2JTZA

Solution structure and chemical shift assignments of the f104-to-5-flurotryptophan mutant of cardiac troponin c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
161
structure length
160
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jtzA02
4TNCA 5TNCA 2F8PA 2GGMA 4GNKB 2KQYA 1F55A 4GGFC 5JJGA 5AERA 3AAJA 1TCOB 1CDMA 3AAKA 5CPVA 1XK4C 2BE6A 1QV1A 2LP2A 1DJXA 2MBXA 1C7VA 2PRUA 2HF5A 1JWDA 1NX3A 2MLEC 4USLA 2LMUA 3TDZA 2HQWA 2KFGA 3HX4A 3VROA 1TTXA 2R2IA 3ZWHA 1PSBA 1SYMA 4MZKA 2MRDA 1BJFA 5G08A 4AQJA 1IH0A 1A29A 2V53A 4DRWA 4UPGA 2K2FA 1XA5A 1PRWA 1KQVA 1AK8A 2PASA 1UP5A 3DF0A 1SMGA 2ZRTA 3I5IB 1BLQA 2KYFA 1CDLA 1QVIZ 1SR6C 3KF9A 2P6BB 2I18A 1EL4A 3OHMB 3HCMA 1G8IA 3EK4A 2F3YA 1BT6A 2Y5IA 4ORBB 1E8AA 1OMDA 2WNDA 4Q04A 1BU3A 1Y6WA 2EHBA 4I5NB 4C0LA 1M46A 3IF7A 3O4YA 3SIBA 3PFVA 2FCEA 1DJYA 1SNLA 1LVCD 1MXEA 5HLOA 3EVUA 1PULA 1NCYA 1OZSA 1R6PA 2LLTA 3EKJA 3FWCA 3JTDB 2L50A 2OTGB 1G4YR 1NPQA 4GAOA 3MSEB 1LXFC 1CFPA 4HREE 1K9UA 4NDBA 1SL9A 2I2RE 4XYNA 1HT9A 3BUXB 1NUBA 1CM1A 4F0ZB 1RWYA 1F70A 4PE0A 1BMOA 1DGVA 2KHNA 3D10A 4MZJA 2CTNA 4M2QA 4DUQA 5HYDA 2NLNA 1KK7Y 1KK8C 1MWNA 2LV7A 1YRUB 1EG3A 1SCMC 2MAZA 1KWOB 1SK6D 2JNFA 4U8DA 3NXAA 1WLMA 4ZCUA 5I2LA 3BOWB 4OCIA 3EK7A 3I5GC 4I5KA 2F2PA 1CTRA 2JWWA 2BKIB 2M49B 1TCFA 1YX8A 1SCVA 1QX2A 1QX5B 1KFXL 2HPSA 4MVFA 1JBAA 1NCZA 2JXCA 3WHUB 4DCKA 1ZFSA 2KFFA 3ICBA 4PALA 3WNXB 4NDDA 2MA2A 1Y1UA 3DF0B 1CMGA 4YI8A 2LHLA 4GBAA 2JOJA 1QATA 1DVIA 3GK2A 2F3ZA 1X02A 1CDPA 2PALA 1MR8A 3DVMA 1A03A 1ZUZA 4FTGA 1ODBA 1Q80A 4QJ3B 1C7WA 2L2EA 1KFXS 1MXLC 2WCFA 2MHHA 4ICBA 2CCMA 4NQGA 1YRTB 3I5IC 1KK8B 1TRFA 3VRRA 4CIDA 2AAOA 1SL7A 1EXRA 1CLMA 1K96A 4PCWA 1KSMA 1NX1A 3A4UB 2JRFA 4R1EA 4NDCA 2E6WA 1OE9B 5AEQA 1OMVA 2BCAA 3A8RA 1B1GA 1K2HA 3I5GB 3VRPA 4YRUA 2JXLA 1F71A 1F8HA 3O78A 1L7ZA 1LKJA 1U5IA 1XFWO 3I5FB 1IG5A 3GOFA 2WORA 3SG4A 1QJTA 4JQ0D 5FYXA 1DMOA 2JT3A 3IQQA 4ORAB 3VRQA 1CB1A 2LM5A 1K9KA 5I8NA 2BE4A 3JTDC 4PE1A 2OTGC 4ZCVA 2WCBA 1SPYA 1YUSA 1NWDA 1KCYA 2BL0B 4JPZB 1EG4A 1F4QA 2JC2A 3BUMB 3BOWA 2ISDA 1FW4A 4ORCB 3QRXA 1YX7A 2M3WA 2JPTA 1TOPA 3LCPC 4WQ3A 2JZIA 1QVIY 1DF0A 3EKHA 1SRAA 1QIVA 2M0RA 1FI6A 1RTP1 3BUNB 1N0YA 2HQ8A 3O2PA 1GJYA 3TDIA 3PALA 4OVNF 3K21A 5GQQC 3ZNIA 3BQ3A 1WRZA 3KHEA 1K95A 1KWOC 1JC2A 1M31A 2M97A 2BCXA 1CLBA 1TNXA 2D8NA 1CDNA 1K90D 1MHOA 1IWQA 2CXJA 1YTZC 1S1EA 2Q4UA 2DOQA 1SW8A 2JT8A 5F6TA 1DJZA 3TUYB 1QLSA 3KPXA 1D1OA 2LC5A 1TNQA 1ZMZA 2B1UA 3FIAA 4QJ5B 1A75B 2HETA 1K8UA 1XFZO 1QX7A 2JTZA 1K94A 1IQ5A 1MUXA 2Y4QA 4A4CA 4PE4A 4FQOA 1CFFA 1PK0D 1IQ3A 2K0JA 1WRLA 1B9AA 3PLFB 2Q91A 1TNPA 2ZRSA 3FWBA 2KFHA 2F2OA 2LVIA 3WHTB 3OB1B 1KSOA 1OZOA 5CSJA 1C07A 4MZLA 1UHJA 3BXKA 3CR2A 3I5HB 2M7LA 1XFUO 1U5IB 5D69A 4MRXA 4AOMA 3CS1A 1XVJA 3CR4X 3TS5B 4E68A 4GFTA 1S3PA 3SG3A 2AUCA 4CFRA 4XJKB 1J1DA 4IL1A 4HSZA 4QJ4B 1IJ6A 1JFJA 1UHHA 1B8CA 3PSRA 2KNEA 4PHNA 4YGAA 5CSIA 1NX0A 4PHJA 2JQ6A 4GPLB 1XFVO 1UWOA 1XFXO 2K2AA 2M8UA 5ER5A 2L0PA 1DJWA 2KAVA 3RM1A 3VGOA 3JVTB 2NCPA 1BR4B 3I5FC 3KEVA 4OR9B 1B47A 1N65A 1NCXA 4OV2A 1J7OA 3VRNA 1FI5A 2FJUB 5DKQA 1DF0B 2WOSA 3EVVA 1DGUA 5AFPA 1OMRA 3LK1A 1L2OB 2LAPA 4WQ2A 4I5LB 2MJWB 3OX6A 2BL0C 2KI6D 1Y1XA 2SCPA 1MF8B 1UHIA 5IBWA 3O6BA 1NP8A 4YGDB 5I2QA 1J55A 2BECA 1IKUA 2LVVA 2O60A 1DTLA 2KGRA 1A75A 2JT0A 1CFCA 4CFQA 3AKBA 4YGBB 3RLZA 1AJ5A 2JTTA 3TZ1A 4PHMA 1AJ4A 1LA0A 2JULA 3CLNA 1RECA 2LP3A 1JFKA 2KI6C 1QV0A 2L4HA 1PVBA 1S5GZ 1DJHA 1W7IB 2CT9A 2CBLA 1FBVA 4C0KA 1WDCB 1YVLA 3PN7B 2LMTA 3TUYC 3M0WA 