2JTZA

Solution structure and chemical shift assignments of the f104-to-5-flurotryptophan mutant of cardiac troponin c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
161
structure length
160
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 27
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jtzA02
1WY9A 2OS8B 1AJ5A 4WRIA 4CIDA 1RK9A 3NSOA 4GPLB 5HKWA 1Y6WA 1OE9B 1IJ6A 1SPYA 3NXAA 4I5NB 4BY5A 2E6WA 1M45A 3FIAA 4YI9A 2CXJA 2LANA 3BQ3A 5KSZA 2LLSA 2BE6A 2LNKA 2KAXA 3DVEA 2LVVA 2CT9A 4DIRA 2L50A 1L7ZA 3F45A 1NUBA 1YX8A 5FYXA 2R2IA 3OX5A 2I18A 1BMOA 4PHKA 4YI8A 4YGEB 2M7LA 2HF5A 1AVSA 2ZKMX 1GJYA 3DVKA 1V1FA 2KFHA 4R1EA 1S3PA 3CS1A 1K96A 4YRUA 2L4HA 4PE1A 2MJWB 1F4OA 1M31A 2JRFA 2JTTA 4NDDA 3SG4A 2O5GA 1L2OC 1NSHA 3BUWB 3FWBA 5HYDA 2F3YA 4E68A 1RECA 5JOLA 1F71A 3JTDB 2ZFDA 3WHTB 2HPSA 1ALVA 1QV0A 1F4QA 2BKIB 2KFFA 1IKUA 1DF0A 1OMRA 1UHJA 1TNWA 1WDCC 1NCZA 1WRLA 5G08A 4D1EA 1NIWA 1CFDA 2KI6C 1D1OA 3SG5A 1NYAA 4CLNA 1TNQA 1G8IA 4OV2A 1XFZO 4YGBB 1KSMA 4GGNA 4C0LA 1AK8A 1ZFSA 3PATA 2LVKA 3BOWA 1SCMB 3E3RA 1SL9A 1BG1A 3DVJA 1GGZA 3I5GC 2LVIA 1S26D 2I7AA 2LLUA 1RROA 3D0YA 4P2YB 1KK8C 4PCWA 1KQMB 4DS7A 2NCOA 5D69A 2HQWA 1CTRA 3BUOB 1C7WA 1S5GZ 4GAOA 1N0YA 1SKTA 3DF0A 4JWQA 2WOSA 3OB1B 2NXQA 2RGIA 5J3XA 2KBMA 1LVCD 2AAOA 4C0KA 1LKJA 3SG7A 2M1KB 1J7OA 1TCOB 4MZJA 1OMVA 1E8AA 1KWOB 2H61A 2KYFA 2KHNA 1CLLA 1XK4A 2F2PA 1JUOA 3OX6A 2OTGB 2FOTA 3EVUA 3VRQA 3KPXA 1DJGA 1DGVA 2Y5IA 1R6PA 2PALA 2EGDA 2COLB 2M97A 1SR6B 1QX2A 1PRWA 2WNDA 1S36A 1CMFA 1Q80A 4L9MA 5HKYA 1ALWA 1Y1AA 3I5HC 2JTZA 2ISDA 1PALA 2EC6C 4UPGA 1JBAA 1EL4A 2M3WA 4MRXA 4NDCA 1CB1A 1BOCA 2GGMA 1XO5A 1OZOA 4JQ0D 1UHNA 2KI4B 2F2OA 1BJFA 5KTYA 3D10A 4MVFA 1SCVA 2BCBA 4JPZB 1SK6D 4XJKA 1LXFC 1K9KA 3JVTB 1CFCA 1WRZA 4MZLA 1KCYA 2K2FA 5AERA 2VRGA 1TTXA 1XFXO 3CGAA 4ZCVA 1Y0VH 2F33A 1YRTB 1S6IA 2G2BA 2G9BA 2I2RE 2LC5A 4OR9B 5GQQC 1DTLA 1IWQA 1SW8A 2KFGA 1GGWA 3TDZA 5BPJA 4HRHA 1F70A 1B47A 1YRUB 3SIBA 1DJZA 1PVAA 4OCIA 5I8NA 2JQ6A 1MQ1A 1ZMZA 3SJSA 2LV7A 1B4CA 1K8UA 2L2EA 1J55A 2H61C 5KU1A 2KGBC 1XK4C 1M39A 1XFUO 1U5IB 1S5GY 1UURA 2SCPA 4YGAA 3NSIA 5CPVA 3GK1A 1YUUA 2D8NA 3CLNA 5I2OA 4MSPA 4TNCA 1WDCB 2LM5A 2P6BB 1B7TZ 1TCFA 2HQ8A 1WRKA 3AAKA 2WCEA 4DCKA 4WQ2A 2LP3A 5DKRA 4CFQA 2FJUB 2MBXA 2KNEA 3HCMA 4NQGA 2ZNDA 1CDLA 1K90D 1ZACA 4QJ5B 4PHMA 1MR8A 4HRGA 2BCAA 2JULA 2LE9B 3A8RA 1AJ4A 5F6TA 1FI6A 4DRWA 1J7PA 3C1VA 3I5GB 1J7QA 5TNCA 2L5XB 2ZRSA 1H4BA 2K8MB 4YGDB 5I2LA 1KK8B 4PE7A 1MXLC 2LP2A 3WXAA 2MRDA 1MHOA 1K94A 3FS7A 3RM1A 2LLTA 2Q4UA 1QASA 1C07A 1YR5A 2O60A 3KEVA 1S6CA 2CBLA 3BXKA 2QPTA 4ZCUA 1WLZA 3GK4X 3TUYB 4PHNA 4DUQA 3TDIA 2BL0B 4QJ4B 2L4IA 3GK2A 1A2XA 3QRXA 1TNXA 3I5IC 3TDUA 1OQPA 2HETA 1A75B 2LMTA 5DKQA 4A4BA 3DVMA 1RTP1 4PHJA 4MRYA 1NWDA 1VRKA 1KFUS 2JWWA 1TNPA 2CTNA 1XFVO 3PM8A 1CFPA 4HREE 2LHIA 2KSPA 1DJWA 1QIWA 3VRRA 1FPWA 2OS8C 1IGVA 2M49B 4PALA 1QLSA 5I2QA 1IQ5A 1BU3A 1MWNA 2SASA 4GNKB 1K2HA 1W7JB 1EXRA 1AHRA 2CNPA 1H8BA 1K9UA 4N1GA 1FI5A 2MLFC 4GBAA 3I5HB 3K21A 2H2KA 2EC6B 4GUKA 2BBNA 1BLQA 4GFTA 1EG4A 3NSKA 1YVLA 4PE4A 1A03A 3CR2A 1IG5A 4AQIA 1BF5A 2KQ6A 3PN7B 1SY9A 3TZ1A 2K7BA 1QLKA 3LK1A 1B7TY 3O78A 4MBEA 3AAJA 2K0JA 2M29A 2JNFA 1OMDA 4U8DA 5D7FA 3RLZA 1KFXS 2E30A 3IF7A 2JXCA 3BUMB 1JFKA 3SIAA 1UP5A 1UUSA 1SYMA 3EK8A 2M8UA 3DF0B 1DT7B 2NCPA 1B8RA 2GV5A 5HLOA 2ZRTA 1DVIA 1Y1UA 2WCFA 3HX4A 3JTDC 2KBIA 3CWGA 3PSRA 1J7RA 2L98A 5B8IB 3SG6A 4IL1A 1EH2A 3PFVA 4YBHB 4P5OE 4USLA 3I5FC 5JJGA 2K7DA 3ICBA 2Q91A 2Y4QA 1CLMA 1XA5A 3LK0A 3VROA 3VRPA 2LHLA 4MEWA 3H4SE 3FWCA 1EG3A 3IQQA 3EVVA 2BECA 1CMGA 1IH0A 2LVJA 1DJHA 3A4UB 4ORBB 1N65A 1B8CA 1ZUZA 1DMOA 2LMVA 1OZSA 4WQ3A 1KK7Z 3WNXB 1QIVA 3KHEA 3EKJA 1NP8A 4GGFA 4I5JA 1SL7A 4ETOA 1A4PA 1SBJA 1F55A 3WHUB 1YUSA 2IS9A 2WC8A 1B8LA 1QVIZ 1YX7A 1BT6A 1QS7A 4XJKB 2LAPA 3CTNA 2K61A 2JOJA 1L2OB 1HT9A 4ORAB 1XFWO 2K7CA 2WCBA 2Y1MA 3VGOA 1QTXA 1CFFA 1JC2A 5CSJA 2BKHB 3NSLA 3SG2A 2JZIA 2DOQA 2KDHA 1N2DA 2M0RA 2MLEC 1AP4A 1CDNA 1A29A 1TN4A 1DJXA 2PRUA 2JNXA 1CDPA 4C0JA 3I5IB 4NDBA 3TS5C 4OKHA 3DD4A 4FQOA 1CNPA 1PK0D 1R2UA 1XFYO 2B1UA 4AQJA 4MLWA 1QX7A 1RJVA 2MAZA 2Y1NA 1NPQA 1BR1B 4XYNA 2PASA 1B1GA 1F54A 3AKAA 1DJYA 2BCXA 2JT3A 2M1UA 2LCPA 1CLBA 2MHHA 1PVBA 1LA0A 1QXPA 5ER4X 2KI4C 3ZWHA 1S6JA 1NX3A 2JU0A 2ZN8A 5K89A 3M0WA 2M9GA 4HSZA 1KFUL 3JVTC 2K2AA 3PLFB 5HKZA 1OOJA 2L51A 1CDMA 4GGFC 4QJ3B 5CSIA 1JFJA 1X02A 2BE4A 4FTGA 2I94A 1NX2A 1PULA 1W7IB 1DGUA 3MSEB 3VRNA 1IJ5A 1K9PA 2MA2A 4ICBA 2PSRA 2AUCA 1V1GA 1K95A 1FBVA 3O6BA 1A75A 1CM1A 2KGRA 2JPTA 2LMUA 1KK7Y 5AXIA 2AMIA 5AFPA 2KAYA 1BODA 1RFJA 1DF0B 4I5KA 1F8HA 3KF9A 3CR4X 3BYAA 1Y1XA 4Q04A 1SRAA 4MN0A 4F0ZB 1UHKA 1QVIY 1PSBA 1SL8A 2L0PA 4N1FA 1KFXL 2KI6D 1G33A 3I5FB 1QX5B 1B9AA 3AKBA 3BOWB 3EKHA 1ZOTB 1SMGA 3EK7A 1KQVA 1XVJA 2A4JA 4N5XA 1CKKA 3OHMB 1FW4A 4YGCB 3O2PA 2NZ0A 2GGZA 3D0YB 3KO0A 3OP0A 2JXLA 1J1DA 2ZNEA 2K7OA 1MUXA 1S1EA 3O4YA 3CR5X 2V53A 1J1EA 5DKNA 1AUIB 4BY4A 3BUXB 1LA3A 1JWDA 2JC2A 3LL8B 3EVRA 1GQMA 2WORA 1G4YR 4M2QA 1BR4B 1M63B 2EHBA 2OPOA 3ZNIA 2F8PA 3CZTX 3TUYC 1KSOA 4M2OA 1HQVA 2QACA 2BL0C 1JF2A 2TN4A 1SNLA 1K93D 2FCEA 2F3ZA 1PSRA 4A4CA 2KYCA 1QATA 5HLVA 1LINA 1YUTA 3OB2B 5CSNA 4I5LB 1ODBA 1OSAA 1TOPA 1XYDA 2LUXA 1SCMC 5PALA 1QV1A 2FCDA 2JT8A 4ORCB 3TS5B 1EJ3A 1UWOA 1DJIA 1TIZA 5ER5A 5AANA 1QJTA 3GOFA 1KQMC 1YURA 2BBMA 1WLMA 1YVHA 4CPVA 1UHIA 2KAVA 1MXEA 2PVBA 3LCPC 3LLEA 1IRJA 5AEQA 4PDZA 2LUCA 4CFRA 1C7VA 1JF0A 1M46A 1NX1A 1CM4A 1IQ3A 1NCXA 2PMYA 3PN7C 1JSAA 4OVNF 1KWOC 3PALA 1U5IA 4MZKA 2OTGC 1TRFA 2KQYA 2NLNA 2KOTA 2CCMA 3EK4A 1UHHA 1RWYA 1MF8B 3IQOA 1NX0A 4PE0A 1YTZC 5CSFA 4AOMA 2JT0A 1FF1A 2ZN9A 3SG3A 3BUNB 5IBWA 1NCYA 1SR6C 2M7NA 4M2PA
