4PCWA

Crystal structure of the n-terminal domain of human profilaggrin at 2.2 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
STLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMVFKLAQAYYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Filaggrin
publication title Crystal Structure of Human Profilaggrin S100 Domain and Identification of Target Proteins Annexin II, Stratifin, and HSP27.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pcwA00
2BKIB 1M31A 1PSBA 4YGAA 2WCEA 1N0YA 2K7BA 1J1EA 2BCAA 2OS8C 2PVBA 1BOCA 2SCPA 5AANA 2IS9A 5AERA 1DF0A 4JWQA 1F4OA 1K2HA 1PULA 3QRXA 1XO5A 1LA0A 3FS7A 1DTLA 1CLMA 2QACA 3K21A 1WDCB 3TS5B 1YX7A 1QIWA 2GGMA 4MLWA 1DGUA 1YRUB 1YVLA 4PCWA 2LMUA 2M1UA 2MBXA 5I2LA 2CNPA 2MAZA 1NIWA 4YBHB 2LE9B 4MRYA 1E8AA 1L2OB 1MHOA 2I18A 2M29A 4MVFA 4DCKA 1A03A 1IWQA 2LHLA 3TDUA 2CXJA 2L51A 2Y4QA 3I5FC 4CFQA 1YR5A 2MJWB 5K89A 2V53A 1XA5A 3NSKA 2HQWA 2RGIA 1QS7A 1S26D 1LA3A 1CFCA 5DKRA 1V1FA 1QTXA 4CLNA 1KK7Z 3CR2A 3FWBA 1UURA 3WNXB 1WLMA 5PALA 1AJ5A 1KK8B 1TRFA 1UHIA 2LVJA 3EVUA 5HYDA 1G8IA 1M63B 1BODA 3DD4A 1SW8A 4L9MA 2G9BA 1BMOA 1UWOA 2MRDA 4PDZA 4GNKB 2KAVA 1DJGA 5F6TA 1C7WA 1XYDA 4AQIA 5I2QA 1XFYO 1YVHA 3SG3A 4P2YB 1CFPA 1KFXL 2NXQA 4AQJA 1NCXA 2LCPA 1C07A 1UUSA 1NYAA 2WCBA 3AAJA 1KSMA 3SG7A 4YI9A 1JBAA 1H8BA 2KYFA 1B8RA 4YGCB 4GPLB 3RLZA 1PRWA 1CFFA 3WHTB 2L0PA 4YGBB 1W7JB 1XK4C 2KNEA 1G4YR 1SL9A 2R2IA 2TN4A 5CSFA 1OOJA 1PALA 1PVBA 2G2BA 3BOWA 1SCMC 3TDZA 4MN0A 1KFUL 1KK8C 1CM4A 3KHEA 4HRHA 4OKHA 4A4CA 4NDBA 1MF8B 4YGDB 3A4UB 1LINA 1KQMC 3D10A 2ZNDA 3PLFB 2PSRA 1DT7B 1S36A 1Y1XA 1OMRA 2BCBA 1CDNA 1FF1A 2JNXA 1UHKA 2KI6D 1L7ZA 1AP4A 3EKHA 1DJZA 3NSLA 1S6JA 4HRGA 2KBIA 3I5GC 4YI8A 3OB1B 1DGVA 2LUXA 1AHRA 5IBWA 1A29A 1TIZA 3I5IB 3TZ1A 1B8CA 3EKJA 1CDPA 1Y1UA 2KFGA 1TNQA 1WY9A 3SIBA 5I8NA 1XK4A 1TOPA 4WRIA 3VRNA 1J7OA 2JT8A 1N2DA 2ZKMX 3OB2B 5KU1A 2L2EA 1QATA 3WHUB 2BL0B 4QJ4B 2JRFA 4DRWA 3LLEA 3SJSA 3BUOB 4PALA 5CPVA 1JC2A 4WQ3A 1RK9A 4GUKA 4PHKA 1A75B 5GQQC 2JOJA 1BT6A 4N1FA 3NXAA 1WLZA 2FCDA 3BUXB 2K8MB 1S5GZ 3F45A 1YURA 1GQMA 1F8HA 2KFHA 2KGBC 2LUCA 3EK4A 1PVAA 1WRLA 1BR1B 1K8UA 1QJTA 1RECA 2LAPA 2SASA 1EG3A 1QX2A 5ER5A 4QJ5B 1FW4A 1CLBA 1TN4A 3PN7B 2CTNA 1NP8A 3IQOA 3OX5A 2LLTA 2PRUA 3LL8B 1B4CA 2H2KA 3JTDC 2E6WA 1NSHA 2P6BB 1TTXA 2BL0C 3KF9A 3PALA 4DS7A 4YRUA 1AVSA 1KFXS 1U5IA 2JTZA 4JPZB 1CKKA 1SYMA 3D0YB 2L50A 3DF0B 3OX6A 2M9GA 4N5XA 4PHMA 1M46A 1RWYA 4GGFC 3ZNIA 3RM1A 1QASA 4A4BA 2K7OA 5G08A 1F4QA 3JVTB 1V1GA 1IJ5A 1NUBA 2E30A 2LMVA 2LVKA 1AJ4A 3GOFA 2M3WA 4XJKA 2BBNA 2M7NA 4CPVA 2BBMA 1DJWA 1KFUS 2BCXA 2ZN9A 2Y5IA 4BY4A 4ZCUA 4D1EA 5D69A 2KAYA 1R2UA 1BR4B 1S3PA 1FI5A 3MSEB 4P5OE 5D7FA 2COLB 1EL4A 2L98A 1PK0D 1C7VA 4C0LA 4MZKA 4NQGA 1OE9B 2WC8A 1J7PA 1YTZC 2WORA 1SMGA 1WDCC 4C0KA 3TS5C 2LVIA 1G33A 2KOTA 2K61A 1CFDA 4DIRA 1EJ3A 1BJFA 2JXCA 2BE6A 2BKHB 2CCMA 1IRJA 2LV7A 1F55A 1L2OC 2PMYA 1YUSA 1B7TZ 3CGAA 4UPGA 3CWGA 3I5HB 1RJVA 5BPJA 4USLA 1IJ6A 1MR8A 1RROA 2DOQA 2MLFC 5DKQA 3KEVA 1S6CA 5FYXA 1SK6D 4GGNA 4C0JA 3OP0A 1QX5B 1JF0A 1SR6B 2FCEA 2L4HA 2I7AA 3PM8A 1K95A 2FOTA 4MSPA 2LMTA 1F71A 1SL8A 2Y1MA 2M49B 1LXFC 3SG5A 1YUUA 1EXRA 2JWWA 1OMDA 4WQ2A 2EC6B 4MZLA 3ICBA 1HT9A 1TNWA 3TUYB 4AOMA 1J55A 2ZRSA 4M2OA 1R6PA 1NWDA 3CTNA 4MRXA 2JZIA 4M2PA 1SY9A 1QIVA 3OHMB 3CR5X 1JF2A 4CIDA 1N65A 5KTYA 1S6IA 1Y0VH 2LVVA 1FI6A 2OTGB 3H4SE 2AMIA 1DF0B 1F54A 1CDLA 2ZNEA 1ALWA 1SNLA 3VROA 1IKUA 4ETOA 1UHNA 1SR6C 3PSRA 1QVIZ 3O6BA 1DVIA 1J7QA 1B8LA 2H61C 1K94A 2O5GA 1NPQA 2M1KB 3NSIA 1CTRA 2JQ6A 1DMOA 2B1UA 2ISDA 4PE7A 2EC6C 1QV0A 1LKJA 1RTP1 2CBLA 1ZMZA 3FWCA 3BQ3A 4HREE 1FBVA 4ORAB 4ORCB 4N1GA 3M0WA 1CNPA 3KO0A 1SKTA 3VGOA 3VRRA 2Q4UA 1MWNA 4MZJA 2JTTA 2M7LA 2BECA 5AXIA 4E68A 1HQVA 1MXEA 1WRZA 3HCMA 2K2AA 2L4IA 2OTGC 1TCFA 4NDDA 3I5IC 1K93D 4I5NB 4PE0A 3CS1A 2HETA 1K90D 2LC5A 2HPSA 3EVVA 5JOLA 1QXPA 1BF5A 4IL1A 1DJXA 1IH0A 1J1DA 2KI4B 2H61A 1YUTA 2F8PA 1TNPA 2KDHA 1SPYA 1K9KA 1JFKA 4PE4A 2LLUA 2L5XB 1TNXA 2JT0A 1UHJA 2O60A 5B8IB 2AUCA 1GJYA 4MEWA 1IG5A 1K9UA 1SBJA 1JFJA 1ZOTB 2Y1NA 5J3XA 2FJUB 1H4BA 2PALA 3LCPC 5AFPA 2KQYA 2ZFDA 2KSPA 4QJ3B 5DKNA 1AUIB 5CSJA 1DJIA 5HLVA 4OVNF 3DVJA 1KK7Y 1OMVA 3BOWB 2PASA 2MLEC 1A4PA 2JC2A 3AKBA 1B47A 4ORBB 3PN7C 2BE4A 2HF5A 5I2OA 2K7DA 1S1EA 2F3YA 1M45A 2I2RE 1NCYA 2LP2A 2QPTA 3EVRA 1DJYA 2KI4C 2Q91A 1OQPA 3GK4X 5HKZA 1CMGA 1EH2A 1A2XA 3EK8A 4OR9B 3SG6A 2JT3A 1SRAA 2F2OA 3SG2A 2F2PA 4OV2A 1Q80A 1NX1A 3AAKA 3LK1A 1WRKA 4GAOA 3VRQA 2LHIA 1QLSA 1B7TY 1A75A 2M0RA 2GV5A 4GGFA 1BG1A 2KYCA 3O78A 4ZCVA 1BU3A 1Y6WA 3IQQA 1GGWA 2JNFA 3JVTC 1MUXA 2JPTA 4PE1A 3CR4X 1MQ1A 2EHBA 2I94A 1W7IB 4I5JA 3ZWHA 1XFZO 2K7CA 4NDCA 1QV1A 1YRTB 4JQ0D 3SIAA 1ALVA 2NZ0A 1BLQA 1SCMB 2AAOA 5HKWA 1XFUO 1CMFA 1FPWA 1CDMA 4GBAA 1KQMB 3TDIA 2JULA 1D1OA 1KWOB 1CLLA 1IGVA 2D8NA 1OSAA 2M8UA 4TNCA 3NSOA 4OCIA 2F3ZA 2EGDA 2LNKA 1ZACA 5JJGA 1B1GA 5ER4X 4I5LB 3D0YA 3DF0A 2OPOA 2CT9A 2GGZA 3I5GB 4HSZA 1KQVA 4I5KA 3AKAA 2KBMA 3PFVA 1ODBA 4FQOA 5AEQA 3SG4A 3CZTX 1KCYA 5CSNA 3DVMA 2MA2A 1NCZA 4U8DA 1IQ3A 1J7RA 1JUOA 2K0JA 4FTGA 1JSAA 1K9PA 3CLNA 1GGZA 3EK7A 1X02A 2KHNA 4YGEB 3I5HC 5HKYA 1IQ5A 1QVIY 2WNDA 2K2FA 2A4JA 3KPXA 1CM1A 1PSRA 1ZFSA 3PATA 3DVKA 1XFWO 2JXLA 2HQ8A 1U5IB 1YX8A 2NLNA 1NX3A 1M39A 2MHHA 3O2PA 1NX2A 1KWOC 1LVCD 1NX0A 1XFXO 4BY5A 1XFVO 1XVJA 3VRPA 2LANA 3HX4A 3BYAA 4PHNA 4GFTA 3A8RA 1S5GY 2KGRA 4XJKB 3E3RA 2JU0A 2KI6C 2NCPA 1ZUZA 1UP5A 2WOSA 3TUYC 1OZSA 1DJHA 2OS8B 5HLOA 1VRKA 2KQ6A 1Y1AA 3GK1A 3JTDB 1SCVA 5KSZA 3BUNB 1JWDA 4ICBA 2F33A 3BUWB 4DUQA 2LLSA 2ZN8A 1KSOA 4Q04A 1SL7A 2LP3A 4PHJA 2VRGA 1K96A 4CFRA 1TCOB 1UHHA 1B9AA 3C1VA 1AK8A 4M2QA 1OZOA 3DVEA 2KFFA 5CSIA 2WCFA 1QLKA 1CB1A 1EG4A 2LM5A 2NCOA 2M97A 3BXKA 5TNCA 4F0ZB 3IF7A 3GK2A 4XYNA 3I5FB 3LK0A 2KAXA 2ZRTA 3FIAA 1F70A 3BUMB 1QX7A 3O4YA 1MXLC 1RFJA 4MBEA 3WXAA 4R1EA
