4PCWA

Crystal structure of the n-terminal domain of human profilaggrin at 2.2 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
b'STLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMVFKLAQAYYES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filaggrin
publication title Crystal Structure of Human Profilaggrin S100 Domain and Identification of Target Proteins Annexin II, Stratifin, and HSP27.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pcwA00
4PALA 4Q04A 2LAPA 2I7AA 4A4BA 1S5GY 2KYCA 3CGAA 2NXQA 4ZCVA 3OHMB 2LHLA 2LVIA 4YGCB 5ER5A 4PE0A 2DOQA 1J55A 1OZOA 1U5IA 1CFFA 1J7RA 1CDPA 1QVIZ 3F45A 2LCPA 3PN7C 1FI6A 1S26D 4CFQA 1QX5B 4C0JA 4GGFC 2IS9A 2F2OA 5IBWA 5CPVA 2LANA 5JOLA 1SYMA 3KO0A 2MHHA 2PRUA 4FQOA 4WQ3A 3PLFB 1S6JA 4TNCA 5I2QA 4YRUA 1BOCA 1MHOA 4MVFA 5HLVA 3CLNA 3OP0A 3FWBA 1IWQA 1XVJA 2KSPA 1G4YR 1SMGA 4R1EA 4DCKA 1AHRA 1Q80A 1M46A 1N65A 2JWWA 2CNPA 2JZIA 3IQOA 3LK0A 4QJ4B 4OV2A 1CDMA 1ZOTB 2JOJA 5DKNA 4E68A 5TNCA 3SG4A 2KFFA 1CFCA 1IRJA 5AEQA 1GGZA 2Y4QA 2KI4C 1F71A 1PSBA 1MUXA 1OMRA 1DMOA 1MF8B 1KK8C 1AJ4A 1VRKA 3AKBA 3BOWA 1YVHA 1S6IA 1UUSA 2M0RA 5CSFA 2WCEA 1QASA 1SY9A 1KSOA 3ICBA 4U8DA 1SNLA 2KQYA 1UWOA 4ZCUA 1J7QA 1EG4A 2I2RE 1DF0B 1B4CA 1ZUZA 1CM1A 3SIAA 4ORCB 1BODA 3BUOB 2HF5A 2LVJA 2KNEA 1HQVA 1TTXA 3I5GC 3VGOA 5ER4X 2OS8C 4CPVA 3I5FB 5HKWA 4F0ZB 2ZN9A 4GGNA 1IKUA 5HKZA 2LLUA 2LVVA 2PSRA 1LKJA 2BL0C 1CLLA 3WNXB 3CR5X 2LUCA 2I94A 1OE9B 1QXPA 3CR4X 3GOFA 4MZKA 5I2LA 2GGMA 4HSZA 3VRNA 3NSKA 3EVUA 1AVSA 1QLSA 1QIWA 1CB1A 1QIVA 4I5KA 4I5NB 3EVRA 1A75A 1IGVA 1SBJA 1BU3A 3NSOA 3OX5A 1F54A 1DJWA 4PCWA 4N1GA 2OPOA 1GQMA 4MZJA 3DF0B 1J1EA 1YUSA 4ORBB 1UHIA 5DKRA 3BUXB 2KFHA 2OTGB 2M1KB 4C0LA 2LNKA 3NSLA 1PVBA 1H8BA 1HT9A 2KI6C 1F55A 2G9BA 2Y5IA 1RJVA 1UHKA 5I2OA 1BLQA 1AJ5A 5KSZA 3FS7A 1CNPA 4PHJA 1KK7Y 2BECA 1CKKA 3IQQA 4QJ3B 2LLSA 1K8UA 1XFXO 1XYDA 1MR8A 2K7DA 4N5XA 1UHNA 2COLB 2KI6D 3I5HB 1XFVO 4DUQA 2M9GA 1JF2A 2ZNDA 1UURA 3IF7A 1IH0A 1KQVA 2H2KA 2D8NA 4AOMA 1KQMC 2BKHB 1L2OB 2JRFA 4D1EA 3AAKA 1CMFA 1RWYA 1KSMA 1SRAA 1TRFA 1K90D 3TS5B 2KYFA 1NX0A 3H4SE 1AP4A 1B8RA 2M97A 1J7OA 5G08A 1YUUA 4CFRA 4DIRA 2K2AA 4MN0A 1PRWA 1QATA 4NDBA 4HREE 3D0YA 1A03A 1DJIA 2SASA 1SPYA 1DTLA 2RGIA 4MEWA 3VRPA 2LMUA 4C0KA 1C7VA 2JTZA 3JTDB 2L98A 3DVKA 3O78A 4PHKA 1YX7A 1KWOB 2HETA 2JQ6A 4CIDA 1FW4A 5I8NA 1J7PA 1SCMC 3MSEB 2MAZA 1CDNA 5B8IB 2EC6B 2M8UA 3VRQA 1IQ3A 1B7TZ 2L4IA 1TNXA 1JBAA 1WDCC 1R6PA 3I5IC 1U5IB 1CLBA 3SG5A 2R2IA 1EG3A 2HPSA 1NCYA 3ZNIA 2I18A 1SK6D 3TDIA 1F70A 1M63B 2ISDA 1A29A 1D1OA 2VRGA 4MBEA 2MBXA 4P2YB 3TDUA 1XFWO 1B1GA 1M39A 3AAJA 2L5XB 3A8RA 2PMYA 4YI9A 1AK8A 1Y1XA 4OR9B 5AFPA 3GK4X 1DJHA 3JVTB 3OX6A 1DGUA 4NQGA 4M2PA 1XA5A 1DJYA 1DVIA 2LP2A 3DVJA 1M31A 1OSAA 1S5GZ 3C1VA 1S6CA 2PALA 5J3XA 1PULA 3TUYB 1XFZO 5FYXA 1CFDA 1TIZA 1TNPA 2KDHA 3OB2B 2KHNA 3BYAA 4YGAA 1CLMA 1RTP1 4ORAB 1K95A 1K9UA 1TNQA 2F3ZA 1IG5A 1LVCD 2MLEC 4MRXA 1MXLC 2FJUB 2V53A 4A4CA 1KCYA 4GFTA 4OVNF 4NDDA 1J1DA 1LXFC 1BF5A 2MLFC 1LINA 1XFUO 1JF0A 2CBLA 1JC2A 4PE7A 1CDLA 5KTYA 1WRKA 2B1UA 2BCAA 3NSIA 4M2OA 2FCDA 1NIWA 2KAVA 3RM1A 3BUNB 2F8PA 1TOPA 1NUBA 4N1FA 1UHHA 2LHIA 1MWNA 2AUCA 5K89A 2L2EA 2BBMA 2KBMA 5D69A 1EJ3A 1JFKA 2Y1MA 2M7LA 1WLMA 2NCOA 4XYNA 1LA0A 1OZSA 3TDZA 1K94A 3EVVA 1SR6B 1TCFA 4AQIA 1QV1A 1JSAA 2WCFA 3VRRA 2LUXA 3AKAA 1ZMZA 2NCPA 4UPGA 1RK9A 2JC2A 5DKQA 2HQ8A 1W7JB 1NX1A 2M49B 2LMTA 2L0PA 3LLEA 1PSRA 3KHEA 5BPJA 1QS7A 4BY5A 5KU1A 3I5FC 4XJKA 4PDZA 1BR4B 1YRTB 2F3YA 2K7BA 2O5GA 3EKHA 1ODBA 1QLKA 3BUMB 2JULA 3CWGA 4BY4A 4L9MA 3ZWHA 2KFGA 5AXIA 1FI5A 1UHJA 3DVEA 4JWQA 1JUOA 1YVLA 2JT3A 4JPZB 1M45A 1UP5A 3OB1B 4AQJA 1L7ZA 2LMVA 4DRWA 2H61C 2ZRTA 1F8HA 2ZN8A 3O2PA 1QX2A 2CXJA 1Y1UA 4YGBB 1KFXL 1NSHA 2WNDA 1YURA 2QPTA 1C7WA 3PFVA 3PN7B 1CFPA 2KAYA 2M29A 1WY9A 1EXRA 1NCXA 2FOTA 1OMDA 3SG3A 2Q91A 2BKIB 2WC8A 4ETOA 3FWCA 2LV7A 2BE6A 2K7CA 3VROA 2K61A 2WCBA 1CTRA 4M2QA 5F6TA 1JFJA 1MQ1A 1G8IA 1SL8A 2MJWB 2LM5A 4YGEB 3D0YB 1Y1AA 3I5HC 2BE4A 4HRHA 4QJ5B 3WHTB 4IL1A 1WRZA 1C07A 1KK7Z 1L2OC 2CCMA 4FTGA 1CM4A 3SIBA 3TS5C 3TZ1A 1S3PA 2CT9A 2LLTA 1R2UA 1IJ6A 4YBHB 2E30A 1AUIB 1PK0D 2PASA 5HYDA 1XFYO 5AANA 2M7NA 2PVBA 2KI4B 3NXAA 5CSNA 3GK2A 2L51A 3CR2A 3WHUB 4OCIA 1H4BA 2JTTA 2KQ6A 4MZLA 2G2BA 1E8AA 1A4PA 5D7FA 1B8LA 1BMOA 1KK8B 3JTDC 3LCPC 1V1FA 1ZACA 3O4YA 1MXEA 4GUKA 1KWOC 2F33A 2K0JA 1NX3A 2JU0A 3HX4A 3EK7A 1SKTA 1DJZA 2AMIA 3SJSA 1XO5A 1QV0A 2WORA 4YGDB 1F4QA 2EC6C 3O6BA 2E6WA 1B9AA 2JXLA 2ZFDA 1YUTA 1WLZA 4HRGA 3SG2A 1CMGA 1IJ5A 1NP8A 2JT0A 1DT7B 2CTNA 1NWDA 3LL8B 4WRIA 5GQQC 3I5GB 3EKJA 3K21A 1KFUL 2OS8B 3WXAA 1S36A 1DJGA 1Y0VH 2AAOA 1ZFSA 3BOWB 1OQPA 3HCMA 1QX7A 2BL0B 3QRXA 2KAXA 2MRDA 3BQ3A 2HQWA 1DF0A 2Q4UA 4P5OE 1X02A 2EHBA 2GGZA 4NDCA 1GJYA 2JPTA 4MLWA 4DS7A 2BCXA 3JVTC 1SL7A 2EGDA 1K96A 3BUWB 2F2PA 1SCVA 1KFXS 1QJTA 3GK1A 2JNXA 4YI8A 3FIAA 2GV5A 5CSIA 2JXCA 3SG7A 4USLA 2ZNEA 1FBVA 4ICBA 1S1EA 2ZRSA 4WQ2A 3D10A 1YX8A 1G33A 3A4UB 1SL9A 3TUYC 2O60A 4PHNA 2NLNA 1WRLA 3KF9A 1K2HA 4GBAA 1TN4A 3DD4A 4GAOA 1XK4A 2LC5A 2K8MB 1FPWA 2K7OA 1QTXA 1N2DA 1NPQA 5CSJA 2MA2A 2K2FA 5HLOA 1OMVA 1W7IB 2KOTA 2H61A 2KGRA 2QACA 3DF0A 2Y1NA 1A75B 1BT6A 3LK1A 2M3WA 1LA3A 3KPXA 3M0WA 5HKYA 2JT8A 1ALVA 2P6BB 3EK8A 1PALA 1TNWA 3EK4A 4PE1A 3SG6A 1KQMB 4PE4A 4CLNA 1V1GA 1XK4C 1GGWA 2ZKMX 1QVIY 2LVKA 3PALA 2KBIA 2BCBA 3KEVA 2JNFA 4XJKB 1SR6C 3PATA 1SW8A 4PHMA 4GPLB 1PVAA 2M1UA 1N0YA 2TN4A 3CZTX 4GNKB 3BXKA 2KGBC 1RECA 1B7TY 3CTNA 1RFJA 4MSPA 2OTGC 2WOSA 4I5JA 1EH2A 1JWDA 1ALWA 1K9PA 1B47A 1BJFA 1K9KA 2NZ0A 2FCEA 1F4OA 2A4JA 1BR1B 1SCMB 1EL4A 2SCPA 1YTZC 1B8CA 1YRUB 1DGVA 3CS1A 5JJGA 1NYAA 1Y6WA 1YR5A 2LE9B 1KFUS 3PM8A 1OOJA 3E3RA 4MRYA 2LP3A 1WDCB 1FF1A 3PSRA 2L50A 3I5IB 4GGFA 1RROA 1A2XA 1NCZA 3DVMA 1NX2A 1TCOB 1BG1A 1IQ5A 5AERA 2BBNA 2L4HA 3RLZA 4I5LB 1DJXA 1K93D 4OKHA 4JQ0D 5PALA