chains in the Genus database with same CATH superfamily
1WY9A 2OS8B 1AJ5A 1ORGA 4WRIA 4CIDA 4PT1A 1RK9A 3NSOA 3S0DA 4GPLB 5HKWA 1Y6WA 1OE9B 1IJ6A 1SPYA 3NXAA 4I5NB 4BY5A 2E6WA 1M45A 3FIAA 4YI9A 2CXJA 2LANA 3BQ3A 5KSZA 2LLSA 2BE6A 2LNKA 2KAXA 3DVEA 2LVVA 2CT9A 3DZTA 3EG5B 4DIRA 3CZ2A 2L50A 1L7ZA 3F45A 1NUBA 1YX8A 5FYXA 2R2IA 3OX5A 2I18A 1BMOA 4PHKA 4YI8A 4YGEB 2M7LA 2HF5A 5FI2A 1AVSA 2L2CA 2ZKMX 1GJYA 3DVKA 2WCKA 1V1FA 2KFHA 4R1EA 1S3PA 3CS1A 1K96A 4YRUA 2L4HA 4PE1A 2MJWB 1F4OA 1M31A 2JRFA 2JTTA 2QEOA 3S0EA 4INWA 4NDDA 3SG4A 2O5GA 1L2OC 1NSHA 3BUWB 3FWBA 5HYDA 2F3YA 4E68A 1RECA 5JOLA 1F71A 3JTDB 2ZFDA 3WHTB 2HPSA 1ALVA 1QV0A 1F4QA 2BKIB 2KFFA 1IKUA 1DF0A 1OMRA 1UHJA 1TNWA 1WDCC 1NCZA 1WRLA 5G08A 4D1EA 1NIWA 1CFDA 2KI6C 1D1OA 3SG5A 1NYAA 4CLNA 1TNQA 1G8IA 4JKTA 4OV2A 3SS4A 1XFZO 4YGBB 3B88A 1KSMA 4GGNA 4C0LA 1AK8A 1ZFSA 3PATA 3S0BA 2LVKA 3BOWA 1SCMB 3E3RA 1C3YA 2PQLA 1OOHA 1SL9A 5FI7A 1BG1A 3DVJA 1IIOA 1GGZA 3I5GC 2LVIA 1S26D 2I7AA 2LLUA 1RROA 3D0YA 1Z4HA 1KK8C 4P2YB 4PCWA 1KQMB 4DS7A 2NCOA 5D69A 2HQWA 1CTRA 3BUOB 1C3ZA 1C7WA 1S5GZ 4GAOA 1N0YA 1SKTA 3DF0A 4JWQA 2WOSA 3OB1B 2NXQA 3QMEA 2RGIA 5J3XA 2KBMA 1LVCD 2AAOA 4C0KA 3L47A 1LKJA 3SG7A 2M1KB 1J7OA 1TCOB 3CZ1A 4MZJA 1OMVA 1E8AA 1KWOB 2K60A 2H61A 2KYFA 2KHNA 1CLLA 1XK4A 2F2PA 1JUOA 1DQEA 3OX6A 2OTGB 2FOTA 3BFHA 3EVUA 3VRQA 3KPXA 1Z2CB 2WC6A 1DJGA 1DGVA 2Y5IA 1R6PA 2PALA 2EGDA 2COLB 2M97A 1SR6B 1QX2A 1PRWA 2WNDA 1S36A 1CMFA 1P28A 1Q80A 4L9MA 1ALWA 1Y1AA 3I5HC 2JTZA 2ISDA 1PALA 2EC6C 4UPGA 5HKYA 1EL4A 2M3WA 4MRXA 3S0FA 4NDCA 1CB1A 2BNXA 1BOCA 2GGMA 3BFBA 1XO5A 1OZOA 3DYEA 1UHNA 4JQ0D 2KI4B 2F2OA 1BJFA 5KTYA 3D10A 4MVFA 1SCVA 2BCBA 4JPZB 1SK6D 4XJKA 1LXFC 1K9KA 3JVTB 1CFCA 1WRZA 4MZLA 1KCYA 2K2FA 5AERA 3R72A 2VRGA 1TTXA 1XFXO 3CGAA 4ZCVA 1Y0VH 2F33A 1YRTB 1S6IA 2G2BA 2G9BA 2I2RE 2LC5A 4OR9B 5GQQC 1DTLA 1IWQA 1SW8A 2KFGA 1GGWA 3CYZA 3TDZA 5BPJA 3SS5A 4HRHA 1F70A 1B47A 1YRUB 3SIBA 1DJZA 1PVAA 4OCIA 5I8NA 2JQ6A 3NGVA 1MQ1A 1ZMZA 3SJSA 2BAPA 2LV7A 1B4CA 1K8UA 2L2EA 1J55A 2H61C 5KU1A 2KGBC 1XK4C 1M39A 1XFUO 1U5IB 1S5GY 1UURA 2SCPA 4YGAA 3B7AA 3NSIA 3GK1A 1YUUA 2D8NA 2KLDA 3CLNA 5CPVA 5I2OA 3Q8IA 2KPHA 4MSPA 4TNCA 1WDCB 2LM5A 2P6BB 1B7TZ 1TCFA 2HQ8A 1WRKA 3AAKA 2WCEA 4DCKA 4WQ2A 2LP3A 5DKRA 4CFQA 2FJUB 2MBXA 2KNEA 3HCMA 4NQGA 2ZNDA 1CDLA 1K90D 1ZACA 4QJ5B 4PHMA 1MR8A 4HRGA 1LS8A 2BCAA 1OOFA 2JULA 2LE9B 3D77A 3A8RA 1AJ4A 5F6TA 3SS3A 1FI6A 4DRWA 1J7PA 3C1VA 3I5GB 1J7QA 3D75A 2L5XB 5TNCA 2ZRSA 3S0GA 1H4BA 2K8MB 4YGDB 5I2LA 1KK8B 4PE7A 1MXLC 2LP2A 3WXAA 2MRDA 1MHOA 1K94A 3FS7A 3RM1A 2LLTA 2Q4UA 1QASA 2WCMA 1C07A 1YR5A 1QWVA 2O60A 3KEVA 1S6CA 3V2LA 2CBLA 3RZSA 3BXKA 2QPTA 4ZCUA 2WC5A 1WLZA 3GK4X 3TUYB 4PHNA 4DUQA 3TDIA 2BL0B 2GTEA 4QJ4B 2L4IA 3GK2A 1A2XA 3QRXA 1TNXA 3I5IC 3TDUA 1OQPA 2HETA 1A75B 2LMTA 5DKQA 4A4BA 3DVMA 3D73A 1RTP1 2QEBA 3B6XA 4PHJA 4MRYA 1NWDA 1VRKA 3OGNA 1KFUS 2JWWA 1TNPA 2CTNA 1XFVO 3PM8A 1CFPA 1T14A 4HREE 2LHIA 3IVTA 2KSPA 1DJWA 1QIWA 3VRRA 1FPWA 2OS8C 1IGVA 2M49B 4PALA 1QLSA 5I2QA 1IQ5A 1BU3A 1MWNA 2SASA 4GNKB 1K2HA 1W7JB 1EXRA 1AHRA 2CNPA 1H8BA 1K9UA 4N1GA 1FI5A 2MLFC 4GBAA 3I5HB 3K21A 3PM2A 2H2KA 2EC6B 4GUKA 2BBNA 1BLQA 4GFTA 1DC1A 5I94A 1EG4A 3NSKA 1YVLA 4PE4A 1A03A 3CR2A 1IG5A 4AQIA 1BF5A 2KQ6A 3PN7B 1SY9A 3TZ1A 2K7BA 1QLKA 3LK1A 1B7TY 3O78A 4MBEA 3AAJA 2K0JA 2M29A 2JNFA 1OMDA 4U8DA 5D7FA 3RLZA 1KFXS 2E30A 3CABA 3IF7A 2JXCA 3BUMB 1JFKA 3SIAA 1UP5A 1UUSA 1SYMA 3EK8A 2M8UA 3D76A 3DF0B 1DT7B 2NCPA 1B8RA 2GV5A 5HLOA 2L5YA 2ZRTA 1DVIA 1Y1UA 2WCFA 3HX4A 3JTDC 2KBIA 3CWGA 3NHTA 3PSRA 1J7RA 2L98A 5B8IB 3SG6A 4IL1A 1EH2A 3PFVA 4YBHB 4P5OE 4USLA 1GM0A 3I5FC 3NHIA 5JJGA 2K7DA 3ICBA 2Q91A 2Y4QA 1CLMA 1XA5A 3LK0A 3VROA 3VRPA 2LHLA 4MEWA 3H4SE 3FWCA 1EG3A 3IQQA 3EVVA 2BECA 1CMGA 1IH0A 2LVJA 1DJHA 3A4UB 4ORBB 1N65A 1B8CA 3BJHA 3R1OA 5D3OA 4F7FA 1ZUZA 1DMOA 2LMVA 1OZSA 4WQ3A 1KK7Z 3WNXB 1W9ZA 1OOGA 3S0AA 1QIVA 3KHEA 3EKJA 1NP8A 4GGFA 4I5JA 1SL7A 4ETOA 1A4PA 1SBJA 3K1EA 1F55A 3WHUB 1YUSA 2IS9A 2QDIA 2JPOA 2WC8A 1B8LA 1QVIZ 1YX7A 1BT6A 1QS7A 3OBVA 2LAPA 3CTNA 4XJKB 2K61A 2JOJA 2KLEA 1L2OB 1HT9A 5FI6A 4ORAB 1XFWO 2K7CA 2WCBA 2Y1MA 3VGOA 1QTXA 5EL2A 3VB1A 1CFFA 5CSJA 1JC2A 2BKHB 3NSLA 3SG2A 2JZIA 2DOQA 2KDHA 1N2DA 2M0RA 1DEKA 2MLEC 1AP4A 1CDNA 2PYQA 1A29A 1TN4A 1DJXA 2PRUA 2JNXA 1CDPA 4C0JA 3I5IB 4NDBA 3TS5C 4OKHA 3BFAA 3DD4A 4FQOA 1CNPA 1PK0D 1R2UA 1XFYO 2B1UA 4AQJA 3B86A 4MLWA 1QX7A 1RJVA 2MAZA 1SSEB 5DICA 2Y1NA 1NPQA 1BR1B 4XYNA 2PASA 1B1GA 1F54A 3AKAA 1DJYA 2BCXA 2JT3A 2M1UA 2LCPA 1CLBA 2MHHA 4JD9A 3CDNA 1PVBA 3N7HA 1LA0A 1QXPA 2WCLA 5ER4X 2KI4C 2H8VA 3ZWHA 1S6JA 1NX3A 2JU0A 2ZN8A 5K89A 3M0WA 1JBAA 2M9GA 4HSZA 1KFUL 3JVTC 2K2AA 3PLFB 5HKZA 1OOJA 2L51A 1CDMA 4GGFC 4QJ3B 5CSIA 1JFJA 1X02A 2BE4A 4FTGA 2I94A 2ERBA 1NX2A 1PULA 1W7IB 1DGUA 3MSEB 3VRNA 1IJ5A 1K9PA 2MA2A 4ICBA 2PSRA 2AUCA 1V1GA 1K95A 1FBVA 3O6BA 1A75A 1CM1A 2KGRA 2JPTA 4KYNA 2LMUA 1KK7Y 5AXIA 2AMIA 2P71A 5AFPA 2KAYA 1BODA 1RFJA 1DF0B 4I5KA 4INXA 1F8HA 3KF9A 3CR4X 3BYAA 1Y1XA 4Q04A 1SRAA 4MN0A 4F0ZB 1UHKA 1QVIY 1PSBA 1SL8A 