chains in the Genus database with same CATH superfamily
2BKIB 1M31A 1PSBA 4YGAA 2WCEA 2WC6A 1N0YA 2K7BA 1J1EA 2BCAA 2OS8C 2PVBA 1BOCA 2SCPA 5AANA 2IS9A 5AERA 1DF0A 4JWQA 1F4OA 5EL2A 1K2HA 1PULA 3QRXA 1XO5A 1LA0A 3FS7A 1DTLA 4INWA 1CLMA 2QACA 3K21A 3B86A 1WDCB 3TS5B 1YX7A 1QIWA 2GGMA 4OZDA 2H8VA 4MLWA 1DGUA 1YRUB 1YVLA 4INXA 4PCWA 2LMUA 2M1UA 2MBXA 3DY9A 5I2LA 3K1EA 3VB1A 3O4XA 2CNPA 2MAZA 1NIWA 4YBHB 2LE9B 4MRYA 1E8AA 1L2OB 1MHOA 2I18A 2M29A 4MVFA 4DCKA 1A03A 1IWQA 2LHLA 2QDIA 3TDUA 2CXJA 2L51A 2Y4QA 3I5FC 4CFQA 1YR5A 2MJWB 5K89A 2V53A 1XA5A 3NSKA 3R1PA 2KLDA 2HQWA 2RGIA 1QS7A 1S26D 3DZTA 1LA3A 1CFCA 2L5YA 2QEOA 5DKRA 1V1FA 1QTXA 3PM2A 4CLNA 3SS4A 1KK7Z 3CR2A 3FWBA 1UURA 3WNXB 1WLMA 5PALA 1AJ5A 1KK8B 1TRFA 1UHIA 2LVJA 3EVUA 3RZSA 5HYDA 1G8IA 1M63B 1BODA 3DD4A 1SW8A 1DC1A 4L9MA 2G9BA 1BMOA 1UWOA 2MRDA 3SS5A 4PDZA 4GNKB 2KAVA 1DJGA 5F6TA 1C7WA 1XYDA 4AQIA 5I2QA 1XFYO 1YVHA 3R1OA 4P2YB 3SG3A 1CFPA 3B88A 1KFXL 2NXQA 4AQJA 1NCXA 1C3ZA 2LCPA 1C07A 1UUSA 3CZ2A 1NYAA 2WCBA 3AAJA 5FI7A 1KSMA 3SG7A 4YI9A 1JBAA 1H8BA 2KYFA 1B8RA 4YGCB 4GPLB 3RLZA 3S0FA 1PRWA 1CFFA 3WHTB 2L0PA 4YGBB 1W7JB 1XK4C 1OW4A 2KNEA 1G4YR 1SL9A 2R2IA 2TN4A 2WCMA 5CSFA 1OOJA 1PALA 1PVBA 2G2BA 3BOWA 2YGUA 1SCMC 3TDZA 4MN0A 1KFUL 1KK8C 1CM4A 1TUJA 1Z2CB 3KHEA 4HRHA 4OKHA 4A4CA 4NDBA 1MF8B 4YGDB 3A4UB 1LINA 1KQMC 3D10A 2ZNDA 3PLFB 2PSRA 1DT7B 3R72A 1S36A 1Y1XA 1OMRA 2BCBA 1CDNA 1FF1A 2JNXA 1UHKA 2KI6D 1L7ZA 1AP4A 3EKHA 1DJZA 3NSLA 1S6JA 3PJIA 2KBIA 4HRGA 3I5GC 4YI8A 3OB1B 1DGVA 2LUXA 1AHRA 5IBWA 1A29A 1TIZA 3I5IB 3TZ1A 1B8CA 3BFBA 3EKJA 1CDPA 1Y1UA 2KFGA 1TNQA 1WY9A 3SIBA 5I8NA 1XK4A 1TOPA 4WRIA 3VRNA 1J7OA 2JT8A 1N2DA 2ZKMX 3OB2B 5KU1A 2L2EA 1QATA 3WHUB 2BL0B 4QJ4B 2JRFA 4DRWA 3LLEA 3SJSA 3BUOB 3UO9A 4PALA 5CPVA 1JC2A 4WQ3A 1RK9A 3V2LA 4GUKA 2PYQA 4PHKA 1A75B 5GQQC 2JOJA 3S0AA 1BT6A 4N1FA 5HL1A 3NXAA 1WLZA 2FCDA 3BUXB 2K8MB 1S5GZ 3F45A 1YURA 1DQEA 1GQMA 1F8HA 2KFHA 2KGBC 2LUCA 3EK4A 1PVAA 1WRLA 1BR1B 1K8UA 1QJTA 1RECA 2LAPA 2SASA 1EG3A 1QX2A 5ER5A 4QJ5B 1FW4A 4JD9A 3Q8IA 1CLBA 1TN4A 1OOHA 3L4AA 3PN7B 2CTNA 1NP8A 3D74A 3IQOA 2LLTA 2PRUA 3L47A 3LL8B 3OX5A 1B4CA 2H2KA 3JTDC 1TUZA 3DXLA 2KLEA 2E6WA 1NSHA 2P6BB 1TTXA 2BL0C 3KF9A 3PALA 4JKTA 3S0GA 4DS7A 4YRUA 1AVSA 1KFXS 1U5IA 2JTZA 4JPZB 2WCJA 1CKKA 1SYMA 3D0YB 2L50A 2QEBA 3DF0B 3OX6A 2M9GA 3S0DA 4N5XA 4PHMA 1M46A 1RWYA 4GGFC 4PT1A 3ZNIA 3RM1A 1QASA 4F7FA 4A4BA 2K7OA 5G08A 1F4QA 1ORGA 3JVTB 3OGNA 1V1GA 1IJ5A 1NUBA 2E30A 2LMVA 2LVKA 1AJ4A 3GOFA 2M3WA 3CZ0A 4XJKA 2BBNA 2M7NA 2BNXA 3FE6A 4CPVA 2BBMA 1DJWA 1KFUS 1LS8A 2BCXA 2Y5IA 2ZN9A 4BY4A 4ZCUA 4D1EA 5D69A 2KAYA 1R2UA 2L2CA 1BR4B 1S3PA 2P70A 1FI5A 3MSEB 4P5OE 5D7FA 2COLB 1EL4A 2L98A 1PK0D 3FE8A 1C7VA 4C0LA 4MZKA 4FQTA 4NQGA 1OE9B 2WC8A 1DEKA 1J7PA 1YTZC 2WORA 1SMGA 2K60A 1WDCC 4C0KA 3TS5C 1DELA 2LVIA 1G33A 2KOTA 1GM0A 2K61A 1CFDA 4DIRA 1EJ3A 1BJFA 2JXCA 2BE6A 2BKHB 2CCMA 1IRJA 2LV7A 1F55A 1L2OC 2PMYA 3CYZA 1YUSA 3BFHA 1B7TZ 3NGVA 3CGAA 4UPGA 3D75A 3CWGA 3I5HB 4IJ7A 1RJVA 3L4LA 5BPJA 4USLA 1IJ6A 1MR8A 1RROA 2DOQA 2MLFC 5I94A 5DKQA 3KEVA 1S6CA 5FYXA 1SK6D 4GGNA 4C0JA 3OP0A 1QX5B 3NHTA 1JF0A 1SR6B 2FCEA 2L4HA 2I7AA 3PM8A 1K95A 2FOTA 4MSPA 2LMTA 1F71A 2QEVA 1SL8A 2WC5A 2Y1MA 2M49B 1LXFC 3SG5A 1YUUA 1EXRA 2JWWA 1OMDA 1OOFA 1QWVA 4WQ2A 2EC6B 3SS3A 4MZLA 3ICBA 1HT9A 1P28A 1TNWA 3TUYB 4AOMA 1J55A 2ZRSA 4M2OA 1R6PA 2JPOA 1NWDA 3CTNA 3BFAA 2JZIA 3D73A 4M2PA 1SY9A 1QIVA 4MRXA 3OHMB 3CR5X 1JF2A 4CIDA 1N65A 5KTYA 1S6IA 1Y0VH 2LVVA 1FI6A 2OTGB 3H4SE 2AMIA 1DF0B 1F54A 1CDLA 2ZNEA 1ALWA 1SNLA 3VROA 1IKUA 4ETOA 1UHNA 1SR6C 3PSRA 1QVIZ 3O6BA 1DVIA 1J7QA 1B8LA 2H61C 1K94A 2O5GA 1NPQA 1TWOA 2M1KB 3NSIA 1CTRA 2JQ6A 1DMOA 2WCHA 2B1UA 2ISDA 4PE7A 2QEHA 2EC6C 1QV0A 1LKJA 1RTP1 2CBLA 1ZMZA 3FWCA 3BQ3A 4HREE 1FBVA 4ORAB 4ORCB 4N1GA 3M0WA 1CNPA 3KO0A 1SKTA 3VGOA 3VRRA 2Q4UA 4KYNA 1MWNA 4MZJA 3D77A 2JTTA 2M7LA 2BECA 5AXIA 4E68A 1HQVA 1MXEA 1WRZA 3HCMA 2K2AA 2L4IA 2OTGC 1TCFA 4NDDA 3I5IC 1K93D 4I5NB 4PE0A 3CS1A 2HETA 1K90D 2LC5A 2HPSA 3EVVA 5JOLA 1QXPA 3D78A 4IL1A 1BF5A 1DJXA 1IH0A 3S0EA 3CABA 1J1DA 2KI4B 2H61A 1YUTA 2F8PA 1TNPA 2P71A 2KDHA 1SPYA 1K9KA 1JFKA 4PE4A 2LLUA 2L5XB 1TNXA 2JT0A 1UHJA 2O60A 5B8IB 3FE9A 1GJYA 2AUCA 4MEWA 1IG5A 1K9UA 1SBJA 5FI6A 1JFJA 1ZOTB 3NHIA 2Y1NA 5J3XA 2FJUB 1H4BA 2PALA 3LCPC 5AFPA 2KQYA 2ZFDA 2KSPA 3EG5B 4QJ3B 5DKNA 1AUIB 5CSJA 1DJIA 5HLVA 4OVNF 3DVJA 1KK7Y 1OMVA 1Z4HA 2BAPA 3BOWB 2PASA 2MLEC 1A4PA 2JC2A 3AKBA 1B47A 4ORBB 3PN7C 3QMEA 2BE4A 2HF5A 5I2OA 2K7DA 1S1EA 2F3YA 1M45A 2I2RE 1NCYA 2LP2A 2QPTA 3EVRA 1DJYA 2KI4C 2Q91A 1OQPA 3GK4X 5HKZA 1CMGA 1EH2A 1A2XA 3EK8A 4OR9B 3SG6A 2JT3A 1SRAA 3R1VA 2F2OA 3SG2A 2F2PA 4OV2A 1W9ZA 1Q80A 1NX1A 1OOGA 2GTEA 3AAKA 3LK1A 1WRKA 4GAOA 3VRQA 2LHIA 1QLSA 1B7TY 1A75A 2M0RA 2GV5A 4GGFA 1BG1A 2KYCA 2PQLA 3O78A 5FI2A 4ZCVA 1BU3A 1Y6WA 3IQQA 3CZ1A 2JNFA 1GGWA 3JVTC 2FJYA 1MUXA 2JPTA 4PE1A 3CR4X 1MQ1A 2EHBA 2I94A 1W7IB 4I5JA 3ZWHA 