2JNXA 1YR5A 2JU0A 2KOTA 2K7OA 5AANA 5HKWA 1NX2A 1XO5A 1NYAA 2L5XB 2NCOA 1Y0VH 2LVKA 4XJKA 3AKAA 3EK8A 2LE9B 5DKNA 1G33A 1H8BA 4GGFA 1CM4A 2AMIA 2KAXA 4CLNA 1TNWA 1XK4A 3NSOA 1J1EA 3SG2A 1RK9A 1ZACA 1ALWA 2IS9A 1GGWA 1LINA 3GK1A 1RROA 3F45A 4MRYA 1S6JA 5KU1A 1J7PA 1Y1AA 3DVJA 2LLUA 2E30A 1F4OA 2I94A 3I5HC 3BUOB 3DVEA 2KI4C 1JF0A 3TS5C 1K9PA 2OS8B 2LHIA 1SL8A 1UHNA 4N1GA 3WXAA 4I5JA 2LCPA 2G9BA 1QTXA 1YURA 2K8MB 3OP0A 3SG5A 1LA3A 1GQMA 2MLFC 2EC6B 4GGNA 3TDUA 2A4JA 2H2KA 1AP4A 3NSKA 2PVBA 2LLSA 1XFYO 2OPOA 4M2PA 2M1KB 5D7FA 5JOLA 1IGVA 2RGIA 1WY9A 5B8IB 1S36A 3NSIA 4M2OA 1W7JB 1DT7B 3JVTC 3IQOA 3CWGA 1SKTA 1PVAA 2L98A 2TN4A 1QS7A 3BUWB 1CMFA 1QASA 1PALA 1CNPA 2Y1NA 5AXIA 2KBMA 4MBEA 1KQMB 1NIWA 2PSRA 5KTYA 1WRKA 4MSPA 5HKZA 1L2OC 1B7TY 1UHKA 1V1FA 1AUIB 1DJGA 2BCBA 2SASA 2WC8A 1UUSA 2L4IA 1ALVA 2LVJA 2NZ0A 4PDZA 2M9GA 4ETOA 5PALA 3D0YB 1BODA 3LLEA 1V1GA 3GK4X 1CFDA 5KSZA 1JUOA 1B7TZ 1SY9A 2KDHA 1IJ5A 1QIWA 2GV5A 2KBIA 2BKHB 1WLZA 3PATA 2BBMA 3NSLA 1UURA 2M1UA 2KI4B 1H4BA 3CTNA 1M39A 4PHKA 2O5GA 3LL8B 3KO0A 2H61A 2Y1MA 4DS7A 2I7AA 3CZTX 4AQIA 5HLVA 1IRJA 2BBNA 5HKYA 1WDCC 1BR1B 3PN7C 1QXPA 1PSRA 4YGEB 1YUUA 4PE7A 4C0JA 2LANA 2ZN9A 1AVSA 1N2DA 2L51A 2PMYA 5DKRA 3BYAA 4N5XA 1J7RA 2LMVA 1VRKA 3DD4A 1B8LA 3SG7A 2CNPA 3LK0A 4BY4A 2LUCA 1HQVA 3C1VA 2H61C 4CPVA 5BPJA 1CKKA 2QACA 1JF2A 2KYCA 2M7NA 1AHRA 2K7CA 5J3XA 4JWQA 4DIRA 4MLWA 4MEWA 4P2YB 1SR6B 5ER4X 1SBJA 5I2OA 4YI9A 5CSNA 1GGZA 1KK7Z 1S6IA 2WCEA 1KFUL 2OS8C 1S5GY 2EGDA 1R2UA 2KSPA 3E3RA 4L9MA 1TIZA 1YVHA 2COLB 1EJ3A 1BG1A 4YGCB 1TN4A 2EC6C 1FPWA 1J7QA 2FOTA 1S6CA 3OB2B 1ZOTB 4HRGA 1A4PA 1CLLA 3D0YA 1B4CA 1B8RA 2ZKMX 2LNKA 2QPTA 1BF5A 1OOJA 1RJVA 5CSFA 4A4BA 3H4SE 3CGAA 2ZNDA 1M63B 4OKHA 3SJSA 1JSAA 2K7DA 1RFJA 1XYDA 4BY5A 1NSHA 1KQMC 2F33A 2VRGA 1KFUS 4YBHB 2GGZA 1QLKA 2KAYA 3FS7A 4WRIA 1MQ1A 4N1FA 1K93D 2KQ6A 4MN0A 3SG6A 3CR5X 4D1EA 5K89A 4P5OE 1EH2A 2M29A 3PM8A 2NXQA 1S26D 2G2BA 2LUXA 1OQPA 3OX5A 1F54A 1BOCA 1DJIA 2ZN8A 2K61A 3DVKA 1SCMB 3SIAA 2FCDA 2KGBC 4GUKA 2ZFDA 1A2XA 1YUTA 2ZNEA 1FF1A 1OSAA 1M45A 4HRHA 2K7BA 3EVRA
chains in the Genus database with same CATH superfamily
4TNCA 5TNCA 1W9ZA 2F8PA 2GGMA 4GNKB 2KQYA 1F55A 4GGFC 5JJGA 5AERA 3AAJA 1TCOB 1CDMA 3AAKA 5CPVA 1XK4C 2BE6A 1QV1A 2LP2A 1DJXA 2MBXA 1C7VA 2PRUA 2HF5A 1JWDA 1NX3A 2MLEC 4USLA 2LMUA 3TDZA 3DY9A 2HQWA 2KFGA 3HX4A 3VROA 1TTXA 2R2IA 3ZWHA 1PSBA 4INXA 1SYMA 4MZKA 2MRDA 1BJFA 5G08A 2QEHA 4AQJA 1IH0A 1A29A 2V53A 4DRWA 4UPGA 2K2FA 1XA5A 1PRWA 3D77A 4JKTA 1KQVA 1OOIX 1Z2CB 1AK8A 2PASA 1UP5A 3DF0A 1SMGA 2ZRTA 3I5IB 1BLQA 2KYFA 1CDLA 1QVIZ 1SR6C 2KLEA 3KF9A 2P6BB 2I18A 1EL4A 3OHMB 3HCMA 3S0DA 1G8IA 3S0BA 3EK4A 2F3YA 1BT6A 2Y5IA 4ORBB 1E8AA 1OMDA 2WNDA 4Q04A 1Z4HA 3BFAA 1BU3A 1Y6WA 2EHBA 4I5NB 4C0LA 1M46A 1DELA 3IF7A 3O4YA 3SIBA 1TWOA 3PFVA 2FCEA 1DJYA 1SNLA 3L4LA 3SS3A 1LVCD 1MXEA 5HLOA 3EVUA 1PULA 1NCYA 1OZSA 1R6PA 2LLTA 3EKJA 3FWCA 3JTDB 2L50A 2OTGB 1G4YR 1NPQA 4GAOA 3MSEB 1LXFC 1CFPA 3R72A 4HREE 1K9UA 4NDBA 1SL9A 2I2RE 4XYNA 1HT9A 1C3ZA 1NUBA 3BUXB 1CM1A 4F0ZB 3S0AA 1RWYA 1F70A 4PE0A 1BMOA 1DGVA 2KHNA 3D10A 4MZJA 2CTNA 4M2QA 4DUQA 3CZ0A 5HYDA 2NLNA 1KK7Y 1KK8C 1MWNA 3NGVA 2ERBA 2LV7A 1YRUB 1EG3A 1SCMC 2MAZA 1KWOB 1SK6D 2JNFA 4U8DA 3NXAA 5FI7A 1WLMA 4ZCUA 5I2LA 3BOWB 4OCIA 3B88A 3EK7A 3I5GC 4I5KA 2F2PA 1CTRA 2JWWA 2BKIB 2M49B 4F7FA 1TCFA 3FE8A 1YX8A 1SCVA 1QX2A 1QX5B 2L5YA 1KFXL 3OGNA 2HPSA 4MVFA 1IIOA 1JBAA 1NCZA 2JXCA 3WHUB 4DCKA 1ZFSA 2KFFA 3ICBA 4PALA 3WNXB 4NDDA 2MA2A 