2L0PA 4N1FA 1KFXL 2KI6D 1G33A 3I5FB 1QX5B 1B9AA 3AKBA 3BOWB 3EKHA 3UNWA 1ZOTB 1SMGA 3EK7A 1KQVA 1XVJA 2A4JA 2QEVA 4N5XA 3OHMB 1CKKA 1FW4A 4YGCB 3O2PA 3R1VA 2NZ0A 2GGZA 3D0YB 3KO0A 3OP0A 3O4XA 3B87A 2JXLA 1J1DA 2ZNEA 2K7OA 1MUXA 1S1EA 3O4YA 3CR5X 2V53A 1J1EA 3CZ0A 3UO9A 5DKNA 1AUIB 4BY4A 3BUXB 1TWOA 1LA3A 1JWDA 2JC2A 3LL8B 3DXLA 3EVRA 1GQMA 2WORA 1G4YR 4M2QA 1BR4B 1M63B 2EHBA 2OPOA 3ZNIA 2F8PA 3CZTX 3TUYC 1KSOA 4M2OA 1HQVA 2QACA 2BL0C 1JF2A 1OW4A 2TN4A 1SNLA 1K93D 2FCEA 2F3ZA 1PSRA 4A4CA 2KYCA 1QATA 3L4AA 1TUZA 2QEHA 1LINA 1YUTA 3OB2B 4FQTA 5CSNA 5HLVA 4I5LB 1ODBA 3DY9A 1OSAA 1TOPA 1XYDA 2LUXA 1SCMC 5PALA 1OOIX 3FE8A 1QV1A 2FCDA 2JT8A 4ORCB 3TS5B 4OZDA 1EJ3A 1UWOA 1DJIA 1TIZA 5ER5A 5AANA 3FE9A 1QJTA 1XFRA 3GOFA 4IJ7A 2YGUA 1KQMC 1YURA 2BBMA 1WLMA 1YVHA 4CPVA 1UHIA 2KAVA 1MXEA 2PVBA 3L4LA 3LCPC 3LLEA 1IRJA 5AEQA 4PDZA 2LUCA 4CFRA 3PJIA 1C7VA 1JF0A 1M46A 1NX1A 1CM4A 1IQ3A 1NCXA 2PMYA 3PN7C 1TUJA 2P70A 3FE6A 3D78A 1JSAA 4OVNF 3D74A 1KWOC 2WCJA 2FJYA 3PALA 1U5IA 4MZKA 2OTGC 1TRFA 2KQYA 2NLNA 2WCHA 2KOTA 3R1PA 2CCMA 3EK4A 1UHHA 1RWYA 1MF8B 3IQOA 1NX0A 4PE0A 1YTZC 5CSFA 4AOMA 1DELA 2JT0A 1FF1A 2ZN9A 3SG3A 5HL1A 3BUNB 5IBWA 1NCYA 1SR6C 2M7NA 4M2PA
chains in the Genus database with same CATH topology
1WY9A 2OS8B 1AJ5A 4WRIA 4CIDA 1RK9A 3NSOA 4GPLB 5HKWA 1Y6WA 1OE9B 1IJ6A 1SPYA 3NXAA 4I5NB 4BY5A 2E6WA 1M45A 3FIAA 4YI9A 2CXJA 2LANA 3BQ3A 5KSZA 2LLSA 2BE6A 2LNKA 2KAXA 3DVEA 2LVVA 2CT9A 4DIRA 2L50A 1L7ZA 3F45A 1NUBA 1YX8A 5FYXA 2R2IA 3OX5A 2I18A 1BMOA 4PHKA 4YI8A 4YGEB 2M7LA 2HF5A 1AVSA 2ZKMX 1GJYA 3DVKA 1V1FA 2KFHA 4R1EA 1S3PA 3CS1A 1K96A 4YRUA 2L4HA 4PE1A 2MJWB 1F4OA 1M31A 2JRFA 2JTTA 4NDDA 3SG4A 2O5GA 1L2OC 1NSHA 3BUWB 3FWBA 5HYDA 2F3YA 4E68A 1RECA 5JOLA 1F71A 3JTDB 2ZFDA 3WHTB 2HPSA 1ALVA 1QV0A 1F4QA 2BKIB 2KFFA 1IKUA 1DF0A 1OMRA 1UHJA 1TNWA 1WDCC 1NCZA 1WRLA 5G08A 4D1EA 1NIWA 1CFDA 2KI6C 1D1OA 3SG5A 1NYAA 4CLNA 1TNQA 1G8IA 4OV2A 1XFZO 4YGBB 1KSMA 4GGNA 4C0LA 1AK8A 1ZFSA 3PATA 2LVKA 3BOWA 1SCMB 3E3RA 1SL9A 1BG1A 3DVJA 1GGZA 3I5GC 2LVIA 1S26D 2I7AA 2LLUA 1RROA 3D0YA 4P2YB 1KK8C 4PCWA 1KQMB 4DS7A 2NCOA 5D69A 2HQWA 1CTRA 3BUOB 1C7WA 1S5GZ 4GAOA 1N0YA 1SKTA 3DF0A 4JWQA 2WOSA 3OB1B 2NXQA 2RGIA 5J3XA 2KBMA 1LVCD 2AAOA 4C0KA 1LKJA 3SG7A 2M1KB 1J7OA 1TCOB 4MZJA 1OMVA 1E8AA 1KWOB 2H61A 2KYFA 2KHNA 1CLLA 1XK4A 2F2PA 1JUOA 3OX6A 2OTGB 2FOTA 3EVUA 3VRQA 3KPXA 1DJGA 1DGVA 2Y5IA 1R6PA 2PALA 2EGDA 2COLB 2M97A 1SR6B 1QX2A 1PRWA 2WNDA 1S36A 1CMFA 1Q80A 4L9MA 5HKYA 1ALWA 1Y1AA 3I5HC 2JTZA 2ISDA 1PALA 2EC6C 4UPGA 1JBAA 1EL4A 2M3WA 4MRXA 4NDCA 1CB1A 1BOCA 2GGMA 1XO5A 1OZOA 4JQ0D 1UHNA 2KI4B 2F2OA 1BJFA 5KTYA 3D10A 4MVFA 1SCVA 2BCBA 4JPZB 1SK6D 4XJKA 1LXFC 1K9KA 3JVTB 1CFCA 1WRZA 4MZLA 1KCYA 2K2FA 5AERA 2VRGA 1TTXA 1XFXO 3CGAA 4ZCVA 1Y0VH 2F33A 1YRTB 1S6IA 2G2BA 2G9BA 2I2RE 2LC5A 4OR9B 5GQQC 1DTLA 1IWQA 1SW8A 2KFGA 1GGWA 3TDZA 5BPJA 4HRHA 1F70A 1B47A 1YRUB 3SIBA 1DJZA 1PVAA 4OCIA 5I8NA 2JQ6A 1MQ1A 1ZMZA 3SJSA 2LV7A 1B4CA 1K8UA 2L2EA 1J55A 2H61C 5KU1A 2KGBC 1XK4C 1M39A 1XFUO 1U5IB 1S5GY 1UURA 2SCPA 4YGAA 3NSIA 5CPVA 3GK1A 1YUUA 2D8NA 3CLNA 5I2OA 4MSPA 4TNCA 1WDCB 2LM5A 2P6BB 1B7TZ 1TCFA 2HQ8A 1WRKA 3AAKA 2WCEA 4DCKA 4WQ2A 2LP3A 5DKRA 4CFQA 2FJUB 2MBXA 2KNEA 3HCMA 4NQGA 2ZNDA 1CDLA 1K90D 1ZACA 4QJ5B 4PHMA 1MR8A 4HRGA 2BCAA 2JULA 2LE9B 3A8RA 1AJ4A 5F6TA 1FI6A 4DRWA 1J7PA 3C1VA 3I5GB 1J7QA 5TNCA 2L5XB 2ZRSA 1H4BA 2K8MB 4YGDB 5I2LA 1KK8B 4PE7A 1MXLC 2LP2A 3WXAA 2MRDA 1MHOA 1K94A 3FS7A 3RM1A 2LLTA 2Q4UA 1QASA 1C07A 1YR5A 2O60A 3KEVA 1S6CA 2CBLA 3BXKA 2QPTA 4ZCUA 1WLZA 3GK4X 3TUYB 4PHNA 4DUQA 3TDIA 2BL0B 4QJ4B 2L4IA 3GK2A 1A2XA 3QRXA 1TNXA 3I5IC 3TDUA 1OQPA 2HETA 1A75B 2LMTA 5DKQA 4A4BA 3DVMA 1RTP1 4PHJA 4MRYA 1NWDA 1VRKA 1KFUS 2JWWA 1TNPA 2CTNA 1XFVO 3PM8A 1CFPA 4HREE 2LHIA 2KSPA 1DJWA 1QIWA 3VRRA 1FPWA 2OS8C 1IGVA 2M49B 4PALA 1QLSA 5I2QA 1IQ5A 1BU3A 1MWNA 2SASA 4GNKB 1K2HA 1W7JB 1EXRA 1AHRA 2CNPA 1H8BA 1K9UA 4N1GA 1FI5A 2MLFC 4GBAA 3I5HB 3K21A 2H2KA 2EC6B 4GUKA 2BBNA 1BLQA 4GFTA 1EG4A 3NSKA 1YVLA 4PE4A 1A03A 3CR2A 1IG5A 4AQIA 1BF5A 2KQ6A 3PN7B 1SY9A 3TZ1A 2K7BA 1QLKA 3LK1A 1B7TY 3O78A 4MBEA 3AAJA 2K0JA 2M29A 2JNFA 1OMDA 4U8DA 5D7FA 3RLZA 1KFXS 2E30A 3IF7A 2JXCA 3BUMB 1JFKA 3SIAA 1UP5A 1UUSA 1SYMA 3EK8A 2M8UA 3DF0B 1DT7B 2NCPA 1B8RA 2GV5A 5HLOA 2ZRTA 1DVIA 1Y1UA 2WCFA 3HX4A 3JTDC 2KBIA 3CWGA 3PSRA 1J7RA 2L98A 5B8IB 3SG6A 4IL1A 1EH2A 3PFVA 4YBHB 4P5OE 4USLA 3I5FC 5JJGA 2K7DA 3ICBA 2Q91A 2Y4QA 1CLMA 1XA5A 3LK0A 3VROA 3VRPA 2LHLA 4MEWA 3H4SE 3FWCA 1EG3A 3IQQA 3EVVA 2BECA 1CMGA 1IH0A 2LVJA 1DJHA 3A4UB 4ORBB 1N65A 1B8CA 1ZUZA 1DMOA 2LMVA 1OZSA 4WQ3A 1KK7Z 3WNXB 1QIVA 3KHEA 3EKJA 1NP8A 4GGFA 4I5JA 1SL7A 4ETOA 1A4PA 1SBJA 1F55A 3WHUB 1YUSA 2IS9A 2WC8A 1B8LA 1QVIZ 1YX7A 1BT6A 1QS7A 4XJKB 2LAPA 3CTNA 2K61A 2JOJA 1L2OB 1HT9A 4ORAB 1XFWO 2K7CA 2WCBA 2Y1MA 3VGOA 1QTXA 1CFFA 1JC2A 5CSJA 2BKHB 3NSLA 3SG2A 2JZIA 2DOQA 2KDHA 1N2DA 2M0RA 2MLEC 1AP4A 1CDNA 1A29A 1TN4A 1DJXA 2PRUA 2JNXA 1CDPA 4C0JA 3I5IB 4NDBA 3TS5C 4OKHA 3DD4A 4FQOA 1CNPA 1PK0D 1R2UA 1XFYO 2B1UA 4AQJA 4MLWA 1QX7A 1RJVA 2MAZA 2Y1NA 1NPQA 1BR1B 4XYNA 2PASA 1B1GA 1F54A 3AKAA 1DJYA 2BCXA 2JT3A 2M1UA 2LCPA 1CLBA 2MHHA 1PVBA 1LA0A 1QXPA 5ER4X 2KI4C 3ZWHA 1S6JA 1NX3A 2JU0A 2ZN8A 5K89A 3M0WA 2M9GA 4HSZA 1KFUL 3JVTC 2K2AA 3PLFB 5HKZA 1OOJA 2L51A 1CDMA 4GGFC 4QJ3B 5CSIA 1JFJA 1X02A 2BE4A 4FTGA 2I94A 1NX2A 1PULA 