4PCWA

Crystal structure of the n-terminal domain of human profilaggrin at 2.2 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
STLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMVFKLAQAYYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filaggrin
publication title Crystal Structure of Human Profilaggrin S100 Domain and Identification of Target Proteins Annexin II, Stratifin, and HSP27.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pcwA00
4QJ5B 3DVEA 2Y1MA 1YX7A 2OPOA 1GGZA 2K2FA 1S36A 2FCDA 2FJUB 2JWWA 2KAXA 4DIRA 2JNXA 3CR4X 1OMRA 2BL0B 1Y1XA 1DJWA 1QASA 1DTLA 1OZOA 2H2KA 1MUXA 3PN7C 3DD4A 2K7BA 2LUCA 2LLUA 1DF0B 1MXLC 1N65A 1S26D 3BYAA 4AQJA 2K2AA 2EC6B 1XYDA 4YI9A 1LXFC 1F4OA 3CR5X 1BJFA 2JXCA 3MSEB 4CFRA 2QPTA 2CCMA 3TS5C 2KI6D 5I2OA 3WXAA 2KBIA 2JTTA 1CTRA 4PDZA 4F0ZB 2P6BB 5JOLA 1CKKA 1PSRA 3I5GC 1IQ5A 4PALA 1UP5A 3PLFB 1QJTA 4HRHA 1XFWO 2BE6A 2KQYA 1OMDA 2WCEA 1K9PA 2WCBA 3K21A 4N1FA 4BY5A 1K93D 1FBVA 1NX2A 1YUUA 2PRUA 2OTGC 2WOSA 1SW8A 3GK1A 5G08A 3CWGA 2ZN8A 1MXEA 5FYXA 4C0JA 1YUTA 3OX5A 3A4UB 1SYMA 1Y1UA 1KK8B 3HX4A 1OZSA 2JU0A 1M39A 3NSKA 3EVRA 1CDNA 1SCVA 1EL4A 4YI8A 2ZNDA 1MWNA 2G9BA 1SBJA 3O2PA 3CS1A 2KGRA 1B8LA 1QLKA 3LL8B 1QTXA 1B1GA 1W7JB 1DMOA 2F2PA 4N5XA 3NSIA 4NDCA 1TCFA 1WLMA 1N0YA 1LKJA 1BU3A 1CMFA 1KFUL 1TCOB 1XK4C 1MHOA 2H61A 1YRTB 4BY4A 2F3YA 2KSPA 4GBAA 2KDHA 2M49B 1YUSA 1K94A 4WQ2A 2Y5IA 1SCMC 2BECA 5I2LA 1R2UA 4M2PA 3AAKA 1SY9A 3KF9A 3PN7B 1DGUA 1PSBA 1ZFSA 3LK0A 1E8AA 3WHUB 1OOJA 3PATA 3VRPA 3EK4A 1CMGA 5CPVA 1KWOB 4DCKA 2JC2A 2LMVA 2F8PA 5PALA 1TTXA 2RGIA 3SIBA 3O6BA 3TS5B 3EK8A 3PFVA 1SK6D 2ZKMX 1A2XA 3I5HC 2D8NA 5IBWA 4PE0A 4A4CA 3TUYC 2M29A 2K7OA 1CFPA 1J7PA 2KYCA 1YX8A 3I5GB 5AEQA 1J1EA 1J1DA 2M7NA 2MAZA 3PSRA 4M2OA 1CLLA 4GUKA 1L2OB 5K89A 4QJ4B 1ZACA 1DF0A 1ZUZA 1FI5A 4HREE 4GPLB 4MZKA 1OSAA 2AAOA 1AK8A 4WQ3A 1JFKA 3SG2A 4MZJA 2COLB 2HQWA 3FIAA 1IJ5A 3HCMA 3BUNB 4OVNF 2M3WA 2HPSA 2LVJA 4IL1A 1Y6WA 5DKRA 2FOTA 2LM5A 2WNDA 3D0YB 1F8HA 3AKAA 2I2RE 1C07A 1WRKA 1K95A 2M0RA 5I2QA 1MQ1A 3H4SE 1PVBA 1UHKA 4UPGA 1YR5A 1TRFA 1K9KA 5D69A 1UUSA 4NQGA 1DJZA 3BOWB 2KGBC 3BQ3A 1V1GA 4PHMA 2BE4A 2NZ0A 5BPJA 1NYAA 2M7LA 1AP4A 2LHLA 2BBMA 3VRRA 5J3XA 3GOFA 1SR6C 1QX7A 3F45A 4M2QA 4PHJA 2BBNA 5HKZA 1S5GY 1JFJA 1IKUA 1JBAA 1SL9A 3OX6A 4ICBA 3BUWB 3CGAA 1NX1A 2KAYA 2M1UA 2MJWB 1IG5A 4N1GA 5AERA 1XFVO 1B7TZ 3FWCA 3I5HB 5F6TA 3TUYB 2SASA 1QS7A 1IH0A 2L4HA 2GGMA 4I5KA 1Q80A 1B9AA 1SRAA 4OV2A 2M97A 3DF0B 1ALWA 4HSZA 3AAJA 5KU1A 3TDUA 4CLNA 1DGVA 1FI6A 4PHKA 3DVJA 2BKIB 1XFYO 1K2HA 1DT7B 1UWOA 2KOTA 1GQMA 1UHNA 3LK1A 1ALVA 2LLTA 4I5LB 1GJYA 2O60A 3PM8A 4D1EA 1J55A 3JVTC 4U8DA 1IGVA 3AKBA 1M31A 4AQIA 2NXQA 1BR1B 1NIWA 2KQ6A 1NP8A 1S3PA 1QVIZ 2Y1NA 1WDCB 4XJKB 4E68A 1CM1A 1G8IA 1ODBA 5CSNA 2LNKA 1JF2A 3FS7A 4YRUA 2AUCA 2L5XB 5HLVA 1GGWA 4GGFC 2R2IA 1LA0A 1SNLA 1W7IB 2L98A 2EGDA 2DOQA 1NX3A 3D0YA 1F55A 3D10A 1RWYA 1NSHA 2F33A 1DJXA 5D7FA 3NSLA 4I5JA 2ZFDA 2E30A 1H4BA 1XK4A 1B7TY 2MRDA 3KEVA 1F54A 2KFHA 3LCPC 1JC2A 4CFQA 1KSMA 1F4QA 1XA5A 1B8RA 1N2DA 5CSFA 4AOMA 2LMTA 4ETOA 3BOWA 4DUQA 3KPXA 4ZCUA 1IJ6A 1X02A 2K8MB 3EVUA 2KHNA 1TNWA 2LC5A 2QACA 1QIWA 1BR4B 1RROA 1LVCD 1KQVA 3FWBA 1XFZO 4MRYA 3I5IC 1M46A 2L2EA 1Y1AA 1TOPA 2CXJA 4MEWA 5AFPA 2ZN9A 1WRLA 5HKYA 1RFJA 1WLZA 1K96A 2BCBA 1YRUB 1EXRA 2F2OA 2LCPA 1L7ZA 2Y4QA 1YTZC 2OTGB 3WHTB 1PALA 4YGAA 1S6IA 4YGBB 3SG4A 2BL0C 3DF0A 2KBMA 1FPWA 4PE1A 1F71A 2JQ6A 1JUOA 1AUIB 2LLSA 1KQMC 2BKHB 4JWQA 1OE9B 3NSOA 1UHIA 3VGOA 1QVIY 2MHHA 5GQQC 1F70A 1J7QA 2K0JA 2ZNEA 4MRXA 2JULA 2EC6C 5TNCA 1ZMZA 1V1FA 3DVMA 3I5FC 4R1EA 3ZNIA 1KSOA 2OS8C 2MA2A 2O5GA 3JTDC 3EVVA 1CFCA 2CBLA 3O78A 1DJYA 4JPZB 3SG5A 3NXAA 2MBXA 3RLZA 2KI6C 2BCXA 1WRZA 5I8NA 2WCFA 1HT9A 2HF5A 3SJSA 1NCXA 1QLSA 1YURA 1OMVA 2I94A 1EJ3A 1SCMB 2KI4C 1TIZA 3E3RA 3OP0A 2VRGA 1SL7A 2PASA 1C7WA 1EH2A 2LMUA 1MF8B 1C7VA 2KNEA 1ZOTB 2AMIA 1B47A 2L0PA 3EKJA 4NDBA 2JNFA 1EG3A 4XJKA 1QXPA 2JRFA 1K9UA 1JSAA 1CLBA 1CM4A 1IQ3A 2BCAA 4P2YB 3KHEA 1WY9A 2LVVA 4USLA 4JQ0D 1YVLA 2JZIA 2KFGA 4TNCA 1SL8A 4DS7A 1BLQA 3CTNA 1MR8A 3A8RA 1PK0D 1NUBA 2JOJA 2JXLA 1PVAA 5KTYA 1XFUO 2NCPA 2WORA 1A03A 1LINA 2GV5A 2PSRA 4GNKB 4A4BA 4FQOA 2I18A 5CSJA 1KFXS 5JJGA 4ZCVA 1XFXO 1YVHA 4QJ3B 1KQMB 2LVIA 2K7CA 4ORCB 5HKWA 4C0LA 1RTP1 3SIAA 1FF1A 4MZLA 1QIVA 1QV1A 4C0KA 3IF7A 5ER4X 3BUMB 3I5FB 3ZWHA 1QX5B 1KWOC 2OS8B 2ZRTA 3JTDB 3TZ1A 1S6JA 1NCYA 2LVKA 1TNPA 4PE4A 4YBHB 1BOCA 1NX0A 1SPYA 1TNXA 4MVFA 2JTZA 2M9GA 1NCZA 3BUOB 4MLWA 4HRGA 1BF5A 5B8IB 1B4CA 2LANA 1DVIA 1K8UA 2KI4B 4YGDB 2LE9B 2LP3A 2LAPA 1FW4A 1A29A 1L2OC 2LHIA 4NDDA 1RK9A 3ICBA 1KK7Z 2MLEC 1U5IB 1SMGA 1AVSA 3EK7A 3QRXA 3OB2B 4OKHA 1SR6B 1OQPA 3GK4X 2JT3A 2PMYA 2LP2A 5AANA 1AJ4A 2HETA 4DRWA 5CSIA 2Q91A 2L4IA 1PRWA 1DJIA 1NWDA 1R6PA 2M1KB 1A75B 2Q4UA 4GGFA 2H61C 1G33A 3DVKA 4PHNA 2ISDA 4CPVA 4YGEB 5KSZA 1JWDA 1XVJA 2G2BA 1IRJA 3TDZA 2B1UA 4GGNA 1H8BA 2GGZA 3BXKA 3IQQA 1IWQA 2TN4A 3VROA 2F3ZA 2JT0A 1KFXL 1S6CA 4Q04A 1CDLA 1NPQA 2SCPA 1Y0VH 1TNQA 3TDIA 3OB1B 2NLNA 5HLOA 1A4PA 3GK2A 4L9MA 3RM1A 1CDMA 3EKHA 1DJHA 4ORBB 1J7OA 2A4JA 4MSPA 4PE7A 1VRKA 3O4YA 3VRQA 1HQVA 1PULA 2JPTA 3SG6A 5HYDA 4OCIA 1DJGA 3CR2A 2LV7A 1S5GZ 3JVTB 1CB1A 2JT8A 4GFTA 4YGCB 3PALA 1SKTA 2FCEA 3KO0A 2IS9A 4I5NB 3BUXB 1RECA 1BT6A 1UHHA 1JF0A 2PALA 3IQOA 4XYNA 3VRNA 1XO5A 2KYFA 1UURA 1AHRA 1D1OA 3CLNA 1BG1A 1KK7Y 3CZTX 1J7RA 1CLMA 2EHBA 4MBEA 1M45A 2WC8A 2L51A 2M8UA 1CNPA 2KFFA 2K7DA 4WRIA 2ZRSA 1UHJA 3SG7A 3M0WA 5DKQA 4GAOA 1G4YR 1QV0A 3OHMB 4ORAB 4CIDA 1CFFA 2HQ8A 2L50A 1BMOA 3LLEA 1CFDA 1B8CA 1RJVA 3SG3A 1S1EA 2I7AA 1M63B 4FTGA 4PCWA 1QX2A 2KAVA 5ER5A 3C1VA 1KK8C 1QATA 2MLFC 2CT9A 1AJ5A 3WNXB 2E6WA 2CNPA 1BODA 5AXIA 2CTNA 1KCYA 1U5IA 4OR9B 1K90D 4P5OE 1LA3A 1CDPA 1WDCC 2V53A 2LUXA 3I5IB 1EG4A 5DKNA 2K61A 1KFUS 4MN0A 1A75A 1TN4A 2PVBA 2NCOA
