;  1G33 A;  1UHK A;  1KWO C;  1CMG A;  2LAP A;  3PM2 A;  2MAZ A;  1NIW A;  1XFY O;  3SG2 A;  1RK9 A;  2KGR A;  3TDU A;  4DIR A;  5I2L A;  2M7L A;  1ZMZ A;  1SMG A;  4FTG A;  3GK4 X;  1W7J B;  1B1G A;  1AVS A;  1Y0V H;  4CID A;  2GV5 A;  2WCK A;  5CSN A;  5TNC A;  5BPJ A;  4A4C A;  1DJZ A;  2NXQ A;  3SS4 A;  2K7D A;  1J7Q A;  2Y5I A;  1K9U A;  5ER4 X;  1CLL A;  1S6J A;  2CCM A;  2JTT A;  2WCM A;  2K61 A;  5I2Q A;  4MRX A;  2BKI B;  3BJH A;  1K2H A;  4E68 A;  1OW4 A;  1XFW O;  2K8M B;  3I5H C;  1J1D A;  3EKJ A;  1DT7 B;  2ZND A;  2KHN A;  1DEK A;  1IKU A;  2ZNE A;  1YUT A;  1DEL A;  1CDL A;  2BCB A;  5B8I B;  2F8P A;  3LCP C;  1D1O A;  3L47 A;  3NGV A;  1BG1 A;  1TNX A;  4USL A;  1NP8 A;  5K89 A;  1YUS A;  2QDI A;  1CFP A;  2H61 C;  2JTZ A;  3I5G B;  1WRK A;  1EL4 A;  1EG4 A;  1C07 A;  2WND A;  1LA3 A;  4ORC B;  1SL9 A;  3NHI A;  1S26 D;  1NUB A;  3WNX B;  1PSB A;  1AP4 A;  1UHH A;  1J55 A;  1IIO A;  3WHT B;  1U5I B;  3FIA A;  1DJG A;  2KAV A;  3OB2 B;  2PAL A;  5HLV A;  1KFU L;  3TUY B;  1CMF A;  4I5J A;  4U8D A;  2JU0 A;  1OSA A;  2JXC A;  3H4S E;  3JTD C;  5DKN A;  4A4B A;  1CDM A;  4WRI A;  1PVA A;  3VRQ A;  1IJ5 A;  2BAP A;  3DVM A;  3O4Y A;  1WRL A;  2WCE A;  1PAL A;  3LK1 A;  1EXR A;  4INX A;  4PAL A;  1J7R A;  1B7T Y;  2ZRS A;  2P71 A;  2GGM A;  1YRU B;  2H8V A;  4GGF C;  3DYE A;  2WC5 A;  2F33 A;  1DJX A;  5HL1 A;  1WRZ A;  3D0Y A;  4OCI A;  3PN7 B;  4ZCU A;  1CNP A;  1TCF A;  2LNK A;  2O5G A;  2LLT A;  2RGI A;  3S0A A;  4MLW A;  3HCM A;  2CXJ A;  1B8R A;  1Y6W A;  2OTG C;  1JF2 A;  1JFJ A;  5HKZ A;  2BBM A;  2M49 B;  2PMY A;  1DF0 B;  3PAT A;  4PE0 A;  5DIC A;  2PAS A;  1SRA A;  1WDC B;  2L4H A;  3GOF A;  3R1P A;  2JPO A;  2JXL A;  2F2O A;  4MZJ A;  2WCL A;  1SR6 B;  1Y1X A;  3D77 A;  4DS7 A;  4F7F A;  3K21 A;  2MRD A;  3BUX B;  4MVF A;  1IG5 A;  5AAN A;  1KFU S;  1BU3 A;  5IBW A;  5FI2 A;  2LP3 A;  4N1G A;  1TN4 A;  3O2P A;  1YX7 A;  3DVK A;  1NX2 A;  3JVT C;  1CLM A;  2KI6 C;  2JC2 A;  2M0R A;  2VRG A;  2K60 A;  5J3X A;  2I7A A;  2M97 A;  5I94 A;  3CZ2 A;  5D69 