1Y1UA 3DF0B 1CMGA 4YI8A 3RZSA 2LHLA 4GBAA 2JOJA 1QATA 1DVIA 3GK2A 2F3ZA 1X02A 1CDPA 2PALA 1MR8A 3DVMA 1A03A 1ZUZA 4FTGA 1ODBA 1Q80A 4QJ3B 1C7WA 2L2EA 1KFXS 1MXLC 2WCFA 2MHHA 4ICBA 2CCMA 4NQGA 1YRTB 3S0GA 3EG5B 3I5IC 1KK8B 1TRFA 3VRRA 4CIDA 2AAOA 1SL7A 1EXRA 1CLMA 1K96A 4PCWA 1KSMA 3B86A 1NX1A 3A4UB 2JRFA 4R1EA 4NDCA 2E6WA 1OE9B 5AEQA 1OMVA 2BCAA 3A8RA 1B1GA 1K2HA 3FE6A 1LS8A 3I5GB 3VRPA 2JXLA 4YRUA 1F71A 1OOHA 1F8HA 3O78A 1L7ZA 1LKJA 1U5IA 1XFWO 3I5FB 1IG5A 3GOFA 2WORA 3SG4A 1QJTA 4JQ0D 5FYXA 1DMOA 2JT3A 3IQQA 4ORAB 3VRQA 1CB1A 3S0EA 2LM5A 1K9KA 5I8NA 2BE4A 3JTDC 4PE1A 3R1PA 2OTGC 4ZCVA 2WCBA 5HL1A 1SPYA 1YUSA 1NWDA 2JPOA 2BL0B 1KCYA 3CZ2A 4JPZB 1EG4A 1F4QA 2JC2A 3BUMB 3BOWA 3DZTA 2ISDA 1FW4A 4ORCB 3QRXA 3B6XA 3CYZA 1YX7A 2M3WA 2JPTA 1TOPA 3LCPC 4WQ3A 2JZIA 1QVIY 1DF0A 3EKHA 1SRAA 1QIVA 2M0RA 1FI6A 1RTP1 3BUNB 1N0YA 2HQ8A 3CZ1A 1SSEB 3O2PA 1GJYA 3TDIA 3PALA 4OVNF 3K21A 5GQQC 3ZNIA 3BQ3A 1WRZA 3CDNA 3KHEA 1K95A 1KWOC 1JC2A 1M31A 2M97A 2BCXA 4OZDA 5DICA 1CLBA 1TNXA 2D8NA 1CDNA 1K90D 1MHOA 1IWQA 1OOGA 2CXJA 1YTZC 1S1EA 3R1VA 2Q4UA 4PT1A 2DOQA 1SW8A 2JT8A 5F6TA 1DJZA 3TUYB 2GTEA 1QLSA 3KPXA 1D1OA 2LC5A 1TNQA 1ZMZA 3D75A 2B1UA 3FIAA 4QJ5B 1A75B 2HETA 1K8UA 1XFZO 1QX7A 2JTZA 1K94A 5FI6A 1IQ5A 1MUXA 1TUJA 2Y4QA 4A4CA 4PE4A 4FQOA 1CFFA 1PK0D 1IQ3A 2K0JA 3OBVA 1WRLA 3UO9A 1B9AA 3PLFB 2Q91A 1TNPA 2ZRSA 3FWBA 2KFHA 2F2OA 1C3YA 2LVIA 3WHTB 3OB1B 1KSOA 1OZOA 5CSJA 1C07A 4MZLA 1UHJA 3BXKA 3CR2A 3I5HB 2M7LA 1XFUO 1U5IB 5D69A 4MRXA 4AOMA 3CS1A 1XVJA 3CR4X 3TS5B 4E68A 4GFTA 1S3PA 3D78A 3SG3A 4FQTA 2AUCA 4CFRA 4XJKB 1J1DA 4IL1A 4HSZA 4QJ4B 3DYEA 1IJ6A 1JFJA 1UHHA 1B8CA 3PSRA 2KNEA 4PHNA 4YGAA 5CSIA 1NX0A 5EL2A 4PHJA 2JQ6A 4GPLB 3SS5A 1XFVO 1UWOA 1XFXO 2K2AA 2M8UA 5ER5A 2L0PA 1DJWA 2KAVA 3BFHA 5D3OA 3JVTB 2NCPA 1BR4B 3I5FC 3KEVA 4OR9B 1B47A 1N65A 1NCXA 4OV2A 1J7OA 3VRNA 1FI5A 3FE9A 2FJUB 5DKQA 1DF0B 2WOSA 3EVVA 1DGUA 5AFPA 1OMRA 3LK1A 5FI2A 1L2OB 2LAPA 4WQ2A 4I5LB 2WCKA 2MJWB 3OX6A 2BL0C 2KI6D 1Y1XA 2SCPA 4INWA 1MF8B 3L4AA 1UHIA 4KYNA 5IBWA 3O6BA 1NP8A 4YGDB 2H8VA 5I2QA 1J55A 2BECA 1IKUA 2WCLA 2LVVA 3D73A 3PM2A 2O60A 1DTLA 2WC6A 2KGRA 1A75A 2JT0A 1CFCA 4IJ7A 4CFQA 3AKBA 3BFBA 4YGBB 1AJ5A 2JTTA 3RLZA 3TZ1A 5I94A 4PHMA 2P71A 1AJ4A 2QDIA 1LA0A 2JULA 3CLNA 1RECA 2LP3A 1JFKA 2KI6C 3BJHA 1QV0A 2L4HA 1PVBA 1S5GZ 1DJHA 1W7IB 2CT9A 2CBLA 1FBVA 4C0KA 1WDCB 1YVLA 3PN7B 2LMTA 3TUYC 3M0WA 2JNXA 3RM1A 1YR5A 2JU0A 2KOTA 2K7OA 5AANA 5HKWA 1NX2A 1XO5A 1NYAA 2BAPA 2L5XB 2NCOA 1Y0VH 2LVKA 4XJKA 3AKAA 3EK8A 2LE9B 5DKNA 1G33A 1H8BA 4GGFA 1CM4A 2AMIA 2KAXA 1T14A 4CLNA 1TNWA 1XK4A 3O4XA 3NSOA 1J1EA 3SG2A 1RK9A 1ZACA 1ALWA 2IS9A 1GGWA 1LINA 3GK1A 1RROA 3F45A 4MRYA 1S6JA 5KU1A 3DXLA 1J7PA 1Y1AA 3DVJA 1DEKA 2LLUA 2E30A 2QEBA 1F4OA 2I94A 3I5HC 2KLDA 3BUOB 3DVEA 2KI4C 1JF0A 3TS5C 1K9PA 2WCJA 2OS8B 2LHIA 1SL8A 1UHNA 4N1GA 3WXAA 3QMEA 2LCPA 4I5JA 2G9BA 3VB1A 1QTXA 2WCMA 1YURA 2K8MB 3OP0A 3SG5A 1LA3A 1GQMA 2MLFC 2EC6B 4GGNA 3TDUA 2A4JA 2H2KA 1AP4A 3NSKA 2PVBA 2LLSA 1XFYO 2OPOA 3SS4A 4M2PA 2M1KB 5D7FA 5JOLA 1IGVA 2RGIA 1WY9A 5B8IB 1S36A 3NSIA 4M2OA 1W7JB 1DT7B 3JVTC 3IQOA 3CWGA 1SKTA 1PVAA 2L98A 2TN4A 1QS7A 3BUWB 1CMFA 2FJYA 1QASA 1PALA 1CNPA 2Y1NA 3R1OA 1OOFA 2KBMA 4MBEA 1KQMB 5AXIA 1NIWA 2PSRA 5KTYA 1WRKA 4MSPA 5HKZA 1L2OC 1B7TY 1UHKA 1V1FA 1AUIB 1DJGA 2BCBA 2SASA 2WC8A 1UUSA 2YGUA 2L4IA 1ALVA 2LVJA 2NZ0A 4PDZA 2M9GA 4ETOA 5PALA 3D0YB 1BODA 3LLEA 1V1GA 2BNXA 3GK4X 1CFDA 1QWVA 5KSZA 1JUOA 1B7TZ 1SY9A 2KDHA 1IJ5A 1QIWA 2GV5A 2KBIA 