chains in the Genus database with same CATH superfamily
4QJ5B 3DVEA 2Y1MA 1YX7A 2L5YA 1GGZA 2K2FA 2OPOA 1S36A 2FCDA 2FJUB 2JWWA 3FE9A 2KAXA 4DIRA 2JNXA 3S0AA 3CR4X 1OMRA 3FE8A 2L2CA 2BL0B 1Y1XA 1DJWA 1QASA 1DTLA 1OZOA 2H2KA 1MUXA 3PN7C 3DD4A 2K7BA 2LUCA 2LLUA 1DF0B 1MXLC 1N65A 1S26D 3BYAA 4AQJA 2K2AA 2EC6B 1XYDA 4YI9A 1LXFC 1F4OA 1DELA 3CR5X 1BJFA 2JXCA 2QEVA 3MSEB 3NHIA 4CFRA 2QPTA 2CCMA 3TS5C 2KI6D 5I2OA 3WXAA 2KBIA 2JTTA 1CTRA 4PDZA 4F0ZB 3BJHA 2P6BB 5JOLA 2WCLA 1CKKA 1PSRA 3I5GC 1IQ5A 4PALA 1UP5A 3PLFB 1QJTA 4HRHA 1XFWO 4F7FA 2BE6A 2KQYA 1OMDA 2WCEA 1K9PA 2WCBA 3K21A 3L4AA 4N1FA 1K93D 4BY5A 1FBVA 1NX2A 1OOGA 1YUUA 2OTGC 2PRUA 2WOSA 1SW8A 3GK1A 1OOHA 3CWGA 5G08A 2ZN8A 1MXEA 3EG5B 5FYXA 1YUTA 4C0JA 3OX5A 3A4UB 1W9ZA 1Y1UA 1KK8B 1SYMA 1OZSA 2JU0A 3HX4A 5I94A 1M39A 3NSKA 3EVRA 1CDNA 1SCVA 1EL4A 4YI8A 2ZNDA 1MWNA 2G9BA 1SBJA 3O2PA 3CS1A 2KGRA 1B8LA 1QLKA 3LL8B 1QTXA 1B1GA 1W7JB 1DMOA 2F2PA 4N5XA 3NSIA 4NDCA 1TCFA 1WLMA 1N0YA 1LKJA 1BU3A 1CMFA 1KFUL 1TCOB 1XK4C 1MHOA 2H61A 3S0FA 1YRTB 4BY4A 2F3YA 2KSPA 4GBAA 2KDHA 2M49B 1YUSA 1K94A 3BFBA 4WQ2A 2FJYA 2Y5IA 1SCMC 2BECA 5I2LA 2H8VA 1OOIX 1R2UA 4M2PA 3AAKA 1SY9A 3KF9A 3PN7B 1DGUA 1PSBA 1ZFSA 3LK0A 1E8AA 3WHUB 1OOJA 3PATA 3VRPA 3EK4A 1CMGA 3IVTA 5CPVA 1KWOB 2KLDA 3B88A 2JC2A 4DCKA 2LMVA 2F8PA 5PALA 1TTXA 2RGIA 3SIBA 3O6BA 3TS5B 3EK8A 3PFVA 1SK6D 2ZKMX 1A2XA 3I5HC 2D8NA 5IBWA 4PE0A 4A4CA 3TUYC 2M29A 2K7OA 1CFPA 1J7PA 2KYCA 1YX8A 3I5GB 5AEQA 1J1EA 1J1DA 2M7NA 2MAZA 3PSRA 4M2OA 1CLLA 4GUKA 1L2OB 5K89A 4QJ4B 1ZACA 1DF0A 1ZUZA 2GTEA 1FI5A 4HREE 4GPLB 2BNXA 4MZKA 2KPHA 2YGUA 1OSAA 2AAOA 3RZSA 4WQ3A 1AK8A 1JFKA 3SG2A 4MZJA 2COLB 2HQWA 3FIAA 1T14A 1IJ5A 2JPOA 3HCMA 3BUNB 4OVNF 3S0EA 2M3WA 2HPSA 2LVJA 4IL1A 1Y6WA 5DKRA 2FOTA 2LM5A 2WNDA 3D0YB 1F8HA 3AKAA 2I2RE 1C07A 1WRKA 1K95A 2M0RA 4IJ7A 5I2QA 1MQ1A 1LS8A 1ORGA 3DY9A 3K1EA 3H4SE 1PVBA 1UHKA 4UPGA 1YR5A 1TRFA 1K9KA 1XFRA 5D69A 1GM0A 1UUSA 4NQGA 1DJZA 3BOWB 2KGBC 3BQ3A 1V1GA 3B6XA 4PHMA 2BE4A 2NZ0A 3BFAA 5BPJA 1NYAA 2M7LA 1AP4A 2LHLA 2BBMA 3O4XA 3VRRA 5J3XA 3GOFA 3UO9A 1SR6C 1QX7A 3F45A 4M2QA 4KYNA 2BBNA 4PHJA 1S5GY 5HKZA 1JFJA 1IKUA 1JBAA 1SL9A 3OX6A 4ICBA 2WCJA 3BUWB 3CZ2A 3CDNA 3CGAA 1NX1A 2KAYA 2M1UA 3NGVA 2MJWB 1IG5A 4N1GA 5AERA 1XFVO 1B7TZ 3FWCA 3I5HB 5F6TA 3TUYB 2SASA 3S0DA 1QS7A 1IH0A 2L4HA 2GGMA 4I5KA 2ERBA 1Q80A 1B9AA 1SRAA 4OV2A 2M97A 3DF0B 1ALWA 4HSZA 1SSEB 3AAJA 5KU1A 3UNWA 3TDUA 4CLNA 1DGVA 1FI6A 4PHKA 3SS4A 3D73A 3DVJA 2BKIB 1XFYO 1K2HA 2QEHA 1DT7B 1UWOA 2KOTA 1GQMA 1UHNA 3LK1A 1ALVA 2LLTA 4I5LB 1GJYA 2O60A 3PM8A 4D1EA 1J55A 3JVTC 4U8DA 1IGVA 3S0BA 3AKBA 1M31A 4AQIA 3N7HA 2NXQA 1BR1B 1NIWA 2KQ6A 1NP8A 1S3PA 1QVIZ 2Y1NA 1WDCB 4XJKB 4E68A 1CM1A 3D77A 4FQTA 1G8IA 1ODBA 5CSNA 2LNKA 1JF2A 3FS7A 3R72A 4YRUA 2AUCA 3S0GA 2L5XB 5HLVA 1GGWA 4GGFC 2R2IA 3CABA 1LA0A 2P70A 1SNLA 1W7IB 2L98A 2EGDA 2DOQA 1NX3A 3D0YA 1F55A 3D10A 1RWYA 3B86A 1NSHA 2F33A 4OZDA 1DJXA 5D7FA 3NSLA 4I5JA 2ZFDA 2E30A 1H4BA 1XK4A 1B7TY 2MRDA 3KEVA 1F54A 2KFHA 3LCPC 1JC2A 4CFQA 1KSMA 1F4QA 1XA5A 1B8RA 1N2DA 5CSFA 3SS3A 4AOMA 2LMTA 4ETOA 3BOWA 4DUQA 3KPXA 5HL1A 4ZCUA 1IJ6A 1X02A 2K8MB 3EVUA 2KHNA 1TNWA 2LC5A 2QACA 1QIWA 1BR4B 1RROA 1LVCD 1KQVA 3FWBA 1XFZO 4MRYA 3I5IC 1M46A 2L2EA 1Y1AA 1TOPA 2CXJA 4MEWA 5AFPA 2ZN9A 1WRLA 5HKYA 1RFJA 1WLZA 2KLEA 1K96A 2BCBA 1YRUB 1EXRA 2F2OA 3D74A 2LCPA 1L7ZA 3R1OA 2Y4QA 1YTZC 2OTGB 3WHTB 1PALA 4YGAA 1C3YA 1S6IA 4YGBB 3SG4A 3V2LA 1C3ZA 2BL0C 3DF0A 2KBMA 1FPWA 3L4LA 4PE1A 1F71A 2JQ6A 1JUOA 1AUIB 2LLSA 1KQMC 2BKHB 3D78A 1OE9B 3NSOA 1UHIA 4JWQA 3VGOA 1QVIY 2MHHA 5GQQC 1F70A 1J7QA 2K0JA 2ZNEA 4MRXA 2JULA 2EC6C 5TNCA 1ZMZA 1V1FA 3DVMA 3I5FC 4R1EA 3ZNIA 1KSOA 2OS8C 2MA2A 2O5GA 3JTDC 3EVVA 3L47A 2CBLA 1CFCA 3O78A 1DJYA 4JPZB 3SG5A 3NXAA 2MBXA 3RLZA 2KI6C 2BCXA 1WRZA 5I8NA 2WCFA 1HT9A 2HF5A 3SJSA 1NCXA 1QLSA 1YURA 5FI6A 1TUJA 1OMVA 2I94A 1EJ3A 1SCMB 2KI4C 1TIZA 3E3RA 3OP0A 2VRGA 1SL7A 2PASA 1C7WA 1EH2A 2LMUA 1MF8B 1C7VA 2KNEA 1ZOTB 2AMIA 1B47A 2L0PA 3EKJA 4NDBA 2JNFA 1EG3A 4XJKA 1QXPA 2JRFA 4INXA 1K9UA 1JSAA 1CLBA 1CM4A 1IQ3A 2BCAA 4P2YB 3KHEA 2P71A 1WY9A 2LVVA 2QDIA 3CYZA 4JQ0D 4USLA 1YVLA 2JZIA 2KFGA 4TNCA 1SL8A 4DS7A 1BLQA 3CTNA 1MR8A 3A8RA 1PK0D 2PQLA 1NUBA 2JOJA 2JXLA 1PVAA 5KTYA 1XFUO 2NCPA 1QWVA 2WORA 1A03A 1LINA 2GV5A 2PSRA 4GNKB 4A4BA 4FQOA 2I18A 1IIOA 3R1PA 5CSJA 1KFXS 5JJGA 4ZCVA 1XFXO 1YVHA 4QJ3B 1KQMB 2LVIA 2K7CA 4ORCB 5HKWA 4C0LA 1RTP1 3SIAA 1FF1A 4MZLA 1QIVA 1QV1A 4C0KA 3IF7A 5ER4X 2WC6A 3BUMB 3I5FB 3ZWHA 1QX5B 1KWOC 2OS8B 2ZRTA 3DXLA 3JTDB 3TZ1A 1S6JA 4JD9A 1NCYA 2LVKA 1Z4HA 1TNPA 4PE4A 4YBHB 1BOCA 1NX0A 1SPYA 1TNXA 4MVFA 3NHTA 2JTZA 2M9GA 1NCZA 3BUOB 4MLWA 4HRGA 1BF5A 5B8IB 1B4CA 2LANA 1DVIA 1K8UA 2KI4B 4YGDB 2LE9B 2LP3A 2LAPA 1FW4A 1A29A 1L2OC 3OBVA 2LHIA 4NDDA 1RK9A 3ICBA 1KK7Z 2MLEC 1U5IB 1SMGA 1AVSA 3EK7A 3QRXA 3OB2B 4OKHA 1SR6B 1OQPA 3R1VA 3GK4X 2JT3A 2PMYA 2LP2A 5AANA 1AJ4A 2HETA 4DRWA 3CZ1A 5CSIA 2WCKA 2Q91A 