A;  5G08 A;  3CDN A;  3S0B A;  2JT3 A;  2SAS A;  5KU1 A;  4TNC A;  2KSP A;  2LUX A;  1BOC A;  1ORG A;  1J7P A;  1CLB A;  1YX8 A;  2WC8 A;  3I5I C;  3IQQ A;  1AJ4 A;  3UO9 A;  2QEV A;  1OQP A;  2PRU A;  1C3Y A;  3FE6 A;  4R1E A;  3F45 A;  2MLE C;  4MEW A;  2JZI A;  3VB1 A;  1QJT A;  1KK7 Z;  1SYM A;  1TNW A;  2K0J A;  2KFF A;  2QEH A;  1JUO A;  5CSF A;  2G9B A;  1OMV A;  1UP5 A;  2KLD A;  2PQL A;  2YGU A;  2E6W A;  1OZO A;  2L51 A;  1XFX O;  5CPV A;  4HRE E;  1CKK A;  3O78 A;  1OMD A;  4D1E A;  2ZRT A;  1NWD A;  2PSR A;  2KI6 D;  1SCM C;  3BFA A;  2M1U A;  1DVI A;  2JOJ A;  5D3O A;  1A03 A;  2FCD A;  1IGV A;  3SG7 A;  4JPZ B;  1KK8 C;  2L4I A;  4HRG A;  2B1U A;  1PUL A;  1QAS A;  1C3Z A;  1TIZ A;  2KAY A;  1Y1U A;  1F54 A;  1DJI A;  1JC2 A;  1RFJ A;  1SNL A;  2JRF A;  2OPO A;  4GGN A;  3OX6 A;  3D75 A;  2BCA A;  2MA2 A;  3NXA A;  1BF5 A;  1NX3 A;  1OOG A;  2NCO A;  4JQ0 D;  2ISD A;  1BT6 A;  1LA0 A;  5CSI A;  5CSJ A;  4QJ5 B;  1YR5 A;  2LLS A;  1QAT A;  1UUR A;  1TNQ A;  1A75 B;  2LM5 A;  1XFU O;  3OX5 A;  1UHJ A;  1XO5 A;  1NX1 A;  1QIV A;  2P70 A;  3PAL A;  1SY9 A;  3SG4 A;  1V1F A;  1DMO A;  1NCY A;  1XA5 A;  2IS9 A;  3SG5 A;  2KNE A;  3DVE A;  5ER5 A;  1CFC A;  1QLS A;  3FWC A;  3SJS A;  5AFP A;  1GGZ A;  1BR4 B;  2F3Y A;  1KWO B;  4I5K A;  2F3Z A;  5HKW A;  3WHU B;  4AOM A;  3BFH A;  2M8U A;  1IQ5 A;  1K9K A;  2KBI A;  1JBA A;  1NCX A;  1ODB A;  1J1E A;  3AAK A;  1QVI Z;  2M1K B;  4GAO A;  1W9Z A;  1FPW A;  1V1G A;  1WLZ A;  4INW A;  1M31 A;  1SBJ A;  4GFT A;  4JKT A;  2DOQ A;  1YTZ C;  1M46 A;  2TN4 A;  3VGO A;  1UWO A;  2LMT A;  1K96 A;  3NSO A;  1W7I B;  2LVI A;  2M7N A;  4L9M A;  1K8U A;  1S5G Z;  2MBX A;  3KEV A;  4M2P A;  3GK2 A;  2FJY A;  1QLK A;  3UNW A;  1M39 A;  1H8B A;  1DGU A;  4MBE A;  1OOF A;  1KQM C;  4I5N B;  2WOR A;  1U5I A;  1FBV A;  4MN0 A;  1CFD A;  3RLZ A;  4YBH B;  1F4O A;  2ZKM X;  1YUR A;  1MR8 A;  1OOJ A;  3OB1 B;  1JSA A;  1DJY A;  3I5H B;  5AEQ A;  2ZN9 A;  3SS5 A;  2F2P A;  1ZFS A;  2WCB A;  2EC6 C;  1XYD A;  4JD9 A;  2GGZ A;  2QPT A;  3EK7 