2BKHB 1WLZA 3PATA 2BBMA 3NSLA 1UURA 2M1UA 2KI4B 1H4BA 3CTNA 1M39A 4PHKA 2O5GA 3LL8B 3KO0A 2H61A 2Y1MA 3NHIA 3N7HA 2QEOA 4DS7A 2I7AA 1GM0A 3CZTX 4AQIA 5HLVA 1IRJA 2BBNA 5HKYA 1WDCC 1BR1B 3NHTA 3PJIA 1QXPA 1PSRA 3PN7C 4YGEB 1YUUA 4PE7A 4C0JA 2LANA 2ZN9A 1AVSA 1N2DA 2L51A 2PMYA 5DKRA 3BYAA 3D74A 4N5XA 2KPHA 4JD9A 1J7RA 2LMVA 1VRKA 3DD4A 1B8LA 3SG7A 2CNPA 3LK0A 4BY4A 2LUCA 1HQVA 3C1VA 2H61C 2QEVA 4CPVA 5BPJA 1CKKA 2QACA 1JF2A 2KYCA 2M7NA 1AHRA 2K7CA 5J3XA 4JWQA 4DIRA 4MLWA 4MEWA 3Q8IA 4P2YB 1SR6B 5ER4X 1SBJA 5I2OA 1DQEA 4YI9A 5CSNA 1GGZA 3B87A 1KK7Z 1S6IA 2WCEA 1KFUL 2OS8C 1S5GY 2EGDA 1R2UA 2KSPA 2PQLA 3E3RA 4L9MA 1TIZA 1YVHA 2COLB 1EJ3A 3B7AA 3D76A 1BG1A 4YGCB 3L47A 1OW4A 1TN4A 2EC6C 1FPWA 1J7QA 2FOTA 2WCHA 1S6CA 3OB2B 1ZOTB 4HRGA 1A4PA 1CLLA 2PYQA 3D0YA 3V2LA 1B4CA 1B8RA 2ZKMX 2LNKA 2K60A 2P70A 2QPTA 1BF5A 1OOJA 1RJVA 5CSFA 3VGOA 4A4BA 3H4SE 1XFRA 3CGAA 3IVTA 2ZNDA 1M63B 4OKHA 3SJSA 1JSAA 2K7DA 1RFJA 1XYDA 4BY5A 1NSHA 1KQMC 2F33A 2VRGA 1KFUS 4YBHB 2GGZA 1QLKA 2KAYA 3FS7A 4WRIA 3UNWA 1MQ1A 4N1FA 1K93D 2KQ6A 4MN0A 3SG6A 3CR5X 4D1EA 5K89A 4P5OE 1EH2A 2M29A 3PM8A 2NXQA 1S26D 2G2BA 2LUXA 1OQPA 1DC1A 3OX5A 1F54A 1BOCA 3S0FA 2WC5A 1DJIA 1P28A 2K61A 2ZN8A 1SCMB 3CABA 3DVKA 3SIAA 2FCDA 2L2CA 1TUZA 3K1EA 2KGBC 4GUKA 2ZFDA 1A2XA 1YUTA 2ZNEA 1FF1A 1OSAA 1M45A 1ORGA 4HRHA 2K7BA 3EVRA
chains in the Genus database with same CATH topology
4TNCA 5TNCA 2F8PA 2GGMA 4GNKB 2KQYA 1F55A 4GGFC 5JJGA 5AERA 3AAJA 1TCOB 1CDMA 3AAKA 5CPVA 1XK4C 2BE6A 1QV1A 2LP2A 1DJXA 2MBXA 1C7VA 2PRUA 2HF5A 1JWDA 1NX3A 2MLEC 4USLA 2LMUA 3TDZA 2HQWA 2KFGA 3HX4A 3VROA 1TTXA 2R2IA 3ZWHA 1PSBA 1SYMA 4MZKA 2MRDA 1BJFA 5G08A 4AQJA 1IH0A 1A29A 2V53A 4DRWA 4UPGA 2K2FA 1XA5A 1PRWA 1KQVA 1AK8A 2PASA 1UP5A 3DF0A 1SMGA 2ZRTA 3I5IB 1BLQA 2KYFA 1CDLA 1QVIZ 1SR6C 3KF9A 2P6BB 2I18A 1EL4A 3OHMB 3HCMA 1G8IA 3EK4A 2F3YA 1BT6A 2Y5IA 4ORBB 1E8AA 1OMDA 2WNDA 4Q04A 1BU3A 1Y6WA 2EHBA 4I5NB 4C0LA 1M46A 3IF7A 3O4YA 3SIBA 3PFVA 2FCEA 1DJYA 1SNLA 1LVCD 1MXEA 5HLOA 3EVUA 1PULA 1NCYA 1OZSA 1R6PA 2LLTA 3EKJA 3FWCA 3JTDB 2L50A 2OTGB 1G4YR 1NPQA 4GAOA 3MSEB 1LXFC 1CFPA 4HREE 1K9UA 4NDBA 1SL9A 2I2RE 4XYNA 1HT9A 3BUXB 1NUBA 1CM1A 4F0ZB 1RWYA 1F70A 4PE0A 1BMOA 1DGVA 2KHNA 3D10A 4MZJA 2CTNA 4M2QA 4DUQA 5HYDA 2NLNA 1KK7Y 1KK8C 1MWNA 2LV7A 1YRUB 1EG3A 1SCMC 2MAZA 1KWOB 1SK6D 2JNFA 4U8DA 3NXAA 1WLMA 4ZCUA 5I2LA 3BOWB 4OCIA 3EK7A 3I5GC 4I5KA 2F2PA 1CTRA 2JWWA 2BKIB 2M49B 1TCFA 1YX8A 1SCVA 1QX2A 1QX5B 1KFXL 2HPSA 4MVFA 1JBAA 1NCZA 2JXCA 3WHUB 4DCKA 1ZFSA 2KFFA 3ICBA 4PALA 3WNXB 4NDDA 2MA2A 1Y1UA 3DF0B 1CMGA 4YI8A 2LHLA 4GBAA 2JOJA 1QATA 1DVIA 3GK2A 2F3ZA 1X02A 1CDPA 2PALA 1MR8A 3DVMA 1A03A 1ZUZA 4FTGA 1ODBA 1Q80A 4QJ3B 1C7WA 2L2EA 1KFXS 1MXLC 2WCFA 2MHHA 4ICBA 2CCMA 4NQGA 1YRTB 3I5IC 1KK8B 1TRFA 3VRRA 4CIDA 2AAOA 1SL7A 1EXRA 1CLMA 1K96A 4PCWA 1KSMA 1NX1A 3A4UB 2JRFA 4R1EA 4NDCA 2E6WA 1OE9B 5AEQA 1OMVA 2BCAA 3A8RA 1B1GA 1K2HA 3I5GB 3VRPA 4YRUA 2JXLA 1F71A 1F8HA 3O78A 1L7ZA 1LKJA 1U5IA 1XFWO 3I5FB 1IG5A 3GOFA 2WORA 3SG4A 1QJTA 4JQ0D 5FYXA 1DMOA 2JT3A 3IQQA 4ORAB 3VRQA 1CB1A 2LM5A 1K9KA 5I8NA 2BE4A 3JTDC 4PE1A 2OTGC 4ZCVA 2WCBA 1SPYA 1YUSA 1NWDA 1KCYA 2BL0B 4JPZB 1EG4A 1F4QA 2JC2A 3BUMB 3BOWA 2ISDA 1FW4A 4ORCB 3QRXA 1YX7A 2M3WA 2JPTA 1TOPA 3LCPC 4WQ3A 2JZIA 1QVIY 1DF0A 3EKHA 1SRAA 1QIVA 2M0RA 1FI6A 1RTP1 3BUNB 1N0YA 2HQ8A 3O2PA 1GJYA 3TDIA 3PALA 4OVNF 3K21A 5GQQC 3ZNIA 3BQ3A 1WRZA 3KHEA 1K95A 1KWOC 1JC2A 1M31A 2M97A 2BCXA 1CLBA 1TNXA 2D8NA 1CDNA 1K90D 1MHOA 1IWQA 2CXJA 1YTZC 