chains in the Genus database with same CATH superfamily
4PALA 4Q04A 2LAPA 2I7AA 4A4BA 1S5GY 2KYCA 3CGAA 2NXQA 4ZCVA 3OHMB 2LHLA 2LVIA 4YGCB 5ER5A 3EG5B 4PE0A 2DOQA 2QEHA 1J55A 1OZOA 1U5IA 1CFFA 1J7RA 1CDPA 1QVIZ 3F45A 2LCPA 3PN7C 1FI6A 1S26D 4CFQA 1QX5B 4C0JA 3B7AA 4GGFC 2IS9A 3NHIA 2F2OA 5I94A 5IBWA 5CPVA 2LANA 5JOLA 1SYMA 3KO0A 2MHHA 2PRUA 4FQOA 4WQ3A 3PLFB 1S6JA 4TNCA 5I2QA 4YRUA 1BOCA 1MHOA 4MVFA 3S0DA 1OW4A 5HLVA 3CLNA 3OP0A 3FWBA 1IWQA 1XVJA 2KSPA 1G4YR 3B6XA 1P28A 1SMGA 1OOIX 4R1EA 1AHRA 4DCKA 1Q80A 1M46A 1N65A 3Q8IA 3FE8A 2JWWA 2CNPA 2JZIA 3IQOA 3LK0A 4QJ4B 4OV2A 1CDMA 1ZOTB 2JOJA 5DKNA 4E68A 5TNCA 3SG4A 1W9ZA 2KFFA 1CFCA 1IRJA 5AEQA 1GGZA 2Y4QA 2KI4C 1F71A 1PSBA 1MUXA 1OMRA 1DMOA 3CZ0A 1MF8B 1KK8C 1AJ4A 1OOFA 1VRKA 3AKBA 3BOWA 1YVHA 1S6IA 3BFHA 2K60A 1UUSA 2M0RA 5CSFA 2WCEA 1QASA 1SY9A 1KSOA 3ICBA 4U8DA 1SNLA 3CABA 2KQYA 1UWOA 4ZCUA 1J7QA 1EG4A 3B87A 3BJHA 2I2RE 1DF0B 2P71A 4IJ7A 1B4CA 3CZ2A 1ZUZA 1CM1A 3SIAA 4ORCB 1BODA 3BUOB 2HF5A 2LVJA 2KNEA 1HQVA 3O4XA 1TTXA 3I5GC 3VGOA 5ER4X 2OS8C 4CPVA 3I5FB 5HKWA 4F0ZB 2ZN9A 3R1OA 4GGNA 1IKUA 5HKZA 2LLUA 2LVVA 2PSRA 1LKJA 2BL0C 1CLLA 3WNXB 3CR5X 2LUCA 2I94A 1OE9B 1QXPA 3CR4X 3GOFA 4MZKA 5I2LA 2GGMA 4HSZA 3VRNA 3NSKA 3EVUA 4JD9A 3SS3A 3DXLA 1AVSA 1QLSA 5FI7A 1QIWA 1CB1A 1QIVA 4I5KA 4I5NB 3EVRA 1A75A 1IGVA 1SBJA 1BU3A 3NSOA 3OX5A 1F54A 1DJWA 4PCWA 4N1GA 2OPOA 1GQMA 4MZJA 5HL1A 3DF0B 1J1EA 1YUSA 4ORBB 1UHIA 5DKRA 3BUXB 2KFHA 2OTGB 2M1KB 4C0LA 2LNKA 3NSLA 1PVBA 1H8BA 1HT9A 2KI6C 1F55A 2G9BA 1OOHA 1RJVA 1UHKA 2Y5IA 5I2OA 1BLQA 4INXA 1AJ5A 5KSZA 3FS7A 1DC1A 1CNPA 4PHJA 1KK7Y 2BECA 1CKKA 2WCHA 3IQQA 4QJ3B 2LLSA 2L5YA 1K8UA 1XFXO 1XYDA 1MR8A 2K7DA 4N5XA 1UHNA 3PJIA 2COLB 2KI6D 2BNXA 3I5HB 1XFVO 3FE6A 4DUQA 2M9GA 1JF2A 2ZNDA 1UURA 3IF7A 1IH0A 1KQVA 2H2KA 2D8NA 4AOMA 1KQMC 2BKHB 1L2OB 2JRFA 4D1EA 3AAKA 1CMFA 1RWYA 1KSMA 1SRAA 1TRFA 1K90D 2P70A 3TS5B 2KYFA 1NX0A 3H4SE 1AP4A 1B8RA 2M97A 1J7OA 5G08A 4OZDA 1YUUA 4CFRA 4DIRA 2K2AA 4MN0A 1PRWA 1QATA 4NDBA 4HREE 3D0YA 1A03A 1DJIA 2SASA 1SPYA 1DTLA 2RGIA 4MEWA 3VRPA 2LMUA 3QMEA 4C0KA 2JTZA 1C7VA 3JTDB 2L98A 3DVKA 3O78A 2L2CA 4PHKA 1YX7A 3SS4A 1KWOB 2HETA 2JQ6A 3SS5A 1FW4A 4CIDA 5I8NA 1J7PA 1SCMC 2H8VA 3MSEB 2MAZA 4KYNA 1DQEA 1CDNA 5B8IB 2EC6B 2M8UA 3VRQA 1IQ3A 1B7TZ 2L4IA 1TNXA 1JBAA 1WDCC 1R6PA 3I5IC 1U5IB 1CLBA 3SG5A 2R2IA 1EG3A 2HPSA 1NCYA 4FQTA 1QWVA 3ZNIA 2I18A 1SK6D 3TDIA 1F70A 2ERBA 1M63B 2ISDA 1LS8A 3L4LA 1A29A 2WCKA 1XFRA 5D3OA 1D1OA 2VRGA 4MBEA 2MBXA 4P2YB 3TDUA 1XFWO 1B1GA 1M39A 3AAJA 3V2LA 1C3ZA 2L5XB 3A8RA 2PMYA 4YI9A 1AK8A 2WCMA 3IVTA 1Y1XA 4OR9B 5AFPA 3GK4X 1DJHA 3JVTB 3OX6A 1DGUA 4NQGA 3NGVA 4M2PA 1XA5A 3CZ1A 1DJYA 1DVIA 2LP2A 3DVJA 1M31A 1OSAA 1S5GZ 3CDNA 3C1VA 1S6CA 3D74A 2PALA 3OBVA 5J3XA 1PULA 3TUYB 2WC6A 3D78A 1XFZO 5FYXA 1CFDA 1TIZA 1TNPA 2KDHA 3OB2B 2KHNA 3BYAA 4YGAA 1CLMA 1RTP1 4ORAB 1K95A 1K9UA 1TNQA 2F3ZA 1IG5A 1LVCD 2MLEC 4MRXA 1MXLC 2FJUB 2V53A 4PT1A 1DEKA 4A4CA 1KCYA 4GFTA 4F7FA 4OVNF 2JPOA 4NDDA 1J1DA 1LXFC 1BF5A 2MLFC 1LINA 1XFUO 2KLDA 1JF0A 2CBLA 3DY9A 4PE7A 1CDLA 5KTYA 1WRKA 2B1UA 2BCAA 3NSIA 4M2OA 1JC2A 2FCDA 1NIWA 2KAVA 3RM1A 3CYZA 3BUNB 2F8PA 1TOPA 2QEOA 1NUBA 4N1FA 1UHHA 2LHIA 1MWNA 2AUCA 5K89A 2L2EA 2BBMA 2KBMA 5D69A 1EJ3A 1JFKA 2Y1MA 2M7LA 1WLMA 2NCOA 4XYNA 1LA0A 1OZSA 3TDZA 1K94A 3EVVA 1SR6B 1TCFA 4AQIA 2FJYA 3D76A 1QV1A 1JSAA 2WCFA 3VRRA 2LUXA 3AKAA 1ZMZA 2NCPA 4UPGA 1RK9A 2JC2A 5DKQA 2HQ8A 2QEBA 3B86A 2KLEA 1W7JB 1NX1A 2M49B 2LMTA 2L0PA 3LLEA 1PSRA 3KHEA 5BPJA 1QS7A 4BY5A 5FI2A 5KU1A 3I5FC 4XJKA 4PDZA 1BR4B 1YRTB 2F3YA 2K7BA 2O5GA 3EKHA 1ODBA 1QLKA 3BUMB 2JULA 5FI6A 3CWGA 4BY4A 1DELA 4L9MA 3ZWHA 2KFGA 5AXIA 1FI5A 1UHJA 3DVEA 4JWQA 1JUOA 1YVLA 2JT3A 1TUJA 4JPZB 1M45A 1UP5A 3OB1B 4AQJA 1L7ZA 2LMVA 4DRWA 2H61C 2ZRTA 1F8HA 2ZN8A 3O2PA 1QX2A 2CXJA 3PM2A 1Y1UA 4YGBB 1KFXL 1NSHA 2WNDA 1YURA 2QPTA 1C7WA 3PFVA 3PN7B 1CFPA 2KAYA 2M29A 1WY9A 1EXRA 1NCXA 2FOTA 1OMDA 3SG3A 2Q91A 2BKIB 2WC8A 1TWOA 3FWCA 4ETOA 2LV7A 2BE6A 2K7CA 3VROA 1OOGA 2K61A 2KPHA 2WCBA 1CTRA 4M2QA 5F6TA 1JFJA 1MQ1A 1G8IA 1SL8A 2MJWB 2LM5A 2WC5A 4YGEB 3D0YB 1Y1AA 3I5HC 2BE4A 2QEVA 4HRHA 4QJ5B 2QDIA 3WHTB 4IL1A 1WRZA 3OGNA 1C07A 1KK7Z 1T14A 1L2OC 2CCMA 4FTGA 1CM4A 2PQLA 3SIBA 3TS5C 3K1EA 3TZ1A 1S3PA 2CT9A 2LLTA 1R2UA 1IJ6A 4YBHB 2E30A 1AUIB 3S0EA 1PK0D 2PASA 5EL2A 5HYDA 1XFYO 5AANA 2M7NA 2PVBA 2KI4B 3NXAA 5CSNA 3GK2A 1Z2CB 2L51A 3CR2A 3WHUB 3UNWA 4OCIA 1H4BA 2JTTA 2KQ6A 4MZLA 2G2BA 1E8AA 1A4PA 5D7FA 1B8LA 1BMOA 1KK8B 3JTDC 3LCPC 1V1FA 1ZACA 3O4YA 1MXEA 4GUKA 1KWOC 2F33A 2K0JA 1NX3A 2JU0A 3HX4A 3EK7A 3R1PA 1SKTA 1DJZA 2AMIA 3SJSA 1XO5A 1QV0A 2WORA 4YGDB 1F4QA 3B88A 2EC6C 3O6BA 2E6WA 1B9AA 3S0AA 2JXLA 2ZFDA 1YUTA 1WLZA 4HRGA 3SG2A 1CMGA 1IJ5A 1NP8A 2JT0A 1DT7B 2CTNA 1NWDA 3LL8B 3D73A 4WRIA 5GQQC 3I5GB 3EKJA 3K21A 3S0BA 1KFUL 2OS8B 4INWA 3WXAA 1S36A 1DJGA 1Y0VH 3BFAA 2AAOA 1ZFSA 3BOWB 2WCLA 3L4AA 1OQPA 3HCMA 1QX7A 2BL0B 3QRXA 2BAPA 2KAXA 