2L4IA 1PRWA 1DJIA 1NWDA 1R6PA 2M1KB 1A75B 1OW4A 2Q4UA 3D75A 3DYEA 3Q8IA 4GGFA 2H61C 5EL2A 3QMEA 1G33A 3DVKA 4PHNA 2ISDA 4CPVA 4YGEB 5KSZA 1JWDA 1XVJA 2G2BA 1DC1A 2K60A 1IRJA 3TDZA 2B1UA 4GGNA 1H8BA 2QEOA 1TWOA 2GGZA 2BAPA 3BXKA 3IQQA 1IWQA 2TN4A 3VROA 2F3ZA 5DICA 2JT0A 1KFXL 1S6CA 4Q04A 1CDLA 1NPQA 2SCPA 1Y0VH 1TNQA 3TDIA 3OB1B 2NLNA 5HLOA 3CZ0A 1A4PA 1DQEA 3GK2A 4L9MA 3RM1A 1CDMA 1OOFA 1DJHA 3B87A 3EKHA 4ORBB 1J7OA 2A4JA 4MSPA 4PE7A 1VRKA 3O4YA 3VRQA 1HQVA 1PULA 2JPTA 3SG6A 5HYDA 4OCIA 1DJGA 3CR2A 2LV7A 3OGNA 5D3OA 1S5GZ 3JVTB 1CB1A 2JT8A 4GFTA 4YGCB 5FI7A 3PALA 1SKTA 2FCEA 3KO0A 2IS9A 4I5NB 3BUXB 1RECA 1BT6A 1UHHA 1JF0A 5FI2A 2PALA 3IQOA 4XYNA 3VRNA 1XO5A 2KYFA 1UURA 1P28A 1AHRA 1D1OA 3CLNA 3DZTA 1BG1A 1KK7Y 3CZTX 1J7RA 1CLMA 1Z2CB 3SS5A 2EHBA 4MBEA 3PJIA 1M45A 2PYQA 2WC8A 2L51A 2M8UA 1CNPA 2KFFA 2K7DA 4WRIA 2ZRSA 2WCHA 1UHJA 2WC5A 3SG7A 1TUZA 3VB1A 3BFHA 3M0WA 4PT1A 5DKQA 4GAOA 1G4YR 4INWA 1QV0A 3OHMB 4ORAB 4CIDA 1CFFA 2HQ8A 2L50A 1BMOA 2WCMA 3D76A 3LLEA 1CFDA 1B8CA 1RJVA 2QEBA 4JKTA 1S1EA 2I7AA 1M63B 4FTGA 3SG3A 4PCWA 1QX2A 2KAVA 5ER5A 3B7AA 3C1VA 3PM2A 1KK8C 1QATA 2MLFC 2CT9A 1AJ5A 3WNXB 2E6WA 2CNPA 1BODA 5AXIA 2CTNA 1KCYA 1U5IA 4OR9B 3FE6A 1K90D 4P5OE 1LA3A 2PVBA 1CDPA 1WDCC 2V53A 2LUXA 3I5IB 1EG4A 5DKNA 2K61A 1KFUS 4MN0A 1A75A 1DEKA 1TN4A 2NCOA
chains in the Genus database with same CATH topology
4QJ5B 3DVEA 2Y1MA 1YX7A 2OPOA 1GGZA 2K2FA 1S36A 2FCDA 2FJUB 2JWWA 2KAXA 4DIRA 2JNXA 3CR4X 1OMRA 2BL0B 1Y1XA 1DJWA 1QASA 1DTLA 1OZOA 2H2KA 1MUXA 3PN7C 3DD4A 2K7BA 2LUCA 2LLUA 1DF0B 1MXLC 1N65A 1S26D 3BYAA 4AQJA 2K2AA 2EC6B 1XYDA 4YI9A 1LXFC 1F4OA 3CR5X 1BJFA 2JXCA 3MSEB 4CFRA 2QPTA 2CCMA 3TS5C 2KI6D 5I2OA 3WXAA 2KBIA 2JTTA 1CTRA 4PDZA 4F0ZB 2P6BB 5JOLA 1CKKA 1PSRA 3I5GC 1IQ5A 4PALA 1UP5A 3PLFB 1QJTA 4HRHA 1XFWO 2BE6A 2KQYA 1OMDA 2WCEA 1K9PA 2WCBA 3K21A 4N1FA 4BY5A 1K93D 1FBVA 1NX2A 1YUUA 2PRUA 2OTGC 2WOSA 1SW8A 3GK1A 5G08A 3CWGA 2ZN8A 1MXEA 5FYXA 4C0JA 1YUTA 3OX5A 3A4UB 1SYMA 1Y1UA 1KK8B 3HX4A 1OZSA 2JU0A 1M39A 3NSKA 3EVRA 1CDNA 1SCVA 1EL4A 4YI8A 2ZNDA 1MWNA 2G9BA 1SBJA 3O2PA 3CS1A 2KGRA 1B8LA 1QLKA 3LL8B 1QTXA 1B1GA 1W7JB 1DMOA 2F2PA 4N5XA 3NSIA 4NDCA 1TCFA 1WLMA 1N0YA 1LKJA 1BU3A 1CMFA 1KFUL 1TCOB 1XK4C 1MHOA 2H61A 1YRTB 4BY4A 2F3YA 2KSPA 4GBAA 2KDHA 2M49B 1YUSA 1K94A 4WQ2A 2Y5IA 1SCMC 2BECA 5I2LA 1R2UA 4M2PA 3AAKA 1SY9A 3KF9A 3PN7B 1DGUA 1PSBA 1ZFSA 3LK0A 1E8AA 3WHUB 1OOJA 3PATA 3VRPA 3EK4A 1CMGA 5CPVA 1KWOB 4DCKA 2JC2A 2LMVA 2F8PA 5PALA 1TTXA 2RGIA 3SIBA 3O6BA 3TS5B 3EK8A 3PFVA 1SK6D 2ZKMX 1A2XA 3I5HC 2D8NA 5IBWA 4PE0A 4A4CA 3TUYC 2M29A 2K7OA 1CFPA 1J7PA 2KYCA 1YX8A 3I5GB 5AEQA 1J1EA 1J1DA 2M7NA 2MAZA 3PSRA 4M2OA 1CLLA 4GUKA 1L2OB 5K89A 4QJ4B 1ZACA 1DF0A 1ZUZA 1FI5A 4HREE 4GPLB 4MZKA 1OSAA 2AAOA 1AK8A 4WQ3A 1JFKA 3SG2A 4MZJA 2COLB 2HQWA 3FIAA 1IJ5A 3HCMA 3BUNB 4OVNF 2M3WA 2HPSA 2LVJA 4IL1A 1Y6WA 5DKRA 2FOTA 2LM5A 2WNDA 3D0YB 1F8HA 3AKAA 2I2RE 1C07A 1WRKA 1K95A 2M0RA 5I2QA 1MQ1A 3H4SE 1PVBA 1UHKA 4UPGA 1YR5A 1TRFA 1K9KA 5D69A 1UUSA 4NQGA 1DJZA 3BOWB 2KGBC 3BQ3A 1V1GA 4PHMA 2BE4A 2NZ0A 5BPJA 1NYAA 2M7LA 1AP4A 2LHLA 2BBMA 3VRRA 5J3XA 3GOFA 1SR6C 1QX7A 3F45A 4M2QA 4PHJA 2BBNA 5HKZA 1S5GY 1JFJA 1IKUA 1JBAA 1SL9A 3OX6A 4ICBA 3BUWB 3CGAA 1NX1A 2KAYA 2M1UA 2MJWB 1IG5A 4N1GA 5AERA 1XFVO 1B7TZ 3FWCA 3I5HB 5F6TA 3TUYB 2SASA 1QS7A 1IH0A 2L4HA 2GGMA 4I5KA 1Q80A 1B9AA 1SRAA 4OV2A 2M97A 3DF0B 1ALWA 4HSZA 3AAJA 5KU1A 3TDUA 4CLNA 1DGVA 1FI6A 4PHKA 3DVJA 2BKIB 1XFYO 1K2HA 1DT7B 1UWOA 2KOTA 1GQMA 1UHNA 3LK1A 1ALVA 2LLTA 4I5LB 1GJYA 2O60A 3PM8A 4D1EA 1J55A 3JVTC 4U8DA 1IGVA 3AKBA 1M31A 4AQIA 2NXQA 1BR1B 1NIWA 2KQ6A 1NP8A 1S3PA 1QVIZ 2Y1NA 1WDCB 4XJKB 4E68A 1CM1A 1G8IA 1ODBA 5CSNA 2LNKA 1JF2A 3FS7A 4YRUA 2AUCA 2L5XB 5HLVA 1GGWA 4GGFC 2R2IA 1LA0A 1SNLA 1W7IB 2L98A 2EGDA 2DOQA 1NX3A 3D0YA 1F55A 3D10A 1RWYA 1NSHA 2F33A 1DJXA 5D7FA 3NSLA 4I5JA 2ZFDA 2E30A 1H4BA 1XK4A 1B7TY 2MRDA 3KEVA 1F54A 2KFHA 3LCPC 1JC2A 4CFQA 1KSMA 1F4QA 1XA5A 1B8RA 1N2DA 5CSFA 4AOMA 2LMTA 4ETOA 3BOWA 4DUQA 3KPXA 4ZCUA 1IJ6A 1X02A 2K8MB 3EVUA 2KHNA 1TNWA 2LC5A 2QACA 1QIWA 1BR4B 1RROA 1LVCD 1KQVA 3FWBA 1XFZO 4MRYA 3I5IC 1M46A 2L2EA 1Y1AA 1TOPA 2CXJA 4MEWA 5AFPA 2ZN9A 1WRLA 5HKYA 1RFJA 1WLZA 1K96A 2BCBA 1YRUB 1EXRA 2F2OA 2LCPA 1L7ZA 2Y4QA 1YTZC 2OTGB 3WHTB 1PALA 4YGAA 1S6IA 4YGBB 3SG4A 2BL0C 3DF0A 2KBMA 1FPWA 4PE1A 1F71A 2JQ6A 1JUOA 1AUIB 2LLSA 1KQMC 2BKHB 4JWQA 1OE9B 3NSOA 1UHIA 3VGOA 1QVIY 2MHHA 5GQQC 1F70A 1J7QA 2K0JA 2ZNEA 4MRXA 2JULA 2EC6C 5TNCA 1ZMZA 1V1FA 3DVMA 3I5FC 4R1EA 3ZNIA 1KSOA 2OS8C 2MA2A 2O5GA 3JTDC 3EVVA 1CFCA 2CBLA 3O78A 1DJYA 4JPZB 3SG5A 3NXAA 2MBXA 3RLZA 2KI6C 2BCXA 1WRZA 5I8NA 2WCFA 1HT9A 2HF5A 3SJSA 1NCXA 1QLSA 1YURA 1OMVA 2I94A 1EJ3A 1SCMB 2KI4C 1TIZA 3E3RA 3OP0A 2VRGA 1SL7A 2PASA 1C7WA 1EH2A 2LMUA 1MF8B 1C7VA 2KNEA 1ZOTB 2AMIA 1B47A 2L0PA 3EKJA 4NDBA 2JNFA 1EG3A 4XJKA 1QXPA 2JRFA 1K9UA 1JSAA 1CLBA 1CM4A 1IQ3A 2BCAA 4P2YB 3KHEA 1WY9A 2LVVA 4USLA 4JQ0D 1YVLA 2JZIA 2KFGA 4TNCA 1SL8A 4DS7A 1BLQA 3CTNA 1MR8A 3A8RA 1PK0D 1NUBA 2JOJA 2JXLA 1PVAA 5KTYA 1XFUO 2NCPA 2WORA 1A03A 1LINA 2GV5A 2PSRA 4GNKB 4A4BA 4FQOA 2I18A 5CSJA 1KFXS 5JJGA 4ZCVA 1XFXO 1YVHA 4QJ3B 1KQMB 2LVIA 2K7CA 4ORCB 5HKWA 4C0LA 1RTP1 3SIAA 1FF1A 4MZLA 1QIVA 1QV1A 4C0KA 3IF7A 5ER4X 3BUMB 3I5FB 3ZWHA 1QX5B 1KWOC 2OS8B 2ZRTA 3JTDB 3TZ1A 1S6JA 1NCYA 2LVKA 1TNPA 4PE4A 4YBHB 1BOCA 1NX0A 1SPYA 1TNXA 4MVFA 2JTZA 2M9GA 