1XFZO 2K7CA 4NDCA 1QV1A 1YRTB 4JQ0D 3SIAA 1ALVA 2NZ0A 3DYEA 1BLQA 1SCMB 2AAOA 5HKWA 1XFUO 1CMFA 1FPWA 1CDMA 4GBAA 1KQMB 3TDIA 2JULA 1D1OA 1KWOB 1CLLA 1IGVA 2D8NA 1OSAA 2M8UA 4TNCA 3NSOA 4OCIA 2F3ZA 2EGDA 2LNKA 1ZACA 1T14A 5JJGA 1B1GA 5ER4X 4I5LB 3CDNA 3D0YA 3DF0A 2OPOA 2CT9A 2GGZA 3I5GB 4HSZA 1KQVA 4I5KA 3OBVA 1XFRA 2KBMA 3AKAA 3PFVA 3BJHA 1ODBA 4FQOA 5AEQA 3SG4A 3CZTX 1KCYA 2WCLA 3DVMA 2MA2A 1NCZA 4U8DA 5CSNA 1IQ3A 1J7RA 1JUOA 2K0JA 4FTGA 1JSAA 1K9PA 3CLNA 1GGZA 3EK7A 1X02A 2KHNA 4YGEB 3I5HC 5HKYA 1IQ5A 1QVIY 2WNDA 2K2FA 2A4JA 3KPXA 1CM1A 1PSRA 1ZFSA 3PATA 3DVKA 1XFWO 3B7AA 2JXLA 2HQ8A 1U5IB 1YX8A 2NLNA 1NX3A 1M39A 2MHHA 3O2PA 1NX2A 1KWOC 1LVCD 1NX0A 1XFXO 3N7HA 1OOIX 2ERBA 1XFVO 3D76A 1XVJA 3IVTA 4BY5A 1IIOA 3UNWA 2LANA 3VRPA 3HX4A 3BYAA 4PHNA 4GFTA 3A8RA 1S5GY 2KGRA 4XJKB 3E3RA 2JU0A 2KI6C 2NCPA 1ZUZA 1UP5A 2WOSA 5D3OA 3TUYC 1OZSA 1DJHA 2OS8B 5HLOA 1VRKA 2KQ6A 1Y1AA 3GK1A 3JTDB 3B6XA 1SCVA 5KSZA 3BUNB 1JWDA 4ICBA 2F33A 3BUWB 2WCKA 4DUQA 2LLSA 2ZN8A 1KSOA 4Q04A 1SL7A 2LP3A 4PHJA 1C3YA 2VRGA 1K96A 4CFRA 1TCOB 1UHHA 1B9AA 3C1VA 1AK8A 1SSEB 3B87A 1OZOA 4M2QA 3DVEA 2KFFA 5CSIA 2WCFA 1QLKA 1CB1A 2KPHA 1EG4A 2LM5A 3S0BA 2NCOA 2M97A 3BXKA 5TNCA 4F0ZB 3IF7A 3GK2A 4XYNA 3I5FB 3LK0A 2KAXA 2ZRTA 3FIAA 1F70A 3BUMB 1QX7A 3O4YA 1MXLC 5DICA 1RFJA 4MBEA 3WXAA 4R1EA
chains in the Genus database with same CATH topology
2BKIB 1M31A 1PSBA 4YGAA 2WCEA 1N0YA 2K7BA 1J1EA 2BCAA 2OS8C 2PVBA 1BOCA 2SCPA 5AANA 2IS9A 5AERA 1DF0A 4JWQA 1F4OA 1K2HA 1PULA 3QRXA 1XO5A 1LA0A 3FS7A 1DTLA 1CLMA 2QACA 3K21A 1WDCB 3TS5B 1YX7A 1QIWA 2GGMA 4MLWA 1DGUA 1YRUB 1YVLA 4PCWA 2LMUA 2M1UA 2MBXA 5I2LA 2CNPA 2MAZA 1NIWA 4YBHB 2LE9B 4MRYA 1E8AA 1L2OB 1MHOA 2I18A 2M29A 4MVFA 4DCKA 1A03A 1IWQA 2LHLA 3TDUA 2CXJA 2L51A 2Y4QA 3I5FC 4CFQA 1YR5A 2MJWB 5K89A 2V53A 1XA5A 3NSKA 2HQWA 2RGIA 1QS7A 1S26D 1LA3A 1CFCA 5DKRA 1V1FA 1QTXA 4CLNA 1KK7Z 3CR2A 3FWBA 1UURA 3WNXB 1WLMA 5PALA 1AJ5A 1KK8B 1TRFA 1UHIA 2LVJA 3EVUA 5HYDA 1G8IA 1M63B 1BODA 3DD4A 1SW8A 4L9MA 2G9BA 1BMOA 1UWOA 2MRDA 4PDZA 4GNKB 2KAVA 1DJGA 5F6TA 1C7WA 1XYDA 4AQIA 5I2QA 1XFYO 1YVHA 3SG3A 4P2YB 1CFPA 1KFXL 2NXQA 4AQJA 1NCXA 2LCPA 1C07A 1UUSA 1NYAA 2WCBA 3AAJA 1KSMA 3SG7A 4YI9A 1JBAA 1H8BA 2KYFA 1B8RA 4YGCB 4GPLB 3RLZA 1PRWA 1CFFA 3WHTB 2L0PA 4YGBB 1W7JB 1XK4C 2KNEA 1G4YR 1SL9A 2R2IA 2TN4A 5CSFA 1OOJA 1PALA 1PVBA 2G2BA 3BOWA 1SCMC 3TDZA 4MN0A 1KFUL 1KK8C 1CM4A 3KHEA 4HRHA 4OKHA 4A4CA 4NDBA 1MF8B 4YGDB 3A4UB 1LINA 1KQMC 3D10A 2ZNDA 3PLFB 2PSRA 1DT7B 1S36A 1Y1XA 1OMRA 2BCBA 1CDNA 1FF1A 2JNXA 1UHKA 2KI6D 1L7ZA 1AP4A 3EKHA 1DJZA 3NSLA 1S6JA 4HRGA 2KBIA 3I5GC 4YI8A 3OB1B 1DGVA 2LUXA 1AHRA 5IBWA 1A29A 1TIZA 3I5IB 3TZ1A 1B8CA 3EKJA 1CDPA 1Y1UA 2KFGA 1TNQA 1WY9A 3SIBA 5I8NA 1XK4A 1TOPA 4WRIA 3VRNA 1J7OA 2JT8A 1N2DA 2ZKMX 3OB2B 5KU1A 2L2EA 1QATA 3WHUB 2BL0B 4QJ4B 2JRFA 4DRWA 3LLEA 3SJSA 3BUOB 4PALA 5CPVA 1JC2A 4WQ3A 1RK9A 4GUKA 4PHKA 1A75B 5GQQC 2JOJA 1BT6A 4N1FA 3NXAA 1WLZA 2FCDA 3BUXB 2K8MB 1S5GZ 3F45A 1YURA 1GQMA 1F8HA 2KFHA 2KGBC 2LUCA 3EK4A 1PVAA 1WRLA 1BR1B 1K8UA 1QJTA 1RECA 2LAPA 2SASA 1EG3A 1QX2A 5ER5A 4QJ5B 1FW4A 1CLBA 1TN4A 3PN7B 2CTNA 1NP8A 3IQOA 3OX5A 2LLTA 2PRUA 3LL8B 1B4CA 2H2KA 3JTDC 2E6WA 1NSHA 2P6BB 1TTXA 2BL0C 3KF9A 3PALA 4DS7A 4YRUA 1AVSA 1KFXS 1U5IA 2JTZA 4JPZB 1CKKA 1SYMA 3D0YB 2L50A 3DF0B 3OX6A 2M9GA 4N5XA 4PHMA 1M46A 1RWYA 4GGFC 3ZNIA 3RM1A 1QASA 4A4BA 2K7OA 5G08A 1F4QA 3JVTB 1V1GA 1IJ5A 1NUBA 2E30A 2LMVA 2LVKA 1AJ4A 3GOFA 2M3WA 4XJKA 2BBNA 2M7NA 4CPVA 2BBMA 1DJWA 1KFUS 2BCXA 2ZN9A 2Y5IA 4BY4A 4ZCUA 4D1EA 5D69A 2KAYA 1R2UA 1BR4B 1S3PA 1FI5A 3MSEB 4P5OE 5D7FA 2COLB 1EL4A 2L98A 1PK0D 1C7VA 4C0LA 4MZKA 4NQGA 1OE9B 2WC8A 1J7PA 1YTZC 2WORA 1SMGA 1WDCC 4C0KA 3TS5C 2LVIA 1G33A 2KOTA 2K61A 1CFDA 4DIRA 1EJ3A 1BJFA 2JXCA 2BE6A 2BKHB 2CCMA 1IRJA 2LV7A 1F55A 1L2OC 2PMYA 1YUSA 1B7TZ 3CGAA 4UPGA 3CWGA 3I5HB 1RJVA 5BPJA 4USLA 1IJ6A 1MR8A 1RROA 2DOQA 2MLFC 5DKQA 3KEVA 1S6CA 5FYXA 1SK6D 4GGNA 4C0JA 3OP0A 1QX5B 1JF0A 1SR6B 2FCEA 2L4HA 2I7AA 3PM8A 1K95A 2FOTA 4MSPA 2LMTA 1F71A 1SL8A 2Y1MA 2M49B 1LXFC 3SG5A 1YUUA 1EXRA 2JWWA 1OMDA 4WQ2A 2EC6B 4MZLA 3ICBA 1HT9A 1TNWA 3TUYB 4AOMA 1J55A 2ZRSA 4M2OA 1R6PA 1NWDA 3CTNA 4MRXA 2JZIA 4M2PA 1SY9A 1QIVA 3OHMB 3CR5X 1JF2A 4CIDA 1N65A 5KTYA 1S6IA 1Y0VH 2LVVA 1FI6A 2OTGB 3H4SE 2AMIA 1DF0B 1F54A 1CDLA 2ZNEA 1ALWA 1SNLA 3VROA 1IKUA 4ETOA 1UHNA 1SR6C 3PSRA 1QVIZ 3O6BA 1DVIA 1J7QA 1B8LA 2H61C 1K94A 2O5GA 1NPQA 2M1KB 3NSIA 1CTRA 2JQ6A 1DMOA 2B1UA 2ISDA 4PE7A 2EC6C 1QV0A 1LKJA 1RTP1 2CBLA 1ZMZA 3FWCA 3BQ3A 4HREE 1FBVA 4ORAB 4ORCB 4N1GA 3M0WA 1CNPA 3KO0A 1SKTA 3VGOA 3VRRA 2Q4UA 1MWNA 4MZJA 2JTTA 2M7LA 2BECA 5AXIA 4E68A 1HQVA 1MXEA 1WRZA 3HCMA 2K2AA 2L4IA 2OTGC 1TCFA 4NDDA 3I5IC 1K93D 4I5NB 4PE0A 3CS1A 2HETA 1K90D 2LC5A 2HPSA 3EVVA 5JOLA 1QXPA 1BF5A 4IL1A 1DJXA 1IH0A 1J1DA 2KI4B 2H61A 1YUTA 2F8PA 1TNPA 2KDHA 1SPYA 1K9KA 1JFKA 4PE4A 2LLUA 2L5XB 1TNXA 2JT0A 1UHJA 2O60A 5B8IB 2AUCA 1GJYA 4MEWA 1IG5A 1K9UA 1SBJA 1JFJA 1ZOTB 2Y1NA 5J3XA 2FJUB 1H4BA 2PALA 3LCPC 5AFPA 2KQYA 2ZFDA 2KSPA 4QJ3B 5DKNA 1AUIB 5CSJA 1DJIA 5HLVA 4OVNF 3DVJA 1KK7Y 1OMVA 3BOWB 2PASA 2MLEC 1A4PA 2JC2A 3AKBA 1B47A 4ORBB 3PN7C 2BE4A 2HF5A 5I2OA 2K7DA 1S1EA 2F3YA 1M45A 2I2RE 1NCYA 2LP2A 2QPTA 3EVRA 1DJYA 2KI4C 2Q91A 1OQPA 3GK4X 5HKZA 1CMGA 1EH2A 1A2XA 3EK8A 4OR9B 3SG6A 2JT3A 1SRAA 2F2OA 3SG2A 2F2PA 4OV2A 1Q80A 1NX1A 3AAKA 3LK1A 1WRKA 4GAOA 3VRQA 2LHIA 