A;  2LHL A;  3NSK A;  5I8N A;  1XFR A;  4OV2 A;  2BE4 A;  1NX0 A;  2P6B B;  3DZT A;  3EG5 B;  3OP0 A;  3CGA A;  3HX4 A;  3IF7 A;  5FI7 A;  1WLM A;  1K94 A;  3BOW B;  2KBM A;  1CM4 A;  1MWN A;  3PM8 A;  4PE1 A;  3VRN A;  1YVH A;  2BCX A;  2LE9 B;  4P2Y B;  3OGN A;  1M63 B;  1TCO B;  2GTE A;  4HSZ A;  3BUO B;  5DKR A;  4IJ7 A;  5KTY A;  2BL0 C;  1S6C A;  2COL B;  2PYQ A;  4Q04 A;  3LL8 B;  3WXA A;  1KCY A;  3TS5 C;  1SKT A;  4YRU A;  5FYX A;  3BXK A;  2BKH B;  1NSH A;  3B87 A;  1VRK A;  2CT9 A;  3CYZ A;  3JTD B;  3K1E A;  3CLN A;  1DF0 A;  2KFH A;  3PLF B;  3KF9 A;  1QXP A;  2R2I A;  1N65 A;  1BOD A;  2Q91 A;  1OE9 B;  2KGB C;  2L98 A;  3CR4 X;  2QEB A;  2BE6 A;  1TNP A;  2JT8 A;  4WQ2 A;  1ALV A;  2PVB A;  3B86 A;  2MJW B;  2HF5 A;  3A8R A;  2Y4Q A;  3I5F C;  1K93 D;  2HET A;  2AUC A;  2H2K A;  2FCE A;  2QAC A;  1KK7 Y;  4AQJ A;  1DTL A;  2KDH A;  1K90 D;  3SIA A;  2L50 A;  1NYA A;  3R72 A;  4QJ3 B;  2OS8 C;  4MZK A;  3EK8 A;  2NLN A;  1LXF C;  4MZL A;  3CWG A;  1REC A;  1XVJ A;  3D76 A;  1A4P A;  3KO0 A;  3R1O A;  3SS3 A;  1B47 A;  2HQW A;  3SG3 A;  3RM1 A;  2OTG B;  3QME A;  4YGC B;  1PSR A;  4IL1 A;  3EVV A;  3DY9 A;  1R6P A;  1L2O C;  4XJK B;  5FI6 A;  2KI4 C;  2MLF C;  1ZOT B;  3NSL A;  3DF0 A;  1FI6 A;  1TRF A;  2SCP A;  3AKA A;  1RTP 1;  1JWD A;  1AUI B;  2JWW A;  4PHJ A;  1KFX L;  3CZT X;  1GJY A;  1LKJ A;  1LVC D;  4I5L B;  2D8N A;  3KPX A;  1DGV A;  3B7A A;  2LAN A;  3IQO A;  4YGD B;  2KOT A;  1QTX A;  3JVT B;  4N1F A;  1J7O A;  3A4U B;  3R1V A;  1GQM A;  1XFV O;  3PFV A;  2OS8 B;  4P5O E;  1F70 A;  2M9G A;  3TDI A;  1AHR A;  1OZS A;  1S3P A;  2Q4U A;  5EL2 A;  2CBL A;  3C1V A;  2JUL A;  1QWV A;  3EK4 A;  4F0Z B;  2LCP A;  3DXL A;  2I2R E;  1PK0 D;  3S0F A;  1SL7 A;  4FQO A;  1CFF A;  3I5I B;  3M0W A;  4GPL B;  4C0K A;  2KI4 B;  2KPH A;  1MF8 B;  1X02 A;  1F4Q A;  3QRX A;  3TZ1 A;  1SPY A;  5KSZ A;  2EHB A;  2LLU A;  2LVJ A;  2JT0 A;  4PDZ A;  4CPV A;  1IQ3 A;  1G4Y R;  4YGE B;  3VRR A;  4DUQ A;  2KAX A;  1A75 A;  4PHM A;  1KSO A;  4UPG A;  3TDZ A;  1GM0 A;  1F8H A;  2L2E A;  1DC1 A;  2HQ8 A;  2L5X B;  1SCM B;  4PE7 A;  1MXL C;  2KLE A;  3AKB A;  3CR2 A;  1CM1 A;  1MUX A;  1IWQ A;  1QX7 A;  1KK8 B;  1S5G Y;  2LVV A;  1F71 A;  3NHT A;  1L7Z A;  1KFX S;  1YVL A;  1WY9 A;  3I5G C;  2L5Y A;  2AMI A;  2WOS A;  3OBV A;  3D78 A;  3FWB A; 