1NCZA 3BUOB 4MLWA 4HRGA 1BF5A 5B8IB 1B4CA 2LANA 1DVIA 1K8UA 2KI4B 4YGDB 2LE9B 2LP3A 2LAPA 1FW4A 1A29A 1L2OC 2LHIA 4NDDA 1RK9A 3ICBA 1KK7Z 2MLEC 1U5IB 1SMGA 1AVSA 3EK7A 3QRXA 3OB2B 4OKHA 1SR6B 1OQPA 3GK4X 2JT3A 2PMYA 2LP2A 5AANA 1AJ4A 2HETA 4DRWA 5CSIA 2Q91A 2L4IA 1PRWA 1DJIA 1NWDA 1R6PA 2M1KB 1A75B 2Q4UA 4GGFA 2H61C 1G33A 3DVKA 4PHNA 2ISDA 4CPVA 4YGEB 5KSZA 1JWDA 1XVJA 2G2BA 1IRJA 3TDZA 2B1UA 4GGNA 1H8BA 2GGZA 3BXKA 3IQQA 1IWQA 2TN4A 3VROA 2F3ZA 2JT0A 1KFXL 1S6CA 4Q04A 1CDLA 1NPQA 2SCPA 1Y0VH 1TNQA 3TDIA 3OB1B 2NLNA 5HLOA 1A4PA 3GK2A 4L9MA 3RM1A 1CDMA 3EKHA 1DJHA 4ORBB 1J7OA 2A4JA 4MSPA 4PE7A 1VRKA 3O4YA 3VRQA 1HQVA 1PULA 2JPTA 3SG6A 5HYDA 4OCIA 1DJGA 3CR2A 2LV7A 1S5GZ 3JVTB 1CB1A 2JT8A 4GFTA 4YGCB 3PALA 1SKTA 2FCEA 3KO0A 2IS9A 4I5NB 3BUXB 1RECA 1BT6A 1UHHA 1JF0A 2PALA 3IQOA 4XYNA 3VRNA 1XO5A 2KYFA 1UURA 1AHRA 1D1OA 3CLNA 1BG1A 1KK7Y 3CZTX 1J7RA 1CLMA 2EHBA 4MBEA 1M45A 2WC8A 2L51A 2M8UA 1CNPA 2KFFA 2K7DA 4WRIA 2ZRSA 1UHJA 3SG7A 3M0WA 5DKQA 4GAOA 1G4YR 1QV0A 3OHMB 4ORAB 4CIDA 1CFFA 2HQ8A 2L50A 1BMOA 3LLEA 1CFDA 1B8CA 1RJVA 3SG3A 1S1EA 2I7AA 1M63B 4FTGA 4PCWA 1QX2A 2KAVA 5ER5A 3C1VA 1KK8C 1QATA 2MLFC 2CT9A 1AJ5A 3WNXB 2E6WA 2CNPA 1BODA 5AXIA 2CTNA 1KCYA 1U5IA 4OR9B 1K90D 4P5OE 1LA3A 1CDPA 1WDCC 2V53A 2LUXA 3I5IB 1EG4A 5DKNA 2K61A 1KFUS 4MN0A 1A75A 1TN4A 2PVBA 2NCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJ5 B;  3DVE A;  2Y1M A;  1YX7 A;  2OPO A;  1GGZ A;  2K2F A;  1S36 A;  2FCD A;  2FJU B;  2JWW A;  2KAX A;  4DIR A;  2JNX A;  3CR4 X;  1OMR A;  2BL0 B;  1Y1X A;  1DJW A;  1QAS A;  1DTL A;  1OZO A;  2H2K A;  1MUX A;  3PN7 C;  3DD4 A;  2K7B A;  2LUC A;  2LLU A;  1DF0 B;  1MXL C;  1N65 A;  1S26 D;  3BYA A;  4AQJ A;  2K2A A;  2EC6 B;  1XYD A;  4YI9 A;  1LXF C;  1F4O A;  3CR5 X;  1BJF A;  2JXC A;  3MSE B;  4CFR A;  2QPT A;  2CCM A;  3TS5 C;  2KI6 D;  5I2O A;  3WXA A;  2KBI A;  2JTT A;  1CTR A;  4PDZ A;  4F0Z B;  2P6B B;  5JOL A;  1CKK A;  1PSR A;  3I5G C;  1IQ5 A;  4PAL A;  1UP5 A;  3PLF B;  1QJT A;  4HRH A;  1XFW O;  2BE6 A;  2KQY A;  1OMD A;  2WCE A;  1K9P A;  2WCB A;  3K21 A;  4N1F A;  4BY5 A;  1K93 D;  1FBV A;  1NX2 A;  1YUU A;  2PRU A;  2OTG C;  2WOS A;  1SW8 A;  3GK1 A;  5G08 A;  3CWG A;  2ZN8 A;  1MXE A;  5FYX A;  4C0J A;  1YUT A;  3OX5 A;  3A4U B;  1SYM A;  1Y1U A;  1KK8 B;  3HX4 A;  1OZS A;  2JU0 A;  1M39 A;  3NSK A;  3EVR A;  1CDN A;  1SCV A;  1EL4 A;  4YI8 A;  2ZND A;  1MWN A;  2G9B A;  1SBJ A;  3O2P A;  3CS1 A;  2KGR A;  1B8L A;  1QLK A;  3LL8 B;  1QTX A;  1B1G A;  1W7J B;  1DMO A;  2F2P A;  4N5X A;  3NSI A;  4NDC A;  1TCF A;  1WLM A;  1N0Y A;  1LKJ A;  1BU3 A;  1CMF A;  1KFU L;  1TCO B;  1XK4 C;  1MHO A;  2H61 A;  1YRT B;  4BY4 A;  2F3Y A;  2KSP A;  4GBA A;  2KDH A;  2M49 B;  1YUS A;  1K94 A;  4WQ2 A;  2Y5I A;  1SCM C;  2BEC A;  5I2L A;  1R2U A;  4M2P A;  3AAK A;  1SY9 A;  3KF9 A;  3PN7 B;  1DGU A;  1PSB A;  1ZFS A;  3LK0 A;  1E8A A;  3WHU B;  1OOJ A;  3PAT A;  3VRP A;  3EK4 A;  1CMG A;  5CPV A;  1KWO B;  4DCK A;  2JC2 A;  2LMV A;  2F8P A;  5PAL A;  1TTX A;  2RGI A;  3SIB A;  3O6B A;  3TS5 B;  3EK8 A;  3PFV A;  1SK6 D;  2ZKM X;  1A2X A;  3I5H C;  2D8N A;  5IBW A;  4PE0 A;  4A4C A;  3TUY C;  2M29 A;  2K7O A;  1CFP A;  1J7P A;  2KYC A;  1YX8 A;  3I5G B;  5AEQ A;  1J1E A;  1J1D A;  2M7N A;  2MAZ A;  3PSR A;  4M2O A;  1CLL A;  4GUK A;  1L2O B;  5K89 A;  4QJ4 B;  1ZAC A;  1DF0 A;  1ZUZ A;  1FI5 A;  4HRE E;  4GPL B;  4MZK A;  1OSA A;  2AAO A;  1AK8 A;  4WQ3 A;  1JFK A;  3SG2 A;  4MZJ A;  2COL B;  2HQW A;  3FIA A;  1IJ5 A;  3HCM A;  3BUN B;  4OVN F;  2M3W A;  2HPS A;  2LVJ A;  4IL1 A;  1Y6W A;  5DKR A;  2FOT A;  2LM5 A;  2WND A;  3D0Y B;  1F8H A;  3AKA A;  2I2R E;  1C07 A;  1WRK A;  1K95 A;  2M0R A;  5I2Q A;  1MQ1 A;  3H4S E;  1PVB A;  1UHK A;  4UPG A;  1YR5 A;  1TRF A;  1K9K A;  5D69 A;  1UUS A;  4NQG A;  1DJZ A;  3BOW B;  2KGB C;  3BQ3 A;  1V1G A;  4PHM A;  2BE4 A;  2NZ0 A;  5BPJ A;  1NYA A;  2M7L A;  1AP4 A;  2LHL A;  2BBM A;  3VRR A;  5J3X A;  3GOF A;  1SR6 C;  1QX7 A;  3F45 A;  4M2Q A;  4PHJ A;  2BBN A;  5HKZ A;  1S5G Y;  1JFJ A;  1IKU A;  1JBA A;  1SL9 A;  3OX6 A;  4ICB A;  3BUW B;  3CGA A;  1NX1 A;  2KAY A;  2M1U A;  2MJW B;  1IG5 A;  4N1G A;  5AER A;  1XFV O;  1B7T Z;  3FWC A;  3I5H B;  5F6T A;  3TUY B;  2SAS A;  1QS7 A;  1IH0 A;  2L4H A;  2GGM A;  4I5K A;  1Q80 A;  1B9A A;  1SRA A;  4OV2 A;  2M97 A;  3DF0 B;  1ALW A;  4HSZ A;  3AAJ A;  5KU1 A;  3TDU A;  4CLN A;  1DGV A;  1FI6 A;  4PHK A;  3DVJ A;  2BKI B;  1XFY O;  1K2H A;  1DT7 B;  1UWO A;  2KOT A;  1GQM A;  1UHN A;  3LK1 A;  1ALV A;  2LLT A;  4I5L B;  1GJY A;  2O60 A;  3PM8 A;  4D1E A;  1J55 A;  3JVT C;  4U8D A;  1IGV A;  3AKB A;  1M31 A;  4AQI A;  2NXQ A;  1BR1 B;  1NIW A;  2KQ6 A;  1NP8 A;  1S3P A;  1QVI Z;  2Y1N A;  1WDC B;  4XJK B;  4E68 A;  1CM1 A;  1G8I A;  1ODB A;  5CSN A;  2LNK A;  1JF2 A;  3FS7 A;  4YRU A;  2AUC A;  2L5X B;  5HLV A;  1GGW A;  4GGF C;  2R2I A;  1LA0 A;  1SNL A;  1W7I B;  2L98 A;  2EGD A;  2DOQ A;  1NX3 A;  3D0Y A;  1F55 A;  3D10 A;  1RWY A;  1NSH A;  2F33 A;  1DJX A;  5D7F A;  3NSL A;  4I5J A;  2ZFD A;  2E30 A;  1H4B A;  1XK4 A;  1B7T Y;  2MRD A;  3KEV A;  1F54 A;  2KFH A;  3LCP C;  1JC2 A;  4CFQ A;  1KSM A;  1F4Q A;  1XA5 A;  1B8R A;  1N2D A;  5CSF A;  4AOM A;  2LMT A;  4ETO A;  3BOW A;  4DUQ A;  3KPX A;  4ZCU A;  1IJ6 A;  1X02 A;  2K8M