1W7IB 1DGUA 3MSEB 3VRNA 1IJ5A 1K9PA 2MA2A 4ICBA 2PSRA 2AUCA 1V1GA 1K95A 1FBVA 3O6BA 1A75A 1CM1A 2KGRA 2JPTA 2LMUA 1KK7Y 5AXIA 2AMIA 5AFPA 2KAYA 1BODA 1RFJA 1DF0B 4I5KA 1F8HA 3KF9A 3CR4X 3BYAA 1Y1XA 4Q04A 1SRAA 4MN0A 4F0ZB 1UHKA 1QVIY 1PSBA 1SL8A 2L0PA 4N1FA 1KFXL 2KI6D 1G33A 3I5FB 1QX5B 1B9AA 3AKBA 3BOWB 3EKHA 1ZOTB 1SMGA 3EK7A 1KQVA 1XVJA 2A4JA 4N5XA 1CKKA 3OHMB 1FW4A 4YGCB 3O2PA 2NZ0A 2GGZA 3D0YB 3KO0A 3OP0A 2JXLA 1J1DA 2ZNEA 2K7OA 1MUXA 1S1EA 3O4YA 3CR5X 2V53A 1J1EA 5DKNA 1AUIB 4BY4A 3BUXB 1LA3A 1JWDA 2JC2A 3LL8B 3EVRA 1GQMA 2WORA 1G4YR 4M2QA 1BR4B 1M63B 2EHBA 2OPOA 3ZNIA 2F8PA 3CZTX 3TUYC 1KSOA 4M2OA 1HQVA 2QACA 2BL0C 1JF2A 2TN4A 1SNLA 1K93D 2FCEA 2F3ZA 1PSRA 4A4CA 2KYCA 1QATA 5HLVA 1LINA 1YUTA 3OB2B 5CSNA 4I5LB 1ODBA 1OSAA 1TOPA 1XYDA 2LUXA 1SCMC 5PALA 1QV1A 2FCDA 2JT8A 4ORCB 3TS5B 1EJ3A 1UWOA 1DJIA 1TIZA 5ER5A 5AANA 1QJTA 3GOFA 1KQMC 1YURA 2BBMA 1WLMA 1YVHA 4CPVA 1UHIA 2KAVA 1MXEA 2PVBA 3LCPC 3LLEA 1IRJA 5AEQA 4PDZA 2LUCA 4CFRA 1C7VA 1JF0A 1M46A 1NX1A 1CM4A 1IQ3A 1NCXA 2PMYA 3PN7C 1JSAA 4OVNF 1KWOC 3PALA 1U5IA 4MZKA 2OTGC 1TRFA 2KQYA 2NLNA 2KOTA 2CCMA 3EK4A 1UHHA 1RWYA 1MF8B 3IQOA 1NX0A 4PE0A 1YTZC 5CSFA 4AOMA 2JT0A 1FF1A 2ZN9A 3SG3A 3BUNB 5IBWA 1NCYA 1SR6C 2M7NA 4M2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY9 A;  2OS8 B;  1AJ5 A;  4WRI A;  4CID A;  1RK9 A;  3NSO A;  4GPL B;  5HKW A;  1Y6W A;  1OE9 B;  1IJ6 A;  1SPY A;  3NXA A;  4I5N B;  4BY5 A;  2E6W A;  1M45 A;  3FIA A;  4YI9 A;  2CXJ A;  2LAN A;  3BQ3 A;  5KSZ A;  2LLS A;  2BE6 A;  2LNK A;  2KAX A;  3DVE A;  2LVV A;  2CT9 A;  4DIR A;  2L50 A;  1L7Z A;  3F45 A;  1NUB A;  1YX8 A;  5FYX A;  2R2I A;  3OX5 A;  2I18 A;  1BMO A;  4PHK A;  4YI8 A;  4YGE B;  2M7L A;  2HF5 A;  1AVS A;  2ZKM X;  1GJY A;  3DVK A;  1V1F A;  2KFH A;  4R1E A;  1S3P A;  3CS1 A;  1K96 A;  4YRU A;  2L4H A;  4PE1 A;  2MJW B;  1F4O A;  1M31 A;  2JRF A;  2JTT A;  4NDD A;  3SG4 A;  2O5G A;  1L2O C;  1NSH A;  3BUW B;  3FWB A;  5HYD A;  2F3Y A;  4E68 A;  1REC A;  5JOL A;  1F71 A;  3JTD B;  2ZFD A;  3WHT B;  2HPS A;  1ALV A;  1QV0 A;  1F4Q A;  2BKI B;  2KFF A;  1IKU A;  1DF0 A;  1OMR A;  1UHJ A;  1TNW A;  1WDC C;  1NCZ A;  1WRL A;  5G08 A;  4D1E A;  1NIW A;  1CFD A;  2KI6 C;  1D1O A;  3SG5 A;  1NYA A;  4CLN A;  1TNQ A;  1G8I A;  4OV2 A;  1XFZ O;  4YGB B;  1KSM A;  4GGN A;  4C0L A;  1AK8 A;  1ZFS A;  3PAT A;  2LVK A;  3BOW A;  1SCM B;  3E3R A;  1SL9 A;  1BG1 A;  3DVJ A;  1GGZ A;  3I5G C;  2LVI A;  1S26 D;  2I7A A;  2LLU A;  1RRO A;  3D0Y A;  4P2Y B;  1KK8 C;  4PCW A;  1KQM B;  4DS7 A;  2NCO A;  5D69 A;  2HQW A;  1CTR A;  3BUO B;  1C7W A;  1S5G Z;  4GAO A;  1N0Y A;  1SKT A;  3DF0 A;  4JWQ A;  2WOS A;  3OB1 B;  2NXQ A;  2RGI A;  5J3X A;  2KBM A;  1LVC D;  2AAO A;  4C0K A;  1LKJ A;  3SG7 A;  2M1K B;  1J7O A;  1TCO B;  4MZJ A;  1OMV A;  1E8A A;  1KWO B;  2H61 A;  2KYF A;  2KHN A;  1CLL A;  1XK4 A;  2F2P A;  1JUO A;  3OX6 A;  2OTG B;  2FOT A;  3EVU A;  3VRQ A;  3KPX A;  1DJG A;  1DGV A;  2Y5I A;  1R6P A;  2PAL A;  2EGD A;  2COL B;  2M97 A;  1SR6 B;  1QX2 A;  1PRW A;  2WND A;  1S36 A;  1CMF A;  1Q80 A;  4L9M A;  5HKY A;  1ALW A;  1Y1A A;  3I5H C;  2JTZ A;  2ISD A;  1PAL A;  2EC6 C;  4UPG A;  1JBA A;  1EL4 A;  2M3W A;  4MRX A;  4NDC A;  1CB1 A;  1BOC A;  2GGM A;  1XO5 A;  1OZO A;  4JQ0 D;  1UHN A;  2KI4 B;  2F2O A;  1BJF A;  5KTY A;  3D10 A;  4MVF A;  1SCV A;  2BCB A;  4JPZ B;  1SK6 D;  4XJK A;  1LXF C;  1K9K A;  3JVT B;  1CFC A;  1WRZ A;  4MZL A;  1KCY A;  2K2F A;  5AER A;  2VRG A;  1TTX A;  1XFX O;  3CGA A;  4ZCV A;  1Y0V H;  2F33 A;  1YRT B;  1S6I A;  2G2B A;  2G9B A;  2I2R E;  2LC5 A;  4OR9 B;  5GQQ C;  1DTL A;  1IWQ A;  1SW8 A;  2KFG A;  1GGW A;  3TDZ A;  5BPJ A;  4HRH A;  1F70 A;  1B47 A;  1YRU B;  3SIB A;  1DJZ A;  1PVA A;  4OCI A;  5I8N A;  2JQ6 A;  1MQ1 A;  1ZMZ A;  3SJS A;  2LV7 A;  1B4C A;  1K8U A;  2L2E A;  1J55 A;  2H61 C;  5KU1 A;  2KGB C;  1XK4 C;  1M39 A;  1XFU O;  1U5I B;  1S5G Y;  1UUR A;  2SCP A;  4YGA A;  3NSI A;  5CPV A;  3GK1 A;  1YUU A;  2D8N A;  3CLN A;  5I2O A;  4MSP A;  4TNC A;  1WDC B;  2LM5 A;  2P6B B;  1B7T Z;  1TCF A;  2HQ8 A;  1WRK A;  3AAK A;  2WCE A;  4DCK A;  4WQ2 A;  2LP3 A;  5DKR A;  4CFQ A;  2FJU B;  2MBX A;  2KNE A;  3HCM A;  4NQG A;  2ZND A;  1CDL A;  1K90 D;  1ZAC A;  4QJ5 B;  4PHM A;  1MR8 A;  4HRG A;  2BCA A;  2JUL A;  2LE9 B;  3A8R A;  1AJ4 A;  5F6T A;  1FI6 A;  4DRW A;  1J7P A;  3C1V A;  3I5G B;  1J7Q A;  5TNC A;  2L5X B;  2ZRS A;  1H4B A;  2K8M B;  4YGD B;  5I2L A;  1KK8 B;  4PE7 A;  1MXL C;  2LP2 A;  3WXA A;  2MRD A;  1MHO A;  1K94 A;  3FS7 A;  3RM1 A;  2LLT A;  2Q4U A;  1QAS A;  1C07 A;  1YR5 A;  2O60 A;  3KEV A;  1S6C A;  2CBL A;  3BXK A;  2QPT A;  4ZCU A;  1WLZ A;  3GK4 X;  3TUY B;  4PHN A;  4DUQ A;  3TDI A;  2BL0 B;  4QJ4 B;  2L4I A;  3GK2 A;  1A2X A;  3QRX A;  1TNX A;  3I5I C;  3TDU A;  1OQP A;  2HET A;  1A75 B;  2LMT A;  5DKQ A;  4A4B A;  3DVM A;  1RTP 1;  4PHJ A;  4MRY A;  1NWD A;  1VRK A;  1KFU S;  2JWW A;  1TNP A;  2CTN A;  1XFV O;  3PM8 A;  1CFP A;  4HRE E;  2LHI A;  2KSP A;  1DJW A;  1QIW A;  3VRR A;  1FPW A;  2OS8 C;  1IGV A;  2M49 B;  4PAL A;  1QLS A;  5I2Q A;  1IQ5 A;  1BU3 A;  1MWN A;  2SAS A;  4GNK B;  1K2H A;  1W7J B;  1EXR A;  1AHR A;  2CNP A;  1H8B A;  1K9U A;  4N1G A;  1FI5 A;  2MLF C;  4GBA A;  3I5H B;  3K21 A;  2H2K A;  2EC6 B;  