2JTZA

Solution structure and chemical shift assignments of the f104-to-5-flurotryptophan mutant of cardiac troponin c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
161
structure length
160
Chain Sequence
b'MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 27
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jtzA02
1SYMA 1PALA 3VRNA 2ZRTA 3KHEA 3LK1A 1NYAA 1MHOA 1OMVA 1QXPA 1TOPA 1B4CA 4CPVA 1GGWA 2F2PA 2M8UA 2LM5A 1SCMB 1N65A 1BR1B 3I5HB 1PULA 2JXLA 2KGBC 1SPYA 4ORCB 4IL1A 1NX2A 4M2OA 1B7TY 1B9AA 1IGVA 1W7JB 4JPZB 1QVIY 2KBIA 1UP5A 2L98A 3OP0A 1CFDA 2M49B 5BPJA 2FJUB 1JBAA 2K7BA 1BG1A 5CSFA 4AOMA 5K89A 3RM1A 1CDNA 1S36A 1DJHA 1WDCB 2GGMA 1SL9A 1SK6D 2WCFA 3WHTB 1KFXS 1RTP1 1K95A 2PMYA 3LCPC 3AKAA 4P5OE 3JVTB 4GUKA 2PRUA 1CDPA 1A4PA 2JRFA 5HYDA 1AJ4A 1J7PA 1KQVA 1XK4A 2M29A 3GK4X 2ZN9A 2JT0A 1OZSA 5B8IB 2Y4QA 1CM4A 1LA3A 2KAXA 3VROA 1L2OC 3BUXB 2P6BB 1SKTA 1KK8C 1B1GA 1LVCD 3CZTX 2OTGB 4XJKA 2PVBA 3I5IB 1ODBA 3OB2B 2BKIB 4XJKB 4MZKA 5I2QA 3JTDB 2MJWB 4YBHB 3QRXA 4YGBB 2MLEC 1NP8A 2F3YA 4M2QA 3CWGA 4PE0A 1AK8A 2JXCA 1R2UA 2M3WA 2LV7A 4PHMA 2LUCA 2BBNA 1K93D 1KK7Z 2KFHA 1GQMA 4GNKB 2M0RA 3SIBA 1YUUA 4QJ5B 5CPVA 4D1EA 3DVMA 1LA0A 1DF0A 1RWYA 1J7QA 1DF0B 2DOQA 3GK2A 1UUSA 4XYNA 1FI6A 1EG3A 3DD4A 2COLB 2ZRSA 4PE1A 5PALA 2CCMA 2K0JA 2JT3A 4I5LB 3A4UB 1CMFA 3DVKA 2JU0A 2LCPA 4L9MA 4OVNF 1YRTB 2BL0B 1QLSA 1F4QA 2AMIA 1S5GY 1CFPA 1ALWA 1JUOA 1QIWA 1YX7A 2HQWA 3SG4A 1CB1A 1DJYA 3TDZA 3AKBA 1DJZA 1UHJA 1QV0A 2LUXA 1B7TZ 5J3XA 3KEVA 2K7CA 1QVIZ 2LLSA 2SASA 4M2PA 4DIRA 2QPTA 3ZWHA 2FCEA 4CFQA 1DVIA 2LVKA 2ZNDA 4Q04A 1DJXA 4FTGA 2LAPA 2KGRA 1J7OA 1DT7B 2Y1NA 1KFXL 2LMTA 2Y5IA 1Y6WA 5CSJA 1XO5A 1S6CA 3I5GC 3EK4A 1QIVA 1OOJA 1QTXA 3BUMB 3WHUB 1XYDA 2KQ6A 4YI8A 1BODA 1F8HA 1NX1A 4HRHA 3TS5C 5AERA 1A03A 1B8RA 1EXRA 3VRQA 1H8BA 1TNWA 1K94A 1MXEA 1K8UA 3I5GB 2I2RE 1M31A 4WQ2A 2KYFA 2LMUA 2MAZA 4WQ3A 1NX0A 2MBXA 4F0ZB 3TUYC 3BUOB 1HQVA 5AFPA 3H4SE 1BJFA 4YI9A 2L4IA 1IKUA 1FPWA 3IF7A 2JT8A 3PN7B 3FWBA 2A4JA 1EG4A 1K90D 1TIZA 2KHNA 1KWOC 2EHBA 3I5FC 5KTYA 1G33A 4OKHA 4GPLB 4CFRA 1SY9A 1RK9A 3OX5A 5HKWA 3EK7A 1CLMA 3CR4X 4YGDB 1UHKA 1YVLA 4U8DA 4C0KA 1SW8A 1DJGA 1KSOA 2I18A 5HLVA 1C07A 4PALA 2EC6C 3KPXA 2F33A 2LVJA 3DVJA 1JFJA 1K9PA 3BOWA 1W7IB 3EVVA 1QX5B 2JC2A 1MXLC 2I7AA 2KI6C 2JTZA 3BOWB 3EVUA 3NSLA 2Y1MA 4QJ3B 1QATA 4PHJA 3TDIA 1EL4A 2ZFDA 2M7NA 3GOFA 1XVJA 5CSNA 2BCAA 1S5GZ 2K7DA 1JWDA 2EC6B 4ORBB 1L7ZA 5KU1A 5I8NA 1XFZO 3BQ3A 5ER5A 3SJSA 1M46A 1QASA 2LANA 4MZLA 1CTRA 2JZIA 3CR2A 2F3ZA 1QJTA 1N0YA 2BE6A 3TDUA 1J7RA 1NCXA 1NUBA 1SR6C 2KI4C 2KQYA 1CMGA 4DCKA 2KBMA 2KAYA 4PE7A 3ICBA 1G4YR 2IS9A 1CFFA 2LLUA 1IG5A 4C0LA 2BECA 2LP3A 5TNCA 1DJWA 5HKZA 1CKKA 1L2OB 1KQMC 1F70A 1KK8B 4BY4A 1R6PA 1OE9B 2OS8C 5DKRA 1C7WA 2JWWA 1OSAA 1DTLA 1WLZA 1IJ5A 1BU3A 3PALA 5JOLA 1B8LA 3VRRA 2SCPA 1MQ1A 1TNPA 1UURA 4PDZA 4JWQA 3BUWB 2LMVA 4WRIA 5HLOA 1NWDA 2GGZA 2D8NA 1F71A 2LVIA 1MWNA 1SNLA 2MHHA 3SG2A 1LINA 1U5IA 4P2YB 2LLTA 1U5IB 4R1EA 2Q4UA 3RLZA 1S3PA 2M97A 1FBVA 1ZUZA 1NX3A 3VRPA 1TN4A 1J1DA 1GJYA 4MN0A 5AEQA 1UHHA 1CLBA 1Q80A 1YTZC 3F45A 4MZJA 1YX8A 1M39A 3SG6A 2ZN8A 2M7LA 3D0YA 1EJ3A 2B1UA 3D0YB 2H61C 1NCYA 3IQQA 3DF0A 3O6BA 3DF0B 3PLFB 4NDBA 1KCYA 2KAVA 1PSBA 3HX4A 3LK0A 4HREE 3O78A 2V53A 2M9GA 2KNEA 1OMRA 2CT9A 1NSHA 2FOTA 1JSAA 2K61A 4C0JA 2I94A 1YR5A 5FYXA 2G2BA 3IQOA 5IBWA 4GGFA 2E6WA 3A8RA 1D1OA 1M45A 5DKQA 1TCFA 3KF9A 4TNCA 1V1FA 4ZCUA 3CGAA 2TN4A 4YRUA 3TS5B 1YVHA 1AJ5A 1MUXA 4USLA 1A2XA 1PK0D 1EH2A 2LHIA 2Q91A 1UHNA 1K96A 2CXJA 2FCDA 2K7OA 3TUYB 5I2LA 2NZ0A 4PHNA 1F54A 1KSMA 1QS7A 2MRDA 3VGOA 1FF1A 2R2IA 1SBJA 4FQOA 4GGFC 1S6IA 4MVFA 2OPOA 1M63B 2HQ8A 2JNFA 3SG7A 2E30A 1H4BA 4I5JA 4NDCA 2KSPA 1KWOB 1ZFSA 3I5FB 3FIAA 2WCEA 1KK7Y 2LVVA 2L50A 2WOSA 3PM8A 1CNPA 1BLQA 1V1GA 1ALVA 1SCMC 1YUSA 2L2EA 3I5HC 1A29A 1UWOA 1WRZA 1DGVA 1BOCA 1DJIA 4GAOA 3GK1A 1CM1A 5G08A 1PVAA 1IRJA 5D7FA 2ZNEA 3BYAA 1WRKA 4N5XA 2JPTA 4DRWA 1AP4A 2JQ6A 4OCIA 1YURA 3SG5A 2K8MB 1WDCC 2BBMA 2F8PA 1YRUB 1K2HA 1LXFC 1K9KA 3NSKA 5F6TA 2KI6D 4AQJA 3JVTC 4PCWA 1FW4A 2WCBA 3BUNB 4GFTA 1KFUS 1Y1AA 3AAJA 4ORAB 1TNXA 3DVEA 3KO0A 1IJ6A 2PALA 2RGIA 3PATA 1G8IA 2L0PA 3WXAA 1XK4C 2JNXA 1XFUO 4QJ4B 5DKNA 5AXIA 1PSRA 1A75A 1OQPA 1SR6B 1CDMA 2KI4B 4HSZA 1A75B 4N1FA 4OV2A 1SL7A 2CTNA 2M1KB 1C7VA 2L4HA 2LE9B 1SRAA 2AAOA 2BE4A 4JQ0D 4MSPA 3OB1B 1TCOB 2OTGC 3PFVA 1ZACA 1F4OA 3I5IC 3AAKA 3JTDC 4N1GA 3MSEB 1BT6A 4MEWA 1KQMB 2KFGA 1MF8B 2HPSA 2H2KA 1TTXA 1WY9A 1AVSA 1OZOA 1IWQA 2JULA 2K2FA 1S26D 2KOTA 3CS1A 4GGNA 2LHLA 4ZCVA 1DMOA 2OS8B 1CFCA 1QV1A 1ZMZA 4MRYA 1UHIA 2F2OA 5ER4X 1NCZA 3FWCA 1IH0A 4OR9B 1Y0VH 2VRGA 1RROA 1AHRA 2NCPA 2NXQA 1RFJA 2KDHA 1BMOA 4UPGA 1GGZA 1XFYO 1SL8A 1JF0A 2KFFA 1PRWA 1CLLA 3OX6A 1IQ3A 2QACA 1Y1XA 3EVRA 4YGEB 5JJGA 5AANA 1E8AA 2O60A 3O4YA 2HETA 4GBAA 5HKYA 2BL0C 3TZ1A 1NPQA 4CIDA 1JFKA 4YGCB 4DS7A 2WC8A 1CDLA 2G9BA 5KSZA 1OMDA 4AQIA 3NSIA 2HF5A 3EKJA 1JF2A 1LKJA 2JOJA 3ZNIA 4MLWA 4YGAA 1K9UA 2M1UA 2ZKMX 3EK8A 4DUQA 3O2PA 2LC5A 2L51A 1HT9A 4HRGA 3WNXB 4BY5A 2H61A 4NQGA 2WNDA 4I5KA 3EKHA 1TNQA 1NIWA 1QX2A 2PASA 1SMGA 1XFXO 3D10A 3LL8B 3LLEA 3C1VA 2CBLA 3NSOA 2ISDA 3SIAA 1XFVO 1QX7A 1TRFA 1WRLA 3FS7A 4A4CA 1S1EA 1PVBA 2PSRA 3SG3A 1WLMA 3BXKA 1KFUL 1N2DA 1J55A 1S6JA 1XFWO 1Y1UA 1JC2A 1X02A 2MA2A 2JTTA 2BKHB 3CLNA 2BCXA 1B8CA 2NCOA 3OHMB 4PE4A 4A4BA 3NXAA 1ZOTB 4MRXA 2EGDA 2GV5A 4ICBA 4MBEA 1J1EA 1QLKA 2AUCA 1VRKA 4ETOA 1DGUA 1BR4B 1BF5A 1AUIB 4PHKA 1SCVA 1XA5A 3CTNA 3K21A 2WORA 5GQQC 2K2AA 3PN7C 1YUTA 1RJVA 2KYCA 4I5NB 4CLNA 3HCMA 5CSIA 5D69A 4E68A 2O5GA 2BCBA 2CNPA 2NLNA 5I2OA 2LNKA 3PSRA 4NDDA 3M0WA 1B47A 2L5XB 1IQ5A 3E3RA 3CR5X 1F55A 1MR8A 1RECA 2LP2A 2MLFC 1FI5A