B;  3EVU A;  2KHN A;  1TNW A;  2LC5 A;  2QAC A;  1QIW A;  1BR4 B;  1RRO A;  1LVC D;  1KQV A;  3FWB A;  1XFZ O;  4MRY A;  3I5I C;  1M46 A;  2L2E A;  1Y1A A;  1TOP A;  2CXJ A;  4MEW A;  5AFP A;  2ZN9 A;  1WRL A;  5HKY A;  1RFJ A;  1WLZ A;  1K96 A;  2BCB A;  1YRU B;  1EXR A;  2F2O A;  2LCP A;  1L7Z A;  2Y4Q A;  1YTZ C;  2OTG B;  3WHT B;  1PAL A;  4YGA A;  1S6I A;  4YGB B;  3SG4 A;  2BL0 C;  3DF0 A;  2KBM A;  1FPW A;  4PE1 A;  1F71 A;  2JQ6 A;  1JUO A;  1AUI B;  2LLS A;  1KQM C;  2BKH B;  4JWQ A;  1OE9 B;  3NSO A;  1UHI A;  3VGO A;  1QVI Y;  2MHH A;  5GQQ C;  1F70 A;  1J7Q A;  2K0J A;  2ZNE A;  4MRX A;  2JUL A;  2EC6 C;  5TNC A;  1ZMZ A;  1V1F A;  3DVM A;  3I5F C;  4R1E A;  3ZNI A;  1KSO A;  2OS8 C;  2MA2 A;  2O5G A;  3JTD C;  3EVV A;  1CFC A;  2CBL A;  3O78 A;  1DJY A;  4JPZ B;  3SG5 A;  3NXA A;  2MBX A;  3RLZ A;  2KI6 C;  2BCX A;  1WRZ A;  5I8N A;  2WCF A;  1HT9 A;  2HF5 A;  3SJS A;  1NCX A;  1QLS A;  1YUR A;  1OMV A;  2I94 A;  1EJ3 A;  1SCM B;  2KI4 C;  1TIZ A;  3E3R A;  3OP0 A;  2VRG A;  1SL7 A;  2PAS A;  1C7W A;  1EH2 A;  2LMU A;  1MF8 B;  1C7V A;  2KNE A;  1ZOT B;  2AMI A;  1B47 A;  2L0P A;  3EKJ A;  4NDB A;  2JNF A;  1EG3 A;  4XJK A;  1QXP A;  2JRF A;  1K9U A;  1JSA A;  1CLB A;  1CM4 A;  1IQ3 A;  2BCA A;  4P2Y B;  3KHE A;  1WY9 A;  2LVV A;  4USL A;  4JQ0 D;  1YVL A;  2JZI A;  2KFG A;  4TNC A;  1SL8 A;  4DS7 A;  1BLQ A;  3CTN A;  1MR8 A;  3A8R A;  1PK0 D;  1NUB A;  2JOJ A;  2JXL A;  1PVA A;  5KTY A;  1XFU O;  2NCP A;  2WOR A;  1A03 A;  1LIN A;  2GV5 A;  2PSR A;  4GNK B;  4A4B A;  4FQO A;  2I18 A;  5CSJ A;  1KFX S;  5JJG A;  4ZCV A;  1XFX O;  1YVH A;  4QJ3 B;  1KQM B;  2LVI A;  2K7C A;  4ORC B;  5HKW A;  4C0L A;  1RTP 1;  3SIA A;  1FF1 A;  4MZL A;  1QIV A;  1QV1 A;  4C0K A;  3IF7 A;  5ER4 X;  3BUM B;  3I5F B;  3ZWH A;  1QX5 B;  1KWO C;  2OS8 B;  2ZRT A;  3JTD B;  3TZ1 A;  1S6J A;  1NCY A;  2LVK A;  1TNP A;  4PE4 A;  4YBH B;  1BOC A;  1NX0 A;  1SPY A;  1TNX A;  4MVF A;  2JTZ A;  2M9G A;  1NCZ A;  3BUO B;  4MLW A;  4HRG A;  1BF5 A;  5B8I B;  1B4C A;  2LAN A;  1DVI A;  1K8U A;  2KI4 B;  4YGD B;  2LE9 B;  2LP3 A;  2LAP A;  1FW4 A;  1A29 A;  1L2O C;  2LHI A;  4NDD A;  1RK9 A;  3ICB A;  1KK7 Z;  2MLE C;  1U5I B;  1SMG A;  1AVS A;  3EK7 A;  3QRX A;  3OB2 B;  4OKH A;  1SR6 B;  1OQP A;  3GK4 X;  2JT3 A;  2PMY A;  2LP2 A;  5AAN A;  1AJ4 A;  2HET A;  4DRW A;  5CSI A;  2Q91 A;  2L4I A;  1PRW A;  1DJI A;  1NWD A;  1R6P A;  2M1K B;  1A75 B;  2Q4U A;  4GGF A;  2H61 C;  1G33 A;  3DVK A;  4PHN A;  2ISD A;  4CPV A;  4YGE B;  5KSZ A;  1JWD A;  1XVJ A;  2G2B A;  1IRJ A;  3TDZ A;  2B1U A;  4GGN A;  1H8B A;  2GGZ A;  3BXK A;  3IQQ A;  1IWQ A;  2TN4 A;  3VRO A;  2F3Z A;  2JT0 A;  1KFX L;  1S6C A;  4Q04 A;  1CDL A;  1NPQ A;  2SCP A;  1Y0V H;  1TNQ A;  3TDI A;  3OB1 B;  2NLN A;  5HLO A;  1A4P A;  3GK2 A;  4L9M A;  3RM1 A;  1CDM A;  3EKH A;  1DJH A;  4ORB B;  1J7O A;  2A4J A;  4MSP A;  4PE7 A;  1VRK A;  3O4Y A;  3VRQ A;  1HQV A;  1PUL A;  2JPT A;  3SG6 A;  5HYD A;  4OCI A;  1DJG A;  3CR2 A;  2LV7 A;  1S5G Z;  3JVT B;  1CB1 A;  2JT8 A;  4GFT A;  4YGC B;  3PAL A;  1SKT A;  2FCE A;  3KO0 A;  2IS9 A;  4I5N B;  3BUX B;  1REC A;  1BT6 A;  1UHH A;  1JF0 A;  2PAL A;  3IQO A;  4XYN A;  3VRN A;  1XO5 A;  2KYF A;  1UUR A;  1AHR A;  1D1O A;  3CLN A;  1BG1 A;  1KK7 Y;  3CZT X;  1J7R A;  1CLM A;  2EHB A;  4MBE A;  1M45 A;  2WC8 A;  2L51 A;  2M8U A;  1CNP A;  2KFF A;  2K7D A;  4WRI A;  2ZRS A;  1UHJ A;  3SG7 A;  3M0W A;  5DKQ A;  4GAO A;  1G4Y R;  1QV0 A;  3OHM B;  4ORA B;  4CID A;  1CFF A;  2HQ8 A;  2L50 A;  1BMO A;  3LLE A;  1CFD A;  1B8C A;  1RJV A;  3SG3 A;  1S1E A;  2I7A A;  1M63 B;  4FTG A;  4PCW A;  1QX2 A;  2KAV A;  5ER5 A;  3C1V A;  1KK8 C;  1QAT A;  2MLF C;  2CT9 A;  1AJ5 A;  3WNX B;  2E6W A;  2CNP A;  1BOD A;  5AXI A;  2CTN A;  1KCY A;  1U5I A;  4OR9 B;  1K90 D;  4P5O E;  1LA3 A;  1CDP A;  1WDC C;  2V53 A;  2LUX A;  3I5I B;  1EG4 A;  5DKN A;  2K61 A;  1KFU S;  4MN0 A;  1A75 A;  1TN4 A;  2PVB A;  2NCO A; 
#chains in the Genus database with same CATH topology
 4QJ5 B;  3DVE A;  2Y1M A;  1YX7 A;  2L5Y A;  1GGZ A;  2K2F A;  2OPO A;  1S36 A;  2FCD A;  2FJU B;  2JWW A;  3FE9 A;  2KAX A;  4DIR A;  2JNX A;  3S0A A;  3CR4 X;  1OMR A;  3FE8 A;  2L2C A;  2BL0 B;  1Y1X A;  1DJW A;  1QAS A;  1DTL A;  1OZO A;  2H2K A;  1MUX A;  3PN7 C;  3DD4 A;  2K7B A;  2LUC A;  2LLU A;  1DF0 B;  1MXL C;  1N65 A;  1S26 D;  3BYA A;  4AQJ A;  2K2A A;  2EC6 B;  1XYD A;  4YI9 A;  1LXF C;  1F4O A;  1DEL A;  3CR5 X;  1BJF A;  2JXC A;  2QEV A;  3MSE B;  3NHI A;  4CFR A;  2QPT A;  2CCM A;  3TS5 C;  2KI6 D;  5I2O A;  3WXA A;  2KBI A;  2JTT A;  1CTR A;  4PDZ A;  4F0Z B;  3BJH A;  2P6B B;  5JOL A;  2WCL A;  1CKK A;  1PSR A;  3I5G C;  1IQ5 A;  4PAL A;  1UP5 A;  3PLF B;  1QJT A;  4HRH A;  1XFW O;  4F7F A;  2BE6 A;  2KQY A;  1OMD A;  2WCE A;  1K9P A;  2WCB A;  3K21 A;  3L4A A;  4N1F A;  1K93 D;  4BY5 A;  1FBV A;  1NX2 A;  1OOG A;  1YUU A;  2OTG C;  2PRU A;  2WOS A;  1SW8 A;  3GK1 A;  1OOH A;  3CWG A;  5G08 A;  2ZN8 A;  1MXE A;  3EG5 B;  5FYX A;  1YUT A;  4C0J A;  3OX5 A;  3A4U B;  1W9Z A;  1Y1U A;  1KK8 B;  1SYM A;  1OZS A;  2JU0 A;  3HX4 A;  5I94 A;  1M39 A;  3NSK A;  3EVR A;  1CDN A;  1SCV A;  1EL4 A;  4YI8 A;  2ZND A;  1MWN A;  2G9B A;  1SBJ A;  3O2P A;  3CS1 A;  2KGR A;  1B8L A;  1QLK A;  3LL8 B;  1QTX