4GUK A;  2BBN A;  1BLQ A;  4GFT A;  1EG4 A;  3NSK A;  1YVL A;  4PE4 A;  1A03 A;  3CR2 A;  1IG5 A;  4AQI A;  1BF5 A;  2KQ6 A;  3PN7 B;  1SY9 A;  3TZ1 A;  2K7B A;  1QLK A;  3LK1 A;  1B7T Y;  3O78 A;  4MBE A;  3AAJ A;  2K0J A;  2M29 A;  2JNF A;  1OMD A;  4U8D A;  5D7F A;  3RLZ A;  1KFX S;  2E30 A;  3IF7 A;  2JXC A;  3BUM B;  1JFK A;  3SIA A;  1UP5 A;  1UUS A;  1SYM A;  3EK8 A;  2M8U A;  3DF0 B;  1DT7 B;  2NCP A;  1B8R A;  2GV5 A;  5HLO A;  2ZRT A;  1DVI A;  1Y1U A;  2WCF A;  3HX4 A;  3JTD C;  2KBI A;  3CWG A;  3PSR A;  1J7R A;  2L98 A;  5B8I B;  3SG6 A;  4IL1 A;  1EH2 A;  3PFV A;  4YBH B;  4P5O E;  4USL A;  3I5F C;  5JJG A;  2K7D A;  3ICB A;  2Q91 A;  2Y4Q A;  1CLM A;  1XA5 A;  3LK0 A;  3VRO A;  3VRP A;  2LHL A;  4MEW A;  3H4S E;  3FWC A;  1EG3 A;  3IQQ A;  3EVV A;  2BEC A;  1CMG A;  1IH0 A;  2LVJ A;  1DJH A;  3A4U B;  4ORB B;  1N65 A;  1B8C A;  1ZUZ A;  1DMO A;  2LMV A;  1OZS A;  4WQ3 A;  1KK7 Z;  3WNX B;  1QIV A;  3KHE A;  3EKJ A;  1NP8 A;  4GGF A;  4I5J A;  1SL7 A;  4ETO A;  1A4P A;  1SBJ A;  1F55 A;  3WHU B;  1YUS A;  2IS9 A;  2WC8 A;  1B8L A;  1QVI Z;  1YX7 A;  1BT6 A;  1QS7 A;  4XJK B;  2LAP A;  3CTN A;  2K61 A;  2JOJ A;  1L2O B;  1HT9 A;  4ORA B;  1XFW O;  2K7C A;  2WCB A;  2Y1M A;  3VGO A;  1QTX A;  1CFF A;  1JC2 A;  5CSJ A;  2BKH B;  3NSL A;  3SG2 A;  2JZI A;  2DOQ A;  2KDH A;  1N2D A;  2M0R A;  2MLE C;  1AP4 A;  1CDN A;  1A29 A;  1TN4 A;  1DJX A;  2PRU A;  2JNX A;  1CDP A;  4C0J A;  3I5I B;  4NDB A;  3TS5 C;  4OKH A;  3DD4 A;  4FQO A;  1CNP A;  1PK0 D;  1R2U A;  1XFY O;  2B1U A;  4AQJ A;  4MLW A;  1QX7 A;  1RJV A;  2MAZ A;  2Y1N A;  1NPQ A;  1BR1 B;  4XYN A;  2PAS A;  1B1G A;  1F54 A;  3AKA A;  1DJY A;  2BCX A;  2JT3 A;  2M1U A;  2LCP A;  1CLB A;  2MHH A;  1PVB A;  1LA0 A;  1QXP A;  5ER4 X;  2KI4 C;  3ZWH A;  1S6J A;  1NX3 A;  2JU0 A;  2ZN8 A;  5K89 A;  3M0W A;  2M9G A;  4HSZ A;  1KFU L;  3JVT C;  2K2A A;  3PLF B;  5HKZ A;  1OOJ A;  2L51 A;  1CDM A;  4GGF C;  4QJ3 B;  5CSI A;  1JFJ A;  1X02 A;  2BE4 A;  4FTG A;  2I94 A;  1NX2 A;  1PUL A;  1W7I B;  1DGU A;  3MSE B;  3VRN A;  1IJ5 A;  1K9P A;  2MA2 A;  4ICB A;  2PSR A;  2AUC A;  1V1G A;  1K95 A;  1FBV A;  3O6B A;  1A75 A;  1CM1 A;  2KGR A;  2JPT A;  2LMU A;  1KK7 Y;  5AXI A;  2AMI A;  5AFP A;  2KAY A;  1BOD A;  1RFJ A;  1DF0 B;  4I5K A;  1F8H A;  3KF9 A;  3CR4 X;  3BYA A;  1Y1X A;  4Q04 A;  1SRA A;  4MN0 A;  4F0Z B;  1UHK A;  1QVI Y;  1PSB A;  1SL8 A;  2L0P A;  4N1F A;  1KFX L;  2KI6 D;  1G33 A;  3I5F B;  1QX5 B;  1B9A A;  3AKB A;  3BOW B;  3EKH A;  1ZOT B;  1SMG A;  3EK7 A;  1KQV A;  1XVJ A;  2A4J A;  4N5X A;  1CKK A;  3OHM B;  1FW4 A;  4YGC B;  3O2P A;  2NZ0 A;  2GGZ A;  3D0Y B;  3KO0 A;  3OP0 A;  2JXL A;  1J1D A;  2ZNE A;  2K7O A;  1MUX A;  1S1E A;  3O4Y A;  3CR5 X;  2V53 A;  1J1E A;  5DKN A;  1AUI B;  4BY4 A;  3BUX B;  1LA3 A;  1JWD A;  2JC2 A;  3LL8 B;  3EVR A;  1GQM A;  2WOR A;  1G4Y R;  4M2Q A;  1BR4 B;  1M63 B;  2EHB A;  2OPO A;  3ZNI A;  2F8P A;  3CZT X;  3TUY C;  1KSO A;  4M2O A;  1HQV A;  2QAC A;  2BL0 C;  1JF2 A;  2TN4 A;  1SNL A;  1K93 D;  2FCE A;  2F3Z A;  1PSR A;  4A4C A;  2KYC A;  1QAT A;  5HLV A;  1LIN A;  1YUT A;  3OB2 B;  5CSN A;  4I5L B;  1ODB A;  1OSA A;  1TOP A;  1XYD A;  2LUX A;  1SCM C;  5PAL A;  1QV1 A;  2FCD A;  2JT8 A;  4ORC B;  3TS5 B;  1EJ3 A;  1UWO A;  1DJI A;  1TIZ A;  5ER5 A;  5AAN A;  1QJT A;  3GOF A;  1KQM C;  1YUR A;  2BBM A;  1WLM A;  1YVH A;  4CPV A;  1UHI A;  2KAV A;  1MXE A;  2PVB A;  3LCP C;  3LLE A;  1IRJ A;  5AEQ A;  4PDZ A;  2LUC A;  4CFR A;  1C7V A;  1JF0 A;  1M46 A;  1NX1 A;  1CM4 A;  1IQ3 A;  1NCX A;  2PMY A;  3PN7 C;  1JSA A;  4OVN F;  1KWO C;  3PAL A;  1U5I A;  4MZK A;  2OTG C;  1TRF A;  2KQY A;  2NLN A;  2KOT A;  2CCM A;  3EK4 A;  1UHH A;  1RWY A;  1MF8 B;  3IQO A;  1NX0 A;  4PE0 A;  1YTZ C;  5CSF A;  4AOM A;  2JT0 A;  1FF1 A;  2ZN9 A;  3SG3 A;  3BUN B;  5IBW A;  1NCY A;  1SR6 C;  2M7N A;  4M2P A; 
#chains in the Genus database with same CATH topology
 1WY9 A;  2OS8 B;  1AJ5 A;  1ORG A;  4WRI A;  4CID A;  4PT1 A;  1RK9 A;  3NSO A;  3S0D A;  4GPL B;  5HKW A;  1Y6W A;  1OE9 B;  1IJ6 A;  1SPY A;  3NXA A;  4I5N B;  4BY5 A;  2E6W A;  1M45 A;  3FIA A;  4YI9 A;  2CXJ A;  2LAN A;  3BQ3 A;  5KSZ A;  2LLS A;  2BE6 A;  2LNK A;  2KAX A;  3DVE A;  2LVV A;  2CT9 A;  3DZT A;  3EG5 B;  4DIR A;  3CZ2 A;  2L50 A;  1L7Z A;  3F45 A;  1NUB A;  1YX8 A;  5FYX A;  2R2I A;  3OX5 A;  2I18 A;  1BMO A;  4PHK A;  4YI8 A;  4YGE B;  2M7L A;  2HF5 A;  5FI2 A;  1AVS A;  2L2C A;  2ZKM X;  1GJY A;  3DVK A;  2WCK A;  1V1F A;  2KFH A;  4R1E A;  1S3P A;  3CS1 A;  1K96 A;  4YRU A;  2L4H A;  4PE1 A;  2MJW B;  1F4O A;  1M31 A;  2JRF A;  2JTT A;  2QEO A;  3S0E A;  4INW A;  4NDD A;  3SG4 A;  2O5G A;  1L2O C;  1NSH A;  3BUW B;  3FWB A;  5HYD A;  2F3Y A;  4E68 A;  1REC A;  5JOL A;  1F71 A;  3JTD B;  2ZFD A;  3WHT B;  2HPS A;  1ALV A;  1QV0 A;  1F4Q A;  2BKI B;  2KFF A;  1IKU A;  1DF0 A;  1OMR A;  1UHJ A;  1TNW A;  1WDC C;  1NCZ A;  1WRL A;  5G08 A;  4D1E A;  1NIW A;  1CFD A;  2KI6 C;  1D1O A;  3SG5 A;  1NYA A;  4CLN A;  1TNQ A;  1G8I A;  4JKT A;  4OV2 A;  3SS4 A;  1XFZ O;  4YGB B;  3B88 A;  1KSM A;  4GGN A;  4C0L A;  1AK8 A;  1ZFS A;  3PAT A;  3S0B A;  2LVK A;  3BOW A;  1SCM B;  3E3R A;  1C3Y A;  2PQL A;  1OOH A;  1SL9 A;  5FI7 A;  1BG1 A;  3DVJ A;  1IIO A;  