1QLSA 1B7TY 1A75A 2M0RA 2GV5A 4GGFA 1BG1A 2KYCA 3O78A 4ZCVA 1BU3A 1Y6WA 3IQQA 1GGWA 2JNFA 3JVTC 1MUXA 2JPTA 4PE1A 3CR4X 1MQ1A 2EHBA 2I94A 1W7IB 4I5JA 3ZWHA 1XFZO 2K7CA 4NDCA 1QV1A 1YRTB 4JQ0D 3SIAA 1ALVA 2NZ0A 1BLQA 1SCMB 2AAOA 5HKWA 1XFUO 1CMFA 1FPWA 1CDMA 4GBAA 1KQMB 3TDIA 2JULA 1D1OA 1KWOB 1CLLA 1IGVA 2D8NA 1OSAA 2M8UA 4TNCA 3NSOA 4OCIA 2F3ZA 2EGDA 2LNKA 1ZACA 5JJGA 1B1GA 5ER4X 4I5LB 3D0YA 3DF0A 2OPOA 2CT9A 2GGZA 3I5GB 4HSZA 1KQVA 4I5KA 3AKAA 2KBMA 3PFVA 1ODBA 4FQOA 5AEQA 3SG4A 3CZTX 1KCYA 5CSNA 3DVMA 2MA2A 1NCZA 4U8DA 1IQ3A 1J7RA 1JUOA 2K0JA 4FTGA 1JSAA 1K9PA 3CLNA 1GGZA 3EK7A 1X02A 2KHNA 4YGEB 3I5HC 5HKYA 1IQ5A 1QVIY 2WNDA 2K2FA 2A4JA 3KPXA 1CM1A 1PSRA 1ZFSA 3PATA 3DVKA 1XFWO 2JXLA 2HQ8A 1U5IB 1YX8A 2NLNA 1NX3A 1M39A 2MHHA 3O2PA 1NX2A 1KWOC 1LVCD 1NX0A 1XFXO 4BY5A 1XFVO 1XVJA 3VRPA 2LANA 3HX4A 3BYAA 4PHNA 4GFTA 3A8RA 1S5GY 2KGRA 4XJKB 3E3RA 2JU0A 2KI6C 2NCPA 1ZUZA 1UP5A 2WOSA 3TUYC 1OZSA 1DJHA 2OS8B 5HLOA 1VRKA 2KQ6A 1Y1AA 3GK1A 3JTDB 1SCVA 5KSZA 3BUNB 1JWDA 4ICBA 2F33A 3BUWB 4DUQA 2LLSA 2ZN8A 1KSOA 4Q04A 1SL7A 2LP3A 4PHJA 2VRGA 1K96A 4CFRA 1TCOB 1UHHA 1B9AA 3C1VA 1AK8A 4M2QA 1OZOA 3DVEA 2KFFA 5CSIA 2WCFA 1QLKA 1CB1A 1EG4A 2LM5A 2NCOA 2M97A 3BXKA 5TNCA 4F0ZB 3IF7A 3GK2A 4XYNA 3I5FB 3LK0A 2KAXA 2ZRTA 3FIAA 1F70A 3BUMB 1QX7A 3O4YA 1MXLC 1RFJA 4MBEA 3WXAA 4R1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKI B;  1M31 A;  1PSB A;  4YGA A;  2WCE A;  1N0Y A;  2K7B A;  1J1E A;  2BCA A;  2OS8 C;  2PVB A;  1BOC A;  2SCP A;  5AAN A;  2IS9 A;  5AER A;  1DF0 A;  4JWQ A;  1F4O A;  1K2H A;  1PUL A;  3QRX A;  1XO5 A;  1LA0 A;  3FS7 A;  1DTL A;  1CLM A;  2QAC A;  3K21 A;  1WDC B;  3TS5 B;  1YX7 A;  1QIW A;  2GGM A;  4MLW A;  1DGU A;  1YRU B;  1YVL A;  4PCW A;  2LMU A;  2M1U A;  2MBX A;  5I2L A;  2CNP A;  2MAZ A;  1NIW A;  4YBH B;  2LE9 B;  4MRY A;  1E8A A;  1L2O B;  1MHO A;  2I18 A;  2M29 A;  4MVF A;  4DCK A;  1A03 A;  1IWQ A;  2LHL A;  3TDU A;  2CXJ A;  2L51 A;  2Y4Q A;  3I5F C;  4CFQ A;  1YR5 A;  2MJW B;  5K89 A;  2V53 A;  1XA5 A;  3NSK A;  2HQW A;  2RGI A;  1QS7 A;  1S26 D;  1LA3 A;  1CFC A;  5DKR A;  1V1F A;  1QTX A;  4CLN A;  1KK7 Z;  3CR2 A;  3FWB A;  1UUR A;  3WNX B;  1WLM A;  5PAL A;  1AJ5 A;  1KK8 B;  1TRF A;  1UHI A;  2LVJ A;  3EVU A;  5HYD A;  1G8I A;  1M63 B;  1BOD A;  3DD4 A;  1SW8 A;  4L9M A;  2G9B A;  1BMO A;  1UWO A;  2MRD A;  4PDZ A;  4GNK B;  2KAV A;  1DJG A;  5F6T A;  1C7W A;  1XYD A;  4AQI A;  5I2Q A;  1XFY O;  1YVH A;  3SG3 A;  4P2Y B;  1CFP A;  1KFX L;  2NXQ A;  4AQJ A;  1NCX A;  2LCP A;  1C07 A;  1UUS A;  1NYA A;  2WCB A;  3AAJ A;  1KSM A;  3SG7 A;  4YI9 A;  1JBA A;  1H8B A;  2KYF A;  1B8R A;  4YGC B;  4GPL B;  3RLZ A;  1PRW A;  1CFF A;  3WHT B;  2L0P A;  4YGB B;  1W7J B;  1XK4 C;  2KNE A;  1G4Y R;  1SL9 A;  2R2I A;  2TN4 A;  5CSF A;  1OOJ A;  1PAL A;  1PVB A;  2G2B A;  3BOW A;  1SCM C;  3TDZ A;  4MN0 A;  1KFU L;  1KK8 C;  1CM4 A;  3KHE A;  4HRH A;  4OKH A;  4A4C A;  4NDB A;  1MF8 B;  4YGD B;  3A4U B;  1LIN A;  1KQM C;  3D10 A;  2ZND A;  3PLF B;  2PSR A;  1DT7 B;  1S36 A;  1Y1X A;  1OMR A;  2BCB A;  1CDN A;  1FF1 A;  2JNX A;  1UHK A;  2KI6 D;  1L7Z A;  1AP4 A;  3EKH A;  1DJZ A;  3NSL A;  1S6J A;  4HRG A;  2KBI A;  3I5G C;  4YI8 A;  3OB1 B;  1DGV A;  2LUX A;  1AHR A;  5IBW A;  1A29 A;  1TIZ A;  3I5I B;  3TZ1 A;  1B8C A;  3EKJ A;  1CDP A;  1Y1U A;  2KFG A;  1TNQ A;  1WY9 A;  3SIB A;  5I8N A;  1XK4 A;  1TOP A;  4WRI A;  3VRN A;  1J7O A;  2JT8 A;  1N2D A;  2ZKM X;  3OB2 B;  5KU1 A;  2L2E A;  1QAT A;  3WHU B;  2BL0 B;  4QJ4 B;  2JRF A;  4DRW A;  3LLE A;  3SJS A;  3BUO B;  4PAL A;  5CPV A;  1JC2 A;  4WQ3 A;  1RK9 A;  4GUK A;  4PHK A;  1A75 B;  5GQQ C;  2JOJ A;  1BT6 A;  4N1F A;  3NXA A;  1WLZ A;  2FCD A;  3BUX B;  2K8M B;  1S5G Z;  3F45 A;  1YUR A;  1GQM A;  1F8H A;  2KFH A;  2KGB C;  2LUC A;  3EK4 A;  1PVA A;  1WRL A;  1BR1 B;  1K8U A;  1QJT A;  1REC A;  2LAP A;  2SAS A;  1EG3 A;  1QX2 A;  5ER5 A;  4QJ5 B;  1FW4 A;  1CLB A;  1TN4 A;  3PN7 B;  2CTN A;  1NP8 A;  3IQO A;  3OX5 A;  2LLT A;  2PRU A;  3LL8 B;  1B4C A;  2H2K A;  3JTD C;  2E6W A;  1NSH A;  2P6B B;  1TTX A;  2BL0 C;  3KF9 A;  3PAL A;  4DS7 A;  4YRU A;  1AVS A;  1KFX S;  1U5I A;  2JTZ A;  4JPZ B;  1CKK A;  1SYM A;  3D0Y B;  2L50 A;  3DF0 B;  3OX6 A;  2M9G A;  4N5X A;  4PHM A;  1M46 A;  1RWY A;  4GGF C;  3ZNI A;  3RM1 A;  1QAS A;  4A4B A;  2K7O A;  5G08 A;  1F4Q A;  3JVT B;  1V1G A;  1IJ5 A;  1NUB A;  2E30 A;  2LMV A;  2LVK A;  1AJ4 A;  3GOF A;  2M3W A;  4XJK A;  2BBN A;  2M7N A;  4CPV A;  2BBM A;  1DJW A;  1KFU S;  2BCX A;  2ZN9 A;  2Y5I A;  4BY4 A;  4ZCU A;  4D1E A;  5D69 A;  2KAY A;  1R2U A;  1BR4 B;  1S3P A;  1FI5 A;  3MSE B;  4P5O E;  5D7F A;  2COL B;  1EL4 A;  2L98 A;  1PK0 D;  1C7V A;  4C0L A;  4MZK A;  4NQG A;  1OE9 B;  2WC8 A;  1J7P A;  1YTZ C;  2WOR A;  1SMG A;  1WDC C;  4C0K A;  3TS5 C;  2LVI A;  1G33 A;  2KOT A;  2K61 A;  1CFD A;  4DIR A;  1EJ3 A;  1BJF A;  2JXC A;  2BE6 A;  2BKH B;  2CCM A;  1IRJ A;  2LV7 A;  1F55 A;  1L2O C;  2PMY A;  1YUS A;  1B7T Z;  3CGA A;  4UPG A;  3CWG A;  3I5H B;  1RJV A;  5BPJ A;  4USL A;  1IJ6 A;  1MR8 A;  1RRO A;  2DOQ A;  2MLF C;  5DKQ A;  3KEV A;  1S6C A;  5FYX A;  1SK6 D;  4GGN A;  4C0J A;  3OP0 A;  1QX5 B;  1JF0 A;  1SR6 B;  2FCE A;  2L4H A;  2I7A A;  3PM8 A;  1K95 A;  2FOT A;  4MSP A;  2LMT A;  1F71 A;  1SL8 A;  2Y1M