chains in the Genus database with same CATH superfamily
1SYMA 1PALA 2KLEA 3VRNA 2ZRTA 3KHEA 3LK1A 1NYAA 1MHOA 1OMVA 1QXPA 1TOPA 1B4CA 4CPVA 1GGWA 1OOHA 3D76A 3B88A 2F2PA 2M8UA 2LM5A 1SCMB 1N65A 1BR1B 3I5HB 1PULA 2JXLA 2KGBC 1SPYA 3Q8IA 4ORCB 4IL1A 1GM0A 3UO9A 1NX2A 4M2OA 1B7TY 1B9AA 1IGVA 1W7JB 2QEHA 4JPZB 1QVIY 2KBIA 1UP5A 2L98A 3OP0A 2P70A 3EG5B 1CFDA 2M49B 5BPJA 2FJUB 1JBAA 2K7BA 1BG1A 5CSFA 4AOMA 5K89A 3RM1A 1CDNA 1S36A 1DJHA 1WDCB 2GGMA 1SL9A 1SK6D 2WCFA 3WHTB 1FI5A 3FE6A 1KFXS 1RTP1 1K95A 2PMYA 3D77A 3AKAA 3LCPC 4P5OE 3JVTB 4GUKA 2PRUA 1CDPA 1A4PA 2JRFA 5HYDA 1AJ4A 1J7PA 1KQVA 1XK4A 3UNWA 2M29A 3BFBA 3S0EA 3GK4X 2ZN9A 2JT0A 1OZSA 5B8IB 2Y4QA 1CM4A 1LA3A 2KAXA 3VROA 1L2OC 3BUXB 3CYZA 1Z4HA 1SKTA 2P6BB 1KK8C 1B1GA 1LVCD 3CZTX 2OTGB 4XJKA 2L5YA 2PVBA 3I5IB 1ODBA 3OB2B 2BKIB 4XJKB 2FJYA 4MZKA 3JTDB 2MJWB 5I2QA 4YBHB 3QRXA 4YGBB 2MLEC 1NP8A 2F3YA 4M2QA 3CWGA 4PE0A 1AK8A 2JXCA 1R2UA 2M3WA 2LV7A 3SS3A 4PHMA 2LUCA 2BBNA 5FI7A 1K93D 1KK7Z 2KFHA 1GQMA 3L47A 4GNKB 2M0RA 3SIBA 1YUUA 4QJ5B 5CPVA 4D1EA 3DVMA 1LA0A 3R1VA 1DF0A 1RWYA 3D74A 1J7QA 1DF0B 2DOQA 3GK2A 1UUSA 4XYNA 1FI6A 1EG3A 3DD4A 2COLB 2ZRSA 4PE1A 5PALA 2CCMA 2K0JA 2JT3A 1SSEB 2P71A 3A4UB 4I5LB 1CMFA 3DVKA 2JU0A 2LCPA 4L9MA 4OVNF 1YRTB 2BL0B 3VB1A 1QLSA 4OZDA 1F4QA 2AMIA 1S5GY 3PM2A 5FI2A 1ALWA 1JUOA 1QIWA 1YX7A 2HQWA 3SG4A 1CFPA 1DJYA 1CB1A 3TDZA 3AKBA 1DJZA 1UHJA 1QV0A 2LUXA 1B7TZ 5J3XA 3KEVA 2K7CA 1QVIZ 3CZ0A 2LLSA 2SASA 4M2PA 4DIRA 2QPTA 3ZWHA 2FCEA 4CFQA 3SS5A 1DVIA 2LVKA 2ZNDA 4Q04A 1DJXA 4FTGA 2LAPA 2KGRA 3CDNA 1J7OA 1DT7B 2Y1NA 5EL2A 3QMEA 3DZTA 1KFXL 2LMTA 2Y5IA 1Y6WA 5CSJA 1XO5A 1S6CA 3I5GC 2BAPA 3EK4A 5FI6A 1QIVA 1OOJA 1QTXA 3BUMB 3WHUB 1XYDA 2KQ6A 4YI8A 1BODA 1F8HA 1NX1A 4HRHA 3TS5C 5AERA 1A03A 1B8RA 1EXRA 3VRQA 1H8BA 1TNWA 1K94A 1ORGA 1MXEA 1K8UA 3I5GB 2I2RE 1M31A 4WQ2A 2KYFA 2LMUA 2MAZA 4WQ3A 1NX0A 2MBXA 4F0ZB 3TUYC 3BUOB 1HQVA 5AFPA 3L4AA 3H4SE 1BJFA 4YI9A 2L4IA 3SS4A 1IKUA 1FPWA 3IF7A 2JT8A 3PN7B 3FWBA 2A4JA 3L4LA 1EG4A 5I94A 1K90D 1TIZA 2KHNA 1KWOC 2EHBA 3I5FC 5KTYA 1G33A 4OKHA 4GPLB 4CFRA 1SY9A 1RK9A 2WC5A 3OX5A 5HKWA 2WCLA 3EK7A 1CLMA 3CR4X 4YGDB 1UHKA 1YVLA 4U8DA 4C0KA 1SW8A 1DJGA 1KSOA 2I18A 5HLVA 1C07A 4PALA 2EC6C 3BFHA 2F33A 2LVJA 3DVJA 3KPXA 1K9PA 2QEBA 3BOWA 1W7IB 3EVVA 1QX5B 2JC2A 1MXLC 2I7AA 2KI6C 2JTZA 3BOWB 3DXLA 3EVUA 2Y1MA 3NSLA 4QJ3B 1QATA 4PHJA 3TDIA 1EL4A 2ZFDA 2M7NA 3GOFA 1XVJA 5CSNA 3RZSA 2BCAA 1S5GZ 2K7DA 3IVTA 1JWDA 2WCHA 2EC6B 4ORBB 1L7ZA 5KU1A 5I8NA 3K1EA 1XFZO 3BQ3A 5ER5A 3SJSA 1M46A 1QASA 2LANA 4MZLA 1CTRA 2JZIA 3CR2A 3DYEA 2F3ZA 1QJTA 1N0YA 2BE6A 3TDUA 1J7RA 1NCXA 1NUBA 1SR6C 2KI4C 2KQYA 1CMGA 4DCKA 2KBMA 5HL1A 3PJIA 2KAYA 4PE7A 3ICBA 1G4YR 2IS9A 1CFFA 2LLUA 1IG5A 4C0LA 2BECA 2LP3A 5TNCA 1DJWA 5HKZA 1CKKA 1L2OB 1KQMC 1F70A 1KK8B 4BY4A 4INWA 1R6PA 1OE9B 2OS8C 2KLDA 5DKRA 1C7WA 2JWWA 1OOGA 1OSAA 1DTLA 1WLZA 1IJ5A 1BU3A 3PALA 5JOLA 1B8LA 1TWOA 2SCPA 3VRRA 1MQ1A 1TNPA 1UURA 4PDZA 4JWQA 3BUWB 2LMVA 1Z2CB 4WRIA 3NGVA 5HLOA 1NWDA 2GGZA 2D8NA 1F71A 2LVIA 3D75A 3R1OA 4FQTA 1MWNA 1SNLA 2MHHA 3SG2A 1LINA 1U5IA 4PT1A 4P2YB 2LLTA 1U5IB 4R1EA 4F7FA 2Q4UA 3RLZA 1S3PA 2M97A 1FBVA 1ZUZA 1NX3A 3VRPA 1TN4A 3D73A 1J1DA 1GJYA 5DICA 4MN0A 2PYQA 5AEQA 1UHHA 1DELA 1CLBA 1TUJA 1Q80A 1YTZC 3F45A 4MZJA 1YX8A 1M39A 3SG6A 2ZN8A 2M7LA 3D0YA 1EJ3A 2B1UA 3D0YB 2H61C 1NCYA 3IQQA 3DF0A 3O6BA 3DF0B 2K60A 3PLFB 3S0FA 4NDBA 1KCYA 3NHIA 3S0GA 2KAVA 1PSBA 3HX4A 3LK0A 4HREE 3O78A 2V53A 1DEKA 2M9GA 2KNEA 1OMRA 2CT9A 1NSHA 2FOTA 1JSAA 2K61A 2WCJA 3N7HA 2I94A 4C0JA 1YR5A 2YGUA 5FYXA 2G2BA 3IQOA 5IBWA 1W9ZA 1T14A 4GGFA 2E6WA 3A8RA 1D1OA 1M45A 5DKQA 1TCFA 3KF9A 4TNCA 1IIOA 3B87A 1V1FA 4ZCUA 3CGAA 2TN4A 4YRUA 3B7AA 3TS5B 3OGNA 1YVHA 1AJ5A 1MUXA 4USLA 1A2XA 1PK0D 1EH2A 2LHIA 2Q91A 1UHNA 1K96A 2CXJA 2FCDA 2K7OA 2WC6A 3TUYB 1XFRA 5I2LA 2NZ0A 4PHNA 1F54A 1KSMA 1QS7A 2MRDA 3VGOA 1FF1A 2R2IA 1SBJA 4FQOA 1OW4A 4GGFC 2QEVA 1S6IA 4MVFA 2OPOA 1M63B 2HQ8A 2JNFA 3SG7A 2E30A 1H4BA 1OOFA 4I5JA 2KSPA 4NDCA 1KWOB 1ZFSA 3I5FB 3FIAA 2WCEA 1KK7Y 2LVVA 2L50A 2WOSA 3PM8A 2WCMA 1CNPA 1OOIX 1BLQA 1V1GA 1ALVA 1C3ZA 1SCMC 1YUSA 2L2EA 3I5HC 1A29A 1UWOA 1WRZA 1DGVA 1BOCA 1DJIA 4GAOA 3GK1A 1CM1A 5G08A 1PVAA 1IRJA 5D7FA 3B86A 2ZNEA 3BYAA 1WRKA 4N5XA 2JPTA 4DRWA 1AP4A 2JQ6A 4OCIA 1YURA 3SG5A 2K8MB 1WDCC 2BBMA 2F8PA 1YRUB 1JFJA 1K2HA 1LXFC 1K9KA 3NSKA 5F6TA 2JPOA 2KI6D 4AQJA 3JVTC 3OBVA 4PCWA 1FW4A 2WCBA 3BUNB 3NHTA 4GFTA 4IJ7A 1KFUS 1Y1AA 3AAJA 4ORAB 1TNXA 3DVEA 3KO0A 3O4XA 1IJ6A 2PALA 2RGIA 3R72A 3PATA 1G8IA 2L0PA 3WXAA 1XK4C 2JNXA 3R1PA 1XFUO 4QJ4B 5DKNA 5AXIA 1PSRA 1A75A 1OQPA 1SR6B 1CDMA 2KI4B 4HSZA 1A75B 4N1FA 4OV2A 1SL7A 2CTNA 2M1KB 1C7VA 2L4HA 2LE9B 1SRAA 2AAOA 2BE4A 4JQ0D 3DY9A 4MSPA 3OB1B 1TCOB 2OTGC 3PFVA 1ZACA 1F4OA 3I5IC 3AAKA 3JTDC 4N1GA 2ERBA 3MSEB 1BT6A 4MEWA 1KQMB 1DC1A 2QEOA 2KFGA 1MF8B 2HPSA 2H2KA 1TTXA 1WY9A 1AVSA 1OZOA 1IWQA 2JULA 2K2FA 1S26D 2KOTA 3CS1A 4GGNA 2LHLA 4ZCVA 1DMOA 2OS8B 1CFCA 1QV1A 1ZMZA 4MRYA 3CZ2A 1UHIA 2F2OA 5ER4X 1NCZA 3FWCA 1IH0A 4OR9B 1Y0VH 2VRGA 1RROA 