1GGZ A;  3I5G C;  2LVI A;  1S26 D;  2I7A A;  2LLU A;  1RRO A;  3D0Y A;  1Z4H A;  1KK8 C;  4P2Y B;  4PCW A;  1KQM B;  4DS7 A;  2NCO A;  5D69 A;  2HQW A;  1CTR A;  3BUO B;  1C3Z A;  1C7W A;  1S5G Z;  4GAO A;  1N0Y A;  1SKT A;  3DF0 A;  4JWQ A;  2WOS A;  3OB1 B;  2NXQ A;  3QME A;  2RGI A;  5J3X A;  2KBM A;  1LVC D;  2AAO A;  4C0K A;  3L47 A;  1LKJ A;  3SG7 A;  2M1K B;  1J7O A;  1TCO B;  3CZ1 A;  4MZJ A;  1OMV A;  1E8A A;  1KWO B;  2K60 A;  2H61 A;  2KYF A;  2KHN A;  1CLL A;  1XK4 A;  2F2P A;  1JUO A;  1DQE A;  3OX6 A;  2OTG B;  2FOT A;  3BFH A;  3EVU A;  3VRQ A;  3KPX A;  1Z2C B;  2WC6 A;  1DJG A;  1DGV A;  2Y5I A;  1R6P A;  2PAL A;  2EGD A;  2COL B;  2M97 A;  1SR6 B;  1QX2 A;  1PRW A;  2WND A;  1S36 A;  1CMF A;  1P28 A;  1Q80 A;  4L9M A;  1ALW A;  1Y1A A;  3I5H C;  2JTZ A;  2ISD A;  1PAL A;  2EC6 C;  4UPG A;  5HKY A;  1EL4 A;  2M3W A;  4MRX A;  3S0F A;  4NDC A;  1CB1 A;  2BNX A;  1BOC A;  2GGM A;  3BFB A;  1XO5 A;  1OZO A;  3DYE A;  1UHN A;  4JQ0 D;  2KI4 B;  2F2O A;  1BJF A;  5KTY A;  3D10 A;  4MVF A;  1SCV A;  2BCB A;  4JPZ B;  1SK6 D;  4XJK A;  1LXF C;  1K9K A;  3JVT B;  1CFC A;  1WRZ A;  4MZL A;  1KCY A;  2K2F A;  5AER A;  3R72 A;  2VRG A;  1TTX A;  1XFX O;  3CGA A;  4ZCV A;  1Y0V H;  2F33 A;  1YRT B;  1S6I A;  2G2B A;  2G9B A;  2I2R E;  2LC5 A;  4OR9 B;  5GQQ C;  1DTL A;  1IWQ A;  1SW8 A;  2KFG A;  1GGW A;  3CYZ A;  3TDZ A;  5BPJ A;  3SS5 A;  4HRH A;  1F70 A;  1B47 A;  1YRU B;  3SIB A;  1DJZ A;  1PVA A;  4OCI A;  5I8N A;  2JQ6 A;  3NGV A;  1MQ1 A;  1ZMZ A;  3SJS A;  2BAP A;  2LV7 A;  1B4C A;  1K8U A;  2L2E A;  1J55 A;  2H61 C;  5KU1 A;  2KGB C;  1XK4 C;  1M39 A;  1XFU O;  1U5I B;  1S5G Y;  1UUR A;  2SCP A;  4YGA A;  3B7A A;  3NSI A;  3GK1 A;  1YUU A;  2D8N A;  2KLD A;  3CLN A;  5CPV A;  5I2O A;  3Q8I A;  2KPH A;  4MSP A;  4TNC A;  1WDC B;  2LM5 A;  2P6B B;  1B7T Z;  1TCF A;  2HQ8 A;  1WRK A;  3AAK A;  2WCE A;  4DCK A;  4WQ2 A;  2LP3 A;  5DKR A;  4CFQ A;  2FJU B;  2MBX A;  2KNE A;  3HCM A;  4NQG A;  2ZND A;  1CDL A;  1K90 D;  1ZAC A;  4QJ5 B;  4PHM A;  1MR8 A;  4HRG A;  1LS8 A;  2BCA A;  1OOF A;  2JUL A;  2LE9 B;  3D77 A;  3A8R A;  1AJ4 A;  5F6T A;  3SS3 A;  1FI6 A;  4DRW A;  1J7P A;  3C1V A;  3I5G B;  1J7Q A;  3D75 A;  2L5X B;  5TNC A;  2ZRS A;  3S0G A;  1H4B A;  2K8M B;  4YGD B;  5I2L A;  1KK8 B;  4PE7 A;  1MXL C;  2LP2 A;  3WXA A;  2MRD A;  1MHO A;  1K94 A;  3FS7 A;  3RM1 A;  2LLT A;  2Q4U A;  1QAS A;  2WCM A;  1C07 A;  1YR5 A;  1QWV A;  2O60 A;  3KEV A;  1S6C A;  3V2L A;  2CBL A;  3RZS A;  3BXK A;  2QPT A;  4ZCU A;  2WC5 A;  1WLZ A;  3GK4 X;  3TUY B;  4PHN A;  4DUQ A;  3TDI A;  2BL0 B;  2GTE A;  4QJ4 B;  2L4I A;  3GK2 A;  1A2X A;  3QRX A;  1TNX A;  3I5I C;  3TDU A;  1OQP A;  2HET A;  1A75 B;  2LMT A;  5DKQ A;  4A4B A;  3DVM A;  3D73 A;  1RTP 1;  2QEB A;  3B6X A;  4PHJ A;  4MRY A;  1NWD A;  1VRK A;  3OGN A;  1KFU S;  2JWW A;  1TNP A;  2CTN A;  1XFV O;  3PM8 A;  1CFP A;  1T14 A;  4HRE E;  2LHI A;  3IVT A;  2KSP A;  1DJW A;  1QIW A;  3VRR A;  1FPW A;  2OS8 C;  1IGV A;  2M49 B;  4PAL A;  1QLS A;  5I2Q A;  1IQ5 A;  1BU3 A;  1MWN A;  2SAS A;  4GNK B;  1K2H A;  1W7J B;  1EXR A;  1AHR A;  2CNP A;  1H8B A;  1K9U A;  4N1G A;  1FI5 A;  2MLF C;  4GBA A;  3I5H B;  3K21 A;  3PM2 A;  2H2K A;  2EC6 B;  4GUK A;  2BBN A;  1BLQ A;  4GFT A;  1DC1 A;  5I94 A;  1EG4 A;  3NSK A;  1YVL A;  4PE4 A;  1A03 A;  3CR2 A;  1IG5 A;  4AQI A;  1BF5 A;  2KQ6 A;  3PN7 B;  1SY9 A;  3TZ1 A;  2K7B A;  1QLK A;  3LK1 A;  1B7T Y;  3O78 A;  4MBE A;  3AAJ A;  2K0J A;  2M29 A;  2JNF A;  1OMD A;  4U8D A;  5D7F A;  3RLZ A;  1KFX S;  2E30 A;  3CAB A;  3IF7 A;  2JXC A;  3BUM B;  1JFK A;  3SIA A;  1UP5 A;  1UUS A;  1SYM A;  3EK8 A;  2M8U A;  3D76 A;  3DF0 B;  1DT7 B;  2NCP A;  1B8R A;  2GV5 A;  5HLO A;  2L5Y A;  2ZRT A;  1DVI A;  1Y1U A;  2WCF A;  3HX4 A;  3JTD C;  2KBI A;  3CWG A;  3NHT A;  3PSR A;  1J7R A;  2L98 A;  5B8I B;  3SG6 A;  4IL1 A;  1EH2 A;  3PFV A;  4YBH B;  4P5O E;  4USL A;  1GM0 A;  3I5F C;  3NHI A;  5JJG A;  2K7D A;  3ICB A;  2Q91 A;  2Y4Q A;  1CLM A;  1XA5 A;  3LK0 A;  3VRO A;  3VRP A;  2LHL A;  4MEW A;  3H4S E;  3FWC A;  1EG3 A;  3IQQ A;  3EVV A;  2BEC A;  1CMG A;  1IH0 A;  2LVJ A;  1DJH A;  3A4U B;  4ORB B;  1N65 A;  1B8C A;  3BJH A;  3R1O A;  5D3O A;  4F7F A;  1ZUZ A;  1DMO A;  2LMV A;  1OZS A;  4WQ3 A;  1KK7 Z;  3WNX B;  1W9Z A;  1OOG A;  3S0A A;  1QIV A;  3KHE A;  3EKJ A;  1NP8 A;  4GGF A;  4I5J A;  1SL7 A;  4ETO A;  1A4P A;  1SBJ A;  3K1E A;  1F55 A;  3WHU B;  1YUS A;  2IS9 A;  2QDI A;  2JPO A;  2WC8 A;  1B8L A;  1QVI Z;  1YX7 A;  1BT6 A;  1QS7 A;  3OBV A;  2LAP A;  3CTN A;  4XJK B;  2K61 A;  2JOJ A;  2KLE A;  1L2O B;  1HT9 A;  5FI6 A;  4ORA B;  1XFW O;  2K7C A;  2WCB A;  2Y1M A;  3VGO A;  1QTX A;  5EL2 A;  3VB1 A;  1CFF A;  5CSJ A;  1JC2 A;  2BKH B;  3NSL A;  3SG2 A;  2JZI A;  2DOQ A;  2KDH A;  1N2D A;  2M0R A;  1DEK A;  2MLE C;  1AP4 A;  1CDN A;  2PYQ A;  1A29 A;  1TN4 A;  1DJX A;  2PRU A;  2JNX A;  1CDP A;  4C0J A;  3I5I B;  4NDB A;  3TS5 C;  4OKH A;  3BFA A;  3DD4 A;  4FQO A;  1CNP A;  1PK0 D;  1R2U A;  1XFY O;  2B1U A;  4AQJ A;  3B86 A;  4MLW A;  1QX7 A;  1RJV A;  2MAZ A;  1SSE B;  5DIC A;  2Y1N A;  1NPQ A;  1BR1 B;  4XYN A;  2PAS A;  1B1G A;  1F54 A;  3AKA A;  1DJY A;  2BCX A;  2JT3 A;  2M1U A;  2LCP A;  1CLB A;  2MHH A;  4JD9 A;  