A;  2M49 B;  1LXF C;  3SG5 A;  1YUU A;  1EXR A;  2JWW A;  1OMD A;  4WQ2 A;  2EC6 B;  4MZL A;  3ICB A;  1HT9 A;  1TNW A;  3TUY B;  4AOM A;  1J55 A;  2ZRS A;  4M2O A;  1R6P A;  1NWD A;  3CTN A;  4MRX A;  2JZI A;  4M2P A;  1SY9 A;  1QIV A;  3OHM B;  3CR5 X;  1JF2 A;  4CID A;  1N65 A;  5KTY A;  1S6I A;  1Y0V H;  2LVV A;  1FI6 A;  2OTG B;  3H4S E;  2AMI A;  1DF0 B;  1F54 A;  1CDL A;  2ZNE A;  1ALW A;  1SNL A;  3VRO A;  1IKU A;  4ETO A;  1UHN A;  1SR6 C;  3PSR A;  1QVI Z;  3O6B A;  1DVI A;  1J7Q A;  1B8L A;  2H61 C;  1K94 A;  2O5G A;  1NPQ A;  2M1K B;  3NSI A;  1CTR A;  2JQ6 A;  1DMO A;  2B1U A;  2ISD A;  4PE7 A;  2EC6 C;  1QV0 A;  1LKJ A;  1RTP 1;  2CBL A;  1ZMZ A;  3FWC A;  3BQ3 A;  4HRE E;  1FBV A;  4ORA B;  4ORC B;  4N1G A;  3M0W A;  1CNP A;  3KO0 A;  1SKT A;  3VGO A;  3VRR A;  2Q4U A;  1MWN A;  4MZJ A;  2JTT A;  2M7L A;  2BEC A;  5AXI A;  4E68 A;  1HQV A;  1MXE A;  1WRZ A;  3HCM A;  2K2A A;  2L4I A;  2OTG C;  1TCF A;  4NDD A;  3I5I C;  1K93 D;  4I5N B;  4PE0 A;  3CS1 A;  2HET A;  1K90 D;  2LC5 A;  2HPS A;  3EVV A;  5JOL A;  1QXP A;  1BF5 A;  4IL1 A;  1DJX A;  1IH0 A;  1J1D A;  2KI4 B;  2H61 A;  1YUT A;  2F8P A;  1TNP A;  2KDH A;  1SPY A;  1K9K A;  1JFK A;  4PE4 A;  2LLU A;  2L5X B;  1TNX A;  2JT0 A;  1UHJ A;  2O60 A;  5B8I B;  2AUC A;  1GJY A;  4MEW A;  1IG5 A;  1K9U A;  1SBJ A;  1JFJ A;  1ZOT B;  2Y1N A;  5J3X A;  2FJU B;  1H4B A;  2PAL A;  3LCP C;  5AFP A;  2KQY A;  2ZFD A;  2KSP A;  4QJ3 B;  5DKN A;  1AUI B;  5CSJ A;  1DJI A;  5HLV A;  4OVN F;  3DVJ A;  1KK7 Y;  1OMV A;  3BOW B;  2PAS A;  2MLE C;  1A4P A;  2JC2 A;  3AKB A;  1B47 A;  4ORB B;  3PN7 C;  2BE4 A;  2HF5 A;  5I2O A;  2K7D A;  1S1E A;  2F3Y A;  1M45 A;  2I2R E;  1NCY A;  2LP2 A;  2QPT A;  3EVR A;  1DJY A;  2KI4 C;  2Q91 A;  1OQP A;  3GK4 X;  5HKZ A;  1CMG A;  1EH2 A;  1A2X A;  3EK8 A;  4OR9 B;  3SG6 A;  2JT3 A;  1SRA A;  2F2O A;  3SG2 A;  2F2P A;  4OV2 A;  1Q80 A;  1NX1 A;  3AAK A;  3LK1 A;  1WRK A;  4GAO A;  3VRQ A;  2LHI A;  1QLS A;  1B7T Y;  1A75 A;  2M0R A;  2GV5 A;  4GGF A;  1BG1 A;  2KYC A;  3O78 A;  4ZCV A;  1BU3 A;  1Y6W A;  3IQQ A;  1GGW A;  2JNF A;  3JVT C;  1MUX A;  2JPT A;  4PE1 A;  3CR4 X;  1MQ1 A;  2EHB A;  2I94 A;  1W7I B;  4I5J A;  3ZWH A;  1XFZ O;  2K7C A;  4NDC A;  1QV1 A;  1YRT B;  4JQ0 D;  3SIA A;  1ALV A;  2NZ0 A;  1BLQ A;  1SCM B;  2AAO A;  5HKW A;  1XFU O;  1CMF A;  1FPW A;  1CDM A;  4GBA A;  1KQM B;  3TDI A;  2JUL A;  1D1O A;  1KWO B;  1CLL A;  1IGV A;  2D8N A;  1OSA A;  2M8U A;  4TNC A;  3NSO A;  4OCI A;  2F3Z A;  2EGD A;  2LNK A;  1ZAC A;  5JJG A;  1B1G A;  5ER4 X;  4I5L B;  3D0Y A;  3DF0 A;  2OPO A;  2CT9 A;  2GGZ A;  3I5G B;  4HSZ A;  1KQV A;  4I5K A;  3AKA A;  2KBM A;  3PFV A;  1ODB A;  4FQO A;  5AEQ A;  3SG4 A;  3CZT X;  1KCY A;  5CSN A;  3DVM A;  2MA2 A;  1NCZ A;  4U8D A;  1IQ3 A;  1J7R A;  1JUO A;  2K0J A;  4FTG A;  1JSA A;  1K9P A;  3CLN A;  1GGZ A;  3EK7 A;  1X02 A;  2KHN A;  4YGE B;  3I5H C;  5HKY A;  1IQ5 A;  1QVI Y;  2WND A;  2K2F A;  2A4J A;  3KPX A;  1CM1 A;  1PSR A;  1ZFS A;  3PAT A;  3DVK A;  1XFW O;  2JXL A;  2HQ8 A;  1U5I B;  1YX8 A;  2NLN A;  1NX3 A;  1M39 A;  2MHH A;  3O2P A;  1NX2 A;  1KWO C;  1LVC D;  1NX0 A;  1XFX O;  4BY5 A;  1XFV O;  1XVJ A;  3VRP A;  2LAN A;  3HX4 A;  3BYA A;  4PHN A;  4GFT A;  3A8R A;  1S5G Y;  2KGR A;  4XJK B;  3E3R A;  2JU0 A;  2KI6 C;  2NCP A;  1ZUZ A;  1UP5 A;  2WOS A;  3TUY C;  1OZS A;  1DJH A;  2OS8 B;  5HLO A;  1VRK A;  2KQ6 A;  1Y1A A;  3GK1 A;  3JTD B;  1SCV A;  5KSZ A;  3BUN B;  1JWD A;  4ICB A;  2F33 A;  3BUW B;  4DUQ A;  2LLS A;  2ZN8 A;  1KSO A;  4Q04 A;  1SL7 A;  2LP3 A;  4PHJ A;  2VRG A;  1K96 A;  4CFR A;  1TCO B;  1UHH A;  1B9A A;  3C1V A;  1AK8 A;  4M2Q A;  1OZO A;  3DVE A;  2KFF A;  5CSI A;  2WCF A;  1QLK A;  1CB1 A;  1EG4 A;  2LM5 A;  2NCO A;  2M97 A;  3BXK A;  5TNC A;  4F0Z B;  3IF7 A;  3GK2 A;  4XYN A;  3I5F B;  3LK0 A;  2KAX A;  2ZRT A;  3FIA A;  1F70 A;  3BUM B;  1QX7 A;  3O4Y A;  1MXL C;  1RFJ A;  4MBE A;  3WXA A;  4R1E A; 
#chains in the Genus database with same CATH topology
 2BKI B;  1M31 A;  1PSB A;  4YGA A;  2WCE A;  2WC6 A;  1N0Y A;  2K7B A;  1J1E A;  2BCA A;  2OS8 C;  2PVB A;  1BOC A;  2SCP A;  5AAN A;  2IS9 A;  5AER A;  1DF0 A;  4JWQ A;  1F4O A;  5EL2 A;  1K2H A;  1PUL A;  3QRX A;  1XO5 A;  1LA0 A;  3FS7 A;  1DTL A;  4INW A;  1CLM A;  2QAC A;  3K21 A;  3B86 A;  1WDC B;  3TS5 B;  1YX7 A;  1QIW A;  2GGM A;  4OZD A;  2H8V A;  4MLW A;  1DGU A;  1YRU B;  1YVL A;  4INX A;  4PCW A;  2LMU A;  2M1U A;  2MBX A;  3DY9 A;  5I2L A;  3K1E A;  3VB1 A;  3O4X A;  2CNP A;  2MAZ A;  1NIW A;  4YBH B;  2LE9 B;  4MRY A;  1E8A A;  1L2O B;  1MHO A;  2I18 A;  2M29 A;  4MVF A;  4DCK A;  1A03 A;  1IWQ A;  2LHL A;  2QDI A;  3TDU A;  2CXJ A;  2L51 A;  2Y4Q A;  3I5F C;  4CFQ A;  1YR5 A;  2MJW B;  5K89 A;  2V53 A;  1XA5 A;  3NSK A;  3R1P A;  2KLD A;  2HQW A;  2RGI A;  1QS7 A;  1S26 D;  3DZT A;  1LA3 A;  1CFC A;  2L5Y A;  2QEO A;  5DKR A;  1V1F A;  1QTX A;  3PM2 A;  4CLN A;  3SS4 A;  1KK7 Z;  3CR2 A;  3FWB A;  1UUR A;  3WNX B;  1WLM A;  5PAL A;  1AJ5 A;  1KK8 B;  1TRF A;  1UHI A;  2LVJ A;  3EVU A;  3RZS A;  5HYD A;  1G8I A;  1M63 B;  1BOD A;  3DD4 A;  1SW8 A;  1DC1 A;  4L9M A;  2G9B A;  1BMO A;  1UWO A;  2MRD A;  3SS5 A;  4PDZ A;  4GNK B;  2KAV A;  1DJG A;  5F6T A;  1C7W A;  1XYD A;  4AQI A;  5I2Q A;  1XFY