2MRDA 3BQ3A 2HQWA 1DF0A 2Q4UA 4P5OE 1X02A 2EHBA 2GGZA 4NDCA 1GJYA 2JPTA 4MLWA 4DS7A 2BCXA 3JVTC 1SL7A 2EGDA 1K96A 3BUWB 2F2PA 1SCVA 1KFXS 1QJTA 3GK1A 2JNXA 3N7HA 4YI8A 5DICA 3FIAA 2GV5A 5CSIA 2JXCA 3SG7A 3VB1A 4USLA 2ZNEA 1FBVA 4ICBA 3S0GA 1S1EA 1TUZA 2ZRSA 4WQ2A 3D10A 1YX8A 1G33A 3A4UB 1SL9A 4JKTA 3TUYC 2O60A 4PHNA 2NLNA 1WRLA 3KF9A 1K2HA 4GBAA 1TN4A 3DD4A 1GM0A 3D75A 4GAOA 1XK4A 2LC5A 2K8MB 1FPWA 2GTEA 2YGUA 3R72A 2K7OA 1QTXA 1N2DA 1NPQA 1SSEB 2MA2A 3DYEA 3NHTA 5CSJA 2K2FA 5HLOA 1OMVA 1W7IB 2KOTA 2H61A 2KGRA 2QACA 3DF0A 2Y1NA 1A75B 1BT6A 3LK1A 1IIOA 3UO9A 2M3WA 1LA3A 3KPXA 3M0WA 5HKYA 2JT8A 3DZTA 1ALVA 2P6BB 3EK8A 1PALA 1TNWA 3EK4A 4PE1A 1Z4HA 3SG6A 1KQMB 4PE4A 4CLNA 1V1GA 1XK4C 1GGWA 2ZKMX 1QVIY 2LVKA 3PALA 2KBIA 2BCBA 3KEVA 2JNFA 3FE9A 4XJKB 1SR6C 3RZSA 3PATA 1SW8A 1C3YA 4PHMA 4GPLB 1PVAA 2M1UA 1N0YA 1ORGA 2PYQA 2TN4A 3BXKA 2KGBC 3CZTX 1RECA 1B7TY 3CTNA 1RFJA 4GNKB 4MSPA 2OTGC 2WOSA 4I5JA 3S0FA 1EH2A 1ALWA 3L47A 1JWDA 1K9PA 2WCJA 1B47A 1BJFA 1K9KA 2NZ0A 2FCEA 1F4OA 2A4JA 3BFBA 1BR1B 1SCMB 1EL4A 2SCPA 1YTZC 1B8CA 1YRUB 1DGVA 3CS1A 5JJGA 1NYAA 1Y6WA 1YR5A 2LE9B 1KFUS 3PM8A 1OOJA 3D77A 3E3RA 4MRYA 2LP3A 1WDCB 1FF1A 3PSRA 2L50A 3I5IB 4GGFA 1RROA 1A2XA 1NCZA 3DVMA 1NX2A 3R1VA 1TCOB 1BG1A 1IQ5A 5AERA 2BBNA 2L4HA 3RLZA 4I5LB 1DJXA 1K93D 4OKHA 4JQ0D 5PALA
chains in the Genus database with same CATH topology
4PALA 4Q04A 2LAPA 2I7AA 4A4BA 1S5GY 2KYCA 3CGAA 2NXQA 4ZCVA 3OHMB 2LHLA 2LVIA 4YGCB 5ER5A 4PE0A 2DOQA 1J55A 1OZOA 1U5IA 1CFFA 1J7RA 1CDPA 1QVIZ 3F45A 2LCPA 3PN7C 1FI6A 1S26D 4CFQA 1QX5B 4C0JA 4GGFC 2IS9A 2F2OA 5IBWA 5CPVA 2LANA 5JOLA 1SYMA 3KO0A 2MHHA 2PRUA 4FQOA 4WQ3A 3PLFB 1S6JA 4TNCA 5I2QA 4YRUA 1BOCA 1MHOA 4MVFA 5HLVA 3CLNA 3OP0A 3FWBA 1IWQA 1XVJA 2KSPA 1G4YR 1SMGA 4R1EA 4DCKA 1AHRA 1Q80A 1M46A 1N65A 2JWWA 2CNPA 2JZIA 3IQOA 3LK0A 4QJ4B 4OV2A 1CDMA 1ZOTB 2JOJA 5DKNA 4E68A 5TNCA 3SG4A 2KFFA 1CFCA 1IRJA 5AEQA 1GGZA 2Y4QA 2KI4C 1F71A 1PSBA 1MUXA 1OMRA 1DMOA 1MF8B 1KK8C 1AJ4A 1VRKA 3AKBA 3BOWA 1YVHA 1S6IA 1UUSA 2M0RA 5CSFA 2WCEA 1QASA 1SY9A 1KSOA 3ICBA 4U8DA 1SNLA 2KQYA 1UWOA 4ZCUA 1J7QA 1EG4A 2I2RE 1DF0B 1B4CA 1ZUZA 1CM1A 3SIAA 4ORCB 1BODA 3BUOB 2HF5A 2LVJA 2KNEA 1HQVA 1TTXA 3I5GC 3VGOA 5ER4X 2OS8C 4CPVA 3I5FB 5HKWA 4F0ZB 2ZN9A 4GGNA 1IKUA 5HKZA 2LLUA 2LVVA 2PSRA 1LKJA 2BL0C 1CLLA 3WNXB 3CR5X 2LUCA 2I94A 1OE9B 1QXPA 3CR4X 3GOFA 4MZKA 5I2LA 2GGMA 4HSZA 3VRNA 3NSKA 3EVUA 1AVSA 1QLSA 1QIWA 1CB1A 1QIVA 4I5KA 4I5NB 3EVRA 1A75A 1IGVA 1SBJA 1BU3A 3NSOA 3OX5A 1F54A 1DJWA 4PCWA 4N1GA 2OPOA 1GQMA 4MZJA 3DF0B 1J1EA 1YUSA 4ORBB 1UHIA 5DKRA 3BUXB 2KFHA 2OTGB 2M1KB 4C0LA 2LNKA 3NSLA 1PVBA 1H8BA 1HT9A 2KI6C 1F55A 2G9BA 2Y5IA 1RJVA 1UHKA 5I2OA 1BLQA 1AJ5A 5KSZA 3FS7A 1CNPA 4PHJA 1KK7Y 2BECA 1CKKA 3IQQA 4QJ3B 2LLSA 1K8UA 1XFXO 1XYDA 1MR8A 2K7DA 4N5XA 1UHNA 2COLB 2KI6D 3I5HB 1XFVO 4DUQA 2M9GA 1JF2A 2ZNDA 1UURA 3IF7A 1IH0A 1KQVA 2H2KA 2D8NA 4AOMA 1KQMC 2BKHB 1L2OB 2JRFA 4D1EA 3AAKA 1CMFA 1RWYA 1KSMA 1SRAA 1TRFA 1K90D 3TS5B 2KYFA 1NX0A 3H4SE 1AP4A 1B8RA 2M97A 1J7OA 5G08A 1YUUA 4CFRA 4DIRA 2K2AA 4MN0A 1PRWA 1QATA 4NDBA 4HREE 3D0YA 1A03A 1DJIA 2SASA 1SPYA 1DTLA 2RGIA 4MEWA 3VRPA 2LMUA 4C0KA 1C7VA 2JTZA 3JTDB 2L98A 3DVKA 3O78A 4PHKA 1YX7A 1KWOB 2HETA 2JQ6A 4CIDA 1FW4A 5I8NA 1J7PA 1SCMC 3MSEB 2MAZA 1CDNA 5B8IB 2EC6B 2M8UA 3VRQA 1IQ3A 1B7TZ 2L4IA 1TNXA 1JBAA 1WDCC 1R6PA 3I5IC 1U5IB 1CLBA 3SG5A 2R2IA 1EG3A 2HPSA 1NCYA 3ZNIA 2I18A 1SK6D 3TDIA 1F70A 1M63B 2ISDA 1A29A 1D1OA 2VRGA 4MBEA 2MBXA 4P2YB 3TDUA 1XFWO 1B1GA 1M39A 3AAJA 2L5XB 3A8RA 2PMYA 4YI9A 1AK8A 1Y1XA 4OR9B 5AFPA 3GK4X 1DJHA 3JVTB 3OX6A 1DGUA 4NQGA 4M2PA 1XA5A 1DJYA 1DVIA 2LP2A 3DVJA 1M31A 1OSAA 1S5GZ 3C1VA 1S6CA 2PALA 5J3XA 1PULA 3TUYB 1XFZO 5FYXA 1CFDA 1TIZA 1TNPA 2KDHA 3OB2B 2KHNA 3BYAA 4YGAA 1CLMA 1RTP1 4ORAB 1K95A 1K9UA 1TNQA 2F3ZA 1IG5A 1LVCD 2MLEC 4MRXA 1MXLC 2FJUB 2V53A 4A4CA 1KCYA 4GFTA 4OVNF 4NDDA 1J1DA 1LXFC 1BF5A 2MLFC 1LINA 1XFUO 1JF0A 2CBLA 1JC2A 4PE7A 1CDLA 5KTYA 1WRKA 2B1UA 2BCAA 3NSIA 4M2OA 2FCDA 1NIWA 2KAVA 3RM1A 3BUNB 2F8PA 1TOPA 1NUBA 4N1FA 1UHHA 2LHIA 1MWNA 2AUCA 5K89A 2L2EA 2BBMA 2KBMA 5D69A 1EJ3A 1JFKA 2Y1MA 2M7LA 1WLMA 2NCOA 4XYNA 1LA0A 1OZSA 3TDZA 1K94A 3EVVA 1SR6B 1TCFA 4AQIA 1QV1A 1JSAA 2WCFA 3VRRA 2LUXA 3AKAA 1ZMZA 2NCPA 4UPGA 1RK9A 2JC2A 5DKQA 2HQ8A 1W7JB 1NX1A 2M49B 2LMTA 2L0PA 3LLEA 1PSRA 3KHEA 5BPJA 1QS7A 4BY5A 5KU1A 3I5FC 4XJKA 4PDZA 1BR4B 1YRTB 2F3YA 2K7BA 2O5GA 3EKHA 1ODBA 1QLKA 3BUMB 2JULA 3CWGA 4BY4A 4L9MA 3ZWHA 2KFGA 5AXIA 1FI5A 1UHJA 3DVEA 4JWQA 1JUOA 1YVLA 2JT3A 4JPZB 1M45A 1UP5A 3OB1B 4AQJA 1L7ZA 2LMVA 4DRWA 2H61C 2ZRTA 1F8HA 2ZN8A 3O2PA 1QX2A 2CXJA 1Y1UA 4YGBB 1KFXL 1NSHA 2WNDA 1YURA 2QPTA 1C7WA 3PFVA 3PN7B 1CFPA 2KAYA 2M29A 1WY9A 1EXRA 1NCXA 2FOTA 1OMDA 3SG3A 2Q91A 2BKIB 2WC8A 4ETOA 3FWCA 2LV7A 2BE6A 2K7CA 3VROA 2K61A 2WCBA 1CTRA 4M2QA 5F6TA 1JFJA 1MQ1A 1G8IA 1SL8A 2MJWB 2LM5A 4YGEB 3D0YB 1Y1AA 3I5HC 2BE4A 4HRHA 4QJ5B 3WHTB 4IL1A 1WRZA 1C07A 1KK7Z 1L2OC 2CCMA 4FTGA 1CM4A 3SIBA 3TS5C 3TZ1A 1S3PA 2CT9A 2LLTA 1R2UA 1IJ6A 4YBHB 2E30A 1AUIB 1PK0D 2PASA 5HYDA 1XFYO 5AANA 2M7NA 2PVBA 2KI4B 3NXAA 5CSNA 3GK2A 2L51A 3CR2A 3WHUB 4OCIA 1H4BA 2JTTA 2KQ6A 4MZLA 2G2BA 1E8AA 1A4PA 5D7FA 1B8LA 1BMOA 1KK8B 3JTDC 3LCPC 1V1FA 1ZACA 3O4YA 1MXEA 4GUKA 1KWOC 2F33A 2K0JA 1NX3A 2JU0A 3HX4A 3EK7A 1SKTA 1DJZA 2AMIA 3SJSA 1XO5A 1QV0A 2WORA 4YGDB 1F4QA 2EC6C 3O6BA 2E6WA 1B9AA 2JXLA 2ZFDA 