1S1EA 2Q4UA 2DOQA 1SW8A 2JT8A 5F6TA 1DJZA 3TUYB 1QLSA 3KPXA 1D1OA 2LC5A 1TNQA 1ZMZA 2B1UA 3FIAA 4QJ5B 1A75B 2HETA 1K8UA 1XFZO 1QX7A 2JTZA 1K94A 1IQ5A 1MUXA 2Y4QA 4A4CA 4PE4A 4FQOA 1CFFA 1PK0D 1IQ3A 2K0JA 1WRLA 1B9AA 3PLFB 2Q91A 1TNPA 2ZRSA 3FWBA 2KFHA 2F2OA 2LVIA 3WHTB 3OB1B 1KSOA 1OZOA 5CSJA 1C07A 4MZLA 1UHJA 3BXKA 3CR2A 3I5HB 2M7LA 1XFUO 1U5IB 5D69A 4MRXA 4AOMA 3CS1A 1XVJA 3CR4X 3TS5B 4E68A 4GFTA 1S3PA 3SG3A 2AUCA 4CFRA 4XJKB 1J1DA 4IL1A 4HSZA 4QJ4B 1IJ6A 1JFJA 1UHHA 1B8CA 3PSRA 2KNEA 4PHNA 4YGAA 5CSIA 1NX0A 4PHJA 2JQ6A 4GPLB 1XFVO 1UWOA 1XFXO 2K2AA 2M8UA 5ER5A 2L0PA 1DJWA 2KAVA 3RM1A 3VGOA 3JVTB 2NCPA 1BR4B 3I5FC 3KEVA 4OR9B 1B47A 1N65A 1NCXA 4OV2A 1J7OA 3VRNA 1FI5A 2FJUB 5DKQA 1DF0B 2WOSA 3EVVA 1DGUA 5AFPA 1OMRA 3LK1A 1L2OB 2LAPA 4WQ2A 4I5LB 2MJWB 3OX6A 2BL0C 2KI6D 1Y1XA 2SCPA 1MF8B 1UHIA 5IBWA 3O6BA 1NP8A 4YGDB 5I2QA 1J55A 2BECA 1IKUA 2LVVA 2O60A 1DTLA 2KGRA 1A75A 2JT0A 1CFCA 4CFQA 3AKBA 4YGBB 3RLZA 1AJ5A 2JTTA 3TZ1A 4PHMA 1AJ4A 1LA0A 2JULA 3CLNA 1RECA 2LP3A 1JFKA 2KI6C 1QV0A 2L4HA 1PVBA 1S5GZ 1DJHA 1W7IB 2CT9A 2CBLA 1FBVA 4C0KA 1WDCB 1YVLA 3PN7B 2LMTA 3TUYC 3M0WA 2JNXA 1YR5A 2JU0A 2KOTA 2K7OA 5AANA 5HKWA 1NX2A 1XO5A 1NYAA 2L5XB 2NCOA 1Y0VH 2LVKA 4XJKA 3AKAA 3EK8A 2LE9B 5DKNA 1G33A 1H8BA 4GGFA 1CM4A 2AMIA 2KAXA 4CLNA 1TNWA 1XK4A 3NSOA 1J1EA 3SG2A 1RK9A 1ZACA 1ALWA 2IS9A 1GGWA 1LINA 3GK1A 1RROA 3F45A 4MRYA 1S6JA 5KU1A 1J7PA 1Y1AA 3DVJA 2LLUA 2E30A 1F4OA 2I94A 3I5HC 3BUOB 3DVEA 2KI4C 1JF0A 3TS5C 1K9PA 2OS8B 2LHIA 1SL8A 1UHNA 4N1GA 3WXAA 4I5JA 2LCPA 2G9BA 1QTXA 1YURA 2K8MB 3OP0A 3SG5A 1LA3A 1GQMA 2MLFC 2EC6B 4GGNA 3TDUA 2A4JA 2H2KA 1AP4A 3NSKA 2PVBA 2LLSA 1XFYO 2OPOA 4M2PA 2M1KB 5D7FA 5JOLA 1IGVA 2RGIA 1WY9A 5B8IB 1S36A 3NSIA 4M2OA 1W7JB 1DT7B 3JVTC 3IQOA 3CWGA 1SKTA 1PVAA 2L98A 2TN4A 1QS7A 3BUWB 1CMFA 1QASA 1PALA 1CNPA 2Y1NA 5AXIA 2KBMA 4MBEA 1KQMB 1NIWA 2PSRA 5KTYA 1WRKA 4MSPA 5HKZA 1L2OC 1B7TY 1UHKA 1V1FA 1AUIB 1DJGA 2BCBA 2SASA 2WC8A 1UUSA 2L4IA 1ALVA 2LVJA 2NZ0A 4PDZA 2M9GA 4ETOA 5PALA 3D0YB 1BODA 3LLEA 1V1GA 3GK4X 1CFDA 5KSZA 1JUOA 1B7TZ 1SY9A 2KDHA 1IJ5A 1QIWA 2GV5A 2KBIA 2BKHB 1WLZA 3PATA 2BBMA 3NSLA 1UURA 2M1UA 2KI4B 1H4BA 3CTNA 1M39A 4PHKA 2O5GA 3LL8B 3KO0A 2H61A 2Y1MA 4DS7A 2I7AA 3CZTX 4AQIA 5HLVA 1IRJA 2BBNA 5HKYA 1WDCC 1BR1B 3PN7C 1QXPA 1PSRA 4YGEB 1YUUA 4PE7A 4C0JA 2LANA 2ZN9A 1AVSA 1N2DA 2L51A 2PMYA 5DKRA 3BYAA 4N5XA 1J7RA 2LMVA 1VRKA 3DD4A 1B8LA 3SG7A 2CNPA 3LK0A 4BY4A 2LUCA 1HQVA 3C1VA 2H61C 4CPVA 5BPJA 1CKKA 2QACA 1JF2A 2KYCA 2M7NA 1AHRA 2K7CA 5J3XA 4JWQA 4DIRA 4MLWA 4MEWA 4P2YB 1SR6B 5ER4X 1SBJA 5I2OA 4YI9A 5CSNA 1GGZA 1KK7Z 1S6IA 2WCEA 1KFUL 2OS8C 1S5GY 2EGDA 1R2UA 2KSPA 3E3RA 4L9MA 1TIZA 1YVHA 2COLB 1EJ3A 1BG1A 4YGCB 1TN4A 2EC6C 1FPWA 1J7QA 2FOTA 1S6CA 3OB2B 1ZOTB 4HRGA 1A4PA 1CLLA 3D0YA 1B4CA 1B8RA 2ZKMX 2LNKA 2QPTA 1BF5A 1OOJA 1RJVA 5CSFA 4A4BA 3H4SE 3CGAA 2ZNDA 1M63B 4OKHA 3SJSA 1JSAA 2K7DA 1RFJA 1XYDA 4BY5A 1NSHA 1KQMC 2F33A 2VRGA 1KFUS 4YBHB 2GGZA 1QLKA 2KAYA 3FS7A 4WRIA 1MQ1A 4N1FA 1K93D 2KQ6A 4MN0A 3SG6A 3CR5X 4D1EA 5K89A 4P5OE 1EH2A 2M29A 3PM8A 2NXQA 1S26D 2G2BA 2LUXA 1OQPA 3OX5A 1F54A 1BOCA 1DJIA 2ZN8A 2K61A 3DVKA 1SCMB 3SIAA 2FCDA 2KGBC 4GUKA 2ZFDA 1A2XA 1YUTA 2ZNEA 1FF1A 1OSAA 1M45A 4HRHA 2K7BA 3EVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TNC A;  5TNC A;  2F8P A;  2GGM A;  4GNK B;  2KQY A;  1F55 A;  4GGF C;  5JJG A;  5AER A;  3AAJ A;  1TCO B;  1CDM A;  3AAK A;  5CPV A;  1XK4 C;  2BE6 A;  1QV1 A;  2LP2 A;  1DJX A;  2MBX A;  1C7V A;  2PRU