3CDN A;  1PVB A;  3N7H A;  1LA0 A;  1QXP A;  2WCL A;  5ER4 X;  2KI4 C;  2H8V A;  3ZWH A;  1S6J A;  1NX3 A;  2JU0 A;  2ZN8 A;  5K89 A;  3M0W A;  1JBA A;  2M9G A;  4HSZ A;  1KFU L;  3JVT C;  2K2A A;  3PLF B;  5HKZ A;  1OOJ A;  2L51 A;  1CDM A;  4GGF C;  4QJ3 B;  5CSI A;  1JFJ A;  1X02 A;  2BE4 A;  4FTG A;  2I94 A;  2ERB A;  1NX2 A;  1PUL A;  1W7I B;  1DGU A;  3MSE B;  3VRN A;  1IJ5 A;  1K9P A;  2MA2 A;  4ICB A;  2PSR A;  2AUC A;  1V1G A;  1K95 A;  1FBV A;  3O6B A;  1A75 A;  1CM1 A;  2KGR A;  2JPT A;  4KYN A;  2LMU A;  1KK7 Y;  5AXI A;  2AMI A;  2P71 A;  5AFP A;  2KAY A;  1BOD A;  1RFJ A;  1DF0 B;  4I5K A;  4INX A;  1F8H A;  3KF9 A;  3CR4 X;  3BYA A;  1Y1X A;  4Q04 A;  1SRA A;  4MN0 A;  4F0Z B;  1UHK A;  1QVI Y;  1PSB A;  1SL8 A;  2L0P A;  4N1F A;  1KFX L;  2KI6 D;  1G33 A;  3I5F B;  1QX5 B;  1B9A A;  3AKB A;  3BOW B;  3EKH A;  3UNW A;  1ZOT B;  1SMG A;  3EK7 A;  1KQV A;  1XVJ A;  2A4J A;  2QEV A;  4N5X A;  3OHM B;  1CKK A;  1FW4 A;  4YGC B;  3O2P A;  3R1V A;  2NZ0 A;  2GGZ A;  3D0Y B;  3KO0 A;  3OP0 A;  3O4X A;  3B87 A;  2JXL A;  1J1D A;  2ZNE A;  2K7O A;  1MUX A;  1S1E A;  3O4Y A;  3CR5 X;  2V53 A;  1J1E A;  3CZ0 A;  3UO9 A;  5DKN A;  1AUI B;  4BY4 A;  3BUX B;  1TWO A;  1LA3 A;  1JWD A;  2JC2 A;  3LL8 B;  3DXL A;  3EVR A;  1GQM A;  2WOR A;  1G4Y R;  4M2Q A;  1BR4 B;  1M63 B;  2EHB A;  2OPO A;  3ZNI A;  2F8P A;  3CZT X;  3TUY C;  1KSO A;  4M2O A;  1HQV A;  2QAC A;  2BL0 C;  1JF2 A;  1OW4 A;  2TN4 A;  1SNL A;  1K93 D;  2FCE A;  2F3Z A;  1PSR A;  4A4C A;  2KYC A;  1QAT A;  3L4A A;  1TUZ A;  2QEH A;  1LIN A;  1YUT A;  3OB2 B;  4FQT A;  5CSN A;  5HLV A;  4I5L B;  1ODB A;  3DY9 A;  1OSA A;  1TOP A;  1XYD A;  2LUX A;  1SCM C;  5PAL A;  1OOI X;  3FE8 A;  1QV1 A;  2FCD A;  2JT8 A;  4ORC B;  3TS5 B;  4OZD A;  1EJ3 A;  1UWO A;  1DJI A;  1TIZ A;  5ER5 A;  5AAN A;  3FE9 A;  1QJT A;  1XFR A;  3GOF A;  4IJ7 A;  2YGU A;  1KQM C;  1YUR A;  2BBM A;  1WLM A;  1YVH A;  4CPV A;  1UHI A;  2KAV A;  1MXE A;  2PVB A;  3L4L A;  3LCP C;  3LLE A;  1IRJ A;  5AEQ A;  4PDZ A;  2LUC A;  4CFR A;  3PJI A;  1C7V A;  1JF0 A;  1M46 A;  1NX1 A;  1CM4 A;  1IQ3 A;  1NCX A;  2PMY A;  3PN7 C;  1TUJ A;  2P70 A;  3FE6 A;  3D78 A;  1JSA A;  4OVN F;  3D74 A;  1KWO C;  2WCJ A;  2FJY A;  3PAL A;  1U5I A;  4MZK A;  2OTG C;  1TRF A;  2KQY A;  2NLN A;  2WCH A;  2KOT A;  3R1P A;  2CCM A;  3EK4 A;  1UHH A;  1RWY A;  1MF8 B;  3IQO A;  1NX0 A;  4PE0 A;  1YTZ C;  5CSF A;  4AOM A;  1DEL A;  2JT0 A;  1FF1 A;  2ZN9 A;  3SG3 A;  5HL1 A;  3BUN B;  5IBW A;  1NCY A;  1SR6 C;  2M7N A;  4M2P A; 
#chains in the Genus database with same CATH homology
 1WY9 A;  2OS8 B;  1AJ5 A;  4WRI A;  4CID A;  1RK9 A;  3NSO A;  4GPL B;  5HKW A;  1Y6W A;  1OE9 B;  1IJ6 A;  1SPY A;  3NXA A;  4I5N B;  4BY5 A;  2E6W A;  1M45 A;  3FIA A;  4YI9 A;  2CXJ A;  2LAN A;  3BQ3 A;  5KSZ A;  2LLS A;  2BE6 A;  2LNK A;  2KAX A;  3DVE A;  2LVV A;  2CT9 A;  4DIR A;  2L50 A;  1L7Z A;  3F45 A;  1NUB A;  1YX8 A;  5FYX A;  2R2I A;  3OX5 A;  2I18 A;  1BMO A;  4PHK A;  4YI8 A;  4YGE B;  2M7L A;  2HF5 A;  1AVS A;  2ZKM X;  1GJY A;  3DVK A;  1V1F A;  2KFH A;  4R1E A;  1S3P A;  3CS1 A;  1K96 A;  4YRU A;  2L4H A;  4PE1 A;  2MJW B;  1F4O A;  1M31 A;  2JRF A;  2JTT A;  4NDD A;  3SG4 A;  2O5G A;  1L2O C;  1NSH A;  3BUW B;  3FWB A;  5HYD A;  2F3Y A;  4E68 A;  1REC A;  5JOL A;  1F71 A;  3JTD B;  2ZFD A;  3WHT B;  2HPS A;  1ALV A;  1QV0 A;  1F4Q A;  2BKI B;  2KFF A;  1IKU A;  1DF0 A;  1OMR A;  1UHJ A;  1TNW A;  1WDC C;  1NCZ A;  1WRL A;  5G08 A;  4D1E A;  1NIW A;  1CFD A;  2KI6 C;  1D1O A;  3SG5 A;  1NYA A;  4CLN A;  1TNQ A;  1G8I A;  4OV2 A;  1XFZ O;  4YGB B;  1KSM A;  4GGN A;  4C0L A;  1AK8 A;  1ZFS A;  3PAT A;  2LVK A;  3BOW A;  1SCM B;  3E3R A;  1SL9 A;  1BG1 A;  3DVJ A;  1GGZ A;  3I5G C;  2LVI A;  1S26 D;  2I7A A;  2LLU A;  1RRO A;  3D0Y A;  4P2Y B;  1KK8 C;  4PCW A;  1KQM B;  4DS7 A;  2NCO A;  5D69 A;  2HQW A;  1CTR A;  3BUO B;  1C7W A;  1S5G Z;  4GAO A;  1N0Y A;  1SKT A;  3DF0 A;  4JWQ A;  2WOS A;  3OB1 B;  2NXQ A;  2RGI A;  5J3X A;  2KBM A;  1LVC D;  2AAO A;  4C0K A;  1LKJ A;  3SG7 A;  2M1K B;  1J7O A;  1TCO B;  4MZJ A;  1OMV A;  1E8A A;  1KWO B;  2H61 A;  2KYF A;  2KHN A;  1CLL A;  1XK4 A;  2F2P A;  1JUO A;  3OX6 A;  2OTG B;  2FOT A;  3EVU A;  3VRQ A;  3KPX A;  1DJG A;  1DGV A;  2Y5I A;  1R6P A;  2PAL A;  2EGD A;  2COL B;  2M97 A;  1SR6 B;  1QX2 A;  1PRW A;  2WND A;  1S36 A;  1CMF A;  1Q80 A;  4L9M A;  5HKY A;  1ALW A;  1Y1A A;  3I5H C;  2JTZ A;  2ISD A;  1PAL A;  2EC6 C;  4UPG A;  1JBA A;  1EL4 A;  2M3W A;  4MRX A;  4NDC A;  1CB1 A;  1BOC A;  2GGM A;  1XO5 A;  1OZO A;  4JQ0 D;  1UHN A;  2KI4 B;  2F2O A;  1BJF A;  5KTY A;  3D10 A;  4MVF A;  1SCV A;  2BCB A;  4JPZ B;  1SK6 D;  4XJK A;  1LXF C;  1K9K A;  3JVT B;  1CFC A;  1WRZ A;  4MZL A;  1KCY A;  2K2F A;  5AER A;  2VRG A;  1TTX A;  1XFX O;  3CGA A;  4ZCV A;  1Y0V H;  2F33 A;  1YRT B;  1S6I A;  2G2B A;  2G9B A;  2I2R E;  2LC5 A;  4OR9 B;  5GQQ C;  1DTL A;  1IWQ A;  1SW8 A;  2KFG A;  1GGW A;  3TDZ A;  5BPJ A;  4HRH A;  1F70 A;  1B47 A;  1YRU B;  3SIB A;  1DJZ A;  1PVA A;  4OCI A;  5I8N A;  2JQ6 A;  1MQ1 A;  1ZMZ A;  3SJS A;  2LV7 A;  1B4C A;  1K8U A;  2L2E A;  1J55 A;  2H61 C;  5KU1 A;  2KGB C;  1XK4 C;  1M39 A;  1XFU O;  1U5I B;  1S5G Y;  1UUR A;  2SCP A;  4YGA A;  3NSI