1AHRA 2NCPA 2NXQA 1RFJA 2KDHA 1BMOA 4UPGA 1GGZA 1XFYO 1SL8A 1JF0A 2KFFA 1PRWA 1CLLA 3OX6A 3S0AA 2KPHA 2QACA 1IQ3A 1Y1XA 2H8VA 3EVRA 4YGEB 5JJGA 5AANA 1E8AA 2O60A 3O4YA 3V2LA 2HETA 4GBAA 4JD9A 4JKTA 5HKYA 2BL0C 2GTEA 1QWVA 3FE8A 3TZ1A 1NPQA 4CIDA 1JFKA 3CZ1A 4YGCB 4DS7A 2QDIA 2WC8A 1CDLA 2G9BA 5KSZA 1OMDA 4AQIA 3NSIA 2HF5A 3EKJA 1JF2A 1LKJA 2JOJA 3ZNIA 4MLWA 4YGAA 1K9UA 2M1UA 2ZKMX 3EK8A 2WCKA 3S0DA 4DUQA 3O2PA 2LC5A 2L51A 1HT9A 4HRGA 3D78A 3WNXB 2H61A 4NQGA 4BY5A 4KYNA 2WNDA 4I5KA 3EKHA 1TNQA 1NIWA 1QX2A 2PASA 1SMGA 1XFXO 3D10A 3LL8B 3LLEA 3C1VA 2CBLA 3NSOA 1TUZA 2ISDA 1XFVO 4INXA 1QX7A 3SIAA 1TRFA 1WRLA 3FS7A 4A4CA 1S1EA 1PVBA 2PSRA 3SG3A 1WLMA 1C3YA 3CABA 3BXKA 1KFUL 1N2DA 1J55A 1S6JA 1XFWO 1Y1UA 3FE9A 1JC2A 1X02A 2MA2A 2JTTA 2BKHB 3CLNA 2BCXA 1B8CA 2NCOA 3OHMB 4PE4A 1P28A 3S0BA 4A4BA 3NXAA 1ZOTB 4MRXA 2EGDA 2GV5A 4ICBA 4MBEA 1J1EA 1QLKA 2AUCA 1VRKA 4ETOA 1DGUA 1BR4B 1BF5A 1LS8A 1AUIB 4PHKA 1SCVA 1XA5A 3CTNA 3K21A 2WORA 5GQQC 2K2AA 3PN7C 1YUTA 1RJVA 2KYCA 2PQLA 4I5NB 4CLNA 1DQEA 3HCMA 5CSIA 2L2CA 5D69A 3B6XA 2O5GA 2BCBA 4E68A 2CNPA 2NLNA 5I2OA 2LNKA 3PSRA 2BNXA 4NDDA 3M0WA 1B47A 2L5XB 3BFAA 1IQ5A 3E3RA 3CR5X 5D3OA 1F55A 1MR8A 1RECA 2LP2A 2MLFC 3BJHA
chains in the Genus database with same CATH topology
1SYMA 1PALA 3VRNA 2ZRTA 3KHEA 3LK1A 1NYAA 1MHOA 1OMVA 1QXPA 1TOPA 1B4CA 4CPVA 1GGWA 2F2PA 2M8UA 2LM5A 1SCMB 1N65A 1BR1B 3I5HB 1PULA 2JXLA 2KGBC 1SPYA 4ORCB 4IL1A 1NX2A 4M2OA 1B7TY 1B9AA 1IGVA 1W7JB 4JPZB 1QVIY 2KBIA 1UP5A 2L98A 3OP0A 1CFDA 2M49B 5BPJA 2FJUB 1JBAA 2K7BA 1BG1A 5CSFA 4AOMA 5K89A 3RM1A 1CDNA 1S36A 1DJHA 1WDCB 2GGMA 1SL9A 1SK6D 2WCFA 3WHTB 1KFXS 1RTP1 1K95A 2PMYA 3LCPC 3AKAA 4P5OE 3JVTB 4GUKA 2PRUA 1CDPA 1A4PA 2JRFA 5HYDA 1AJ4A 1J7PA 1KQVA 1XK4A 2M29A 3GK4X 2ZN9A 2JT0A 1OZSA 5B8IB 2Y4QA 1CM4A 1LA3A 2KAXA 3VROA 1L2OC 3BUXB 2P6BB 1SKTA 1KK8C 1B1GA 1LVCD 3CZTX 2OTGB 4XJKA 2PVBA 3I5IB 1ODBA 3OB2B 2BKIB 4XJKB 4MZKA 5I2QA 3JTDB 2MJWB 4YBHB 3QRXA 4YGBB 2MLEC 1NP8A 2F3YA 4M2QA 3CWGA 4PE0A 1AK8A 2JXCA 1R2UA 2M3WA 2LV7A 4PHMA 2LUCA 2BBNA 1K93D 1KK7Z 2KFHA 1GQMA 4GNKB 2M0RA 3SIBA 1YUUA 4QJ5B 5CPVA 4D1EA 3DVMA 1LA0A 1DF0A 1RWYA 1J7QA 1DF0B 2DOQA 3GK2A 1UUSA 4XYNA 1FI6A 1EG3A 3DD4A 2COLB 2ZRSA 4PE1A 5PALA 2CCMA 2K0JA 2JT3A 4I5LB 3A4UB 1CMFA 3DVKA 2JU0A 2LCPA 4L9MA 4OVNF 1YRTB 2BL0B 1QLSA 1F4QA 2AMIA 1S5GY 1CFPA 1ALWA 1JUOA 1QIWA 1YX7A 2HQWA 3SG4A 1CB1A 1DJYA 3TDZA 3AKBA 1DJZA 1UHJA 1QV0A 2LUXA 1B7TZ 5J3XA 3KEVA 2K7CA 1QVIZ 2LLSA 2SASA 4M2PA 4DIRA 2QPTA 3ZWHA 2FCEA 4CFQA 1DVIA 2LVKA 2ZNDA 4Q04A 1DJXA 4FTGA 2LAPA 2KGRA 1J7OA 1DT7B 2Y1NA 1KFXL 2LMTA 2Y5IA 1Y6WA 5CSJA 1XO5A 1S6CA 3I5GC 3EK4A 1QIVA 1OOJA 1QTXA 3BUMB 3WHUB 1XYDA 2KQ6A 4YI8A 1BODA 1F8HA 1NX1A 4HRHA 3TS5C 5AERA 1A03A 1B8RA 1EXRA 3VRQA 1H8BA 1TNWA 1K94A 1MXEA 1K8UA 3I5GB 2I2RE 1M31A 4WQ2A 2KYFA 2LMUA 2MAZA 4WQ3A 1NX0A 2MBXA 4F0ZB 3TUYC 3BUOB 1HQVA 5AFPA 3H4SE 1BJFA 4YI9A 2L4IA 1IKUA 1FPWA 3IF7A 2JT8A 3PN7B 3FWBA 2A4JA 1EG4A 1K90D 1TIZA 2KHNA 1KWOC 2EHBA 3I5FC 5KTYA 1G33A 4OKHA 4GPLB 4CFRA 1SY9A 1RK9A 3OX5A 5HKWA 3EK7A 1CLMA 3CR4X 4YGDB 1UHKA 1YVLA 4U8DA 4C0KA 1SW8A 1DJGA 1KSOA 2I18A 5HLVA 1C07A 4PALA 2EC6C 3KPXA 2F33A 2LVJA 3DVJA 1JFJA 1K9PA 3BOWA 1W7IB 3EVVA 1QX5B 2JC2A 1MXLC 2I7AA 2KI6C 2JTZA 3BOWB 3EVUA 3NSLA 2Y1MA 4QJ3B 1QATA 4PHJA 3TDIA 1EL4A 2ZFDA 2M7NA 3GOFA 1XVJA 5CSNA 2BCAA 1S5GZ 2K7DA 1JWDA 2EC6B 4ORBB 1L7ZA 5KU1A 5I8NA 1XFZO 3BQ3A 5ER5A 3SJSA 1M46A 1QASA 2LANA 4MZLA 1CTRA 2JZIA 3CR2A 2F3ZA 1QJTA 1N0YA 2BE6A 3TDUA 1J7RA 1NCXA 1NUBA 1SR6C 2KI4C 2KQYA 1CMGA 4DCKA 2KBMA 2KAYA 4PE7A 3ICBA 1G4YR 2IS9A 1CFFA 2LLUA 1IG5A 4C0LA 2BECA 2LP3A 5TNCA 1DJWA 5HKZA 1CKKA 1L2OB 1KQMC 1F70A 1KK8B 4BY4A 1R6PA 1OE9B 2OS8C 5DKRA 1C7WA 2JWWA 1OSAA 1DTLA 1WLZA 1IJ5A 1BU3A 3PALA 5JOLA 1B8LA 3VRRA 2SCPA 1MQ1A 1TNPA 1UURA 4PDZA 4JWQA 3BUWB 2LMVA 4WRIA 5HLOA 1NWDA 2GGZA 2D8NA 1F71A 2LVIA 1MWNA 1SNLA 2MHHA 3SG2A 1LINA 1U5IA 4P2YB 2LLTA 1U5IB 4R1EA 2Q4UA 3RLZA 1S3PA 2M97A 1FBVA 1ZUZA 1NX3A 3VRPA 1TN4A 1J1DA 1GJYA 4MN0A 5AEQA 1UHHA 1CLBA 1Q80A 1YTZC 3F45A 4MZJA 1YX8A 1M39A 3SG6A 2ZN8A 2M7LA 3D0YA 1EJ3A 2B1UA 3D0YB 2H61C 1NCYA 3IQQA 3DF0A 3O6BA 3DF0B 3PLFB 4NDBA 1KCYA 2KAVA 1PSBA 3HX4A 3LK0A 4HREE 3O78A 2V53A 2M9GA 2KNEA 1OMRA 2CT9A 1NSHA 2FOTA 1JSAA 2K61A 4C0JA 2I94A 1YR5A 5FYXA 2G2BA 3IQOA 5IBWA 4GGFA 2E6WA 3A8RA 1D1OA 1M45A 5DKQA 1TCFA 3KF9A 4TNCA 1V1FA 4ZCUA 3CGAA 2TN4A 4YRUA 3TS5B 1YVHA 1AJ5A 1MUXA 4USLA 1A2XA 1PK0D 1EH2A 2LHIA 2Q91A 1UHNA 1K96A 2CXJA 2FCDA 2K7OA 3TUYB 5I2LA 2NZ0A 4PHNA 1F54A 1KSMA 1QS7A 2MRDA 3VGOA 1FF1A 2R2IA 1SBJA 4FQOA 4GGFC 1S6IA 4MVFA 2OPOA 1M63B 2HQ8A 2JNFA 3SG7A 2E30A 1H4BA 4I5JA 4NDCA 2KSPA 1KWOB 1ZFSA 3I5FB 3FIAA 2WCEA 1KK7Y 2LVVA 2L50A 2WOSA 3PM8A 1CNPA 1BLQA 1V1GA 1ALVA 1SCMC 1YUSA 2L2EA 3I5HC 1A29A 1UWOA 1WRZA 1DGVA 1BOCA 1DJIA 4GAOA 3GK1A 1CM1A 5G08A 1PVAA 1IRJA 5D7FA 2ZNEA 3BYAA 1WRKA 4N5XA 2JPTA 4DRWA 1AP4A 2JQ6A 4OCIA 1YURA 3SG5A 2K8MB 1WDCC 2BBMA 2F8PA 1YRUB 1K2HA 1LXFC 1K9KA 3NSKA 5F6TA 2KI6D 4AQJA 3JVTC 4PCWA 1FW4A 2WCBA 3BUNB 4GFTA 1KFUS 1Y1AA 3AAJA 4ORAB 1TNXA 3DVEA 3KO0A 1IJ6A 2PALA 2RGIA 3PATA 1G8IA 2L0PA 3WXAA 1XK4C 2JNXA 1XFUO 4QJ4B 5DKNA 5AXIA 1PSRA 1A75A 1OQPA 1SR6B 1CDMA 2KI4B 4HSZA 1A75B 4N1FA 4OV2A 1SL7A 2CTNA 2M1KB 1C7VA 2L4HA 2LE9B 1SRAA 2AAOA 2BE4A 4JQ0D 4MSPA 3OB1B 1TCOB 2OTGC 3PFVA 1ZACA 1F4OA 3I5IC 3AAKA 3JTDC 4N1GA 3MSEB 