#chains in the Genus database with same CATH homology
 1PVB A;  4ZCV A;  4BY4 A;  2K2F A;  2MHH A;  2WCF A;  2K2A A;  1JFK A;  3TUY C;  1EJ3 A;  1ZUZ A;  3EVR A;  1F55 A;  1UUS A;  1H4B A;  1QX5 B;  5HKY A;  2I94 A;  2FOT A;  3VRP A;  1AK8 A;  2JQ6 A;  2BBN A;  4YGB B;  4M2O A;  3BQ3 A;  1MXE A;  1XFZ O;  2KQ6 A;  1A2X A;  4OR9 B;  1AJ5 A;  1MHO A;  1Q80 A;  2LC5 A;  1RWY A;  5HYD A;  1B9A A;  2Y1N A;  4DRW A;  1C7W A;  3CR5 X;  4GBA A;  1HT9 A;  4JWQ A;  1QS7 A;  2Y1M A;  5AER A;  2V53 A;  1GGW A;  2A4J A;  1EG3 A;  2O60 A;  1IRJ A;  4MRY A;  1PRW A;  2H61 A;  1FF1 A;  4YGA A;  1YUU A;  3BOW A;  3DVJ A;  3LLE A;  3PN7 C;  1S1E A;  2JPT A;  1R2U A;  1LIN A;  2AAO A;  2LVK A;  4OKH A;  1A29 A;  1ALW A;  4ORB B;  5DKQ A;  2K7C A;  1EH2 A;  2K7O A;  2LP2 A;  4CFR A;  1KQM B;  1N0Y A;  4NQG A;  2LMU A;  1CDN A;  4ETO A;  3BUM B;  3AAJ A;  1RRO A;  4N5X A;  1HQV A;  1WDC C;  3O6B A;  1CDP A;  2CNP A;  4HRH A;  3ZWH A;  1TTX A;  2JNX A;  2LV7 A;  4M2Q A;  1SR6 C;  4CFQ A;  2EC6 B;  1DJH A;  1ZAC A;  1UHN A;  3NSI A;  2KYC A;  2LUC A;  4ICB A;  4C0L A;  2CTN A;  1SK6 D;  2I18 A;  2KYF A;  1K95 A;  4YI9 A;  2BEC A;  1K9P A;  2LMV A;  1CB1 A;  3D0Y B;  5PAL A;  5HLO A;  1QV1 A;  3GK1 A;  1QV0 A;  1RJV A;  4QJ4 B;  4GGF A;  2M3W A;  1DJW A;  4GUK A;  2EGD A;  1KSM A;  5I2O A;  1TOP A;  2NCP A;  2NZ0 A;  5F6T A;  2G2B A;  5D7F A;  2ZFD A;  4WQ3 A;  1B8L A;  5AXI A;  4AQI A;  2JNF A;  4BY5 A;  3OHM B;  2BL0 B;  1B7T Z;  2M29 A;  1S36 A;  1QIW A;  3TS5 B;  1C7V A;  1NCZ A;  1FW4 A;  1SW8 A;  3CS1 A;  1BLQ A;  4PE4 A;  3CTN A;  4XJK A;  1Y1A A;  1BJF A;  1E8A A;  2ZN8 A;  3MSE B;  4PCW A;  2LHI A;  3PSR A;  1SL8 A;  3VRO A;  4NDC A;  1N2D A;  4PHN A;  1JF0 A;  4NDD A;  4C0J A;  4PHK A;  3I5F B;  4OVN F;  1B8C A;  