O;  1YVH A;  3R1O A;  4P2Y B;  3SG3 A;  1CFP A;  3B88 A;  1KFX L;  2NXQ A;  4AQJ A;  1NCX A;  1C3Z A;  2LCP A;  1C07 A;  1UUS A;  3CZ2 A;  1NYA A;  2WCB A;  3AAJ A;  5FI7 A;  1KSM A;  3SG7 A;  4YI9 A;  1JBA A;  1H8B A;  2KYF A;  1B8R A;  4YGC B;  4GPL B;  3RLZ A;  3S0F A;  1PRW A;  1CFF A;  3WHT B;  2L0P A;  4YGB B;  1W7J B;  1XK4 C;  1OW4 A;  2KNE A;  1G4Y R;  1SL9 A;  2R2I A;  2TN4 A;  2WCM A;  5CSF A;  1OOJ A;  1PAL A;  1PVB A;  2G2B A;  3BOW A;  2YGU A;  1SCM C;  3TDZ A;  4MN0 A;  1KFU L;  1KK8 C;  1CM4 A;  1TUJ A;  1Z2C B;  3KHE A;  4HRH A;  4OKH A;  4A4C A;  4NDB A;  1MF8 B;  4YGD B;  3A4U B;  1LIN A;  1KQM C;  3D10 A;  2ZND A;  3PLF B;  2PSR A;  1DT7 B;  3R72 A;  1S36 A;  1Y1X A;  1OMR A;  2BCB A;  1CDN A;  1FF1 A;  2JNX A;  1UHK A;  2KI6 D;  1L7Z A;  1AP4 A;  3EKH A;  1DJZ A;  3NSL A;  1S6J A;  3PJI A;  2KBI A;  4HRG A;  3I5G C;  4YI8 A;  3OB1 B;  1DGV A;  2LUX A;  1AHR A;  5IBW A;  1A29 A;  1TIZ A;  3I5I B;  3TZ1 A;  1B8C A;  3BFB A;  3EKJ A;  1CDP A;  1Y1U A;  2KFG A;  1TNQ A;  1WY9 A;  3SIB A;  5I8N A;  1XK4 A;  1TOP A;  4WRI A;  3VRN A;  1J7O A;  2JT8 A;  1N2D A;  2ZKM X;  3OB2 B;  5KU1 A;  2L2E A;  1QAT A;  3WHU B;  2BL0 B;  4QJ4 B;  2JRF A;  4DRW A;  3LLE A;  3SJS A;  3BUO B;  3UO9 A;  4PAL A;  5CPV A;  1JC2 A;  4WQ3 A;  1RK9 A;  3V2L A;  4GUK A;  2PYQ A;  4PHK A;  1A75 B;  5GQQ C;  2JOJ A;  3S0A A;  1BT6 A;  4N1F A;  5HL1 A;  3NXA A;  1WLZ A;  2FCD A;  3BUX B;  2K8M B;  1S5G Z;  3F45 A;  1YUR A;  1DQE A;  1GQM A;  1F8H A;  2KFH A;  2KGB C;  2LUC A;  3EK4 A;  1PVA A;  1WRL A;  1BR1 B;  1K8U A;  1QJT A;  1REC A;  2LAP A;  2SAS A;  1EG3 A;  1QX2 A;  5ER5 A;  4QJ5 B;  1FW4 A;  4JD9 A;  3Q8I A;  1CLB A;  1TN4 A;  1OOH A;  3L4A A;  3PN7 B;  2CTN A;  1NP8 A;  3D74 A;  3IQO A;  2LLT A;  2PRU A;  3L47 A;  3LL8 B;  3OX5 A;  1B4C A;  2H2K A;  3JTD C;  1TUZ A;  3DXL A;  2KLE A;  2E6W A;  1NSH A;  2P6B B;  1TTX A;  2BL0 C;  3KF9 A;  3PAL A;  4JKT A;  3S0G A;  4DS7 A;  4YRU A;  1AVS A;  1KFX S;  1U5I A;  2JTZ A;  4JPZ B;  2WCJ A;  1CKK A;  1SYM A;  3D0Y B;  2L50 A;  2QEB A;  3DF0 B;  3OX6 A;  2M9G A;  3S0D A;  4N5X A;  4PHM A;  1M46 A;  1RWY A;  4GGF C;  4PT1 A;  3ZNI A;  3RM1 A;  1QAS A;  4F7F A;  4A4B A;  2K7O A;  5G08 A;  1F4Q A;  1ORG A;  3JVT B;  3OGN A;  1V1G A;  1IJ5 A;  1NUB A;  2E30 A;  2LMV A;  2LVK A;  1AJ4 A;  3GOF A;  2M3W A;  3CZ0 A;  4XJK A;  2BBN A;  2M7N A;  2BNX A;  3FE6 A;  4CPV A;  2BBM A;  1DJW A;  1KFU S;  1LS8 A;  2BCX A;  2Y5I A;  2ZN9 A;  4BY4 A;  4ZCU A;  4D1E A;  5D69 A;  2KAY A;  1R2U A;  2L2C A;  1BR4 B;  1S3P A;  2P70 A;  1FI5 A;  3MSE B;  4P5O E;  5D7F A;  2COL B;  1EL4 A;  2L98 A;  1PK0 D;  3FE8 A;  1C7V A;  4C0L A;  4MZK A;  4FQT A;  4NQG A;  1OE9 B;  2WC8 A;  1DEK A;  1J7P A;  1YTZ C;  2WOR A;  1SMG A;  2K60 A;  1WDC C;  4C0K A;  3TS5 C;  1DEL A;  2LVI A;  1G33 A;  2KOT A;  1GM0 A;  2K61 A;  1CFD A;  4DIR A;  1EJ3 A;  1BJF A;  2JXC A;  2BE6 A;  2BKH B;  2CCM A;  1IRJ A;  2LV7 A;  1F55 A;  1L2O C;  2PMY A;  3CYZ A;  1YUS A;  3BFH A;  1B7T Z;  3NGV A;  3CGA A;  4UPG A;  3D75 A;  3CWG A;  3I5H B;  4IJ7 A;  1RJV A;  3L4L A;  5BPJ A;  4USL A;  1IJ6 A;  1MR8 A;  1RRO A;  2DOQ A;  2MLF C;  5I94 A;  5DKQ A;  3KEV A;  1S6C A;  5FYX A;  1SK6 D;  4GGN A;  4C0J A;  3OP0 A;  1QX5 B;  3NHT A;  1JF0 A;  1SR6 B;  2FCE A;  2L4H A;  2I7A A;  3PM8 A;  1K95 A;  2FOT A;  4MSP A;  2LMT A;  1F71 A;  2QEV A;  1SL8 A;  2WC5 A;  2Y1M A;  2M49 B;  1LXF C;  3SG5 A;  1YUU A;  1EXR A;  2JWW A;  1OMD A;  1OOF A;  1QWV A;  4WQ2 A;  2EC6 B;  3SS3 A;  4MZL A;  3ICB A;  1HT9 A;  1P28 A;  1TNW A;  3TUY B;  4AOM A;  1J55 A;  2ZRS A;  4M2O A;  1R6P A;  2JPO A;  1NWD A;  3CTN A;  3BFA A;  2JZI A;  3D73 A;  4M2P A;  1SY9 A;  1QIV A;  4MRX A;  3OHM B;  3CR5 X;  1JF2 A;  4CID A;  1N65 A;  5KTY A;  1S6I A;  1Y0V H;  2LVV A;  1FI6 A;  2OTG B;  3H4S E;  2AMI A;  1DF0 B;  1F54 A;  1CDL A;  2ZNE A;  1ALW A;  1SNL A;  3VRO A;  1IKU A;  4ETO A;  1UHN A;  1SR6 C;  3PSR A;  1QVI Z;  3O6B A;  1DVI A;  1J7Q A;  1B8L A;  2H61 C;  1K94 A;  2O5G A;  1NPQ A;  1TWO A;  2M1K B;  3NSI A;  1CTR A;  2JQ6 A;  1DMO A;  2WCH A;  2B1U A;  2ISD A;  4PE7 A;  2QEH A;  2EC6 C;  1QV0 A;  1LKJ A;  1RTP 1;  2CBL A;  1ZMZ A;  3FWC A;  3BQ3 A;  4HRE E;  1FBV A;  4ORA B;  4ORC B;  4N1G A;  3M0W A;  1CNP A;  3KO0 A;  1SKT A;  3VGO A;  3VRR A;  2Q4U A;  4KYN A;  1MWN A;  4MZJ A;  3D77 A;  2JTT A;  2M7L A;  2BEC A;  5AXI A;  4E68 A;  1HQV A;  1MXE A;  1WRZ A;  3HCM A;  2K2A A;  2L4I A;  2OTG C;  1TCF A;  4NDD A;  3I5I C;  1K93 D;  4I5N B;  4PE0 A;  3CS1 A;  2HET A;  1K90 D;  2LC5 A;  2HPS A;  3EVV A;  5JOL A;  1QXP A;  3D78 A;  4IL1 A;  1BF5 A;  1DJX A;  1IH0 A;  3S0E A;  3CAB A;  1J1D A;  2KI4 B;  2H61 A;  1YUT A;  2F8P A;  1TNP A;  2P71 A;  2KDH A;  1SPY A;  1K9K A;  1JFK A;  4PE4 A;  2LLU A;  2L5X B;  1TNX A;  2JT0 A;  1UHJ A;  2O60 A;  5B8I B;  3FE9 A;  1GJY A;  2AUC A;  4MEW A;  1IG5 A;  1K9U A;  1SBJ A;  5FI6 A;  1JFJ A;  1ZOT B;  3NHI A;  2Y1N A;  5J3X A;  2FJU B;  1H4B A;  2PAL A;  3LCP C;  5AFP A;  2KQY A;  2ZFD A;  2KSP A;  3EG5 B;  4QJ3 B;  5DKN A;  1AUI B;  5CSJ A;  1DJI A;  5HLV A;  4OVN F;  3DVJ A;  1KK7 Y;  1OMV A;  1Z4H A;  2BAP A;  3BOW B;  2PAS A;  2MLE C;  1A4P A;  2JC2 A;  3AKB A;  1B47 A;  4ORB B;  3PN7 C;  3QME A;  2BE4 A;  2HF5 A;  5I2O A;  2K7D A;  1S1E