1YUTA 1WLZA 4HRGA 3SG2A 1CMGA 1IJ5A 1NP8A 2JT0A 1DT7B 2CTNA 1NWDA 3LL8B 4WRIA 5GQQC 3I5GB 3EKJA 3K21A 1KFUL 2OS8B 3WXAA 1S36A 1DJGA 1Y0VH 2AAOA 1ZFSA 3BOWB 1OQPA 3HCMA 1QX7A 2BL0B 3QRXA 2KAXA 2MRDA 3BQ3A 2HQWA 1DF0A 2Q4UA 4P5OE 1X02A 2EHBA 2GGZA 4NDCA 1GJYA 2JPTA 4MLWA 4DS7A 2BCXA 3JVTC 1SL7A 2EGDA 1K96A 3BUWB 2F2PA 1SCVA 1KFXS 1QJTA 3GK1A 2JNXA 4YI8A 3FIAA 2GV5A 5CSIA 2JXCA 3SG7A 4USLA 2ZNEA 1FBVA 4ICBA 1S1EA 2ZRSA 4WQ2A 3D10A 1YX8A 1G33A 3A4UB 1SL9A 3TUYC 2O60A 4PHNA 2NLNA 1WRLA 3KF9A 1K2HA 4GBAA 1TN4A 3DD4A 4GAOA 1XK4A 2LC5A 2K8MB 1FPWA 2K7OA 1QTXA 1N2DA 1NPQA 5CSJA 2MA2A 2K2FA 5HLOA 1OMVA 1W7IB 2KOTA 2H61A 2KGRA 2QACA 3DF0A 2Y1NA 1A75B 1BT6A 3LK1A 2M3WA 1LA3A 3KPXA 3M0WA 5HKYA 2JT8A 1ALVA 2P6BB 3EK8A 1PALA 1TNWA 3EK4A 4PE1A 3SG6A 1KQMB 4PE4A 4CLNA 1V1GA 1XK4C 1GGWA 2ZKMX 1QVIY 2LVKA 3PALA 2KBIA 2BCBA 3KEVA 2JNFA 4XJKB 1SR6C 3PATA 1SW8A 4PHMA 4GPLB 1PVAA 2M1UA 1N0YA 2TN4A 3CZTX 4GNKB 3BXKA 2KGBC 1RECA 1B7TY 3CTNA 1RFJA 4MSPA 2OTGC 2WOSA 4I5JA 1EH2A 1JWDA 1ALWA 1K9PA 1B47A 1BJFA 1K9KA 2NZ0A 2FCEA 1F4OA 2A4JA 1BR1B 1SCMB 1EL4A 2SCPA 1YTZC 1B8CA 1YRUB 1DGVA 3CS1A 5JJGA 1NYAA 1Y6WA 1YR5A 2LE9B 1KFUS 3PM8A 1OOJA 3E3RA 4MRYA 2LP3A 1WDCB 1FF1A 3PSRA 2L50A 3I5IB 4GGFA 1RROA 1A2XA 1NCZA 3DVMA 1NX2A 1TCOB 1BG1A 1IQ5A 5AERA 2BBNA 2L4HA 3RLZA 4I5LB 1DJXA 1K93D 4OKHA 4JQ0D 5PALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAL A;  4Q04 A;  2LAP A;  2I7A A;  4A4B A;  1S5G Y;  2KYC A;  3CGA A;  2NXQ A;  4ZCV A;  3OHM B;  2LHL A;  2LVI A;  4YGC B;  5ER5 A;  4PE0 A;  2DOQ A;  1J55 A;  1OZO A;  1U5I A;  1CFF A;  1J7R A;  1CDP A;  1QVI Z;  3F45 A;  2LCP A;  3PN7 C;  1FI6 A;  1S26 D;  4CFQ A;  1QX5 B;  4C0J A;  4GGF C;  2IS9 A;  2F2O A;  5IBW A;  5CPV A;  2LAN A;  5JOL A;  1SYM A;  3KO0 A;  2MHH A;  2PRU A;  4FQO A;  4WQ3 A;  3PLF B;  1S6J A;  4TNC A;  5I2Q A;  4YRU A;  1BOC A;  1MHO A;  4MVF A;  5HLV A;  3CLN A;  3OP0 A;  3FWB A;  1IWQ A;  1XVJ A;  2KSP A;  1G4Y R;  1SMG A;  4R1E A;  4DCK A;  1AHR A;  1Q80 A;  1M46 A;  1N65 A;  2JWW A;  2CNP A;  2JZI A;  3IQO A;  3LK0 A;  4QJ4 B;  4OV2 A;  1CDM A;  1ZOT B;  2JOJ A;  5DKN A;  4E68 A;  5TNC A;  3SG4 A;  2KFF A;  1CFC A;  1IRJ A;  5AEQ A;  1GGZ A;  2Y4Q A;  2KI4 C;  1F71 A;  1PSB A;  1MUX A;  1OMR A;  1DMO A;  1MF8 B;  1KK8 C;  1AJ4 A;  1VRK A;  3AKB A;  3BOW A;  1YVH A;  1S6I A;  1UUS A;  2M0R A;  5CSF A;  2WCE A;  1QAS A;  1SY9 A;  1KSO A;  3ICB A;  4U8D A;  1SNL A;  2KQY A;  1UWO A;  4ZCU A;  1J7Q A;  1EG4 A;  2I2R E;  1DF0 B;  1B4C A;  1ZUZ A;  1CM1 A;  3SIA A;  4ORC B;  1BOD A;  3BUO B;  2HF5 A;  2LVJ A;  2KNE A;  1HQV A;  1TTX A;  3I5G C;  3VGO A;  5ER4 X;  2OS8 C;  4CPV A;  3I5F B;  5HKW A;  4F0Z B;  2ZN9 A;  4GGN A;  1IKU A;  5HKZ A;  2LLU A;  2LVV A;  2PSR A;  1LKJ A;  2BL0 C;  1CLL A;  3WNX B;  3CR5 X;  2LUC A;  2I94 A;  1OE9 B;  1QXP A;  3CR4 X;  3GOF A;  4MZK A;  5I2L A;  2GGM A;  4HSZ A;  3VRN A;  3NSK A;  3EVU A;  1AVS A;  1QLS A;  1QIW A;  1CB1 A;  1QIV A;  4I5K A;  4I5N B;  3EVR A;  1A75 A;  1IGV A;  1SBJ A;  1BU3 A;  3NSO A;  3OX5 A;  1F54 A;  1DJW A;  4PCW A;  4N1G A;  2OPO A;  1GQM A;  4MZJ A;  3DF0 B;  1J1E A;  1YUS A;  4ORB B;  1UHI A;  5DKR A;  3BUX B;  2KFH A;  2OTG B;  2M1K B;  4C0L A;  2LNK A;  3NSL A;  1PVB A;  1H8B A;  1HT9 A;  2KI6 C;  1F55 A;  2G9B A;  2Y5I A;  1RJV A;  1UHK A;  5I2O A;  1BLQ A;  1AJ5 A;  5KSZ A;  3FS7 A;  1CNP A;  4PHJ A;  1KK7 Y;  2BEC A;  1CKK A;  3IQQ A;  4QJ3 B;  2LLS A;  1K8U A;  1XFX O;  1XYD A;  1MR8 A;  2K7D A;  4N5X A;  1UHN A;  2COL B;  2KI6 D;  3I5H B;  1XFV O;  4DUQ A;  2M9G A;  1JF2 A;  2ZND A;  1UUR A;  3IF7 A;  1IH0 A;  1KQV A;  2H2K A;  2D8N A;  4AOM A;  1KQM C;  2BKH B;  1L2O B;  2JRF A;  4D1E A;  3AAK A;  1CMF A;  1RWY A;  1KSM A;  1SRA A;  1TRF A;  1K90 D;  3TS5 B;  2KYF A;  1NX0 A;  3H4S E;  1AP4 A;  1B8R A;  2M97 A;  1J7O A;  5G08 A;  1YUU A;  4CFR A;  4DIR A;  2K2A A;  4MN0 A;  1PRW A;  1QAT A;  4NDB A;  4HRE E;  3D0Y A;  1A03 A;  1DJI A;  2SAS A;  1SPY A;  1DTL A;  2RGI A;  4MEW A;  3VRP A;  2LMU A;  4C0K A;  1C7V A;  2JTZ A;  3JTD B;  2L98 A;  3DVK A;  3O78 A;  4PHK A;  1YX7 A;  1KWO B;  2HET A;  2JQ6 A;  4CID A;  1FW4 A;  5I8N A;  1J7P A;  1SCM C;  3MSE B;  2MAZ A;  1CDN A;  5B8I B;  2EC6 B;  2M8U A;  3VRQ A;  1IQ3 A;  1B7T Z;  2L4I A;  1TNX A;  1JBA A;  1WDC C;  1R6P A;  3I5I C;  1U5I B;  1CLB A;  3SG5 A;  2R2I A;  1EG3 A;  2HPS A;  1NCY A;  3ZNI A;  2I18 A;  1SK6 D;  3TDI A;  1F70 A;  1M63 B;  2ISD A;  1A29 A;  1D1O A;  2VRG A;  4MBE A;  2MBX A;  4P2Y B;  3TDU A;  1XFW O;  1B1G A;  1M39 A;  3AAJ A;  2L5X B;  3A8R A;  2PMY A;  4YI9 A;  1AK8 A;  1Y1X A;  4OR9 B;  5AFP A;  3GK4 X;  1DJH A;  3JVT B;  3OX6 A;  1DGU A;  4NQG A;  4M2P A;  1XA5 A;  1DJY A;  1DVI A;  2LP2 A;  3DVJ A;  1M31 A;  1OSA A;  1S5G Z;  3C1V A;  1S6C A;  2PAL A;  5J3X A;  1PUL A;  3TUY B;  1XFZ O;  5FYX A;  1CFD A;  1TIZ A;  1TNP A;  2KDH A;  3OB2 B;  2KHN A;  3BYA A;  4YGA A;  1CLM A;  1RTP 1;  4ORA B;  1K95 A;  1K9U A;  1TNQ A;  2F3Z A;  1IG5 A;  1LVC D;  2MLE C;  4MRX A;  1MXL C;  2FJU B;  2V53 A;  4A4C A;  1KCY A;  4GFT A;  4OVN F;  4NDD A;  1J1D A;  1LXF C;  1BF5 A;  2MLF C;  1LIN A;  1XFU O;  1JF0 A;  2CBL A;  1JC2 A;  4PE7 A;  1CDL A;  5KTY A;  1WRK A;  2B1U A;  2BCA A;  3NSI A;  4M2O A;  2FCD A;  1NIW A;  2KAV A;  3RM1 A;  3BUN B;  2F8P A;  1TOP A;  1NUB