1BT6A 4MEWA 1KQMB 2KFGA 1MF8B 2HPSA 2H2KA 1TTXA 1WY9A 1AVSA 1OZOA 1IWQA 2JULA 2K2FA 1S26D 2KOTA 3CS1A 4GGNA 2LHLA 4ZCVA 1DMOA 2OS8B 1CFCA 1QV1A 1ZMZA 4MRYA 1UHIA 2F2OA 5ER4X 1NCZA 3FWCA 1IH0A 4OR9B 1Y0VH 2VRGA 1RROA 1AHRA 2NCPA 2NXQA 1RFJA 2KDHA 1BMOA 4UPGA 1GGZA 1XFYO 1SL8A 1JF0A 2KFFA 1PRWA 1CLLA 3OX6A 1IQ3A 2QACA 1Y1XA 3EVRA 4YGEB 5JJGA 5AANA 1E8AA 2O60A 3O4YA 2HETA 4GBAA 5HKYA 2BL0C 3TZ1A 1NPQA 4CIDA 1JFKA 4YGCB 4DS7A 2WC8A 1CDLA 2G9BA 5KSZA 1OMDA 4AQIA 3NSIA 2HF5A 3EKJA 1JF2A 1LKJA 2JOJA 3ZNIA 4MLWA 4YGAA 1K9UA 2M1UA 2ZKMX 3EK8A 4DUQA 3O2PA 2LC5A 2L51A 1HT9A 4HRGA 3WNXB 4BY5A 2H61A 4NQGA 2WNDA 4I5KA 3EKHA 1TNQA 1NIWA 1QX2A 2PASA 1SMGA 1XFXO 3D10A 3LL8B 3LLEA 3C1VA 2CBLA 3NSOA 2ISDA 3SIAA 1XFVO 1QX7A 1TRFA 1WRLA 3FS7A 4A4CA 1S1EA 1PVBA 2PSRA 3SG3A 1WLMA 3BXKA 1KFUL 1N2DA 1J55A 1S6JA 1XFWO 1Y1UA 1JC2A 1X02A 2MA2A 2JTTA 2BKHB 3CLNA 2BCXA 1B8CA 2NCOA 3OHMB 4PE4A 4A4BA 3NXAA 1ZOTB 4MRXA 2EGDA 2GV5A 4ICBA 4MBEA 1J1EA 1QLKA 2AUCA 1VRKA 4ETOA 1DGUA 1BR4B 1BF5A 1AUIB 4PHKA 1SCVA 1XA5A 3CTNA 3K21A 2WORA 5GQQC 2K2AA 3PN7C 1YUTA 1RJVA 2KYCA 4I5NB 4CLNA 3HCMA 5CSIA 5D69A 4E68A 2O5GA 2BCBA 2CNPA 2NLNA 5I2OA 2LNKA 3PSRA 4NDDA 3M0WA 1B47A 2L5XB 1IQ5A 3E3RA 3CR5X 1F55A 1MR8A 1RECA 2LP2A 2MLFC 1FI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYM A;  1PAL A;  3VRN A;  2ZRT A;  3KHE A;  3LK1 A;  1NYA A;  1MHO A;  1OMV A;  1QXP A;  1TOP A;  1B4C A;  4CPV A;  1GGW A;  2F2P A;  2M8U A;  2LM5 A;  1SCM B;  1N65 A;  1BR1 B;  3I5H B;  1PUL A;  2JXL A;  2KGB C;  1SPY A;  4ORC B;  4IL1 A;  1NX2 A;  4M2O A;  1B7T Y;  1B9A A;  1IGV A;  1W7J B;  4JPZ B;  1QVI Y;  2KBI A;  1UP5 A;  2L98 A;  3OP0 A;  1CFD A;  2M49 B;  5BPJ A;  2FJU B;  1JBA A;  2K7B A;  1BG1 A;  5CSF A;  4AOM A;  5K89 A;  3RM1 A;  1CDN A;  1S36 A;  1DJH A;  1WDC B;  2GGM A;  1SL9 A;  1SK6 D;  2WCF A;  3WHT B;  1KFX S;  1RTP 1;  1K95 A;  2PMY A;  3LCP C;  3AKA A;  4P5O E;  3JVT B;  4GUK A;  2PRU A;  1CDP A;  1A4P A;  2JRF A;  5HYD A;  1AJ4 A;  1J7P A;  1KQV A;  1XK4 A;  2M29 A;  3GK4 X;  2ZN9 A;  2JT0 A;  1OZS A;  5B8I B;  2Y4Q A;  1CM4 A;  1LA3 A;  2KAX A;  3VRO A;  1L2O C;  3BUX B;  2P6B B;  1SKT A;  1KK8 C;  1B1G A;  1LVC D;  3CZT X;  2OTG B;  4XJK A;  2PVB A;  3I5I B;  1ODB A;  3OB2 B;  2BKI B;  4XJK B;  4MZK A;  5I2Q A;  3JTD B;  2MJW B;  4YBH B;  3QRX A;  4YGB B;  2MLE C;  1NP8 A;  2F3Y A;  4M2Q A;  3CWG A;  4PE0 A;  1AK8 A;  2JXC A;  1R2U A;  2M3W A;  2LV7 A;  4PHM A;  2LUC A;  2BBN A;  1K93 D;  1KK7 Z;  2KFH A;  1GQM A;  4GNK B;  2M0R A;  3SIB A;  1YUU A;  4QJ5 B;  5CPV A;  4D1E A;  3DVM A;  1LA0 A;  1DF0 A;  1RWY A;  1J7Q A;  1DF0 B;  2DOQ A;  3GK2 A;  1UUS A;  4XYN A;  1FI6 A;  1EG3 A;  3DD4 A;  2COL B;  2ZRS A;  4PE1 A;  5PAL A;  2CCM A;  2K0J A;  2JT3 A;  4I5L B;  3A4U B;  1CMF A;  3DVK A;  2JU0 A;  2LCP A;  4L9M A;  4OVN F;  1YRT B;  2BL0 B;  1QLS A;  1F4Q A;  2AMI A;  1S5G Y;  1CFP A;  1ALW A;  1JUO A;  1QIW A;  1YX7 A;  2HQW A;  3SG4 A;  1CB1 A;  1DJY A;  3TDZ A;  3AKB A;  1DJZ A;  1UHJ A;  1QV0 A;  2LUX A;  1B7T Z;  5J3X A;  3KEV A;  2K7C A;  1QVI Z;  2LLS A;  2SAS A;  4M2P A;  4DIR A;  2QPT A;  3ZWH A;  2FCE A;  4CFQ A;  1DVI A;  2LVK A;  2ZND A;  4Q04 A;  1DJX A;  4FTG A;  2LAP A;  2KGR A;  1J7O A;  1DT7 B;  2Y1N A;  1KFX L;  2LMT A;  2Y5I A;  1Y6W A;  5CSJ A;  1XO5 A;  1S6C A;  3I5G C;  3EK4 A;  1QIV A;  1OOJ A;  1QTX A;  3BUM B;  3WHU B;  1XYD A;  2KQ6 A;  4YI8 A;  1BOD A;  1F8H A;  1NX1 A;  4HRH A;  3TS5 C;  5AER A;  1A03 A;  1B8R A;  1EXR A;  3VRQ A;  1H8B A;  1TNW A;  1K94 A;  1MXE A;  1K8U A;  3I5G B;  2I2R E;  1M31 A;  4WQ2 A;  2KYF A;  2LMU A;  2MAZ A;  4WQ3 A;  1NX0 A;  2MBX A;  4F0Z B;  3TUY C;  3BUO B;  1HQV A;  5AFP A;  3H4S E;  1BJF A;  4YI9 A;  2L4I A;  1IKU A;  1FPW A;  3IF7 A;  2JT8 A;  3PN7 B;  3FWB A;  2A4J A;  1EG4 A;  1K90 D;  1TIZ A;  2KHN A;  1KWO C;  2EHB A;  3I5F C;  5KTY A;  1G33 A;  4OKH A;  4GPL B;  4CFR A;  1SY9 A;  1RK9 A;  3OX5 A;  5HKW A;  3EK7 A;  1CLM A;  3CR4 X;  4YGD B;  1UHK A;  1YVL A;  4U8D A;  4C0K A;  1SW8 A;  1DJG A;  1KSO A;  2I18 A;  5HLV A;  1C07 A;  4PAL A;  2EC6 C;  3KPX A;  2F33 A;  2LVJ A;  3DVJ A;  1JFJ A;  1K9P A;  3BOW A;  1W7I B;  3EVV A;  1QX5 B;  2JC2 A;  1MXL C;  2I7A A;  2KI6 C;  2JTZ A;  3BOW B;  3EVU A;  3NSL A;  2Y1M A;  4QJ3 B;  1QAT A;  4PHJ A;  3TDI A;  1EL4 A;  2ZFD A;  2M7N A;  3GOF A;  1XVJ A;  5CSN A;  2BCA A;  1S5G Z;  2K7D A;  1JWD A;  2EC6 B;  4ORB B;  1L7Z A;  5KU1 A;  5I8N A;  1XFZ O;  3BQ3 A;  5ER5 A;  3SJS A;  1M46 A;  1QAS A;  2LAN A;  4MZL A;  1CTR A;  2JZI A;  3CR2 A;  2F3Z A;  1QJT A;  1N0Y A;  2BE6 A;  3TDU A;  1J7R A;  1NCX A;  1NUB A;  1SR6 C;  2KI4 C;  2KQY A;  1CMG A;  4DCK A;  2KBM A;  2KAY A;  4PE7 A;  3ICB A;  1G4Y R;  2IS9 A;  1CFF A;  2LLU A;  1IG5 A;  4C0L A;  2BEC A;  2LP3 A;  5TNC A;  1DJW A;  5HKZ A;  1CKK A;  1L2O B;  1KQM C;  1F70 A;  1KK8 B;  4BY4 A;  1R6P A;  1OE9 B;  2OS8 C;  5DKR A;  1C7W A;  2JWW A;  1OSA A;  1DTL A;  1WLZ A;  1IJ5 A;  1BU3 A;  3PAL A;  5JOL A;  1B8L A;  3VRR A;  2SCP A;  1MQ1 A;  1TNP A;  1UUR A;  4PDZ A;  4JWQ A;  3BUW B;  2LMV A;  4WRI A;  5HLO A;  1NWD A;  2GGZ A;  2D8N A;  1F71 A;  2LVI A;  1MWN A;  1SNL A;  2MHH A;  3SG2 A;  1LIN A;  1U5I A;  4P2Y B;  2LLT A;  1U5I B;  4R1E A;  2Q4U A;  3RLZ A;  1S3P A;  2M97 A;  1FBV A;  1ZUZ A;  1NX3 A;  