A;  5CPV A;  3GK1 A;  1YUU A;  2D8N A;  3CLN A;  5I2O A;  4MSP A;  4TNC A;  1WDC B;  2LM5 A;  2P6B B;  1B7T Z;  1TCF A;  2HQ8 A;  1WRK A;  3AAK A;  2WCE A;  4DCK A;  4WQ2 A;  2LP3 A;  5DKR A;  4CFQ A;  2FJU B;  2MBX A;  2KNE A;  3HCM A;  4NQG A;  2ZND A;  1CDL A;  1K90 D;  1ZAC A;  4QJ5 B;  4PHM A;  1MR8 A;  4HRG A;  2BCA A;  2JUL A;  2LE9 B;  3A8R A;  1AJ4 A;  5F6T A;  1FI6 A;  4DRW A;  1J7P A;  3C1V A;  3I5G B;  1J7Q A;  5TNC A;  2L5X B;  2ZRS A;  1H4B A;  2K8M B;  4YGD B;  5I2L A;  1KK8 B;  4PE7 A;  1MXL C;  2LP2 A;  3WXA A;  2MRD A;  1MHO A;  1K94 A;  3FS7 A;  3RM1 A;  2LLT A;  2Q4U A;  1QAS A;  1C07 A;  1YR5 A;  2O60 A;  3KEV A;  1S6C A;  2CBL A;  3BXK A;  2QPT A;  4ZCU A;  1WLZ A;  3GK4 X;  3TUY B;  4PHN A;  4DUQ A;  3TDI A;  2BL0 B;  4QJ4 B;  2L4I A;  3GK2 A;  1A2X A;  3QRX A;  1TNX A;  3I5I C;  3TDU A;  1OQP A;  2HET A;  1A75 B;  2LMT A;  5DKQ A;  4A4B A;  3DVM A;  1RTP 1;  4PHJ A;  4MRY A;  1NWD A;  1VRK A;  1KFU S;  2JWW A;  1TNP A;  2CTN A;  1XFV O;  3PM8 A;  1CFP A;  4HRE E;  2LHI A;  2KSP A;  1DJW A;  1QIW A;  3VRR A;  1FPW A;  2OS8 C;  1IGV A;  2M49 B;  4PAL A;  1QLS A;  5I2Q A;  1IQ5 A;  1BU3 A;  1MWN A;  2SAS A;  4GNK B;  1K2H A;  1W7J B;  1EXR A;  1AHR A;  2CNP A;  1H8B A;  1K9U A;  4N1G A;  1FI5 A;  2MLF C;  4GBA A;  3I5H B;  3K21 A;  2H2K A;  2EC6 B;  4GUK A;  2BBN A;  1BLQ A;  4GFT A;  1EG4 A;  3NSK A;  1YVL A;  4PE4 A;  1A03 A;  3CR2 A;  1IG5 A;  4AQI A;  1BF5 A;  2KQ6 A;  3PN7 B;  1SY9 A;  3TZ1 A;  2K7B A;  1QLK A;  3LK1 A;  1B7T Y;  3O78 A;  4MBE A;  3AAJ A;  2K0J A;  2M29 A;  2JNF A;  1OMD A;  4U8D A;  5D7F A;  3RLZ A;  1KFX S;  2E30 A;  3IF7 A;  2JXC A;  3BUM B;  1JFK A;  3SIA A;  1UP5 A;  1UUS A;  1SYM A;  3EK8 A;  2M8U A;  3DF0 B;  1DT7 B;  2NCP A;  1B8R A;  2GV5 A;  5HLO A;  2ZRT A;  1DVI A;  1Y1U A;  2WCF A;  3HX4 A;  3JTD C;  2KBI A;  3CWG A;  3PSR A;  1J7R A;  2L98 A;  5B8I B;  3SG6 A;  4IL1 A;  1EH2 A;  3PFV A;  4YBH B;  4P5O E;  4USL A;  3I5F C;  5JJG A;  2K7D A;  3ICB A;  2Q91 A;  2Y4Q A;  1CLM A;  1XA5 A;  3LK0 A;  3VRO A;  3VRP A;  2LHL A;  4MEW A;  3H4S E;  3FWC A;  1EG3 A;  3IQQ A;  3EVV A;  2BEC A;  1CMG A;  1IH0 A;  2LVJ A;  1DJH A;  3A4U B;  4ORB B;  1N65 A;  1B8C A;  1ZUZ A;  1DMO A;  2LMV A;  1OZS A;  4WQ3 A;  1KK7 Z;  3WNX B;  1QIV A;  3KHE A;  3EKJ A;  1NP8 A;  4GGF A;  4I5J A;  1SL7 A;  4ETO A;  1A4P A;  1SBJ A;  1F55 A;  3WHU B;  1YUS A;  2IS9 A;  2WC8 A;  1B8L A;  1QVI Z;  1YX7 A;  1BT6 A;  1QS7 A;  4XJK B;  2LAP A;  3CTN A;  2K61 A;  2JOJ A;  1L2O B;  1HT9 A;  4ORA B;  1XFW O;  2K7C A;  2WCB A;  2Y1M A;  3VGO A;  1QTX A;  1CFF A;  1JC2 A;  5CSJ A;  2BKH B;  3NSL A;  3SG2 A;  2JZI A;  2DOQ A;  2KDH A;  1N2D A;  2M0R A;  2MLE C;  1AP4 A;  1CDN A;  1A29 A;  1TN4 A;  1DJX A;  2PRU A;  2JNX A;  1CDP A;  4C0J A;  3I5I B;  4NDB A;  3TS5 C;  4OKH A;  3DD4 A;  4FQO A;  1CNP A;  1PK0 D;  1R2U A;  1XFY O;  2B1U A;  4AQJ A;  4MLW A;  1QX7 A;  1RJV A;  2MAZ A;  2Y1N A;  1NPQ A;  1BR1 B;  4XYN A;  2PAS A;  1B1G A;  1F54 A;  3AKA A;  1DJY A;  2BCX A;  2JT3 A;  2M1U A;  2LCP A;  1CLB A;  2MHH A;  1PVB A;  1LA0 A;  1QXP A;  5ER4 X;  2KI4 C;  3ZWH A;  1S6J A;  1NX3 A;  2JU0 A;  2ZN8 A;  5K89 A;  3M0W A;  2M9G A;  4HSZ A;  1KFU L;  3JVT C;  2K2A A;  3PLF B;  5HKZ A;  1OOJ A;  2L51 A;  1CDM A;  4GGF C;  4QJ3 B;  5CSI A;  1JFJ A;  1X02 A;  2BE4 A;  4FTG A;  2I94 A;  1NX2 A;  1PUL A;  1W7I B;  1DGU A;  3MSE B;  3VRN A;  1IJ5 A;  1K9P A;  2MA2 A;  4ICB A;  2PSR A;  2AUC A;  1V1G A;  1K95 A;  1FBV A;  3O6B A;  1A75 A;  1CM1 A;  2KGR A;  2JPT A;  2LMU A;  1KK7 Y;  5AXI A;  2AMI A;  5AFP A;  2KAY A;  1BOD A;  1RFJ A;  1DF0 B;  4I5K A;  1F8H A;  3KF9 A;  3CR4 X;  3BYA A;  1Y1X A;  4Q04 A;  1SRA A;  4MN0 A;  4F0Z B;  1UHK A;  1QVI Y;  1PSB A;  1SL8 A;  2L0P A;  4N1F A;  1KFX L;  2KI6 D;  1G33 A;  3I5F B;  1QX5 B;  1B9A A;  3AKB A;  3BOW B;  3EKH A;  1ZOT B;  1SMG A;  3EK7 A;  1KQV A;  1XVJ A;  2A4J A;  4N5X A;  1CKK A;  3OHM B;  1FW4 A;  4YGC B;  3O2P A;  2NZ0 A;  2GGZ A;  3D0Y B;  3KO0 A;  3OP0 A;  2JXL A;  1J1D A;  2ZNE A;  2K7O A;  1MUX A;  1S1E A;  3O4Y A;  3CR5 X;  2V53 A;  1J1E A;  5DKN A;  1AUI B;  4BY4 A;  3BUX B;  1LA3 A;  1JWD A;  2JC2 A;  3LL8 B;  3EVR A;  1GQM A;  2WOR A;  1G4Y R;  4M2Q A;  1BR4 B;  1M63 B;  2EHB A;  2OPO A;  3ZNI A;  2F8P A;  3CZT X;  3TUY C;  1KSO A;  4M2O A;  1HQV A;  2QAC A;  2BL0 C;  1JF2 A;  2TN4 A;  1SNL A;  1K93 D;  2FCE A;  2F3Z A;  1PSR A;  4A4C A;  2KYC A;  1QAT A;  5HLV A;  1LIN A;  1YUT A;  3OB2 B;  5CSN A;  4I5L B;  1ODB A;  1OSA A;  1TOP A;  1XYD A;  2LUX A;  1SCM C;  5PAL A;  1QV1 A;  2FCD A;  2JT8 A;  4ORC B;  3TS5 B;  1EJ3 A;  1UWO A;  1DJI A;  1TIZ A;  5ER5 A;  5AAN A;  1QJT A;  3GOF A;  1KQM C;  1YUR A;  2BBM A;  1WLM A;  1YVH A;  4CPV A;  1UHI A;  2KAV A;  1MXE A;  2PVB A;  3LCP C;  3LLE A;  1IRJ A;  5AEQ A;  4PDZ A;  2LUC A;  4CFR A;  1C7V A;  1JF0 A;  1M46 A;  1NX1 A;  1CM4 A;  1IQ3 A;  1NCX A;  2PMY A;  3PN7 C;  1JSA A;  4OVN F;  1KWO C;  3PAL A;  1U5I A;  4MZK A;  2OTG C;  1TRF A;  2KQY A;  2NLN A;  2KOT A;  2CCM A;  3EK4 A;  1UHH A;  1RWY A;  1MF8 B;  3IQO A;  1NX0 A;  4PE0 A;  1YTZ C;  5CSF A;  4AOM A;  2JT0 A;  1FF1 A;  2ZN9 A;  3SG3 A;  3BUN B;  5IBW A;  1NCY A;  1SR6 C;  2M7N A;  4M2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...