A;  4N1F A;  1UHH A;  2LHI A;  1MWN A;  2AUC A;  5K89 A;  2L2E A;  2BBM A;  2KBM A;  5D69 A;  1EJ3 A;  1JFK A;  2Y1M A;  2M7L A;  1WLM A;  2NCO A;  4XYN A;  1LA0 A;  1OZS A;  3TDZ A;  1K94 A;  3EVV A;  1SR6 B;  1TCF A;  4AQI A;  1QV1 A;  1JSA A;  2WCF A;  3VRR A;  2LUX A;  3AKA A;  1ZMZ A;  2NCP A;  4UPG A;  1RK9 A;  2JC2 A;  5DKQ A;  2HQ8 A;  1W7J B;  1NX1 A;  2M49 B;  2LMT A;  2L0P A;  3LLE A;  1PSR A;  3KHE A;  5BPJ A;  1QS7 A;  4BY5 A;  5KU1 A;  3I5F C;  4XJK A;  4PDZ A;  1BR4 B;  1YRT B;  2F3Y A;  2K7B A;  2O5G A;  3EKH A;  1ODB A;  1QLK A;  3BUM B;  2JUL A;  3CWG A;  4BY4 A;  4L9M A;  3ZWH A;  2KFG A;  5AXI A;  1FI5 A;  1UHJ A;  3DVE A;  4JWQ A;  1JUO A;  1YVL A;  2JT3 A;  4JPZ B;  1M45 A;  1UP5 A;  3OB1 B;  4AQJ A;  1L7Z A;  2LMV A;  4DRW A;  2H61 C;  2ZRT A;  1F8H A;  2ZN8 A;  3O2P A;  1QX2 A;  2CXJ A;  1Y1U A;  4YGB B;  1KFX L;  1NSH A;  2WND A;  1YUR A;  2QPT A;  1C7W A;  3PFV A;  3PN7 B;  1CFP A;  2KAY A;  2M29 A;  1WY9 A;  1EXR A;  1NCX A;  2FOT A;  1OMD A;  3SG3 A;  2Q91 A;  2BKI B;  2WC8 A;  4ETO A;  3FWC A;  2LV7 A;  2BE6 A;  2K7C A;  3VRO A;  2K61 A;  2WCB A;  1CTR A;  4M2Q A;  5F6T A;  1JFJ A;  1MQ1 A;  1G8I A;  1SL8 A;  2MJW B;  2LM5 A;  4YGE B;  3D0Y B;  1Y1A A;  3I5H C;  2BE4 A;  4HRH A;  4QJ5 B;  3WHT B;  4IL1 A;  1WRZ A;  1C07 A;  1KK7 Z;  1L2O C;  2CCM A;  4FTG A;  1CM4 A;  3SIB A;  3TS5 C;  3TZ1 A;  1S3P A;  2CT9 A;  2LLT A;  1R2U A;  1IJ6 A;  4YBH B;  2E30 A;  1AUI B;  1PK0 D;  2PAS A;  5HYD A;  1XFY O;  5AAN A;  2M7N A;  2PVB A;  2KI4 B;  3NXA A;  5CSN A;  3GK2 A;  2L51 A;  3CR2 A;  3WHU B;  4OCI A;  1H4B A;  2JTT A;  2KQ6 A;  4MZL A;  2G2B A;  1E8A A;  1A4P A;  5D7F A;  1B8L A;  1BMO A;  1KK8 B;  3JTD C;  3LCP C;  1V1F A;  1ZAC A;  3O4Y A;  1MXE A;  4GUK A;  1KWO C;  2F33 A;  2K0J A;  1NX3 A;  2JU0 A;  3HX4 A;  3EK7 A;  1SKT A;  1DJZ A;  2AMI A;  3SJS A;  1XO5 A;  1QV0 A;  2WOR A;  4YGD B;  1F4Q A;  2EC6 C;  3O6B A;  2E6W A;  1B9A A;  2JXL A;  2ZFD A;  1YUT A;  1WLZ A;  4HRG A;  3SG2 A;  1CMG A;  1IJ5 A;  1NP8 A;  2JT0 A;  1DT7 B;  2CTN A;  1NWD A;  3LL8 B;  4WRI A;  5GQQ C;  3I5G B;  3EKJ A;  3K21 A;  1KFU L;  2OS8 B;  3WXA A;  1S36 A;  1DJG A;  1Y0V H;  2AAO A;  1ZFS A;  3BOW B;  1OQP A;  3HCM A;  1QX7 A;  2BL0 B;  3QRX A;  2KAX A;  2MRD A;  3BQ3 A;  2HQW A;  1DF0 A;  2Q4U A;  4P5O E;  1X02 A;  2EHB A;  2GGZ A;  4NDC A;  1GJY A;  2JPT A;  4MLW A;  4DS7 A;  2BCX A;  3JVT C;  1SL7 A;  2EGD A;  1K96 A;  3BUW B;  2F2P A;  1SCV A;  1KFX S;  1QJT A;  3GK1 A;  2JNX A;  4YI8 A;  3FIA A;  2GV5 A;  5CSI A;  2JXC A;  3SG7 A;  4USL A;  2ZNE A;  1FBV A;  4ICB A;  1S1E A;  2ZRS A;  4WQ2 A;  3D10 A;  1YX8 A;  1G33 A;  3A4U B;  1SL9 A;  3TUY C;  2O60 A;  4PHN A;  2NLN A;  1WRL A;  3KF9 A;  1K2H A;  4GBA A;  1TN4 A;  3DD4 A;  4GAO A;  1XK4 A;  2LC5 A;  2K8M B;  1FPW A;  2K7O A;  1QTX A;  1N2D A;  1NPQ A;  5CSJ A;  2MA2 A;  2K2F A;  5HLO A;  1OMV A;  1W7I B;  2KOT A;  2H61 A;  2KGR A;  2QAC A;  3DF0 A;  2Y1N A;  1A75 B;  1BT6 A;  3LK1 A;  2M3W A;  1LA3 A;  3KPX A;  3M0W A;  5HKY A;  2JT8 A;  1ALV A;  2P6B B;  3EK8 A;  1PAL A;  1TNW A;  3EK4 A;  4PE1 A;  3SG6 A;  1KQM B;  4PE4 A;  4CLN A;  1V1G A;  1XK4 C;  1GGW A;  2ZKM X;  1QVI Y;  2LVK A;  3PAL A;  2KBI A;  2BCB A;  3KEV A;  2JNF A;  4XJK B;  1SR6 C;  3PAT A;  1SW8 A;  4PHM A;  4GPL B;  1PVA A;  2M1U A;  1N0Y A;  2TN4 A;  3CZT X;  4GNK B;  3BXK A;  2KGB C;  1REC A;  1B7T Y;  3CTN A;  1RFJ A;  4MSP A;  2OTG C;  2WOS A;  4I5J A;  1EH2 A;  1JWD A;  1ALW A;  1K9P A;  1B47 A;  1BJF A;  1K9K A;  2NZ0 A;  2FCE A;  1F4O A;  2A4J A;  1BR1 B;  1SCM B;  1EL4 A;  2SCP A;  1YTZ C;  1B8C A;  1YRU B;  1DGV A;  3CS1 A;  5JJG A;  1NYA A;  1Y6W A;  1YR5 A;  2LE9 B;  1KFU S;  3PM8 A;  1OOJ A;  3E3R A;  4MRY A;  2LP3 A;  1WDC B;  1FF1 A;  3PSR A;  2L50 A;  3I5I B;  4GGF A;  1RRO A;  1A2X A;  1NCZ A;  3DVM A;  1NX2 A;  1TCO B;  1BG1 A;  1IQ5 A;  5AER A;  2BBN A;  2L4H A;  3RLZ A;  4I5L B;  1DJX A;  1K93 D;  4OKH A;  4JQ0 D;  5PAL A; 
#chains in the Genus database with same CATH topology
 4PAL A;  4Q04 A;  2LAP A;  2I7A A;  4A4B A;  1S5G Y;  2KYC A;  3CGA A;  2NXQ A;  4ZCV A;  3OHM B;  2LHL A;  2LVI A;  4YGC B;  5ER5 A;  3EG5 B;  4PE0 A;  2DOQ A;  2QEH A;  1J55 A;  1OZO A;  1U5I A;  1CFF A;  1J7R A;  1CDP A;  1QVI Z;  3F45 A;  2LCP A;  3PN7 C;  1FI6 A;  1S26 D;  4CFQ A;  1QX5 B;  4C0J A;  3B7A A;  4GGF C;  2IS9 A;  3NHI A;  2F2O A;  5I94 A;  5IBW A;  5CPV A;  2LAN A;  5JOL A;  1SYM A;  3KO0 A;  2MHH A;  2PRU A;  4FQO A;  4WQ3 A;  3PLF B;  1S6J A;  4TNC A;  5I2Q A;  4YRU A;  1BOC A;  1MHO A;  4MVF A;  3S0D A;  1OW4 A;  5HLV A;  3CLN A;  3OP0 A;  3FWB A;  1IWQ A;  1XVJ A;  2KSP A;  1G4Y R;  3B6X A;  1P28 A;  1SMG A;  1OOI X;  4R1E A;  1AHR A;  4DCK A;  1Q80 A;  1M46 A;  1N65 A;  3Q8I A;  3FE8 A;  2JWW A;  2CNP A;  2JZI A;  3IQO A;  3LK0 A;  4QJ4 B;  4OV2 A;  1CDM A;  1ZOT B;  2JOJ A;  5DKN A;  4E68 A;  5TNC A;  3SG4 A;  1W9Z A;  2KFF A;  1CFC A;  1IRJ A;  5AEQ A;  1GGZ A;  2Y4Q A;  2KI4 C;  1F71 A;  1PSB A;  1MUX A;  1OMR A;  1DMO A;  3CZ0 A;  1MF8 B;  1KK8 C;  1AJ4 A;  1OOF A;  1VRK A;  3AKB A;  3BOW A;  1YVH A;  1S6I A;  3BFH A;  2K60 A;  1UUS A;  2M0R A;  5CSF A;  2WCE A;  1QAS A;  1SY9 A;  1KSO A;  3ICB A;  4U8D A;  1SNL A;  3CAB A;  2KQY A;  1UWO A;  4ZCU A;  1J7Q A;  1EG4 A;  3B87 A;  3BJH A;  2I2R E;  1DF0 B;  2P71 A;  4IJ7 A;  1B4C A;  3CZ2 A;  1ZUZ A;  1CM1 A;  3SIA A;  4ORC B;  1BOD A;  3BUO B;  2HF5 A;  2LVJ A;  2KNE A;  1HQV A;  3O4X A;  1TTX A;  3I5G C;  3VGO A;  5ER4 X;  2OS8 C;  4CPV A;  3I5F B;  5HKW A;  4F0Z B;  2ZN9 A;  3R1O A;  4GGN A;  1IKU A;  5HKZ A;  2LLU A;  2LVV A;  2PSR A;  1LKJ A;  2BL0 C;  1CLL A;  3WNX B;  3CR5 X;  2LUC A;  2I94 A;  1OE9 B;  1QXP A;  3CR4 X;  3GOF A;  4MZK A;  5I2L A;  2GGM A;  4HSZ A;  3VRN A;  3NSK A;  3EVU A;  4JD9 A;  3SS3 A;  3DXL A;  1AVS A;  1QLS A;  5FI7 A;  1QIW A;  1CB1 A;  1QIV A;  4I5K A;  4I5N B;  3EVR A;  1A75 A;  1IGV A;  1SBJ A;  1BU3 A;  3NSO A;  3OX5 A;  1F54 A;  1DJW A;  4PCW A;  4N1G A;  2OPO A;  1GQM A;  4MZJ A;  5HL1 A;  3DF0 B;  1J1E A;  1YUS A;  4ORB B;  1UHI A;  5DKR A;  3BUX B;  2KFH A;  2OTG B;  2M1K B;  4C0L A;  2LNK A;  3NSL A;  1PVB A;  1H8B A;  1HT9 A;  2KI6 C;  1F55 A;  2G9B A;  1OOH A;  1RJV A;  1UHK A;  2Y5I A;  5I2O A;  1BLQ A;  4INX A;  1AJ5 A;  5KSZ A;  3FS7 A;  1DC1 A;  1CNP A;  4PHJ A;  1KK7 Y;  2BEC A;  1CKK A;  2WCH A;  3IQQ A;  4QJ3 B;  2LLS A;  2L5Y A;  1K8U A;  1XFX O;  1XYD A;  1MR8 A;  2K7D A;  4N5X A;  1UHN A;  3PJI A;  2COL B;  2KI6 D;  2BNX A;  3I5H B;  1XFV O;  3FE6 A;  4DUQ A;  2M9G A;  1JF2 A;  2ZND A;  1UUR A;  3IF7 A;  1IH0 A;  1KQV A;  2H2K A;  2D8N A;  4AOM A;  1KQM C;  2BKH B;  1L2O B;  2JRF A;  4D1E A;  3AAK A;  1CMF A;  1RWY A;  1KSM A;  1SRA A;  1TRF A;  1K90 D;  2P70 A;  3TS5 B;  2KYF A;  1NX0 A;  3H4S E;  1AP4 A;  1B8R A;  2M97 A;  1J7O A;  5G08 A;  4OZD A;  1YUU A;  4CFR A;  4DIR A;  2K2A A;  4MN0 A;  1PRW A;  1QAT A;  4NDB A;  4HRE E;  3D0Y A;  1A03 A;  1DJI A;  2SAS A;  1SPY A;  1DTL A;  2RGI A;  4MEW A;  3VRP A;  2LMU A;  3QME A;  4C0K A;  2JTZ A;  1C7V A;  3JTD B;  2L98 A;  3DVK A;  3O78 A;  2L2C A;  4PHK A;  1YX7 A;  3SS4 A;  1KWO B;  2HET A;  2JQ6 A;  3SS5 A;  1FW4 A;  4CID A;  5I8N A;  1J7P A;  1SCM C;  2H8V A;  3MSE B;  2MAZ A;  4KYN A;  1DQE A;  1CDN A;  5B8I B;  2EC6 B;  2M8U A;  3VRQ A;  1IQ3 A;  1B7T Z;  2L4I A;  1TNX A;  1JBA A;  1WDC C;  1R6P A;  3I5I C;  1U5I B;  1CLB A;  3SG5 A;  2R2I A;  1EG3 A;  2HPS A;  1NCY A;  4FQT A;  1QWV A;  3ZNI A;  2I18 A;  1SK6 D;  3TDI A;  1F70 A;  2ERB A;  1M63 B;  2ISD A;  1LS8 A;  3L4L A;  1A29 A;  2WCK A;  1XFR A;  5D3O A;  1D1O A;  2VRG A;  4MBE A;  2MBX A;  4P2Y B;  3TDU A;  1XFW O;  1B1G A;  1M39 A;  3AAJ A;  3V2L A;  1C3Z A;  2L5X B;  3A8R A;  2PMY A;  4YI9 A;  1AK8 A;  2WCM A;  3IVT A;  1Y1X A;  4OR9 B;  5AFP A;  3GK4 X;  1DJH A;  3JVT B;  3OX6 A;  1DGU A;  4NQG A;  3NGV A;  4M2P A;  1XA5 A;  3CZ1 A;  1DJY A;  1DVI A;  2LP2 A;  3DVJ A;  1M31 A;  1OSA A;  1S5G Z;  3CDN A;  3C1V A;  1S6C A;  3D74 A;  2PAL A;  3OBV A;  5J3X A;  1PUL A;  3TUY B;  2WC6 A;  3D78 A;  1XFZ O;  5FYX A;  1CFD A;  1TIZ A;  1TNP A;  2KDH A;  3OB2 B;  2KHN A;  3BYA A;  4YGA A;  1CLM A;  1RTP 1;  4ORA B;  1K95 A;  1K9U A;  1TNQ A;  2F3Z A;  1IG5 A;  1LVC D;  2MLE C;  4MRX A;  1MXL C;  2FJU B;  2V53 A;  4PT1 A;  1DEK A;  4A4C A;  1KCY A;  4GFT A;  4F7F A;  4OVN F;  2JPO A;  4NDD A;  1J1D A;  1LXF C;  1BF5 A;  2MLF C;  1LIN A;  1XFU O;  2KLD A;  1JF0 A;  2CBL A;  3DY9 A;  4PE7 A;  1CDL A;  5KTY A;  1WRK A;  2B1U A;  2BCA A;  3NSI A;  4M2O A;  1JC2 A;  2FCD A;  1NIW A;  2KAV A;  3RM1 A;  3CYZ A;  3BUN B;  2F8P A;  1TOP A;  2QEO A;  1NUB A;  4N1F A;  1UHH A;  2LHI A;  1MWN A;  2AUC A;  5K89 A;  2L2E A;  2BBM A;  2KBM A;  5D69 A;  1EJ3 A;  1JFK A;  2Y1M A;  2M7L A;  1WLM A;  2NCO A;  4XYN A;  1LA0 A;  1OZS A;  3TDZ A;  1K94 A;  3EVV A;  1SR6 B;  1TCF A;  4AQI A;  2FJY A;  3D76 A;  1QV1 A;  1JSA A;  2WCF A;  3VRR A;  2LUX A;  3AKA A;  1ZMZ A;  2NCP A;  4UPG A;  1RK9 A;  2JC2 A;  5DKQ A;  2HQ8 A;  2QEB A;  3B86 A;  2KLE A;  1W7J B;  1NX1 A;  2M49 B;  2LMT A;  2L0P A;  3LLE A;  1PSR A;  3KHE A;  5BPJ A;  1QS7 A;  4BY5 A;  5FI2 A;  5KU1 A;  3I5F C;  4XJK A;  4PDZ A;  1BR4 B;  1YRT B;  2F3Y A;  2K7B A;  2O5G A;  3EKH A;  1ODB A;  1QLK A;  3BUM B;  2JUL A;  5FI6 A;  3CWG A;  4BY4 A;  1DEL A;  4L9M A;  3ZWH A;  2KFG A;  5AXI A;  1FI5 A;  1UHJ A;  3DVE A;  4JWQ A;  1JUO A;  1YVL A;  2JT3 A;  1TUJ A;  4JPZ B;  1M45 A;  1UP5 A;  3OB1 B;  4AQJ A;  1L7Z A;  2LMV A;  4DRW A;  2H61 C;  2ZRT A;  1F8H A;  2ZN8 A;  3O2P A;  1QX2 A;  2CXJ A;  3PM2 A;  1Y1U A;  4YGB B;  1KFX L;  1NSH A;  2WND A;  1YUR A;  2QPT A;  1C7W A;  3PFV A;  3PN7 B;  1CFP A;  2KAY A;  2M29 A;  1WY9 A;  1EXR A;  1NCX A;  2FOT A;  1OMD A;  3SG3 A;  2Q91 A;  2BKI B;  2WC8 A;  1TWO A;  3FWC A;  4ETO A;  2LV7 A;  2BE6 A;  2K7C A;  3VRO A;  1OOG A;  2K61 A;  2KPH A;  2WCB A;  1CTR A;  4M2Q A;  5F6T A;  1JFJ A;  1MQ1 A;  1G8I A;  1SL8 A;  2MJW B;  2LM5 A;  2WC5 A;  4YGE B;  3D0Y B;  1Y1A A;  3I5H C;  2BE4 A;  2QEV A;  4HRH A;  4QJ5 B;  2QDI A;  3WHT B;  4IL1 A;  1WRZ A;  3OGN A;  1C07 A;  1KK7 Z;  1T14 A;  1L2O C;  2CCM A;  4FTG A;  1CM4 A;  2PQL A;  3SIB A;  3TS5 C;  3K1E A;  3TZ1 A;  1S3P A;  2CT9 A;  2LLT A;  1R2U A;  1IJ6 A;  4YBH B;  2E30 A;  1AUI B;  3S0E A;  1PK0 D;  2PAS A;  5EL2 A;  5HYD A;  1XFY O;  5AAN A;  2M7N A;  2PVB A;  2KI4 B;  3NXA A;  5CSN A;  3GK2 A;  1Z2C B;  2L51 A;  3CR2 A;  3WHU B;  3UNW A;  4OCI A;  1H4B A;  2JTT A;  2KQ6 A;  4MZL A;  2G2B A;  1E8A A;  1A4P A;  5D7F A;  1B8L A;  1BMO A;  1KK8 B;  3JTD C;  3LCP C;  1V1F A;  1ZAC