A;  2HF5 A;  1JWD A;  1NX3 A;  2MLE C;  4USL A;  2LMU A;  3TDZ A;  2HQW A;  2KFG A;  3HX4 A;  3VRO A;  1TTX A;  2R2I A;  3ZWH A;  1PSB A;  1SYM A;  4MZK A;  2MRD A;  1BJF A;  5G08 A;  4AQJ A;  1IH0 A;  1A29 A;  2V53 A;  4DRW A;  4UPG A;  2K2F A;  1XA5 A;  1PRW A;  1KQV A;  1AK8 A;  2PAS A;  1UP5 A;  3DF0 A;  1SMG A;  2ZRT A;  3I5I B;  1BLQ A;  2KYF A;  1CDL A;  1QVI Z;  1SR6 C;  3KF9 A;  2P6B B;  2I18 A;  1EL4 A;  3OHM B;  3HCM A;  1G8I A;  3EK4 A;  2F3Y A;  1BT6 A;  2Y5I A;  4ORB B;  1E8A A;  1OMD A;  2WND A;  4Q04 A;  1BU3 A;  1Y6W A;  2EHB A;  4I5N B;  4C0L A;  1M46 A;  3IF7 A;  3O4Y A;  3SIB A;  3PFV A;  2FCE A;  1DJY A;  1SNL A;  1LVC D;  1MXE A;  5HLO A;  3EVU A;  1PUL A;  1NCY A;  1OZS A;  1R6P A;  2LLT A;  3EKJ A;  3FWC A;  3JTD B;  2L50 A;  2OTG B;  1G4Y R;  1NPQ A;  4GAO A;  3MSE B;  1LXF C;  1CFP A;  4HRE E;  1K9U A;  4NDB A;  1SL9 A;  2I2R E;  4XYN A;  1HT9 A;  3BUX B;  1NUB A;  1CM1 A;  4F0Z B;  1RWY A;  1F70 A;  4PE0 A;  1BMO A;  1DGV A;  2KHN A;  3D10 A;  4MZJ A;  2CTN A;  4M2Q A;  4DUQ A;  5HYD A;  2NLN A;  1KK7 Y;  1KK8 C;  1MWN A;  2LV7 A;  1YRU B;  1EG3 A;  1SCM C;  2MAZ A;  1KWO B;  1SK6 D;  2JNF A;  4U8D A;  3NXA A;  1WLM A;  4ZCU A;  5I2L A;  3BOW B;  4OCI A;  3EK7 A;  3I5G C;  4I5K A;  2F2P A;  1CTR A;  2JWW A;  2BKI B;  2M49 B;  1TCF A;  1YX8 A;  1SCV A;  1QX2 A;  1QX5 B;  1KFX L;  2HPS A;  4MVF A;  1JBA A;  1NCZ A;  2JXC A;  3WHU B;  4DCK A;  1ZFS A;  2KFF A;  3ICB A;  4PAL A;  3WNX B;  4NDD A;  2MA2 A;  1Y1U A;  3DF0 B;  1CMG A;  4YI8 A;  2LHL A;  4GBA A;  2JOJ A;  1QAT A;  1DVI A;  3GK2 A;  2F3Z A;  1X02 A;  1CDP A;  2PAL A;  1MR8 A;  3DVM A;  1A03 A;  1ZUZ A;  4FTG A;  1ODB A;  1Q80 A;  4QJ3 B;  1C7W A;  2L2E A;  1KFX S;  1MXL C;  2WCF A;  2MHH A;  4ICB A;  2CCM A;  4NQG A;  1YRT B;  3I5I C;  1KK8 B;  1TRF A;  3VRR A;  4CID A;  2AAO A;  1SL7 A;  1EXR A;  1CLM A;  1K96 A;  4PCW A;  1KSM A;  1NX1 A;  3A4U B;  2JRF A;  4R1E A;  4NDC A;  2E6W A;  1OE9 B;  5AEQ A;  1OMV A;  2BCA A;  3A8R A;  1B1G A;  1K2H A;  3I5G B;  3VRP A;  4YRU A;  2JXL A;  1F71 A;  1F8H A;  3O78 A;  1L7Z A;  1LKJ A;  1U5I A;  1XFW O;  3I5F B;  1IG5 A;  3GOF A;  2WOR A;  3SG4 A;  1QJT A;  4JQ0 D;  5FYX A;  1DMO A;  2JT3 A;  3IQQ A;  4ORA B;  3VRQ A;  1CB1 A;  2LM5 A;  1K9K A;  5I8N A;  2BE4 A;  3JTD C;  4PE1 A;  2OTG C;  4ZCV A;  2WCB A;  1SPY A;  1YUS A;  1NWD A;  1KCY A;  2BL0 B;  4JPZ B;  1EG4 A;  1F4Q A;  2JC2 A;  3BUM B;  3BOW A;  2ISD A;  1FW4 A;  4ORC B;  3QRX A;  1YX7 A;  2M3W A;  2JPT A;  1TOP A;  3LCP C;  4WQ3 A;  2JZI A;  1QVI Y;  1DF0 A;  3EKH A;  1SRA A;  1QIV A;  2M0R A;  1FI6 A;  1RTP 1;  3BUN B;  1N0Y A;  2HQ8 A;  3O2P A;  1GJY A;  3TDI A;  3PAL A;  4OVN F;  3K21 A;  5GQQ C;  3ZNI A;  3BQ3 A;  1WRZ A;  3KHE A;  1K95 A;  1KWO C;  1JC2 A;  1M31 A;  2M97 A;  2BCX A;  1CLB A;  1TNX A;  2D8N A;  1CDN A;  1K90 D;  1MHO A;  1IWQ A;  2CXJ A;  1YTZ C;  1S1E A;  2Q4U A;  2DOQ A;  1SW8 A;  2JT8 A;  5F6T A;  1DJZ A;  3TUY B;  1QLS A;  3KPX A;  1D1O A;  2LC5 A;  1TNQ A;  1ZMZ A;  2B1U A;  3FIA A;  4QJ5 B;  1A75 B;  2HET A;  1K8U A;  1XFZ O;  1QX7 A;  2JTZ A;  1K94 A;  1IQ5 A;  1MUX A;  2Y4Q A;  4A4C A;  4PE4 A;  4FQO A;  1CFF A;  1PK0 D;  1IQ3 A;  2K0J A;  1WRL A;  1B9A A;  3PLF B;  2Q91 A;  1TNP A;  2ZRS A;  3FWB A;  2KFH A;  2F2O A;  2LVI A;  3WHT B;  3OB1 B;  1KSO A;  1OZO A;  5CSJ A;  1C07 A;  4MZL A;  1UHJ A;  3BXK A;  3CR2 A;  3I5H B;  2M7L A;  1XFU O;  1U5I B;  5D69 A;  4MRX A;  