A;  2F3Y A;  1M45 A;  2I2R E;  1NCY A;  2LP2 A;  2QPT A;  3EVR A;  1DJY A;  2KI4 C;  2Q91 A;  1OQP A;  3GK4 X;  5HKZ A;  1CMG A;  1EH2 A;  1A2X A;  3EK8 A;  4OR9 B;  3SG6 A;  2JT3 A;  1SRA A;  3R1V A;  2F2O A;  3SG2 A;  2F2P A;  4OV2 A;  1W9Z A;  1Q80 A;  1NX1 A;  1OOG A;  2GTE A;  3AAK A;  3LK1 A;  1WRK A;  4GAO A;  3VRQ A;  2LHI A;  1QLS A;  1B7T Y;  1A75 A;  2M0R A;  2GV5 A;  4GGF A;  1BG1 A;  2KYC A;  2PQL A;  3O78 A;  5FI2 A;  4ZCV A;  1BU3 A;  1Y6W A;  3IQQ A;  3CZ1 A;  2JNF A;  1GGW A;  3JVT C;  2FJY A;  1MUX A;  2JPT A;  4PE1 A;  3CR4 X;  1MQ1 A;  2EHB A;  2I94 A;  1W7I B;  4I5J A;  3ZWH A;  1XFZ O;  2K7C A;  4NDC A;  1QV1 A;  1YRT B;  4JQ0 D;  3SIA A;  1ALV A;  2NZ0 A;  3DYE A;  1BLQ A;  1SCM B;  2AAO A;  5HKW A;  1XFU O;  1CMF A;  1FPW A;  1CDM A;  4GBA A;  1KQM B;  3TDI A;  2JUL A;  1D1O A;  1KWO B;  1CLL A;  1IGV A;  2D8N A;  1OSA A;  2M8U A;  4TNC A;  3NSO A;  4OCI A;  2F3Z A;  2EGD A;  2LNK A;  1ZAC A;  1T14 A;  5JJG A;  1B1G A;  5ER4 X;  4I5L B;  3CDN A;  3D0Y A;  3DF0 A;  2OPO A;  2CT9 A;  2GGZ A;  3I5G B;  4HSZ A;  1KQV A;  4I5K A;  3OBV A;  1XFR A;  2KBM A;  3AKA A;  3PFV A;  3BJH A;  1ODB A;  4FQO A;  5AEQ A;  3SG4 A;  3CZT X;  1KCY A;  2WCL A;  3DVM A;  2MA2 A;  1NCZ A;  4U8D A;  5CSN A;  1IQ3 A;  1J7R A;  1JUO A;  2K0J A;  4FTG A;  1JSA A;  1K9P A;  3CLN A;  1GGZ A;  3EK7 A;  1X02 A;  2KHN A;  4YGE B;  3I5H C;  5HKY A;  1IQ5 A;  1QVI Y;  2WND A;  2K2F A;  2A4J A;  3KPX A;  1CM1 A;  1PSR A;  1ZFS A;  3PAT A;  3DVK A;  1XFW O;  3B7A A;  2JXL A;  2HQ8 A;  1U5I B;  1YX8 A;  2NLN A;  1NX3 A;  1M39 A;  2MHH A;  3O2P A;  1NX2 A;  1KWO C;  1LVC D;  1NX0 A;  1XFX O;  3N7H A;  1OOI X;  2ERB A;  1XFV O;  3D76 A;  1XVJ A;  3IVT A;  4BY5 A;  1IIO A;  3UNW A;  2LAN A;  3VRP A;  3HX4 A;  3BYA A;  4PHN A;  4GFT A;  3A8R A;  1S5G Y;  2KGR A;  4XJK B;  3E3R A;  2JU0 A;  2KI6 C;  2NCP A;  1ZUZ A;  1UP5 A;  2WOS A;  5D3O A;  3TUY C;  1OZS A;  1DJH A;  2OS8 B;  5HLO A;  1VRK A;  2KQ6 A;  1Y1A A;  3GK1 A;  3JTD B;  3B6X A;  1SCV A;  5KSZ A;  3BUN B;  1JWD A;  4ICB A;  2F33 A;  3BUW B;  2WCK A;  4DUQ A;  2LLS A;  2ZN8 A;  1KSO A;  4Q04 A;  1SL7 A;  2LP3 A;  4PHJ A;  1C3Y A;  2VRG A;  1K96 A;  4CFR A;  1TCO B;  1UHH A;  1B9A A;  3C1V A;  1AK8 A;  1SSE B;  3B87 A;  1OZO A;  4M2Q A;  3DVE A;  2KFF A;  5CSI A;  2WCF A;  1QLK A;  1CB1 A;  2KPH A;  1EG4 A;  2LM5 A;  3S0B A;  2NCO A;  2M97 A;  3BXK A;  5TNC A;  4F0Z B;  3IF7 A;  3GK2 A;  4XYN A;  3I5F B;  3LK0 A;  2KAX A;  2ZRT A;  3FIA A;  1F70 A;  3BUM B;  1QX7 A;  3O4Y A;  1MXL C;  5DIC A;  1RFJ A;  4MBE A;  3WXA A;  4R1E A; 
#chains in the Genus database with same CATH homology
 2BKI B;  1M31 A;  1PSB A;  4YGA A;  2WCE A;  1N0Y A;  2K7B A;  1J1E A;  2BCA A;  2OS8 C;  2PVB A;  1BOC A;  2SCP A;  5AAN A;  2IS9 A;  5AER A;  1DF0 A;  4JWQ A;  1F4O A;  1K2H A;  1PUL A;  3QRX A;  1XO5 A;  1LA0 A;  3FS7 A;  1DTL A;  1CLM A;  2QAC A;  3K21 A;  1WDC B;  3TS5 B;  1YX7 A;  1QIW A;  2GGM A;  4MLW A;  1DGU A;  1YRU B;  1YVL A;  4PCW A;  2LMU A;  2M1U A;  2MBX A;  5I2L A;  2CNP A;  2MAZ A;  1NIW A;  4YBH B;  2LE9 B;  4MRY A;  1E8A A;  1L2O B;  1MHO A;  2I18 A;  2M29 A;  4MVF A;  4DCK A;  1A03 A;  1IWQ A;  2LHL A;  3TDU A;  2CXJ A;  2L51 A;  2Y4Q A;  3I5F C;  4CFQ A;  1YR5 A;  2MJW B;  5K89 A;  2V53 A;  1XA5 A;  3NSK A;  2HQW A;  2RGI A;  1QS7 A;  1S26 D;  1LA3 A;  1CFC A;  5DKR A;  1V1F A;  1QTX A;  4CLN A;  1KK7 Z;  3CR2 A;  3FWB A;  1UUR A;  3WNX B;  1WLM A;  5PAL A;  1AJ5 A;  1KK8 B;  1TRF A;  1UHI A;  2LVJ A;  3EVU A;  5HYD A;  1G8I A;  1M63 B;  1BOD A;  3DD4 A;  1SW8 A;  4L9M A;  2G9B A;  1BMO A;  1UWO A;  2MRD A;  4PDZ A;  4GNK B;  2KAV A;  1DJG A;  5F6T A;  1C7W A;  1XYD A;  4AQI A;  5I2Q A;  1XFY O;  1YVH A;  3SG3 A;  4P2Y B;  1CFP A;  1KFX L;  2NXQ A;  4AQJ A;  1NCX A;  2LCP A;  1C07 A;  1UUS A;  1NYA A;  2WCB A;  3AAJ A;  1KSM A;  3SG7 A;  4YI9 A;  1JBA A;  1H8B A;  2KYF A;  1B8R A;  4YGC B;  4GPL B;  3RLZ A;  1PRW A;  1CFF A;  3WHT B;  2L0P A;  4YGB B;  1W7J B;  1XK4 C;  2KNE A;  1G4Y R;  1SL9 A;  2R2I A;  2TN4 A;  5CSF A;  1OOJ A;  1PAL A;  1PVB A;  2G2B A;  3BOW A;  1SCM C;  3TDZ A;  4MN0 A;  1KFU L;  1KK8 C;  1CM4 A;  3KHE A;  4HRH A;  4OKH A;  4A4C A;  4NDB A;  1MF8 B;  4YGD B;  3A4U B;  1LIN A;  1KQM C;  3D10 A;  2ZND A;  3PLF B;  2PSR A;  1DT7 B;  1S36 A;  1Y1X A;  1OMR A;  2BCB A;  1CDN A;  1FF1 A;  2JNX A;  1UHK A;  2KI6 D;  1L7Z A;  1AP4 A;  3EKH A;  1DJZ A;  3NSL A;  1S6J A;  4HRG A;  2KBI A;  3I5G C;  4YI8 A;  3OB1 B;  1DGV A;  2LUX A;  1AHR A;  5IBW A;  1A29 A;  1TIZ A;  3I5I B;  3TZ1 A;  1B8C A;  3EKJ A;  1CDP A;  1Y1U A;  2KFG A;  1TNQ A;  1WY9 A;  3SIB A;  5I8N A;  1XK4 A;  1TOP A;  4WRI A;  3VRN A;  1J7O A;  2JT8 A;  1N2D A;  2ZKM X;  3OB2 B;  5KU1 A;  2L2E A;  1QAT A;  3WHU B;  2BL0 B;  4QJ4 B;  2JRF A;  4DRW A;  3LLE A;  3SJS A;  3BUO B;  4PAL A;  5CPV A;  1JC2 A;  4WQ3 A;  1RK9 A;  4GUK A;  4PHK A;  1A75 B;  5GQQ C;  2JOJ A;  1BT6 A;  4N1F A;  3NXA A;  1WLZ A;  2FCD A;  3BUX B;  2K8M B;  1S5G Z;  3F45 A;  1YUR A;  1GQM A;  1F8H A;  2KFH A;  2KGB C;  2LUC A;  3EK4 A;  1PVA A;  1WRL A;  1BR1 B;  1K8U A;  1QJT A;  1REC A;  2LAP A;  2SAS A;  1EG3 A;  1QX2 A;  5ER5 A;  4QJ5 B;  1FW4 A;  1CLB A;  1TN4 A;  3PN7 B;  2CTN A;  1NP8 A;  3IQO A;  3OX5 A;  2LLT A;  2PRU A;  3LL8 B;  1B4C