3VRP A;  1TN4 A;  1J1D A;  1GJY A;  4MN0 A;  5AEQ A;  1UHH A;  1CLB A;  1Q80 A;  1YTZ C;  3F45 A;  4MZJ A;  1YX8 A;  1M39 A;  3SG6 A;  2ZN8 A;  2M7L A;  3D0Y A;  1EJ3 A;  2B1U A;  3D0Y B;  2H61 C;  1NCY A;  3IQQ A;  3DF0 A;  3O6B A;  3DF0 B;  3PLF B;  4NDB A;  1KCY A;  2KAV A;  1PSB A;  3HX4 A;  3LK0 A;  4HRE E;  3O78 A;  2V53 A;  2M9G A;  2KNE A;  1OMR A;  2CT9 A;  1NSH A;  2FOT A;  1JSA A;  2K61 A;  4C0J A;  2I94 A;  1YR5 A;  5FYX A;  2G2B A;  3IQO A;  5IBW A;  4GGF A;  2E6W A;  3A8R A;  1D1O A;  1M45 A;  5DKQ A;  1TCF A;  3KF9 A;  4TNC A;  1V1F A;  4ZCU A;  3CGA A;  2TN4 A;  4YRU A;  3TS5 B;  1YVH A;  1AJ5 A;  1MUX A;  4USL A;  1A2X A;  1PK0 D;  1EH2 A;  2LHI A;  2Q91 A;  1UHN A;  1K96 A;  2CXJ A;  2FCD A;  2K7O A;  3TUY B;  5I2L A;  2NZ0 A;  4PHN A;  1F54 A;  1KSM A;  1QS7 A;  2MRD A;  3VGO A;  1FF1 A;  2R2I A;  1SBJ A;  4FQO A;  4GGF C;  1S6I A;  4MVF A;  2OPO A;  1M63 B;  2HQ8 A;  2JNF A;  3SG7 A;  2E30 A;  1H4B A;  4I5J A;  4NDC A;  2KSP A;  1KWO B;  1ZFS A;  3I5F B;  3FIA A;  2WCE A;  1KK7 Y;  2LVV A;  2L50 A;  2WOS A;  3PM8 A;  1CNP A;  1BLQ A;  1V1G A;  1ALV A;  1SCM C;  1YUS A;  2L2E A;  3I5H C;  1A29 A;  1UWO A;  1WRZ A;  1DGV A;  1BOC A;  1DJI A;  4GAO A;  3GK1 A;  1CM1 A;  5G08 A;  1PVA A;  1IRJ A;  5D7F A;  2ZNE A;  3BYA A;  1WRK A;  4N5X A;  2JPT A;  4DRW A;  1AP4 A;  2JQ6 A;  4OCI A;  1YUR A;  3SG5 A;  2K8M B;  1WDC C;  2BBM A;  2F8P A;  1YRU B;  1K2H A;  1LXF C;  1K9K A;  3NSK A;  5F6T A;  2KI6 D;  4AQJ A;  3JVT C;  4PCW A;  1FW4 A;  2WCB A;  3BUN B;  4GFT A;  1KFU S;  1Y1A A;  3AAJ A;  4ORA B;  1TNX A;  3DVE A;  3KO0 A;  1IJ6 A;  2PAL A;  2RGI A;  3PAT A;  1G8I A;  2L0P A;  3WXA A;  1XK4 C;  2JNX A;  1XFU O;  4QJ4 B;  5DKN A;  5AXI A;  1PSR A;  1A75 A;  1OQP A;  1SR6 B;  1CDM A;  2KI4 B;  4HSZ A;  1A75 B;  4N1F A;  4OV2 A;  1SL7 A;  2CTN A;  2M1K B;  1C7V A;  2L4H A;  2LE9 B;  1SRA A;  2AAO A;  2BE4 A;  4JQ0 D;  4MSP A;  3OB1 B;  1TCO B;  2OTG C;  3PFV A;  1ZAC A;  1F4O A;  3I5I C;  3AAK A;  3JTD C;  4N1G A;  3MSE B;  1BT6 A;  4MEW A;  1KQM B;  2KFG A;  1MF8 B;  2HPS A;  2H2K A;  1TTX A;  1WY9 A;  1AVS A;  1OZO A;  1IWQ A;  2JUL A;  2K2F A;  1S26 D;  2KOT A;  3CS1 A;  4GGN A;  2LHL A;  4ZCV A;  1DMO A;  2OS8 B;  1CFC A;  1QV1 A;  1ZMZ A;  4MRY A;  1UHI A;  2F2O A;  5ER4 X;  1NCZ A;  3FWC A;  1IH0 A;  4OR9 B;  1Y0V H;  2VRG A;  1RRO A;  1AHR A;  2NCP A;  2NXQ A;  1RFJ A;  2KDH A;  1BMO A;  4UPG A;  1GGZ A;  1XFY O;  1SL8 A;  1JF0 A;  2KFF A;  1PRW A;  1CLL A;  3OX6 A;  1IQ3 A;  2QAC A;  1Y1X A;  3EVR A;  4YGE B;  5JJG A;  5AAN A;  1E8A A;  2O60 A;  3O4Y A;  2HET A;  4GBA A;  5HKY A;  2BL0 C;  3TZ1 A;  1NPQ A;  4CID A;  1JFK A;  4YGC B;  4DS7 A;  2WC8 A;  1CDL A;  2G9B A;  5KSZ A;  1OMD A;  4AQI A;  3NSI A;  2HF5 A;  3EKJ A;  1JF2 A;  1LKJ A;  2JOJ A;  3ZNI A;  4MLW A;  4YGA A;  1K9U A;  2M1U A;  2ZKM X;  3EK8 A;  4DUQ A;  3O2P A;  2LC5 A;  2L51 A;  1HT9 A;  4HRG A;  3WNX B;  4BY5 A;  2H61 A;  4NQG A;  2WND A;  4I5K A;  3EKH A;  1TNQ A;  1NIW A;  1QX2 A;  2PAS A;  1SMG A;  1XFX O;  3D10 A;  3LL8 B;  3LLE A;  3C1V A;  2CBL A;  3NSO A;  2ISD A;  3SIA A;  1XFV O;  1QX7 A;  1TRF A;  1WRL A;  3FS7 A;  4A4C A;  1S1E A;  1PVB A;  2PSR A;  3SG3 A;  1WLM A;  3BXK A;  1KFU L;  1N2D A;  1J55 A;  1S6J A;  1XFW O;  1Y1U A;  1JC2 A;  1X02 A;  2MA2 A;  2JTT A;  2BKH B;  3CLN A;  2BCX A;  1B8C A;  2NCO A;  3OHM B;  4PE4 A;  4A4B A;  3NXA A;  1ZOT B;  4MRX A;  2EGD A;  2GV5 A;  4ICB A;  4MBE A;  1J1E A;  1QLK A;  2AUC A;  1VRK A;  4ETO A;  1DGU A;  1BR4 B;  1BF5 A;  1AUI B;  4PHK A;  1SCV A;  1XA5 A;  3CTN A;  3K21 A;  2WOR A;  5GQQ C;  2K2A A;  3PN7 C;  1YUT A;  1RJV A;  2KYC A;  4I5N B;  4CLN A;  3HCM A;  5CSI A;  5D69 A;  4E68 A;  2O5G A;  2BCB A;  2CNP A;  2NLN A;  5I2O A;  2LNK A;  3PSR A;  4NDD A;  3M0W A;  1B47 A;  2L5X B;  1IQ5 A;  3E3R A;  3CR5 X;  1F55 A;  1MR8 A;  1REC A;  2LP2 A;  2MLF C;  1FI5 A; 
#chains in the Genus database with same CATH topology
 1SYM A;  1PAL A;  2KLE A;  3VRN A;  2ZRT A;  3KHE A;  3LK1 A;  1NYA A;  1MHO A;  1OMV A;  1QXP A;  1TOP A;  1B4C A;  4CPV A;  1GGW A;  1OOH A;  3D76 A;  3B88 A;  2F2P A;  2M8U A;  2LM5 A;  1SCM B;  1N65 A;  1BR1 B;  3I5H B;  1PUL A;  2JXL A;  2KGB C;  1SPY A;  3Q8I A;  4ORC B;  4IL1 A;  1GM0 A;  3UO9 A;  1NX2 A;  4M2O A;  1B7T Y;  1B9A A;  1IGV A;  1W7J B;  2QEH A;  4JPZ B;  1QVI Y;  2KBI A;  1UP5 A;  2L98 A;  3OP0 A;  2P70 A;  3EG5 B;  1CFD A;  2M49 B;  5BPJ A;  2FJU B;  1JBA A;  2K7B A;  1BG1 A;  5CSF A;  4AOM A;  5K89 A;  3RM1 A;  1CDN A;  1S36 A;  1DJH A;  1WDC B;  2GGM A;  1SL9 A;  1SK6 D;  2WCF A;  3WHT B;  1FI5 A;  3FE6 A;  1KFX S;  1RTP 1;  1K95 A;  2PMY A;  3D77 A;  3AKA A;  3LCP C;  4P5O E;  3JVT B;  4GUK A;  2PRU A;  1CDP A;  1A4P A;  2JRF A;  5HYD A;  1AJ4 A;  1J7P A;  1KQV A;  1XK4 A;  3UNW A;  2M29 A;  3BFB A;  3S0E A;  3GK4 X;  2ZN9 A;  2JT0 A;  1OZS A;  5B8I B;  2Y4Q A;  1CM4 A;  1LA3 A;  2KAX A;  3VRO A;  1L2O C;  3BUX B;  3CYZ A;  1Z4H A;  1SKT A;  2P6B B;  1KK8 C;  1B1G A;  1LVC D;  3CZT X;  2OTG B;  4XJK A;  2L5Y A;  2PVB A;  3I5I B;  1ODB A;  3OB2 B;  2BKI B;  4XJK B;  2FJY A;  4MZK A;  3JTD B;  2MJW B;  5I2Q A;  4YBH B;  3QRX A;  4YGB B;  2MLE C;  1NP8 A;  2F3Y A;  4M2Q A;  3CWG A;  4PE0 A;  1AK8 A;  2JXC A;  1R2U A;  2M3W A;  2LV7 A;  