4AOM A;  3CS1 A;  1XVJ A;  3CR4 X;  3TS5 B;  4E68 A;  4GFT A;  1S3P A;  3SG3 A;  2AUC A;  4CFR A;  4XJK B;  1J1D A;  4IL1 A;  4HSZ A;  4QJ4 B;  1IJ6 A;  1JFJ A;  1UHH A;  1B8C A;  3PSR A;  2KNE A;  4PHN A;  4YGA A;  5CSI A;  1NX0 A;  4PHJ A;  2JQ6 A;  4GPL B;  1XFV O;  1UWO A;  1XFX O;  2K2A A;  2M8U A;  5ER5 A;  2L0P A;  1DJW A;  2KAV A;  3RM1 A;  3VGO A;  3JVT B;  2NCP A;  1BR4 B;  3I5F C;  3KEV A;  4OR9 B;  1B47 A;  1N65 A;  1NCX A;  4OV2 A;  1J7O A;  3VRN A;  1FI5 A;  2FJU B;  5DKQ A;  1DF0 B;  2WOS A;  3EVV A;  1DGU A;  5AFP A;  1OMR A;  3LK1 A;  1L2O B;  2LAP A;  4WQ2 A;  4I5L B;  2MJW B;  3OX6 A;  2BL0 C;  2KI6 D;  1Y1X A;  2SCP A;  1MF8 B;  1UHI A;  5IBW A;  3O6B A;  1NP8 A;  4YGD B;  5I2Q A;  1J55 A;  2BEC A;  1IKU A;  2LVV A;  2O60 A;  1DTL A;  2KGR A;  1A75 A;  2JT0 A;  1CFC A;  4CFQ A;  3AKB A;  4YGB B;  3RLZ A;  1AJ5 A;  2JTT A;  3TZ1 A;  4PHM A;  1AJ4 A;  1LA0 A;  2JUL A;  3CLN A;  1REC A;  2LP3 A;  1JFK A;  2KI6 C;  1QV0 A;  2L4H A;  1PVB A;  1S5G Z;  1DJH A;  1W7I B;  2CT9 A;  2CBL A;  1FBV A;  4C0K A;  1WDC B;  1YVL A;  3PN7 B;  2LMT A;  3TUY C;  3M0W A;  2JNX A;  1YR5 A;  2JU0 A;  2KOT A;  2K7O A;  5AAN A;  5HKW A;  1NX2 A;  1XO5 A;  1NYA A;  2L5X B;  2NCO A;  1Y0V H;  2LVK A;  4XJK A;  3AKA A;  3EK8 A;  2LE9 B;  5DKN A;  1G33 A;  1H8B A;  4GGF A;  1CM4 A;  2AMI A;  2KAX A;  4CLN A;  1TNW A;  1XK4 A;  3NSO A;  1J1E A;  3SG2 A;  1RK9 A;  1ZAC A;  1ALW A;  2IS9 A;  1GGW A;  1LIN A;  3GK1 A;  1RRO A;  3F45 A;  4MRY A;  1S6J A;  5KU1 A;  1J7P A;  1Y1A A;  3DVJ A;  2LLU A;  2E30 A;  1F4O A;  2I94 A;  3I5H C;  3BUO B;  3DVE A;  2KI4 C;  1JF0 A;  3TS5 C;  1K9P A;  2OS8 B;  2LHI A;  1SL8 A;  1UHN A;  4N1G A;  3WXA A;  4I5J A;  2LCP A;  2G9B A;  1QTX A;  1YUR A;  2K8M B;  3OP0 A;  3SG5 A;  1LA3 A;  1GQM A;  2MLF C;  2EC6 B;  4GGN A;  3TDU A;  2A4J A;  2H2K A;  1AP4 A;  3NSK A;  2PVB A;  2LLS A;  1XFY O;  2OPO A;  4M2P A;  2M1K B;  5D7F A;  5JOL A;  1IGV A;  2RGI A;  1WY9 A;  5B8I B;  1S36 A;  3NSI A;  4M2O A;  1W7J B;  1DT7 B;  3JVT C;  3IQO A;  3CWG A;  1SKT A;  1PVA A;  2L98 A;  2TN4 A;  1QS7 A;  3BUW B;  1CMF A;  1QAS A;  1PAL A;  1CNP A;  2Y1N A;  5AXI A;  2KBM A;  4MBE A;  1KQM B;  1NIW A;  2PSR A;  5KTY A;  1WRK A;  4MSP A;  5HKZ A;  1L2O C;  1B7T Y;  1UHK A;  1V1F A;  1AUI B;  1DJG A;  2BCB A;  2SAS A;  2WC8 A;  1UUS A;  2L4I A;  1ALV A;  2LVJ A;  2NZ0 A;  4PDZ A;  2M9G A;  4ETO A;  5PAL A;  3D0Y B;  1BOD A;  3LLE A;  1V1G A;  3GK4 X;  1CFD A;  5KSZ A;  1JUO A;  1B7T Z;  1SY9 A;  2KDH A;  1IJ5 A;  1QIW A;  2GV5 A;  2KBI A;  2BKH B;  1WLZ A;  3PAT A;  2BBM A;  3NSL A;  1UUR A;  2M1U A;  2KI4 B;  1H4B A;  3CTN A;  1M39 A;  4PHK A;  2O5G A;  3LL8 B;  3KO0 A;  2H61 A;  2Y1M A;  4DS7 A;  2I7A A;  3CZT X;  4AQI A;  5HLV A;  1IRJ A;  2BBN A;  5HKY A;  1WDC C;  1BR1 B;  3PN7 C;  1QXP A;  1PSR A;  4YGE B;  1YUU A;  4PE7 A;  4C0J A;  2LAN A;  2ZN9 A;  1AVS A;  1N2D A;  2L51 A;  2PMY A;  5DKR A;  3BYA A;  4N5X A;  1J7R A;  2LMV A;  1VRK A;  3DD4 A;  1B8L A;  3SG7 A;  2CNP A;  3LK0 A;  4BY4 A;  2LUC A;  1HQV A;  3C1V A;  2H61 C;  4CPV A;  5BPJ A;  1CKK A;  2QAC A;  1JF2 A;  2KYC A;  2M7N A;  1AHR A;  2K7C A;  5J3X A;  4JWQ A;  4DIR A;  4MLW A;  4MEW A;  4P2Y B;  1SR6 B;  5ER4 X;  1SBJ A;  5I2O A;  4YI9 A;  5CSN A;  1GGZ A;  1KK7 Z;  1S6I A;  2WCE A;  1KFU L;  2OS8 C;  1S5G Y;  2EGD A;  1R2U A;  2KSP A;  3E3R A;  4L9M A;  1TIZ A;  1YVH A;  2COL B;  1EJ3 A;  1BG1 A;  4YGC B;  1TN4 