2L0P A;  1NPQ A;  3BUW B;  2K7B A;  3E3R A;  1B4C A;  1YRT B;  3BUN B;  1CTR A;  4GNK B;  4XYN A;  2HPS A;  3ICB A;  2KQY A;  3DF0 B;  2FJU B;  4MSP A;  3LK0 A;  3SG6 A;  1L2O B;  1MQ1 A;  3BYA A;  1QX2 A;  1FI5 A;  3FS7 A;  1XK4 C;  5JJG A;  1KQV A;  1IJ6 A;  1SCV A;  2KFG A;  3EVU A;  4ORA B;  1BMO A;  1BR1 B;  3ZNI A;  4CLN A;  1IH0 A;  1G8I A;  1QVI Y;  4YI8 A;  1XK4 A;  3DD4 A;  1S6I A;  3D10 A;  1OMR A;  1M45 A;  1UHI A;  3KHE A;  5GQQ C;  3SIB A;  4NDB A;  2E30 A;  5JOL A;  4DCK A;  3EKH A;  1G33 A;  1UHK A;  1KWO C;  1CMG A;  2LAP A;  2MAZ A;  1NIW A;  1XFY O;  3SG2 A;  1RK9 A;  2KGR A;  3TDU A;  4DIR A;  5I2L A;  2M7L A;  1ZMZ A;  1SMG A;  4FTG A;  3GK4 X;  1W7J B;  1B1G A;  1AVS A;  1Y0V H;  4CID A;  2GV5 A;  5CSN A;  5TNC A;  5BPJ A;  4A4C A;  1DJZ A;  2NXQ A;  2K7D A;  1J7Q A;  2Y5I A;  1K9U A;  5ER4 X;  1CLL A;  1S6J A;  2CCM A;  2JTT A;  5I2Q A;  2K61 A;  4MRX A;  2BKI B;  1K2H A;  4E68 A;  1XFW O;  2K8M B;  3I5H C;  1J1D A;  3EKJ A;  1DT7 B;  2ZND A;  2KHN A;  1IKU A;  2ZNE A;  1YUT A;  2BCB A;  1CDL A;  5B8I B;  2F8P A;  3LCP C;  1D1O A;  1BG1 A;  1TNX A;  4USL A;  1NP8 A;  5K89 A;  1YUS A;  1CFP A;  2H61 C;  2JTZ A;  3I5G B;  1WRK A;  1EL4 A;  1EG4 A;  1C07 A;  2WND A;  1LA3 A;  4ORC B;  1SL9 A;  1S26 D;  1NUB A;  3WNX B;  1PSB A;  1AP4 A;  1UHH A;  1J55 A;  3WHT B;  1U5I B;  3FIA A;  1DJG A;  2KAV A;  3OB2 B;  2PAL A;  5HLV A;  1KFU L;  3TUY B;  1CMF A;  4I5J A;  4U8D A;  2JU0 A;  1OSA A;  2JXC A;  3H4S E;  3JTD C;  5DKN A;  4A4B A;  1CDM A;  4WRI A;  1PVA A;  3VRQ A;  1IJ5 A;  3O4Y A;  3DVM A;  1WRL A;  2WCE A;  1PAL A;  3LK1 A;  1EXR A;  4PAL A;  1J7R A;  1B7T Y;  2ZRS A;  2GGM A;  1YRU B;  4GGF C;  2F33 A;  1DJX A;  1WRZ A;  3D0Y A;  4OCI A;  3PN7 B;  4ZCU A;  1CNP A;  1TCF A;  2LNK A;  2O5G A;  2LLT A;  2RGI A;  4MLW A;  3HCM A;  2CXJ A;  1B8R A;  1Y6W A;  2OTG C;  1JF2 A;  1JFJ A;  5HKZ A;  2BBM A;  2M49 B;  2PMY A;  1DF0 B;  3PAT A;  4PE0 A;  2PAS A;  1SRA A;  1WDC B;  2L4H A;  3GOF A;  2JXL A;  2F2O A;  4MZJ A;  1SR6 B;  1Y1X A;  4DS7 A;  3K21 A;  2MRD A;  3BUX B;  4MVF A;  1IG5 A;  5AAN A;  1KFU S;  1BU3 A;  5IBW A;  2LP3 A;  4N1G A;  1TN4 A;  3O2P A;  1YX7 A;  3DVK A;  1NX2 A;  3JVT C;  1CLM A;  2KI6 C;  2JC2 A;  2M0R A;  2VRG A;  5J3X A;  2I7A A;  2M97 A;  5D69 A;  5G08 A;  2JT3 A;  2SAS A;  5KU1 A;  4TNC A;  2KSP A;  2LUX A;  1BOC A;  1J7P A;  1CLB A;  1YX8 A;  2WC8 A;  3I5I C;  3IQQ A;  1AJ4 A;  1OQP A;  2PRU A;  4R1E A;  3F45 A;  2MLE C;  4MEW A;  2JZI A;  1QJT A;  1KK7 Z;  1SYM A;  1TNW A;  2K0J A;  2KFF A;  5CSF A;  1JUO A;  2G9B A;  1OMV A;  1UP5 A;  2E6W A;  1OZO A;  2L51 A;  1XFX O;  5CPV A;  4HRE E;  1CKK A;  3O78 A;  1OMD A;  4D1E A;  2ZRT A;  1NWD A;  2PSR A;  2KI6 D;  1SCM C;  2M1U A;  1DVI A;  2JOJ A;  1A03 A;  2FCD A;  1IGV A;  3SG7 A;  4JPZ B;  1KK8 C;  2L4I A;  4HRG A;  2B1U A;  1PUL A;  1QAS A;  1TIZ A;  2KAY A;  1Y1U A;  1F54 A;  1DJI A;  1JC2 A;  1RFJ A;  1SNL A;  2JRF A;  2OPO A;  4GGN A;  3OX6 A;  2BCA A;  2MA2 A;  3NXA A;  1BF5 A;  1NX3 A;  2NCO A;  4JQ0 D;  2ISD A;  1BT6 A;  1LA0 A;  5CSI A;  5CSJ A;  4QJ5 B;  1YR5 A;  2LLS A;  1QAT A;  1UUR A;  1TNQ A;  1A75 B;  2LM5 A;  1XFU O;  3OX5 A;  1UHJ A;  1XO5 A;  1NX1 A;  1QIV A;  3PAL A;  3SG4 A;  1SY9 A;  1DMO A;  1V1F A;  1NCY A;  1XA5 A;  2IS9 A;  3SG5 A;  2KNE A;  3DVE A;  5ER5 A;  1CFC A;  1QLS A;  3FWC A;  3SJS A;  5AFP A;  1GGZ A;  1BR4 B;  2F3Y A;  1KWO B;  4I5K A;  2F3Z A;  5HKW A;  3WHU B;  4AOM A;  2M8U A;  1IQ5 A;  1K9K A;  2KBI A;  1JBA A;  1NCX A;  1ODB A;  1J1E A;  3AAK A;  1QVI Z;  2M1K B;  4GAO A;  1FPW A;  1V1G A;  1WLZ A;  1M31 A;  1SBJ A;  4GFT A;  2DOQ A;  1YTZ C;  1M46 A;  2TN4 A;  3VGO A;  1UWO A;  2LMT A;  1K96 A;  3NSO A;  1W7I B;  2LVI A;  2M7N A;  4L9M A;  1K8U A;  1S5G Z;  2MBX A;  3KEV A;  4M2P A;  3GK2 A;  1QLK A;  1H8B A;  1M39 A;  1DGU A;  4MBE A;  4I5N B;  1KQM C;  2WOR A;  1U5I A;  1FBV A;  4MN0 A;  1CFD A;  3RLZ A;  4YBH B;  1F4O A;  2ZKM X;  1YUR A;  1MR8 A;  1OOJ A;  3OB1 B;  1JSA A;  1DJY A;  3I5H B;  5AEQ A;  2ZN9 A;  2F2P A;  1ZFS A;  2WCB A;  2EC6 C;  1XYD A;  2GGZ A;  2QPT A;  3EK7 A;  2LHL A;  3NSK