3SS3 A;  4PHM A;  2LUC A;  2BBN A;  5FI7 A;  1K93 D;  1KK7 Z;  2KFH A;  1GQM A;  3L47 A;  4GNK B;  2M0R A;  3SIB A;  1YUU A;  4QJ5 B;  5CPV A;  4D1E A;  3DVM A;  1LA0 A;  3R1V A;  1DF0 A;  1RWY A;  3D74 A;  1J7Q A;  1DF0 B;  2DOQ A;  3GK2 A;  1UUS A;  4XYN A;  1FI6 A;  1EG3 A;  3DD4 A;  2COL B;  2ZRS A;  4PE1 A;  5PAL A;  2CCM A;  2K0J A;  2JT3 A;  1SSE B;  2P71 A;  3A4U B;  4I5L B;  1CMF A;  3DVK A;  2JU0 A;  2LCP A;  4L9M A;  4OVN F;  1YRT B;  2BL0 B;  3VB1 A;  1QLS A;  4OZD A;  1F4Q A;  2AMI A;  1S5G Y;  3PM2 A;  5FI2 A;  1ALW A;  1JUO A;  1QIW A;  1YX7 A;  2HQW A;  3SG4 A;  1CFP A;  1DJY A;  1CB1 A;  3TDZ A;  3AKB A;  1DJZ A;  1UHJ A;  1QV0 A;  2LUX A;  1B7T Z;  5J3X A;  3KEV A;  2K7C A;  1QVI Z;  3CZ0 A;  2LLS A;  2SAS A;  4M2P A;  4DIR A;  2QPT A;  3ZWH A;  2FCE A;  4CFQ A;  3SS5 A;  1DVI A;  2LVK A;  2ZND A;  4Q04 A;  1DJX A;  4FTG A;  2LAP A;  2KGR A;  3CDN A;  1J7O A;  1DT7 B;  2Y1N A;  5EL2 A;  3QME A;  3DZT A;  1KFX L;  2LMT A;  2Y5I A;  1Y6W A;  5CSJ A;  1XO5 A;  1S6C A;  3I5G C;  2BAP A;  3EK4 A;  5FI6 A;  1QIV A;  1OOJ A;  1QTX A;  3BUM B;  3WHU B;  1XYD A;  2KQ6 A;  4YI8 A;  1BOD A;  1F8H A;  1NX1 A;  4HRH A;  3TS5 C;  5AER A;  1A03 A;  1B8R A;  1EXR A;  3VRQ A;  1H8B A;  1TNW A;  1K94 A;  1ORG A;  1MXE A;  1K8U A;  3I5G B;  2I2R E;  1M31 A;  4WQ2 A;  2KYF A;  2LMU A;  2MAZ A;  4WQ3 A;  1NX0 A;  2MBX A;  4F0Z B;  3TUY C;  3BUO B;  1HQV A;  5AFP A;  3L4A A;  3H4S E;  1BJF A;  4YI9 A;  2L4I A;  3SS4 A;  1IKU A;  1FPW A;  3IF7 A;  2JT8 A;  3PN7 B;  3FWB A;  2A4J A;  3L4L A;  1EG4 A;  5I94 A;  1K90 D;  1TIZ A;  2KHN A;  1KWO C;  2EHB A;  3I5F C;  5KTY A;  1G33 A;  4OKH A;  4GPL B;  4CFR A;  1SY9 A;  1RK9 A;  2WC5 A;  3OX5 A;  5HKW A;  2WCL A;  3EK7 A;  1CLM A;  3CR4 X;  4YGD B;  1UHK A;  1YVL A;  4U8D A;  4C0K A;  1SW8 A;  1DJG A;  1KSO A;  2I18 A;  5HLV A;  1C07 A;  4PAL A;  2EC6 C;  3BFH A;  2F33 A;  2LVJ A;  3DVJ A;  3KPX A;  1K9P A;  2QEB A;  3BOW A;  1W7I B;  3EVV A;  1QX5 B;  2JC2 A;  1MXL C;  2I7A A;  2KI6 C;  2JTZ A;  3BOW B;  3DXL A;  3EVU A;  2Y1M A;  3NSL A;  4QJ3 B;  1QAT A;  4PHJ A;  3TDI A;  1EL4 A;  2ZFD A;  2M7N A;  3GOF A;  1XVJ A;  5CSN A;  3RZS A;  2BCA A;  1S5G Z;  2K7D A;  3IVT A;  1JWD A;  2WCH A;  2EC6 B;  4ORB B;  1L7Z A;  5KU1 A;  5I8N A;  3K1E A;  1XFZ O;  3BQ3 A;  5ER5 A;  3SJS A;  1M46 A;  1QAS A;  2LAN A;  4MZL A;  1CTR A;  2JZI A;  3CR2 A;  3DYE A;  2F3Z A;  1QJT A;  1N0Y A;  2BE6 A;  3TDU A;  1J7R A;  1NCX A;  1NUB A;  1SR6 C;  2KI4 C;  2KQY A;  1CMG A;  4DCK A;  2KBM A;  5HL1 A;  3PJI A;  2KAY A;  4PE7 A;  3ICB A;  1G4Y R;  2IS9 A;  1CFF A;  2LLU A;  1IG5 A;  4C0L A;  2BEC A;  2LP3 A;  5TNC A;  1DJW A;  5HKZ A;  1CKK A;  1L2O B;  1KQM C;  1F70 A;  1KK8 B;  4BY4 A;  4INW A;  1R6P A;  1OE9 B;  2OS8 C;  2KLD A;  5DKR A;  1C7W A;  2JWW A;  1OOG A;  1OSA A;  1DTL A;  1WLZ A;  1IJ5 A;  1BU3 A;  3PAL A;  5JOL A;  1B8L A;  1TWO A;  2SCP A;  3VRR A;  1MQ1 A;  1TNP A;  1UUR A;  4PDZ A;  4JWQ A;  3BUW B;  2LMV A;  1Z2C B;  4WRI A;  3NGV A;  5HLO A;  1NWD A;  2GGZ A;  2D8N A;  1F71 A;  2LVI A;  3D75 A;  3R1O A;  4FQT A;  1MWN A;  1SNL A;  2MHH A;  3SG2 A;  1LIN A;  1U5I A;  4PT1 A;  4P2Y B;  2LLT A;  1U5I B;  4R1E A;  4F7F A;  2Q4U A;  3RLZ A;  1S3P A;  2M97 A;  1FBV A;  1ZUZ A;  1NX3 A;  3VRP A;  1TN4 A;  3D73 A;  1J1D A;  1GJY A;  5DIC A;  4MN0 A;  2PYQ A;  5AEQ A;  1UHH A;  1DEL A;  1CLB A;  1TUJ A;  1Q80 A;  1YTZ C;  3F45 A;  4MZJ A;  1YX8 A;  1M39 A;  3SG6 A;  2ZN8 A;  2M7L A;  3D0Y A;  1EJ3 A;  2B1U A;  3D0Y B;  2H61 C;  1NCY A;  3IQQ A;  3DF0 A;  3O6B A;  3DF0 B;  2K60 A;  3PLF B;  3S0F A;  4NDB A;  1KCY A;  3NHI A;  3S0G A;  2KAV A;  1PSB A;  3HX4 A;  3LK0 A;  4HRE E;  3O78 A;  2V53 A;  1DEK A;  2M9G A;  2KNE A;  1OMR A;  2CT9 A;  1NSH A;  2FOT A;  1JSA A;  2K61 A;  2WCJ A;  3N7H A;  2I94 A;  4C0J A;  1YR5 A;  2YGU A;  5FYX A;  2G2B A;  3IQO A;  5IBW A;  1W9Z A;  1T14 A;  4GGF A;  2E6W A;  3A8R A;  1D1O A;  1M45 A;  5DKQ A;  1TCF A;  3KF9 A;  4TNC A;  1IIO A;  3B87 A;  1V1F A;  4ZCU A;  3CGA A;  2TN4 A;  4YRU A;  3B7A A;  3TS5 B;  3OGN A;  1YVH A;  1AJ5 A;  1MUX A;  4USL A;  1A2X A;  1PK0 D;  1EH2 A;  2LHI A;  2Q91 A;  1UHN A;  1K96 A;  2CXJ A;  2FCD A;  2K7O A;  2WC6 A;  3TUY B;  1XFR A;  5I2L A;  2NZ0 A;  4PHN A;  1F54 A;  1KSM A;  1QS7 A;  2MRD A;  3VGO A;  1FF1 A;  2R2I A;  1SBJ A;  4FQO A;  1OW4 A;  4GGF C;  2QEV A;  1S6I A;  4MVF A;  2OPO A;  1M63 B;  2HQ8 A;  2JNF A;  3SG7 A;  2E30 A;  1H4B A;  1OOF A;  4I5J A;  2KSP A;  4NDC A;  1KWO B;  1ZFS A;  3I5F B;  3FIA A;  2WCE A;  1KK7 Y;  2LVV A;  2L50 A;  2WOS A;  3PM8 A;  2WCM A;  1CNP A;  1OOI X;  1BLQ A;  1V1G A;  1ALV A;  1C3Z A;  1SCM C;  1YUS A;  2L2E A;  3I5H C;  1A29 A;  1UWO A;  1WRZ A;  1DGV A;  1BOC A;  1DJI A;  4GAO A;  3GK1 A;  1CM1 A;  5G08 A;  1PVA A;  1IRJ A;  5D7F A;  3B86 A;  2ZNE A;  3BYA A;  1WRK A;  4N5X A;  2JPT A;  4DRW A;  1AP4 A;  2JQ6 A;  4OCI A;  1YUR A;  3SG5 A;  2K8M B;  1WDC C;  2BBM A;  2F8P A;  1YRU B;  1JFJ A;  1K2H A;  1LXF C;  1K9K A;  3NSK A;  5F6T A;  2JPO A;  2KI6 D;  4AQJ A;  3JVT C;  3OBV A;  4PCW A;  1FW4 A;  2WCB A;  3BUN B;  3NHT A;  4GFT A;  4IJ7 A;  1KFU S;  1Y1A A;  3AAJ A;  4ORA B;  1TNX A;  3DVE A;  3KO0 A;  3O4X A;  1IJ6 A;  2PAL A;  2RGI A;  3R72 A;  3PAT A;  1G8I A;  2L0P A;  3WXA