A;  3O4Y A;  1MXE A;  4GUK A;  1KWO C;  2F33 A;  2K0J A;  1NX3 A;  2JU0 A;  3HX4 A;  3EK7 A;  3R1P A;  1SKT A;  1DJZ A;  2AMI A;  3SJS A;  1XO5 A;  1QV0 A;  2WOR A;  4YGD B;  1F4Q A;  3B88 A;  2EC6 C;  3O6B A;  2E6W A;  1B9A A;  3S0A A;  2JXL A;  2ZFD A;  1YUT A;  1WLZ A;  4HRG A;  3SG2 A;  1CMG A;  1IJ5 A;  1NP8 A;  2JT0 A;  1DT7 B;  2CTN A;  1NWD A;  3LL8 B;  3D73 A;  4WRI A;  5GQQ C;  3I5G B;  3EKJ A;  3K21 A;  3S0B A;  1KFU L;  2OS8 B;  4INW A;  3WXA A;  1S36 A;  1DJG A;  1Y0V H;  3BFA A;  2AAO A;  1ZFS A;  3BOW B;  2WCL A;  3L4A A;  1OQP A;  3HCM A;  1QX7 A;  2BL0 B;  3QRX A;  2BAP A;  2KAX A;  2MRD A;  3BQ3 A;  2HQW A;  1DF0 A;  2Q4U A;  4P5O E;  1X02 A;  2EHB A;  2GGZ A;  4NDC A;  1GJY A;  2JPT A;  4MLW A;  4DS7 A;  2BCX A;  3JVT C;  1SL7 A;  2EGD A;  1K96 A;  3BUW B;  2F2P A;  1SCV A;  1KFX S;  1QJT A;  3GK1 A;  2JNX A;  3N7H A;  4YI8 A;  5DIC A;  3FIA A;  2GV5 A;  5CSI A;  2JXC A;  3SG7 A;  3VB1 A;  4USL A;  2ZNE A;  1FBV A;  4ICB A;  3S0G A;  1S1E A;  1TUZ A;  2ZRS A;  4WQ2 A;  3D10 A;  1YX8 A;  1G33 A;  3A4U B;  1SL9 A;  4JKT A;  3TUY C;  2O60 A;  4PHN A;  2NLN A;  1WRL A;  3KF9 A;  1K2H A;  4GBA A;  1TN4 A;  3DD4 A;  1GM0 A;  3D75 A;  4GAO A;  1XK4 A;  2LC5 A;  2K8M B;  1FPW A;  2GTE A;  2YGU A;  3R72 A;  2K7O A;  1QTX A;  1N2D A;  1NPQ A;  1SSE B;  2MA2 A;  3DYE A;  3NHT A;  5CSJ A;  2K2F A;  5HLO A;  1OMV A;  1W7I B;  2KOT A;  2H61 A;  2KGR A;  2QAC A;  3DF0 A;  2Y1N A;  1A75 B;  1BT6 A;  3LK1 A;  1IIO A;  3UO9 A;  2M3W A;  1LA3 A;  3KPX A;  3M0W A;  5HKY A;  2JT8 A;  3DZT A;  1ALV A;  2P6B B;  3EK8 A;  1PAL A;  1TNW A;  3EK4 A;  4PE1 A;  1Z4H A;  3SG6 A;  1KQM B;  4PE4 A;  4CLN A;  1V1G A;  1XK4 C;  1GGW A;  2ZKM X;  1QVI Y;  2LVK A;  3PAL A;  2KBI A;  2BCB A;  3KEV A;  2JNF A;  3FE9 A;  4XJK B;  1SR6 C;  3RZS A;  3PAT A;  1SW8 A;  1C3Y A;  4PHM A;  4GPL B;  1PVA A;  2M1U A;  1N0Y A;  1ORG A;  2PYQ A;  2TN4 A;  3BXK A;  2KGB C;  3CZT X;  1REC A;  1B7T Y;  3CTN A;  1RFJ A;  4GNK B;  4MSP A;  2OTG C;  2WOS A;  4I5J A;  3S0F A;  1EH2 A;  1ALW A;  3L47 A;  1JWD A;  1K9P A;  2WCJ A;  1B47 A;  1BJF A;  1K9K A;  2NZ0 A;  2FCE A;  1F4O A;  2A4J A;  3BFB A;  1BR1 B;  1SCM B;  1EL4 A;  2SCP A;  1YTZ C;  1B8C A;  1YRU B;  1DGV A;  3CS1 A;  5JJG A;  1NYA A;  1Y6W A;  1YR5 A;  2LE9 B;  1KFU S;  3PM8 A;  1OOJ A;  3D77 A;  3E3R A;  4MRY A;  2LP3 A;  1WDC B;  1FF1 A;  3PSR A;  2L50 A;  3I5I B;  4GGF A;  1RRO A;  1A2X A;  1NCZ A;  3DVM A;  1NX2 A;  3R1V A;  1TCO B;  1BG1 A;  1IQ5 A;  5AER A;  2BBN A;  2L4H A;  3RLZ A;  4I5L B;  1DJX A;  1K93 D;  4OKH A;  4JQ0 D;  5PAL A; 
#chains in the Genus database with same CATH homology
 4PAL A;  4Q04 A;  2LAP A;  2I7A A;  4A4B A;  1S5G Y;  2KYC A;  3CGA A;  2NXQ A;  4ZCV A;  3OHM B;  2LHL A;  2LVI A;  4YGC B;  5ER5 A;  4PE0 A;  2DOQ A;  1J55 A;  1OZO A;  1U5I A;  1CFF A;  1J7R A;  1CDP A;  1QVI Z;  3F45 A;  2LCP A;  3PN7 C;  1FI6 A;  1S26 D;  4CFQ A;  1QX5 B;  4C0J A;  4GGF C;  2IS9 A;  2F2O A;  5IBW A;  5CPV A;  2LAN A;  5JOL A;  1SYM A;  3KO0 A;  2MHH A;  2PRU A;  4FQO A;  4WQ3 A;  3PLF B;  1S6J A;  4TNC A;  5I2Q A;  4YRU A;  1BOC A;  1MHO A;  4MVF A;  5HLV A;  3CLN A;  3OP0 A;  3FWB A;  1IWQ A;  1XVJ A;  2KSP A;  1G4Y R;  1SMG A;  4R1E A;  4DCK A;  1AHR A;  1Q80 A;  1M46 A;  1N65 A;  2JWW A;  2CNP A;  2JZI A;  3IQO A;  3LK0 A;  4QJ4 B;  4OV2 A;  1CDM A;  1ZOT B;  2JOJ A;  5DKN A;  4E68 A;  5TNC A;  3SG4 A;  2KFF A;  1CFC A;  1IRJ A;  5AEQ A;  1GGZ A;  2Y4Q A;  2KI4 C;  1F71 A;  1PSB A;  1MUX A;  1OMR A;  1DMO A;  1MF8 B;  1KK8 C;  1AJ4 A;  1VRK A;  3AKB A;  3BOW A;  1YVH A;  1S6I A;  1UUS A;  2M0R A;  5CSF A;  2WCE A;  1QAS A;  1SY9 A;  1KSO A;  3ICB A;  4U8D A;  1SNL A;  2KQY A;  1UWO A;  4ZCU A;  1J7Q A;  1EG4 A;  2I2R E;  1DF0 B;  1B4C A;  1ZUZ A;  1CM1 A;  3SIA A;  4ORC B;  1BOD A;  3BUO B;  2HF5 A;  2LVJ A;  2KNE A;  1HQV A;  1TTX A;  3I5G C;  3VGO A;  5ER4 X;  2OS8 C;  4CPV A;  3I5F B;  5HKW A;  4F0Z B;  2ZN9 A;  4GGN A;  1IKU A;  5HKZ A;  2LLU A;  2LVV A;  2PSR A;  1LKJ A;  2BL0 C;  1CLL A;  3WNX B;  3CR5 X;  2LUC A;  2I94 A;  1OE9 B;  1QXP A;  3CR4 X;  3GOF A;  4MZK A;  5I2L A;  2GGM A;  4HSZ A;  3VRN A;  3NSK A;  3EVU A;  1AVS A;  1QLS A;  1QIW A;  1CB1 A;  1QIV A;  4I5K A;  4I5N B;  3EVR A;  1A75 A;  1IGV A;  1SBJ A;  1BU3 A;  3NSO A;  3OX5 A;  1F54 A;  1DJW A;  4PCW A;  4N1G A;  2OPO A;  1GQM A;  4MZJ A;  3DF0 B;  1J1E A;  1YUS A;  4ORB B;  1UHI A;  5DKR A;  3BUX B;  2KFH A;  2OTG B;  2M1K B;  4C0L A;  2LNK A;  3NSL A;  1PVB A;  1H8B A;  1HT9 A;  2KI6 C;  1F55 A;  2G9B A;  2Y5I A;  1RJV A;  1UHK A;  5I2O A;  1BLQ A;  1AJ5 A;  5KSZ A;  3FS7 A;  1CNP A;  4PHJ A;  1KK7 Y;  2BEC A;  1CKK A;  3IQQ A;  4QJ3 B;  2LLS A;  1K8U A;  1XFX O;  1XYD A;  1MR8 A;  2K7D A;  4N5X A;  1UHN A;  2COL B;  2KI6 D;  3I5H B;  1XFV O;  4DUQ A;  2M9G A;  1JF2 A;  2ZND A;  1UUR A;  3IF7 A;  1IH0 A;  1KQV A;  2H2K A;  2D8N A;  4AOM A;  1KQM C;  2BKH B;  1L2O B;  2JRF A;  4D1E A;  3AAK A;  1CMF A;  1RWY A;  1KSM A;  1SRA A;  1TRF A;  1K90 D;  3TS5 B;  2KYF A;  1NX0 A;  3H4S E;  1AP4 A;  1B8R A;  2M97 A;  1J7O A;  5G08 A;  1YUU A;  4CFR A;  4DIR A;  2K2A A;  4MN0 A;  1PRW A;  1QAT A;  4NDB A;  4HRE E;  3D0Y A;  1A03 A;  1DJI A;  2SAS A;  1SPY A;  1DTL A;  2RGI A;  4MEW A;  3VRP A;  2LMU A;  4C0K A;  1C7V A;  2JTZ A;  3JTD B;  2L98 A;  3DVK A;  3O78 A;  4PHK A;  1YX7 A;  1KWO B;  2HET A;  2JQ6 A;  4CID A;  1FW4 A;  5I8N A;  1J7P A;  1SCM C;  3MSE B;  2MAZ A;  1CDN A;  5B8I B;  2EC6 B;  2M8U A;  3VRQ A;  1IQ3 A;  1B7T Z;  2L4I A;  1TNX A;  1JBA A;  1WDC C;  1R6P A;  3I5I C;  1U5I B;  1CLB A;  3SG5 A;  2R2I A;  1EG3 A;  2HPS A;  1NCY A;  3ZNI A;  2I18 A;  1SK6 D;  3TDI A;  1F70 A;  1M63 B;  2ISD A;  1A29 A;  1D1O A;  2VRG A;  4MBE A;  2MBX A;  4P2Y B;  3TDU A;  1XFW O;  1B1G A;  1M39 A;  3AAJ A;  2L5X B;  3A8R A;  2PMY A;  4YI9 A;  1AK8 A;  1Y1X A;  4OR9 B;  5AFP A;  3GK4 X;  1DJH A;  3JVT B;  3OX6 A;  1DGU A;  4NQG A;  4M2P A;  1XA5 A;  1DJY A;  1DVI A;  2LP2 A;  3DVJ A;  1M31 A;  1OSA A;  1S5G Z;  3C1V A;  1S6C A;  2PAL A;  5J3X A;  1PUL A;  3TUY B;  1XFZ O;  5FYX A;  1CFD A;  1TIZ A;  1TNP A;  2KDH A;  3OB2 B;  2KHN A;  3BYA A;  4YGA A;  1CLM A;  1RTP 1;  4ORA B;  1K95 A;  1K9U A;  1TNQ A;  2F3Z A;  1IG5 A;  1LVC D;  2MLE C;  4MRX A;  1MXL C;  2FJU B;  2V53 A;  4A4C A;  1KCY A;  4GFT A;  4OVN F;  4NDD A;  1J1D A;  1LXF C;  1BF5 A;  2MLF C;  1LIN A;  1XFU O;  1JF0 A;  2CBL A;  1JC2 A;  4PE7 A;  1CDL A;  5KTY A;  1WRK A;  2B1U A;  2BCA A;  3NSI A;  4M2O A;  2FCD A;  1NIW A;  2KAV A;  3RM1 A;  3BUN B;  2F8P A;  1TOP A;  1NUB A;  4N1F A;  1UHH A;  2LHI A;  1MWN A;  2AUC A;  5K89 A;  2L2E A;  2BBM A;  2KBM A;  5D69 A;  1EJ3 A;  1JFK A;  2Y1M A;  2M7L A;  1WLM A;  2NCO A;  4XYN A;  1LA0 A;  1OZS A;  3TDZ A;  1K94 A;  3EVV A;  1SR6 B;  1TCF A;  4AQI A;  1QV1 A;  1JSA A;  2WCF A;  3VRR A;  2LUX A;  3AKA A;  1ZMZ A;  2NCP A;  4UPG A;  1RK9 A;  2JC2 A;  5DKQ A;  2HQ8 A;  1W7J B;  1NX1 A;  2M49 B;  2LMT A;  2L0P A;  3LLE A;  1PSR A;  3KHE A;  5BPJ A;  1QS7 A;  4BY5 A;  5KU1 A;  3I5F C;  4XJK A;  4PDZ A;  1BR4 B;  1YRT B;  2F3Y A;  2K7B A;  2O5G A;  3EKH A;  1ODB A;  1QLK A;  3BUM B;  2JUL A;  3CWG A;  4BY4 A;  4L9M A;  3ZWH A;  2KFG A;  5AXI A;  1FI5 A;  1UHJ A;  3DVE A;  4JWQ A;  1JUO A;  1YVL A;  2JT3 A;  4JPZ B;  1M45 A;  1UP5 A;  3OB1 B;  4AQJ A;  1L7Z A;  2LMV A;  4DRW A;  2H61 C;  2ZRT A;  1F8H A;  2ZN8 A;  3O2P A;  1QX2 A;  2CXJ A;  1Y1U A;  4YGB B;  1KFX L;  1NSH A;  2WND A;  1YUR A;  2QPT A;  1C7W A;  3PFV A;  3PN7 B;  1CFP A;  2KAY A;  2M29 A;  1WY9 A;  1EXR A;  1NCX A;  2FOT A;  1OMD A;  3SG3 A;  2Q91 A;  2BKI B;  2WC8 A;  4ETO A;  3FWC A;  2LV7 A;  2BE6 A;  2K7C A;  3VRO A;  2K61 A;  2WCB A;  1CTR A;  4M2Q A;  5F6T A;  1JFJ A;  1MQ1 A;  1G8I A;  1SL8 A;  2MJW B;  2LM5 A;  4YGE B;  3D0Y B;  1Y1A A;  3I5H C;  2BE4 A;  4HRH A;  4QJ5 B;  3WHT B;  4IL1 A;  1WRZ A;  1C07 A;  1KK7 Z;  1L2O C;  2CCM A;  4FTG A;  1CM4 A;  3SIB A;  3TS5 C;  3TZ1 A;  1S3P A;  2CT9 A;  2LLT A;  1R2U A;  1IJ6 A;  4YBH B;  2E30 A;  1AUI B;  1PK0 D;  2PAS A;  5HYD A;  1XFY O;  5AAN A;  2M7N A;  2PVB A;  2KI4 B;  3NXA A;  5CSN A;  3GK2 A;  2L51 A;  3CR2 A;  3WHU B;  4OCI A;  1H4B A;  2JTT A;  2KQ6 A;  4MZL A;  2G2B A;  1E8A A;  1A4P A;  5D7F A;  1B8L A;  1BMO A;  1KK8 B;  3JTD C;  3LCP C;  1V1F A;  1ZAC A;  3O4Y A;  1MXE A;  4GUK A;  1KWO C;  2F33 A;  2K0J A;  1NX3 A;  2JU0 A;  3HX4 A;  3EK7 A;  1SKT A;  1DJZ A;  2AMI A;  3SJS A;  1XO5 A;  1QV0 A;  2WOR A;  4YGD B;  1F4Q A;  2EC6 C;  3O6B A;  2E6W A;  1B9A A;  2JXL A;  2ZFD A;  1YUT A;  1WLZ A;  4HRG A;  3SG2 A;  1CMG A;  1IJ5 A;  1NP8 A;  2JT0 A;  1DT7 B;  2CTN A;  1NWD A;  3LL8 B;  4WRI A;  5GQQ C;  3I5G B;  3EKJ A;  3K21 A;  1KFU L;  2OS8 B;  3WXA A;  1S36 A;  1DJG A;  1Y0V H;  2AAO A;  1ZFS A;  3BOW B;  1OQP A;  3HCM A;  1QX7 A;  2BL0 B;  3QRX A;  2KAX A;  2MRD A;  3BQ3 A;  2HQW A;  1DF0 A;  2Q4U A;  4P5O E;  1X02 A;  2EHB A;  2GGZ A;  4NDC A;  1GJY A;  2JPT A;  4MLW A;  4DS7 A;  2BCX A;  3JVT C;  1SL7 A;  2EGD A;  1K96 A;  3BUW B;  2F2P A;  1SCV A;  1KFX S;  1QJT A;  3GK1 A;  2JNX A;  4YI8 A;  3FIA A;  2GV5 A;  5CSI A;  2JXC A;  3SG7 A;  4USL A;  2ZNE A;  1FBV A;  4ICB A;  1S1E A;  2ZRS A;  4WQ2 A;  3D10 A;  1YX8 A;  1G33 A;  3A4U B;  1SL9 A;  3TUY C;  2O60 A;  4PHN A;  2NLN A;  1WRL A;  3KF9 A;  1K2H A;  4GBA A;  1TN4 A;  3DD4 A;  4GAO A;  1XK4 A;  2LC5 A;  2K8M B;  1FPW A;  2K7O A;  1QTX A;  1N2D A;  1NPQ A;  5CSJ A;  2MA2 A;  2K2F A;  5HLO A;  1OMV A;  1W7I B;  2KOT A;  2H61 A;  2KGR A;  2QAC A;  3DF0 A;  2Y1N A;  1A75 B;  1BT6 A;  3LK1 A;  2M3W A;  1LA3 A;  3KPX A;  3M0W A;  5HKY A;  2JT8 A;  1ALV A;  2P6B B;  3EK8 A;  1PAL A;  1TNW A;  3EK4 A;  4PE1 A;  3SG6 A;  1KQM B;  4PE4 A;  4CLN A;  1V1G A;  1XK4 C;  1GGW A;  2ZKM X;  1QVI Y;  2LVK A;  3PAL A;  2KBI A;  2BCB A;  3KEV A;  2JNF A;  4XJK B;  1SR6 C;  3PAT A;  1SW8 A;  4PHM A;  4GPL B;  1PVA A;  2M1U A;  1N0Y A;  2TN4 A;  3CZT X;  4GNK B;  3BXK A;  2KGB C;  1REC A;  1B7T Y;  3CTN A;  1RFJ A;  4MSP A;  2OTG C;  2WOS A;  4I5J A;  1EH2 A;  1JWD A;  1ALW A;  1K9P A;  1B47 A;  1BJF A;  1K9K A;  2NZ0 A;  2FCE A;  1F4O A;  2A4J A;  1BR1 B;  1SCM B;  1EL4 A;  2SCP A;  1YTZ C;  1B8C A;  1YRU B;  1DGV A;  3CS1 A;  5JJG A;  1NYA A;  1Y6W A;  1YR5 A;  2LE9 B;  1KFU S;  3PM8 A;  1OOJ A;  3E3R A;  4MRY A;  2LP3 A;  1WDC B;  1FF1 A;  3PSR A;  2L50 A;  3I5I B;  4GGF A;  1RRO A;  1A2X A;  1NCZ A;  3DVM A;  1NX2 A;  1TCO B;  1BG1 A;  1IQ5 A;  5AER A;  2BBN A;  2L4H A;  3RLZ A;  4I5L B;  1DJX A;  1K93 D;  4OKH A;  4JQ0 D;  5PAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...