A;  5I8N A;  4OV2 A;  2BE4 A;  1NX0 A;  2P6B B;  3OP0 A;  3CGA A;  3HX4 A;  3IF7 A;  1WLM A;  1K94 A;  3BOW B;  2KBM A;  1CM4 A;  1MWN A;  3PM8 A;  4PE1 A;  3VRN A;  1YVH A;  2BCX A;  2LE9 B;  4P2Y B;  1M63 B;  1TCO B;  4HSZ A;  3BUO B;  5DKR A;  5KTY A;  2BL0 C;  1S6C A;  2COL B;  4Q04 A;  3WXA A;  3LL8 B;  1KCY A;  3TS5 C;  1SKT A;  4YRU A;  5FYX A;  3BXK A;  2BKH B;  1NSH A;  1VRK A;  2CT9 A;  3JTD B;  3CLN A;  1DF0 A;  2KFH A;  3PLF B;  3KF9 A;  1QXP A;  2R2I A;  1N65 A;  1BOD A;  2Q91 A;  1OE9 B;  2KGB C;  2L98 A;  3CR4 X;  2BE6 A;  1TNP A;  2JT8 A;  4WQ2 A;  1ALV A;  2PVB A;  2MJW B;  2HF5 A;  3A8R A;  2Y4Q A;  3I5F C;  1K93 D;  2HET A;  2AUC A;  2H2K A;  2FCE A;  2QAC A;  1KK7 Y;  4AQJ A;  1DTL A;  2KDH A;  1K90 D;  3SIA A;  2L50 A;  1NYA A;  4QJ3 B;  2OS8 C;  4MZK A;  3EK8 A;  2NLN A;  1LXF C;  4MZL A;  3CWG A;  1REC A;  1XVJ A;  3KO0 A;  1A4P A;  3SG3 A;  1B47 A;  2HQW A;  3RM1 A;  2OTG B;  4YGC B;  1PSR A;  4IL1 A;  3EVV A;  1R6P A;  1L2O C;  4XJK B;  2KI4 C;  2MLF C;  1ZOT B;  3NSL A;  3DF0 A;  1FI6 A;  1TRF A;  2SCP A;  3AKA A;  1RTP 1;  1JWD A;  1AUI B;  2JWW A;  4PHJ A;  1KFX L;  3CZT X;  1GJY A;  1LKJ A;  1LVC D;  4I5L B;  2D8N A;  3KPX A;  1DGV A;  2LAN A;  3IQO A;  4YGD B;  2KOT A;  1QTX A;  3JVT B;  4N1F A;  1J7O A;  3A4U B;  1GQM A;  1XFV O;  3PFV A;  2OS8 B;  4P5O E;  1F70 A;  2M9G A;  3TDI A;  1AHR A;  1OZS A;  1S3P A;  2Q4U A;  2CBL A;  3C1V A;  2JUL A;  3EK4 A;  4F0Z B;  2LCP A;  2I2R E;  1PK0 D;  1SL7 A;  4FQO A;  1CFF A;  3I5I B;  3M0W A;  4GPL B;  4C0K A;  2KI4 B;  1MF8 B;  1X02 A;  1F4Q A;  3QRX A;  3TZ1 A;  1SPY A;  5KSZ A;  2EHB A;  2LLU A;  2LVJ A;  2JT0 A;  4PDZ A;  4CPV A;  1IQ3 A;  1G4Y R;  4YGE B;  3VRR A;  4DUQ A;  2KAX A;  1A75 A;  4PHM A;  1KSO A;  4UPG A;  3TDZ A;  1F8H A;  2L2E A;  2HQ8 A;  2L5X B;  1SCM B;  4PE7 A;  1MXL C;  3AKB A;  3CR2 A;  1CM1 A;  1MUX A;  1IWQ A;  1QX7 A;  1KK8 B;  1S5G Y;  2LVV A;  1F71 A;  1L7Z A;  1KFX S;  1YVL A;  1WY9 A;  3I5G C;  2AMI A;  2WOS A;  3FWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...