A;  1B1G A;  1W7J B;  1DMO A;  2F2P A;  4N5X A;  3NSI A;  4NDC A;  1TCF A;  1WLM A;  1N0Y A;  1LKJ A;  1BU3 A;  1CMF A;  1KFU L;  1TCO B;  1XK4 C;  1MHO A;  2H61 A;  3S0F A;  1YRT B;  4BY4 A;  2F3Y A;  2KSP A;  4GBA A;  2KDH A;  2M49 B;  1YUS A;  1K94 A;  3BFB A;  4WQ2 A;  2FJY A;  2Y5I A;  1SCM C;  2BEC A;  5I2L A;  2H8V A;  1OOI X;  1R2U A;  4M2P A;  3AAK A;  1SY9 A;  3KF9 A;  3PN7 B;  1DGU A;  1PSB A;  1ZFS A;  3LK0 A;  1E8A A;  3WHU B;  1OOJ A;  3PAT A;  3VRP A;  3EK4 A;  1CMG A;  3IVT A;  5CPV A;  1KWO B;  2KLD A;  3B88 A;  2JC2 A;  4DCK A;  2LMV A;  2F8P A;  5PAL A;  1TTX A;  2RGI A;  3SIB A;  3O6B A;  3TS5 B;  3EK8 A;  3PFV A;  1SK6 D;  2ZKM X;  1A2X A;  3I5H C;  2D8N A;  5IBW A;  4PE0 A;  4A4C A;  3TUY C;  2M29 A;  2K7O A;  1CFP A;  1J7P A;  2KYC A;  1YX8 A;  3I5G B;  5AEQ A;  1J1E A;  1J1D A;  2M7N A;  2MAZ A;  3PSR A;  4M2O A;  1CLL A;  4GUK A;  1L2O B;  5K89 A;  4QJ4 B;  1ZAC A;  1DF0 A;  1ZUZ A;  2GTE A;  1FI5 A;  4HRE E;  4GPL B;  2BNX A;  4MZK A;  2KPH A;  2YGU A;  1OSA A;  2AAO A;  3RZS A;  4WQ3 A;  1AK8 A;  1JFK A;  3SG2 A;  4MZJ A;  2COL B;  2HQW A;  3FIA A;  1T14 A;  1IJ5 A;  2JPO A;  3HCM A;  3BUN B;  4OVN F;  3S0E A;  2M3W A;  2HPS A;  2LVJ A;  4IL1 A;  1Y6W A;  5DKR A;  2FOT A;  2LM5 A;  2WND A;  3D0Y B;  1F8H A;  3AKA A;  2I2R E;  1C07 A;  1WRK A;  1K95 A;  2M0R A;  4IJ7 A;  5I2Q A;  1MQ1 A;  1LS8 A;  1ORG A;  3DY9 A;  3K1E A;  3H4S E;  1PVB A;  1UHK A;  4UPG A;  1YR5 A;  1TRF A;  1K9K A;  1XFR A;  5D69 A;  1GM0 A;  1UUS A;  4NQG A;  1DJZ A;  3BOW B;  2KGB C;  3BQ3 A;  1V1G A;  3B6X A;  4PHM A;  2BE4 A;  2NZ0 A;  3BFA A;  5BPJ A;  1NYA A;  2M7L A;  1AP4 A;  2LHL A;  2BBM A;  3O4X A;  3VRR A;  5J3X A;  3GOF A;  3UO9 A;  1SR6 C;  1QX7 A;  3F45 A;  4M2Q A;  4KYN A;  2BBN A;  4PHJ A;  1S5G Y;  5HKZ A;  1JFJ A;  1IKU A;  1JBA A;  1SL9 A;  3OX6 A;  4ICB A;  2WCJ A;  3BUW B;  3CZ2 A;  3CDN A;  3CGA A;  1NX1 A;  2KAY A;  2M1U A;  3NGV A;  2MJW B;  1IG5 A;  4N1G A;  5AER A;  1XFV O;  1B7T Z;  3FWC A;  3I5H B;  5F6T A;  3TUY B;  2SAS A;  3S0D A;  1QS7 A;  1IH0 A;  2L4H A;  2GGM A;  4I5K A;  2ERB A;  1Q80 A;  1B9A A;  1SRA A;  4OV2 A;  2M97 A;  3DF0 B;  1ALW A;  4HSZ A;  1SSE B;  3AAJ A;  5KU1 A;  3UNW A;  3TDU A;  4CLN A;  1DGV A;  1FI6 A;  4PHK A;  3SS4 A;  3D73 A;  3DVJ A;  2BKI B;  1XFY O;  1K2H A;  2QEH A;  1DT7 B;  1UWO A;  2KOT A;  1GQM A;  1UHN A;  3LK1 A;  1ALV A;  2LLT A;  4I5L B;  1GJY A;  2O60 A;  3PM8 A;  4D1E A;  1J55 A;  3JVT C;  4U8D A;  1IGV A;  3S0B A;  3AKB A;  1M31 A;  4AQI A;  3N7H A;  2NXQ A;  1BR1 B;  1NIW A;  2KQ6 A;  1NP8 A;  1S3P A;  1QVI Z;  2Y1N A;  1WDC B;  4XJK B;  4E68 A;  1CM1 A;  3D77 A;  4FQT A;  1G8I A;  1ODB A;  5CSN A;  2LNK A;  1JF2 A;  3FS7 A;  3R72 A;  4YRU A;  2AUC A;  3S0G A;  2L5X B;  5HLV A;  1GGW A;  4GGF C;  2R2I A;  3CAB A;  1LA0 A;  2P70 A;  1SNL A;  1W7I B;  2L98 A;  2EGD A;  2DOQ A;  1NX3 A;  3D0Y A;  1F55 A;  3D10 A;  1RWY A;  3B86 A;  1NSH A;  2F33 A;  4OZD A;  1DJX A;  5D7F A;  3NSL A;  4I5J A;  2ZFD A;  2E30 A;  1H4B A;  1XK4 A;  1B7T Y;  2MRD A;  3KEV A;  1F54 A;  2KFH A;  3LCP C;  1JC2 A;  4CFQ A;  1KSM A;  1F4Q A;  1XA5 A;  1B8R A;  1N2D A;  5CSF A;  3SS3 A;  4AOM A;  2LMT A;  4ETO A;  3BOW A;  4DUQ A;  3KPX A;  5HL1 A;  4ZCU A;  1IJ6 A;  1X02 A;  2K8M B;  3EVU A;  2KHN A;  1TNW A;  2LC5 A;  2QAC A;  1QIW A;  1BR4 B;  1RRO A;  1LVC D;  1KQV A;  3FWB A;  1XFZ O;  4MRY A;  3I5I C;  1M46 A;  2L2E A;  1Y1A A;  1TOP A;  2CXJ A;  4MEW A;  5AFP A;  2ZN9 A;  1WRL A;  5HKY A;  1RFJ A;  1WLZ A;  2KLE A;  1K96 A;  2BCB A;  1YRU B;  1EXR A;  2F2O A;  3D74 A;  2LCP A;  1L7Z A;  3R1O A;  2Y4Q A;  1YTZ C;  2OTG B;  3WHT B;  1PAL A;  4YGA A;  1C3Y A;  1S6I A;  4YGB B;  3SG4 A;  3V2L A;  1C3Z A;  2BL0 C;  3DF0 A;  2KBM A;  1FPW A;  3L4L A;  4PE1 A;  1F71 A;  2JQ6 A;  1JUO A;  1AUI B;  2LLS A;  1KQM C;  2BKH B;  3D78 A;  1OE9 B;  3NSO A;  1UHI A;  4JWQ A;  3VGO A;  1QVI Y;  2MHH A;  5GQQ C;  1F70 A;  1J7Q A;  2K0J A;  2ZNE A;  4MRX A;  2JUL A;  2EC6 C;  5TNC A;  1ZMZ A;  1V1F A;  3DVM A;  3I5F C;  4R1E A;  3ZNI A;  1KSO A;  2OS8 C;  2MA2 A;  2O5G A;  3JTD C;  3EVV A;  3L47 A;  2CBL A;  1CFC A;  3O78 A;  1DJY A;  4JPZ B;  3SG5 A;  3NXA A;  2MBX A;  3RLZ A;  2KI6 C;  2BCX A;  1WRZ A;  5I8N A;  2WCF A;  1HT9 A;  2HF5 A;  3SJS A;  1NCX A;  1QLS A;  1YUR A;  5FI6 A;  1TUJ A;  1OMV A;  2I94 A;  1EJ3 A;  1SCM B;  2KI4 C;  1TIZ A;  3E3R A;  3OP0 A;  2VRG A;  1SL7 A;  2PAS A;  1C7W A;  1EH2 A;  2LMU A;  1MF8 B;  1C7V A;  2KNE A;  1ZOT B;  2AMI A;  1B47 A;  2L0P A;  3EKJ A;  4NDB A;  2JNF A;  1EG3 A;  4XJK A;  1QXP A;  2JRF A;  4INX A;  1K9U A;  1JSA A;  1CLB A;  1CM4 A;  1IQ3 A;  2BCA A;  4P2Y B;  3KHE A;  2P71 A;  1WY9 A;  2LVV A;  2QDI A;  3CYZ A;  4JQ0 D;  4USL A;  1YVL A;  2JZI A;  2KFG A;  4TNC A;  1SL8 A;  4DS7 A;  1BLQ A;  3CTN A;  1MR8 A;  3A8R A;  1PK0 D;  2PQL A;  1NUB A;  2JOJ A;  2JXL A;  1PVA A;  5KTY A;  1XFU O;  2NCP A;  1QWV A;  2WOR A;  1A03 A;  1LIN A;  2GV5 A;  2PSR A;  4GNK B;  4A4B A;  4FQO A;  2I18 A;  1IIO A;  3R1P A;  5CSJ A;  1KFX S;  5JJG A;  4ZCV A;  1XFX O;  1YVH A;  4QJ3 B;  1KQM B;  2LVI A;  2K7C A;  4ORC B;  5HKW A;  4C0L A;  1RTP 1;  3SIA A;  1FF1 A;  4MZL A;  1QIV A;  1QV1 A;  4C0K A;  3IF7 A;  5ER4 X;  2WC6 A;  3BUM B;  3I5F B;  3ZWH A;  1QX5 B;  1KWO C;  2OS8 