A;  1XK4 C;  2JNX A;  3R1P A;  1XFU O;  4QJ4 B;  5DKN A;  5AXI A;  1PSR A;  1A75 A;  1OQP A;  1SR6 B;  1CDM A;  2KI4 B;  4HSZ A;  1A75 B;  4N1F A;  4OV2 A;  1SL7 A;  2CTN A;  2M1K B;  1C7V A;  2L4H A;  2LE9 B;  1SRA A;  2AAO A;  2BE4 A;  4JQ0 D;  3DY9 A;  4MSP A;  3OB1 B;  1TCO B;  2OTG C;  3PFV A;  1ZAC A;  1F4O A;  3I5I C;  3AAK A;  3JTD C;  4N1G A;  2ERB A;  3MSE B;  1BT6 A;  4MEW A;  1KQM B;  1DC1 A;  2QEO A;  2KFG A;  1MF8 B;  2HPS A;  2H2K A;  1TTX A;  1WY9 A;  1AVS A;  1OZO A;  1IWQ A;  2JUL A;  2K2F A;  1S26 D;  2KOT A;  3CS1 A;  4GGN A;  2LHL A;  4ZCV A;  1DMO A;  2OS8 B;  1CFC A;  1QV1 A;  1ZMZ A;  4MRY A;  3CZ2 A;  1UHI A;  2F2O A;  5ER4 X;  1NCZ A;  3FWC A;  1IH0 A;  4OR9 B;  1Y0V H;  2VRG A;  1RRO A;  1AHR A;  2NCP A;  2NXQ A;  1RFJ A;  2KDH A;  1BMO A;  4UPG A;  1GGZ A;  1XFY O;  1SL8 A;  1JF0 A;  2KFF A;  1PRW A;  1CLL A;  3OX6 A;  3S0A A;  2KPH A;  2QAC A;  1IQ3 A;  1Y1X A;  2H8V A;  3EVR A;  4YGE B;  5JJG A;  5AAN A;  1E8A A;  2O60 A;  3O4Y A;  3V2L A;  2HET A;  4GBA A;  4JD9 A;  4JKT A;  5HKY A;  2BL0 C;  2GTE A;  1QWV A;  3FE8 A;  3TZ1 A;  1NPQ A;  4CID A;  1JFK A;  3CZ1 A;  4YGC B;  4DS7 A;  2QDI A;  2WC8 A;  1CDL A;  2G9B A;  5KSZ A;  1OMD A;  4AQI A;  3NSI A;  2HF5 A;  3EKJ A;  1JF2 A;  1LKJ A;  2JOJ A;  3ZNI A;  4MLW A;  4YGA A;  1K9U A;  2M1U A;  2ZKM X;  3EK8 A;  2WCK A;  3S0D A;  4DUQ A;  3O2P A;  2LC5 A;  2L51 A;  1HT9 A;  4HRG A;  3D78 A;  3WNX B;  2H61 A;  4NQG A;  4BY5 A;  4KYN A;  2WND A;  4I5K A;  3EKH A;  1TNQ A;  1NIW A;  1QX2 A;  2PAS A;  1SMG A;  1XFX O;  3D10 A;  3LL8 B;  3LLE A;  3C1V A;  2CBL A;  3NSO A;  1TUZ A;  2ISD A;  1XFV O;  4INX A;  1QX7 A;  3SIA A;  1TRF A;  1WRL A;  3FS7 A;  4A4C A;  1S1E A;  1PVB A;  2PSR A;  3SG3 A;  1WLM A;  1C3Y A;  3CAB A;  3BXK A;  1KFU L;  1N2D A;  1J55 A;  1S6J A;  1XFW O;  1Y1U A;  3FE9 A;  1JC2 A;  1X02 A;  2MA2 A;  2JTT A;  2BKH B;  3CLN A;  2BCX A;  1B8C A;  2NCO A;  3OHM B;  4PE4 A;  1P28 A;  3S0B A;  4A4B A;  3NXA A;  1ZOT B;  4MRX A;  2EGD A;  2GV5 A;  4ICB A;  4MBE A;  1J1E A;  1QLK A;  2AUC A;  1VRK A;  4ETO A;  1DGU A;  1BR4 B;  1BF5 A;  1LS8 A;  1AUI B;  4PHK A;  1SCV A;  1XA5 A;  3CTN A;  3K21 A;  2WOR A;  5GQQ C;  2K2A A;  3PN7 C;  1YUT A;  1RJV A;  2KYC A;  2PQL A;  4I5N B;  4CLN A;  1DQE A;  3HCM A;  5CSI A;  2L2C A;  5D69 A;  3B6X A;  2O5G A;  2BCB A;  4E68 A;  2CNP A;  2NLN A;  5I2O A;  2LNK A;  3PSR A;  2BNX A;  4NDD A;  3M0W A;  1B47 A;  2L5X B;  3BFA A;  1IQ5 A;  3E3R A;  3CR5 X;  5D3O A;  1F55 A;  1MR8 A;  1REC A;  2LP2 A;  2MLF C;  3BJH A; 
#chains in the Genus database with same CATH homology
 1SYM A;  1PAL A;  3VRN A;  2ZRT A;  3KHE A;  3LK1 A;  1NYA A;  1MHO A;  1OMV A;  1QXP A;  1TOP A;  1B4C A;  4CPV A;  1GGW A;  2F2P A;  2M8U A;  2LM5 A;  1SCM B;  1N65 A;  1BR1 B;  3I5H B;  1PUL A;  2JXL A;  2KGB C;  1SPY A;  4ORC B;  4IL1 A;  1NX2 A;  4M2O A;  1B7T Y;  1B9A A;  1IGV A;  1W7J B;  4JPZ B;  1QVI Y;  2KBI A;  1UP5 A;  2L98 A;  3OP0 A;  1CFD A;  2M49 B;  5BPJ A;  2FJU B;  1JBA A;  2K7B A;  1BG1 A;  5CSF A;  4AOM A;  5K89 A;  3RM1 A;  1CDN A;  1S36 A;  1DJH A;  1WDC B;  2GGM A;  1SL9 A;  1SK6 D;  2WCF A;  3WHT B;  1KFX S;  1RTP 1;  1K95 A;  2PMY A;  3LCP C;  3AKA A;  4P5O E;  3JVT B;  4GUK A;  2PRU A;  1CDP A;  1A4P A;  2JRF A;  5HYD A;  1AJ4 A;  1J7P A;  1KQV A;  1XK4 A;  2M29 A;  3GK4 X;  2ZN9 A;  2JT0 A;  1OZS A;  5B8I B;  2Y4Q A;  1CM4 A;  1LA3 A;  2KAX A;  3VRO A;  1L2O C;  3BUX B;  2P6B B;  1SKT A;  1KK8 C;  1B1G A;  1LVC D;  3CZT X;  2OTG B;  4XJK A;  2PVB A;  3I5I B;  1ODB A;  3OB2 B;  2BKI B;  4XJK B;  4MZK A;  5I2Q A;  3JTD B;  2MJW B;  4YBH B;  3QRX A;  4YGB B;  2MLE C;  1NP8 A;  2F3Y A;  4M2Q A;  3CWG A;  4PE0 A;  1AK8 A;  2JXC A;  1R2U A;  2M3W A;  2LV7 A;  4PHM A;  2LUC A;  2BBN A;  1K93 D;  1KK7 Z;  2KFH A;  1GQM A;  4GNK B;  2M0R A;  3SIB A;  1YUU A;  4QJ5 B;  5CPV A;  4D1E A;  3DVM A;  1LA0 A;  1DF0 A;  1RWY A;  1J7Q A;  1DF0 B;  2DOQ A;  3GK2 A;  1UUS A;  4XYN A;  1FI6 A;  1EG3 A;  3DD4 A;  2COL B;  2ZRS A;  4PE1 A;  5PAL A;  2CCM A;  2K0J A;  2JT3 A;  4I5L B;  3A4U B;  1CMF A;  3DVK A;  2JU0 A;  2LCP A;  4L9M A;  4OVN F;  1YRT B;  2BL0 B;  1QLS A;  1F4Q A;  2AMI A;  1S5G Y;  1CFP A;  1ALW A;  1JUO A;  1QIW A;  1YX7 A;  2HQW A;  3SG4 A;  1CB1 A;  1DJY A;  3TDZ A;  3AKB A;  1DJZ A;  1UHJ A;  1QV0 A;  2LUX A;  1B7T Z;  5J3X A;  3KEV A;  2K7C A;  1QVI Z;  2LLS A;  2SAS A;  4M2P A;  4DIR A;  2QPT A;  3ZWH A;  2FCE A;  4CFQ A;  1DVI A;  2LVK A;  2ZND A;  4Q04 A;  1DJX A;  4FTG A;  2LAP A;  2KGR A;  1J7O A;  1DT7 B;  2Y1N A;  1KFX L;  2LMT A;  2Y5I A;  1Y6W A;  5CSJ A;  1XO5 A;  1S6C A;  3I5G C;  3EK4 A;  1QIV A;  1OOJ A;  1QTX A;  3BUM B;  3WHU B;  1XYD A;  2KQ6 A;  4YI8 A;  1BOD A;  1F8H A;  1NX1 A;  4HRH A;  3TS5 C;  5AER A;  1A03 A;  1B8R A;  1EXR A;  3VRQ A;  1H8B A;  1TNW A;  1K94 A;  1MXE A;  1K8U A;  3I5G B;  2I2R E;  1M31 A;  4WQ2 A;  2KYF A;  2LMU A;  2MAZ A;  4WQ3 A;  1NX0 A;  2MBX A;  4F0Z B;  3TUY C;  3BUO B;  1HQV A;  5AFP A;  3H4S E;  1BJF A;  4YI9 A;  2L4I A;  1IKU A;  1FPW A;  3IF7 A;  2JT8 A;  3PN7 B;  3FWB A;  2A4J A;  1EG4 A;  1K90 D;  1TIZ A;  2KHN A;  1KWO C;  2EHB A;  3I5F C;  5KTY A;  1G33 A;  4OKH A;  4GPL B;  4CFR A;  1SY9 A;  1RK9 A;  3OX5 A;  5HKW A;  3EK7 A;  1CLM A;  3CR4 X;  4YGD