A;  2H2K A;  3JTD C;  2E6W A;  1NSH A;  2P6B B;  1TTX A;  2BL0 C;  3KF9 A;  3PAL A;  4DS7 A;  4YRU A;  1AVS A;  1KFX S;  1U5I A;  2JTZ A;  4JPZ B;  1CKK A;  1SYM A;  3D0Y B;  2L50 A;  3DF0 B;  3OX6 A;  2M9G A;  4N5X A;  4PHM A;  1M46 A;  1RWY A;  4GGF C;  3ZNI A;  3RM1 A;  1QAS A;  4A4B A;  2K7O A;  5G08 A;  1F4Q A;  3JVT B;  1V1G A;  1IJ5 A;  1NUB A;  2E30 A;  2LMV A;  2LVK A;  1AJ4 A;  3GOF A;  2M3W A;  4XJK A;  2BBN A;  2M7N A;  4CPV A;  2BBM A;  1DJW A;  1KFU S;  2BCX A;  2ZN9 A;  2Y5I A;  4BY4 A;  4ZCU A;  4D1E A;  5D69 A;  2KAY A;  1R2U A;  1BR4 B;  1S3P A;  1FI5 A;  3MSE B;  4P5O E;  5D7F A;  2COL B;  1EL4 A;  2L98 A;  1PK0 D;  1C7V A;  4C0L A;  4MZK A;  4NQG A;  1OE9 B;  2WC8 A;  1J7P A;  1YTZ C;  2WOR A;  1SMG A;  1WDC C;  4C0K A;  3TS5 C;  2LVI A;  1G33 A;  2KOT A;  2K61 A;  1CFD A;  4DIR A;  1EJ3 A;  1BJF A;  2JXC A;  2BE6 A;  2BKH B;  2CCM A;  1IRJ A;  2LV7 A;  1F55 A;  1L2O C;  2PMY A;  1YUS A;  1B7T Z;  3CGA A;  4UPG A;  3CWG A;  3I5H B;  1RJV A;  5BPJ A;  4USL A;  1IJ6 A;  1MR8 A;  1RRO A;  2DOQ A;  2MLF C;  5DKQ A;  3KEV A;  1S6C A;  5FYX A;  1SK6 D;  4GGN A;  4C0J A;  3OP0 A;  1QX5 B;  1JF0 A;  1SR6 B;  2FCE A;  2L4H A;  2I7A A;  3PM8 A;  1K95 A;  2FOT A;  4MSP A;  2LMT A;  1F71 A;  1SL8 A;  2Y1M A;  2M49 B;  1LXF C;  3SG5 A;  1YUU A;  1EXR A;  2JWW A;  1OMD A;  4WQ2 A;  2EC6 B;  4MZL A;  3ICB A;  1HT9 A;  1TNW A;  3TUY B;  4AOM A;  1J55 A;  2ZRS A;  4M2O A;  1R6P A;  1NWD A;  3CTN A;  4MRX A;  2JZI A;  4M2P A;  1SY9 A;  1QIV A;  3OHM B;  3CR5 X;  1JF2 A;  4CID A;  1N65 A;  5KTY A;  1S6I A;  1Y0V H;  2LVV A;  1FI6 A;  2OTG B;  3H4S E;  2AMI A;  1DF0 B;  1F54 A;  1CDL A;  2ZNE A;  1ALW A;  1SNL A;  3VRO A;  1IKU A;  4ETO A;  1UHN A;  1SR6 C;  3PSR A;  1QVI Z;  3O6B A;  1DVI A;  1J7Q A;  1B8L A;  2H61 C;  1K94 A;  2O5G A;  1NPQ A;  2M1K B;  3NSI A;  1CTR A;  2JQ6 A;  1DMO A;  2B1U A;  2ISD A;  4PE7 A;  2EC6 C;  1QV0 A;  1LKJ A;  1RTP 1;  2CBL A;  1ZMZ A;  3FWC A;  3BQ3 A;  4HRE E;  1FBV A;  4ORA B;  4ORC B;  4N1G A;  3M0W A;  1CNP A;  3KO0 A;  1SKT A;  3VGO A;  3VRR A;  2Q4U A;  1MWN A;  4MZJ A;  2JTT A;  2M7L A;  2BEC A;  5AXI A;  4E68 A;  1HQV A;  1MXE A;  1WRZ A;  3HCM A;  2K2A A;  2L4I A;  2OTG C;  1TCF A;  4NDD A;  3I5I C;  1K93 D;  4I5N B;  4PE0 A;  3CS1 A;  2HET A;  1K90 D;  2LC5 A;  2HPS A;  3EVV A;  5JOL A;  1QXP A;  1BF5 A;  4IL1 A;  1DJX A;  1IH0 A;  1J1D A;  2KI4 B;  2H61 A;  1YUT A;  2F8P A;  1TNP A;  2KDH A;  1SPY A;  1K9K A;  1JFK A;  4PE4 A;  2LLU A;  2L5X B;  1TNX A;  2JT0 A;  1UHJ A;  2O60 A;  5B8I B;  2AUC A;  1GJY A;  4MEW A;  1IG5 A;  1K9U A;  1SBJ A;  1JFJ A;  1ZOT B;  2Y1N A;  5J3X A;  2FJU B;  1H4B A;  2PAL A;  3LCP C;  5AFP A;  2KQY A;  2ZFD A;  2KSP A;  4QJ3 B;  5DKN A;  1AUI B;  5CSJ A;  1DJI A;  5HLV A;  4OVN F;  3DVJ A;  1KK7 Y;  1OMV A;  3BOW B;  2PAS A;  2MLE C;  1A4P A;  2JC2 A;  3AKB A;  1B47 A;  4ORB B;  3PN7 C;  2BE4 A;  2HF5 A;  5I2O A;  2K7D A;  1S1E A;  2F3Y A;  1M45 A;  2I2R E;  1NCY A;  2LP2 A;  2QPT A;  3EVR A;  1DJY A;  2KI4 C;  2Q91 A;  1OQP A;  3GK4 X;  5HKZ A;  1CMG A;  1EH2 A;  1A2X A;  3EK8 A;  4OR9 B;  3SG6 A;  2JT3 A;  1SRA A;  2F2O A;  3SG2 A;  2F2P A;  4OV2 A;  1Q80 A;  1NX1 A;  3AAK A;  3LK1 A;  1WRK A;  4GAO A;  3VRQ A;  2LHI A;  1QLS A;  1B7T Y;  1A75 A;  2M0R A;  2GV5 A;  4GGF A;  1BG1 A;  2KYC A;  3O78 A;  4ZCV A;  1BU3 A;  1Y6W A;  3IQQ A;  1GGW A;  2JNF A;  3JVT C;  1MUX A;  2JPT A;  4PE1 A;  3CR4 X;  1MQ1 A;  2EHB A;  2I94 A;  1W7I B;  4I5J A;  3ZWH A;  1XFZ O;  2K7C A;  4NDC A;  1QV1 A;  1YRT B;  4JQ0 D;  3SIA A;  1ALV A;  2NZ0 A;  1BLQ A;  1SCM B;  2AAO A;  5HKW A;  1XFU O;  1CMF A;  1FPW A;  1CDM A;  4GBA A;  1KQM B;  3TDI A;  2JUL A;  1D1O A;  1KWO B;  1CLL A;  1IGV A;  2D8N A;  1OSA A;  2M8U A;  4TNC A;  3NSO A;  4OCI A;  2F3Z A;  2EGD A;  2LNK A;  1ZAC A;  5JJG A;  1B1G A;  5ER4 X;  4I5L B;  3D0Y A;  3DF0 A;  2OPO A;  2CT9 A;  2GGZ A;  3I5G B;  4HSZ A;  1KQV A;  4I5K A;  3AKA A;  2KBM A;  3PFV A;  1ODB A;  4FQO A;  5AEQ A;  3SG4 A;  3CZT X;  1KCY A;  5CSN A;  3DVM A;  2MA2 A;  1NCZ A;  4U8D A;  1IQ3 A;  1J7R A;  1JUO A;  2K0J A;  4FTG A;  1JSA A;  1K9P A;  3CLN A;  1GGZ A;  3EK7 A;  1X02 A;  2KHN A;  4YGE B;  3I5H C;  5HKY A;  1IQ5 A;  1QVI Y;  2WND A;  2K2F A;  2A4J A;  3KPX A;  1CM1 A;  1PSR A;  1ZFS A;  3PAT A;  3DVK A;  1XFW O;  2JXL A;  2HQ8 A;  1U5I B;  1YX8 A;  2NLN A;  1NX3 A;  1M39 A;  2MHH A;  3O2P A;  1NX2 A;  1KWO C;  1LVC D;  1NX0 A;  1XFX O;  4BY5 A;  1XFV O;  1XVJ A;  3VRP A;  2LAN A;  3HX4 A;  3BYA A;  4PHN A;  4GFT A;  3A8R A;  1S5G Y;  2KGR A;  4XJK B;  3E3R A;  2JU0 A;  2KI6 C;  2NCP A;  1ZUZ A;  1UP5 A;  2WOS A;  3TUY C;  1OZS A;  1DJH A;  2OS8 B;  5HLO A;  1VRK A;  2KQ6 A;  1Y1A A;  3GK1 A;  3JTD B;  1SCV A;  5KSZ A;  3BUN B;  1JWD A;  4ICB A;  2F33 A;  3BUW B;  4DUQ A;  2LLS A;  2ZN8 A;  1KSO A;  4Q04 A;  1SL7 A;  2LP3 A;  4PHJ A;  2VRG A;  1K96 A;  4CFR A;  1TCO B;  1UHH A;  1B9A A;  3C1V A;  1AK8 A;  4M2Q A;  1OZO A;  3DVE A;  2KFF A;  5CSI A;  2WCF A;  1QLK A;  1CB1 A;  1EG4 A;  2LM5 A;  2NCO A;  2M97 A;  3BXK A;  5TNC A;  4F0Z B;  3IF7 A;  3GK2 A;  4XYN A;  3I5F B;  3LK0 A;  2KAX A;  2ZRT A;  3FIA A;  1F70 A;  3BUM B;  1QX7 A;  3O4Y A;  1MXL C;  1RFJ A;  4MBE A;  3WXA A;  4R1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...