B;  2ZRT A;  3DXL A;  3JTD B;  3TZ1 A;  1S6J A;  4JD9 A;  1NCY A;  2LVK A;  1Z4H A;  1TNP A;  4PE4 A;  4YBH B;  1BOC A;  1NX0 A;  1SPY A;  1TNX A;  4MVF A;  3NHT A;  2JTZ A;  2M9G A;  1NCZ A;  3BUO B;  4MLW A;  4HRG A;  1BF5 A;  5B8I B;  1B4C A;  2LAN A;  1DVI A;  1K8U A;  2KI4 B;  4YGD B;  2LE9 B;  2LP3 A;  2LAP A;  1FW4 A;  1A29 A;  1L2O C;  3OBV A;  2LHI A;  4NDD A;  1RK9 A;  3ICB A;  1KK7 Z;  2MLE C;  1U5I B;  1SMG A;  1AVS A;  3EK7 A;  3QRX A;  3OB2 B;  4OKH A;  1SR6 B;  1OQP A;  3R1V A;  3GK4 X;  2JT3 A;  2PMY A;  2LP2 A;  5AAN A;  1AJ4 A;  2HET A;  4DRW A;  3CZ1 A;  5CSI A;  2WCK A;  2Q91 A;  2L4I A;  1PRW A;  1DJI A;  1NWD A;  1R6P A;  2M1K B;  1A75 B;  1OW4 A;  2Q4U A;  3D75 A;  3DYE A;  3Q8I A;  4GGF A;  2H61 C;  5EL2 A;  3QME A;  1G33 A;  3DVK A;  4PHN A;  2ISD A;  4CPV A;  4YGE B;  5KSZ A;  1JWD A;  1XVJ A;  2G2B A;  1DC1 A;  2K60 A;  1IRJ A;  3TDZ A;  2B1U A;  4GGN A;  1H8B A;  2QEO A;  1TWO A;  2GGZ A;  2BAP A;  3BXK A;  3IQQ A;  1IWQ A;  2TN4 A;  3VRO A;  2F3Z A;  5DIC A;  2JT0 A;  1KFX L;  1S6C A;  4Q04 A;  1CDL A;  1NPQ A;  2SCP A;  1Y0V H;  1TNQ A;  3TDI A;  3OB1 B;  2NLN A;  5HLO A;  3CZ0 A;  1A4P A;  1DQE A;  3GK2 A;  4L9M A;  3RM1 A;  1CDM A;  1OOF A;  1DJH A;  3B87 A;  3EKH A;  4ORB B;  1J7O A;  2A4J A;  4MSP A;  4PE7 A;  1VRK A;  3O4Y A;  3VRQ A;  1HQV A;  1PUL A;  2JPT A;  3SG6 A;  5HYD A;  4OCI A;  1DJG A;  3CR2 A;  2LV7 A;  3OGN A;  5D3O A;  1S5G Z;  3JVT B;  1CB1 A;  2JT8 A;  4GFT A;  4YGC B;  5FI7 A;  3PAL A;  1SKT A;  2FCE A;  3KO0 A;  2IS9 A;  4I5N B;  3BUX B;  1REC A;  1BT6 A;  1UHH A;  1JF0 A;  5FI2 A;  2PAL A;  3IQO A;  4XYN A;  3VRN A;  1XO5 A;  2KYF A;  1UUR A;  1P28 A;  1AHR A;  1D1O A;  3CLN A;  3DZT A;  1BG1 A;  1KK7 Y;  3CZT X;  1J7R A;  1CLM A;  1Z2C B;  3SS5 A;  2EHB A;  4MBE A;  3PJI A;  1M45 A;  2PYQ A;  2WC8 A;  2L51 A;  2M8U A;  1CNP A;  2KFF A;  2K7D A;  4WRI A;  2ZRS A;  2WCH A;  1UHJ A;  2WC5 A;  3SG7 A;  1TUZ A;  3VB1 A;  3BFH A;  3M0W A;  4PT1 A;  5DKQ A;  4GAO A;  1G4Y R;  4INW A;  1QV0 A;  3OHM B;  4ORA B;  4CID A;  1CFF A;  2HQ8 A;  2L50 A;  1BMO A;  2WCM A;  3D76 A;  3LLE A;  1CFD A;  1B8C A;  1RJV A;  2QEB A;  4JKT A;  1S1E A;  2I7A A;  1M63 B;  4FTG A;  3SG3 A;  4PCW A;  1QX2 A;  2KAV A;  5ER5 A;  3B7A A;  3C1V A;  3PM2 A;  1KK8 C;  1QAT A;  2MLF C;  2CT9 A;  1AJ5 A;  3WNX B;  2E6W A;  2CNP A;  1BOD A;  5AXI A;  2CTN A;  1KCY A;  1U5I A;  4OR9 B;  3FE6 A;  1K90 D;  4P5O E;  1LA3 A;  2PVB A;  1CDP A;  1WDC C;  2V53 A;  2LUX A;  3I5I B;  1EG4 A;  5DKN A;  2K61 A;  1KFU S;  4MN0 A;  1A75 A;  1DEK A;  1TN4 A;  2NCO A; 
#chains in the Genus database with same CATH homology
 4QJ5 B;  3DVE A;  2Y1M A;  1YX7 A;  2OPO A;  1GGZ A;  2K2F A;  1S36 A;  2FCD A;  2FJU B;  2JWW A;  2KAX A;  4DIR A;  2JNX A;  3CR4 X;  1OMR A;  2BL0 B;  1Y1X A;  1DJW A;  1QAS A;  1DTL A;  1OZO A;  2H2K A;  1MUX A;  3PN7 C;  3DD4 A;  2K7B A;  2LUC A;  2LLU A;  1DF0 B;  1MXL C;  1N65 A;  1S26 D;  3BYA A;  4AQJ A;  2K2A A;  2EC6 B;  1XYD A;  4YI9 A;  1LXF C;  1F4O A;  3CR5 X;  1BJF A;  2JXC A;  3MSE B;  4CFR A;  2QPT A;  2CCM A;  3TS5 C;  2KI6 D;  5I2O A;  3WXA A;  2KBI A;  2JTT A;  1CTR A;  4PDZ A;  4F0Z B;  2P6B B;  5JOL A;  1CKK A;  1PSR A;  3I5G C;  1IQ5 A;  4PAL A;  1UP5 A;  3PLF B;  1QJT A;  4HRH A;  1XFW O;  2BE6 A;  2KQY A;  1OMD A;  2WCE A;  1K9P A;  2WCB A;  3K21 A;  4N1F A;  4BY5 A;  1K93 D;  1FBV A;  1NX2 A;  1YUU A;  2PRU A;  2OTG C;  2WOS A;  1SW8 A;  3GK1 A;  5G08 A;  3CWG A;  2ZN8 A;  1MXE A;  5FYX A;  4C0J A;  1YUT A;  3OX5 A;  3A4U B;  1SYM A;  1Y1U A;  1KK8 B;  3HX4 A;  1OZS A;  2JU0 A;  1M39 A;  3NSK A;  3EVR A;  1CDN A;  1SCV A;  1EL4 A;  4YI8 A;  2ZND A;  1MWN A;  2G9B A;  1SBJ A;  3O2P A;  3CS1 A;  2KGR A;  1B8L A;  1QLK A;  3LL8 B;  1QTX A;  1B1G A;  1W7J B;  1DMO A;  2F2P A;  4N5X A;  3NSI A;  4NDC A;  1TCF A;  1WLM A;  1N0Y A;  1LKJ A;  1BU3 A;  1CMF A;  1KFU L;  1TCO B;  1XK4 C;  1MHO A;  2H61 A;  1YRT B;  4BY4 A;  2F3Y A;  2KSP A;  4GBA A;  2KDH A;  2M49 B;  1YUS A;  1K94 A;  4WQ2 A;  2Y5I A;  1SCM C;  2BEC A;  5I2L A;  1R2U A;  4M2P A;  3AAK A;  1SY9 A;  3KF9 A;  3PN7 B;  1DGU A;  1PSB A;  1ZFS A;  3LK0 A;  1E8A A;  3WHU B;  1OOJ A;  3PAT A;  3VRP A;  3EK4 A;  1CMG A;  5CPV A;  1KWO B;  4DCK A;  2JC2 A;  2LMV A;  2F8P A;  5PAL A;  1TTX A;  2RGI A;  3SIB A;  3O6B A;  3TS5 B;  3EK8 A;  3PFV A;  1SK6 D;  2ZKM X;  1A2X A;  3I5H C;  2D8N A;  5IBW A;  4PE0 A;  4A4C A;  3TUY C;  2M29 A;  2K7O A;  1CFP A;  1J7P A;  2KYC A;  1YX8 A;  3I5G B;  5AEQ A;  1J1E A;  1J1D A;  2M7N A;  2MAZ A;  3PSR A;  4M2O A;  1CLL A;  4GUK A;  1L2O B;  5K89 A;  4QJ4 B;  1ZAC A;  1DF0 A;  1ZUZ A;  1FI5 A;  4HRE E;  4GPL B;  4MZK A;  1OSA A;  2AAO A;  1AK8 A;  4WQ3 A;  1JFK A;  3SG2 A;  4MZJ A;  2COL B;  2HQW A;  3FIA A;  1IJ5 A;  3HCM A;  3BUN B;  4OVN F;  2M3W A;  2HPS A;  2LVJ A;  4IL1 A;  1Y6W A;  5DKR A;  2FOT A;  2LM5 A;  2WND A;  3D0Y B;  1F8H A;  3AKA A;  2I2R E;  1C07 A;  1WRK A;  1K95 A;  2M0R A;  5I2Q A;  1MQ1 A;  3H4S E;  1PVB A;  1UHK A;  4UPG A;  1YR5 A;  1TRF A;  1K9K A;  5D69 A;  1UUS A;  4NQG A;  1DJZ A;  3BOW B;  2KGB C;  3BQ3 A;  1V1G A;  4PHM A;  2BE4 A;  2NZ0 A;  5BPJ A;  1NYA A;  2M7L A;  1AP4 A;  2LHL A;  2BBM A;  3VRR A;  5J3X A;  3GOF A;  1SR6 C;  1QX7 A;  3F45 A;  4M2Q A;  4PHJ A;  2BBN A;  5HKZ A;  1S5G Y;  1JFJ A;  1IKU A;  1JBA A;  1SL9 A;  3OX6 A;  4ICB A;  3BUW B;  3CGA A;  1NX1 A;  2KAY A;  2M1U A;  2MJW B;  1IG5 A;  4N1G A;  5AER A;  1XFV O;  1B7T Z;  3FWC A;  3I5H B;  5F6T A;  3TUY B;  2SAS A;  1QS7 A;  1IH0 A;  2L4H A;  2GGM A;  4I5K A;  1Q80 A;  1B9A A;  1SRA A;  4OV2 A;  2M97 A;  3DF0 B;  1ALW A;  4HSZ A;  3AAJ A;  5KU1 A;  3TDU A;  4CLN A;  1DGV A;  1FI6 A;  4PHK A;  3DVJ A;  2BKI B;  1XFY O;  1K2H A;  1DT7 B;  1UWO A;  2KOT A;  1GQM A;  1UHN A;  3LK1 A;  1ALV A;  2LLT A;  4I5L B;  1GJY A;  2O60 A;  3PM8 A;  4D1E A;  1J55 A;  3JVT C;  4U8D A;  1IGV A;  3AKB A;  1M31 A;  4AQI A;  2NXQ A;  1BR1 B;  1NIW A;  2KQ6 A;  1NP8 A;  1S3P A;  1QVI Z;  2Y1N A;  1WDC B;  4XJK B;  4E68 A;  1CM1 A;  1G8I A;  1ODB A;  5CSN A;  2LNK A;  1JF2 A;  3FS7 A;  4YRU A;  2AUC A;  2L5X B;  5HLV A;  1GGW A;  4GGF C;  2R2I A;  1LA0 A;  1SNL A;  1W7I B;  2L98 A;  2EGD A;  2DOQ A;  1NX3 A;  3D0Y A;  1F55 A;  3D10 A;  1RWY A;  1NSH A;  2F33 A;  1DJX A;  5D7F A;  3NSL A;  4I5J A;  2ZFD A;  2E30 A;  1H4B A;  1XK4 A;  1B7T Y;  2MRD A;  3KEV A;  1F54 A;  2KFH A;  3LCP C;  1JC2 A;  4CFQ A;  1KSM A;  1F4Q A;  1XA5 A;  1B8R A;  1N2D A;  5CSF A;  4AOM A;  2LMT A;  4ETO A;  3BOW A;  4DUQ A;  3KPX A;  4ZCU A;  1IJ6 A;  1X02 A;  2K8M B;  3EVU A;  2KHN A;  1TNW A;  2LC5 A;  2QAC A;  1QIW A;  1BR4 B;  1RRO A;  1LVC D;  1KQV A;  3FWB A;  1XFZ O;  4MRY A;  3I5I C;  1M46 A;  2L2E A;  1Y1A A;  1TOP A;  2CXJ A;  4MEW A;  5AFP A;  2ZN9 A;  1WRL A;  5HKY A;  1RFJ A;  1WLZ A;  1K96 A;  2BCB A;  1YRU B;  1EXR A;  2F2O A;  2LCP A;  1L7Z A;  2Y4Q A;  1YTZ C;  2OTG B;  3WHT B;  1PAL A;  4YGA A;  1S6I A;  4YGB B;  3SG4 A;  2BL0 C;  3DF0 A;  2KBM A;  1FPW A;  4PE1 A;  1F71 A;  2JQ6 A;  1JUO A;  1AUI B;  2LLS A;  1KQM C;  2BKH B;  4JWQ A;  1OE9 B;  3NSO A;  1UHI A;  3VGO A;  1QVI Y;  2MHH A;  5GQQ C;  1F70 A;  1J7Q A;  2K0J A;  2ZNE A;  4MRX A;  2JUL A;  2EC6 C;  5TNC A;  1ZMZ A;  1V1F A;  3DVM A;  3I5F C;  4R1E A;  3ZNI A;  1KSO A;  2OS8 C;  2MA2 A;  2O5G A;  3JTD C;  3EVV A;  1CFC A;  2CBL A;  3O78 A;  1DJY A;  4JPZ B;  3SG5 A;  3NXA A;  2MBX A;  3RLZ A;  2KI6 C;  2BCX A;  1WRZ A;  5I8N A;  2WCF A;  1HT9 A;  2HF5 A;  3SJS A;  1NCX A;  1QLS A;  1YUR A;  1OMV A;  2I94 A;  1EJ3 A;  1SCM B;  2KI4 C;  1TIZ A;  3E3R A;  3OP0 A;  2VRG A;  1SL7 A;  2PAS A;  1C7W A;  1EH2 A;  2LMU A;  1MF8 B;  1C7V A;  2KNE A;  1ZOT B;  2AMI A;  1B47 A;  2L0P A;  3EKJ A;  4NDB A;  2JNF A;  1EG3 A;  4XJK A;  1QXP A;  2JRF A;  1K9U A;  1JSA A;  1CLB A;  1CM4 A;  1IQ3 A;  2BCA A;  4P2Y B;  3KHE A;  1WY9 A;  2LVV A;  4USL A;  4JQ0 D;  1YVL A;  2JZI A;  2KFG A;  4TNC A;  1SL8 A;  4DS7 A;  1BLQ A;  3CTN A;  1MR8 A;  3A8R A;  1PK0 D;  1NUB A;  2JOJ A;  2JXL A;  1PVA A;  5KTY A;  1XFU O;  2NCP A;  2WOR A;  1A03 A;  1LIN A;  2GV5 A;  2PSR A;  4GNK B;  4A4B A;  4FQO A;  2I18 A;  5CSJ A;  1KFX S;  5JJG A;  4ZCV A;  1XFX O;  1YVH A;  4QJ3 B;  1KQM B;  2LVI A;  2K7C A;  4ORC B;  5HKW A;  4C0L A;  1RTP 1;  3SIA A;  1FF1 A;  4MZL A;  1QIV A;  1QV1 A;  4C0K A;  3IF7 A;  5ER4 X;  3BUM B;  3I5F B;  3ZWH A;  1QX5 B;  1KWO C;  2OS8 B;  2ZRT A;  3JTD B;  3TZ1 A;  1S6J A;  1NCY A;  2LVK A;  1TNP A;  4PE4 A;  4YBH B;  1BOC A;  1NX0 A;  1SPY A;  1TNX A;  4MVF A;  2JTZ A;  2M9G A;  1NCZ A;  3BUO B;  4MLW A;  4HRG A;  1BF5 A;  5B8I B;  1B4C A;  2LAN A;  1DVI A;  1K8U A;  2KI4 B;  4YGD B;  2LE9 B;  2LP3 A;  2LAP A;  1FW4 A;  1A29 A;  1L2O C;  2LHI A;  4NDD A;  1RK9 A;  3ICB A;  1KK7 Z;  2MLE C;  1U5I B;  1SMG A;  1AVS A;  3EK7 A;  3QRX A;  3OB2 B;  4OKH A;  1SR6 B;  1OQP A;  3GK4 X;  2JT3 A;  2PMY A;  2LP2 A;  5AAN A;  1AJ4 A;  2HET A;  4DRW A;  5CSI A;  2Q91 A;  2L4I A;  1PRW A;  1DJI A;  1NWD A;  1R6P A;  2M1K B;  1A75 B;  2Q4U A;  4GGF A;  2H61 C;  1G33 A;  3DVK A;  4PHN A;  2ISD A;  4CPV A;  4YGE B;  5KSZ A;  1JWD A;  1XVJ A;  2G2B A;  1IRJ A;  3TDZ A;  2B1U A;  4GGN A;  1H8B A;  2GGZ A;  3BXK A;  3IQQ A;  1IWQ A;  2TN4 A;  3VRO A;  2F3Z A;  2JT0 A;  1KFX L;  1S6C A;  4Q04 A;  1CDL A;  1NPQ A;  2SCP A;  1Y0V H;  1TNQ A;  3TDI A;  3OB1 B;  2NLN A;  5HLO A;  1A4P A;  3GK2 A;  4L9M A;  3RM1 A;  1CDM A;  3EKH A;  1DJH A;  4ORB B;  1J7O A;  2A4J A;  4MSP A;  4PE7 A;  1VRK A;  3O4Y A;  3VRQ A;  1HQV A;  1PUL A;  2JPT A;  3SG6 A;  5HYD A;  4OCI A;  1DJG A;  3CR2 A;  2LV7 A;  1S5G Z;  3JVT B;  1CB1 A;  2JT8 A;  4GFT A;  4YGC B;  3PAL A;  1SKT A;  2FCE A;  3KO0 A;  2IS9 A;  4I5N B;  3BUX B;  1REC A;  1BT6 A;  1UHH A;  1JF0 A;  2PAL A;  3IQO A;  4XYN A;  3VRN A;  1XO5 A;  2KYF A;  1UUR A;  1AHR A;  1D1O A;  3CLN A;  1BG1 A;  1KK7 Y;  3CZT X;  1J7R A;  1CLM A;  2EHB A;  4MBE A;  1M45 A;  2WC8 A;  2L51 A;  2M8U A;  1CNP A;  2KFF A;  2K7D A;  4WRI A;  2ZRS A;  1UHJ A;  3SG7 A;  3M0W A;  5DKQ A;  4GAO A;  1G4Y R;  1QV0 A;  3OHM B;  4ORA B;  4CID A;  1CFF A;  2HQ8 A;  2L50 A;  1BMO A;  3LLE A;  1CFD A;  1B8C A;  1RJV A;  3SG3 A;  1S1E A;  2I7A A;  1M63 B;  4FTG A;  4PCW A;  1QX2 A;  2KAV A;  5ER5 A;  3C1V A;  1KK8 C;  1QAT A;  2MLF C;  2CT9 A;  1AJ5 A;  3WNX B;  2E6W A;  2CNP A;  1BOD A;  5AXI A;  2CTN A;  1KCY A;  1U5I A;  4OR9 B;  1K90 D;  4P5O E;  1LA3 A;  1CDP A;  1WDC C;  2V53 A;  2LUX A;  3I5I B;  1EG4 A;  5DKN A;  2K61 A;  1KFU S;  4MN0 A;  1A75 A;  1TN4 A;  2PVB A;  2NCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...