B;  1UHK A;  1YVL A;  4U8D A;  4C0K A;  1SW8 A;  1DJG A;  1KSO A;  2I18 A;  5HLV A;  1C07 A;  4PAL A;  2EC6 C;  3KPX A;  2F33 A;  2LVJ A;  3DVJ A;  1JFJ A;  1K9P A;  3BOW A;  1W7I B;  3EVV A;  1QX5 B;  2JC2 A;  1MXL C;  2I7A A;  2KI6 C;  2JTZ A;  3BOW B;  3EVU A;  3NSL A;  2Y1M A;  4QJ3 B;  1QAT A;  4PHJ A;  3TDI A;  1EL4 A;  2ZFD A;  2M7N A;  3GOF A;  1XVJ A;  5CSN A;  2BCA A;  1S5G Z;  2K7D A;  1JWD A;  2EC6 B;  4ORB B;  1L7Z A;  5KU1 A;  5I8N A;  1XFZ O;  3BQ3 A;  5ER5 A;  3SJS A;  1M46 A;  1QAS A;  2LAN A;  4MZL A;  1CTR A;  2JZI A;  3CR2 A;  2F3Z A;  1QJT A;  1N0Y A;  2BE6 A;  3TDU A;  1J7R A;  1NCX A;  1NUB A;  1SR6 C;  2KI4 C;  2KQY A;  1CMG A;  4DCK A;  2KBM A;  2KAY A;  4PE7 A;  3ICB A;  1G4Y R;  2IS9 A;  1CFF A;  2LLU A;  1IG5 A;  4C0L A;  2BEC A;  2LP3 A;  5TNC A;  1DJW A;  5HKZ A;  1CKK A;  1L2O B;  1KQM C;  1F70 A;  1KK8 B;  4BY4 A;  1R6P A;  1OE9 B;  2OS8 C;  5DKR A;  1C7W A;  2JWW A;  1OSA A;  1DTL A;  1WLZ A;  1IJ5 A;  1BU3 A;  3PAL A;  5JOL A;  1B8L A;  3VRR A;  2SCP A;  1MQ1 A;  1TNP A;  1UUR A;  4PDZ A;  4JWQ A;  3BUW B;  2LMV A;  4WRI A;  5HLO A;  1NWD A;  2GGZ A;  2D8N A;  1F71 A;  2LVI A;  1MWN A;  1SNL A;  2MHH A;  3SG2 A;  1LIN A;  1U5I A;  4P2Y B;  2LLT A;  1U5I B;  4R1E A;  2Q4U A;  3RLZ A;  1S3P A;  2M97 A;  1FBV A;  1ZUZ A;  1NX3 A;  3VRP A;  1TN4 A;  1J1D A;  1GJY A;  4MN0 A;  5AEQ A;  1UHH A;  1CLB A;  1Q80 A;  1YTZ C;  3F45 A;  4MZJ A;  1YX8 A;  1M39 A;  3SG6 A;  2ZN8 A;  2M7L A;  3D0Y A;  1EJ3 A;  2B1U A;  3D0Y B;  2H61 C;  1NCY A;  3IQQ A;  3DF0 A;  3O6B A;  3DF0 B;  3PLF B;  4NDB A;  1KCY A;  2KAV A;  1PSB A;  3HX4 A;  3LK0 A;  4HRE E;  3O78 A;  2V53 A;  2M9G A;  2KNE A;  1OMR A;  2CT9 A;  1NSH A;  2FOT A;  1JSA A;  2K61 A;  4C0J A;  2I94 A;  1YR5 A;  5FYX A;  2G2B A;  3IQO A;  5IBW A;  4GGF A;  2E6W A;  3A8R A;  1D1O A;  1M45 A;  5DKQ A;  1TCF A;  3KF9 A;  4TNC A;  1V1F A;  4ZCU A;  3CGA A;  2TN4 A;  4YRU A;  3TS5 B;  1YVH A;  1AJ5 A;  1MUX A;  4USL A;  1A2X A;  1PK0 D;  1EH2 A;  2LHI A;  2Q91 A;  1UHN A;  1K96 A;  2CXJ A;  2FCD A;  2K7O A;  3TUY B;  5I2L A;  2NZ0 A;  4PHN A;  1F54 A;  1KSM A;  1QS7 A;  2MRD A;  3VGO A;  1FF1 A;  2R2I A;  1SBJ A;  4FQO A;  4GGF C;  1S6I A;  4MVF A;  2OPO A;  1M63 B;  2HQ8 A;  2JNF A;  3SG7 A;  2E30 A;  1H4B A;  4I5J A;  4NDC A;  2KSP A;  1KWO B;  1ZFS A;  3I5F B;  3FIA A;  2WCE A;  1KK7 Y;  2LVV A;  2L50 A;  2WOS A;  3PM8 A;  1CNP A;  1BLQ A;  1V1G A;  1ALV A;  1SCM C;  1YUS A;  2L2E A;  3I5H C;  1A29 A;  1UWO A;  1WRZ A;  1DGV A;  1BOC A;  1DJI A;  4GAO A;  3GK1 A;  1CM1 A;  5G08 A;  1PVA A;  1IRJ A;  5D7F A;  2ZNE A;  3BYA A;  1WRK A;  4N5X A;  2JPT A;  4DRW A;  1AP4 A;  2JQ6 A;  4OCI A;  1YUR A;  3SG5 A;  2K8M B;  1WDC C;  2BBM A;  2F8P A;  1YRU B;  1K2H A;  1LXF C;  1K9K A;  3NSK A;  5F6T A;  2KI6 D;  4AQJ A;  3JVT C;  4PCW A;  1FW4 A;  2WCB A;  3BUN B;  4GFT A;  1KFU S;  1Y1A A;  3AAJ A;  4ORA B;  1TNX A;  3DVE A;  3KO0 A;  1IJ6 A;  2PAL A;  2RGI A;  3PAT A;  1G8I A;  2L0P A;  3WXA A;  1XK4 C;  2JNX A;  1XFU O;  4QJ4 B;  5DKN A;  5AXI A;  1PSR A;  1A75 A;  1OQP A;  1SR6 B;  1CDM A;  2KI4 B;  4HSZ A;  1A75 B;  4N1F A;  4OV2 A;  1SL7 A;  2CTN A;  2M1K B;  1C7V A;  2L4H A;  2LE9 B;  1SRA A;  2AAO A;  2BE4 A;  4JQ0 D;  4MSP A;  3OB1 B;  1TCO B;  2OTG C;  3PFV A;  1ZAC A;  1F4O A;  3I5I C;  3AAK A;  3JTD C;  4N1G A;  3MSE B;  1BT6 A;  4MEW A;  1KQM B;  2KFG A;  1MF8 B;  2HPS A;  2H2K A;  1TTX A;  1WY9 A;  1AVS A;  1OZO A;  1IWQ A;  2JUL A;  2K2F A;  1S26 D;  2KOT A;  3CS1 A;  4GGN A;  2LHL A;  4ZCV A;  1DMO A;  2OS8 B;  1CFC A;  1QV1 A;  1ZMZ A;  4MRY A;  1UHI A;  2F2O A;  5ER4 X;  1NCZ A;  3FWC A;  1IH0 A;  4OR9 B;  1Y0V H;  2VRG A;  1RRO A;  1AHR A;  2NCP A;  2NXQ A;  1RFJ A;  2KDH A;  1BMO A;  4UPG A;  1GGZ A;  1XFY O;  1SL8 A;  1JF0 A;  2KFF A;  1PRW A;  1CLL A;  3OX6 A;  1IQ3 A;  2QAC A;  1Y1X A;  3EVR A;  4YGE B;  5JJG A;  5AAN A;  1E8A A;  2O60 A;  3O4Y A;  2HET A;  4GBA A;  5HKY A;  2BL0 C;  3TZ1 A;  1NPQ A;  4CID A;  1JFK A;  4YGC B;  4DS7 A;  2WC8 A;  1CDL A;  2G9B A;  5KSZ A;  1OMD A;  4AQI A;  3NSI A;  2HF5 A;  3EKJ A;  1JF2 A;  1LKJ A;  2JOJ A;  3ZNI A;  4MLW A;  4YGA A;  1K9U A;  2M1U A;  2ZKM X;  3EK8 A;  4DUQ A;  3O2P A;  2LC5 A;  2L51 A;  1HT9 A;  4HRG A;  3WNX B;  4BY5 A;  2H61 A;  4NQG A;  2WND A;  4I5K A;  3EKH A;  1TNQ A;  1NIW A;  1QX2 A;  2PAS A;  1SMG A;  1XFX O;  3D10 A;  3LL8 B;  3LLE A;  3C1V A;  2CBL A;  3NSO A;  2ISD A;  3SIA A;  1XFV O;  1QX7 A;  1TRF A;  1WRL A;  3FS7 A;  4A4C A;  1S1E A;  1PVB A;  2PSR A;  3SG3 A;  1WLM A;  3BXK A;  1KFU L;  1N2D A;  1J55 A;  1S6J A;  1XFW O;  1Y1U A;  1JC2 A;  1X02 A;  2MA2 A;  2JTT A;  2BKH B;  3CLN A;  2BCX A;  1B8C A;  2NCO A;  3OHM B;  4PE4 A;  4A4B A;  3NXA A;  1ZOT B;  4MRX A;  2EGD A;  2GV5 A;  4ICB A;  4MBE A;  1J1E A;  1QLK A;  2AUC A;  1VRK A;  4ETO A;  1DGU A;  1BR4 B;  1BF5 A;  1AUI B;  4PHK A;  1SCV A;  1XA5 A;  3CTN A;  3K21 A;  2WOR A;  5GQQ C;  2K2A A;  3PN7 C;  1YUT A;  1RJV A;  2KYC A;  4I5N B;  4CLN A;  3HCM A;  5CSI A;  5D69 A;  4E68 A;  2O5G A;  2BCB A;  2CNP A;  2NLN A;  5I2O A;  2LNK A;  3PSR A;  4NDD A;  3M0W A;  1B47 A;  2L5X B;  1IQ5 A;  3E3R A;  3CR5 X;  1F55 A;  1MR8 A;  1REC A;  2LP2 A;  2MLF C;  1FI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...