A;  2EC6 C;  1FPW A;  1J7Q A;  2FOT A;  1S6C A;  3OB2 B;  1ZOT B;  4HRG A;  1A4P A;  1CLL A;  3D0Y A;  1B4C A;  1B8R A;  2ZKM X;  2LNK A;  2QPT A;  1BF5 A;  1OOJ A;  1RJV A;  5CSF A;  4A4B A;  3H4S E;  3CGA A;  2ZND A;  1M63 B;  4OKH A;  3SJS A;  1JSA A;  2K7D A;  1RFJ A;  1XYD A;  4BY5 A;  1NSH A;  1KQM C;  2F33 A;  2VRG A;  1KFU S;  4YBH B;  2GGZ A;  1QLK A;  2KAY A;  3FS7 A;  4WRI A;  1MQ1 A;  4N1F A;  1K93 D;  2KQ6 A;  4MN0 A;  3SG6 A;  3CR5 X;  4D1E A;  5K89 A;  4P5O E;  1EH2 A;  2M29 A;  3PM8 A;  2NXQ A;  1S26 D;  2G2B A;  2LUX A;  1OQP A;  3OX5 A;  1F54 A;  1BOC A;  1DJI A;  2ZN8 A;  2K61 A;  3DVK A;  1SCM B;  3SIA A;  2FCD A;  2KGB C;  4GUK A;  2ZFD A;  1A2X A;  1YUT A;  2ZNE A;  1FF1 A;  1OSA A;  1M45 A;  4HRH A;  2K7B A;  3EVR A; 
#chains in the Genus database with same CATH topology
 4TNC A;  5TNC A;  1W9Z A;  2F8P A;  2GGM A;  4GNK B;  2KQY A;  1F55 A;  4GGF C;  5JJG A;  5AER A;  3AAJ A;  1TCO B;  1CDM A;  3AAK A;  5CPV A;  1XK4 C;  2BE6 A;  1QV1 A;  2LP2 A;  1DJX A;  2MBX A;  1C7V A;  2PRU A;  2HF5 A;  1JWD A;  1NX3 A;  2MLE C;  4USL A;  2LMU A;  3TDZ A;  3DY9 A;  2HQW A;  2KFG A;  3HX4 A;  3VRO A;  1TTX A;  2R2I A;  3ZWH A;  1PSB A;  4INX A;  1SYM A;  4MZK A;  2MRD A;  1BJF A;  5G08 A;  2QEH A;  4AQJ A;  1IH0 A;  1A29 A;  2V53 A;  4DRW A;  4UPG A;  2K2F A;  1XA5 A;  1PRW A;  3D77 A;  4JKT A;  1KQV A;  1OOI X;  1Z2C B;  1AK8 A;  2PAS A;  1UP5 A;  3DF0 A;  1SMG A;  2ZRT A;  3I5I B;  1BLQ A;  2KYF A;  1CDL A;  1QVI Z;  1SR6 C;  2KLE A;  3KF9 A;  2P6B B;  2I18 A;  1EL4 A;  3OHM B;  3HCM A;  3S0D A;  1G8I A;  3S0B A;  3EK4 A;  2F3Y A;  1BT6 A;  2Y5I A;  4ORB B;  1E8A A;  1OMD A;  2WND A;  4Q04 A;  1Z4H A;  3BFA A;  1BU3 A;  1Y6W A;  2EHB A;  4I5N B;  4C0L A;  1M46 A;  1DEL A;  3IF7 A;  3O4Y A;  3SIB A;  1TWO A;  3PFV A;  2FCE A;  1DJY A;  1SNL A;  3L4L A;  3SS3 A;  1LVC D;  1MXE A;  5HLO A;  3EVU A;  1PUL A;  1NCY A;  1OZS A;  1R6P A;  2LLT A;  3EKJ A;  3FWC A;  3JTD B;  2L50 A;  2OTG B;  1G4Y R;  1NPQ A;  4GAO A;  3MSE B;  1LXF C;  1CFP A;  3R72 A;  4HRE E;  1K9U A;  4NDB A;  1SL9 A;  2I2R E;  4XYN A;  1HT9 A;  1C3Z A;  1NUB A;  3BUX B;  1CM1 A;  4F0Z B;  3S0A A;  1RWY A;  1F70 A;  4PE0 A;  1BMO A;  1DGV A;  2KHN A;  3D10 A;  4MZJ A;  2CTN A;  4M2Q A;  4DUQ A;  3CZ0 A;  5HYD A;  2NLN A;  1KK7 Y;  1KK8 C;  1MWN A;  3NGV A;  2ERB A;  2LV7 A;  1YRU B;  1EG3 A;  1SCM C;  2MAZ A;  1KWO B;  1SK6 D;  2JNF A;  4U8D A;  3NXA A;  5FI7 A;  1WLM A;  4ZCU A;  5I2L A;  3BOW B;  4OCI A;  3B88 A;  3EK7 A;  3I5G C;  4I5K A;  2F2P A;  1CTR A;  2JWW A;  2BKI B;  2M49 B;  4F7F A;  1TCF A;  3FE8 A;  1YX8 A;  1SCV A;  1QX2 A;  1QX5 B;  2L5Y A;  1KFX L;  3OGN A;  2HPS A;  4MVF A;  1IIO A;  1JBA A;  1NCZ A;  2JXC A;  3WHU B;  4DCK A;  1ZFS A;  2KFF A;  3ICB A;  4PAL A;  3WNX B;  4NDD A;  2MA2 A;  1Y1U A;  3DF0 B;  1CMG A;  4YI8 A;  3RZS A;  2LHL A;  4GBA A;  2JOJ A;  1QAT A;  1DVI A;  3GK2 A;  2F3Z A;  1X02 A;  1CDP A;  2PAL A;  1MR8 A;  3DVM A;  1A03 A;  1ZUZ A;  4FTG A;  1ODB A;  1Q80 A;  4QJ3 B;  1C7W A;  2L2E A;  1KFX S;  1MXL C;  2WCF A;  2MHH A;  4ICB A;  2CCM A;  4NQG A;  1YRT B;  3S0G A;  3EG5 B;  3I5I C;  1KK8 B;  1TRF A;  3VRR A;  4CID A;  2AAO A;  1SL7 A;  1EXR A;  1CLM A;  1K96 A;  4PCW A;  1KSM A;  3B86 A;  1NX1 A;  3A4U B;  2JRF A;  4R1E A;  4NDC A;  2E6W A;  1OE9 B;  5AEQ A;  1OMV A;  2BCA A;  3A8R A;  1B1G A;  1K2H A;  3FE6 A;  1LS8 A;  3I5G B;  3VRP A;  2JXL A;  4YRU A;  1F71 A;  1OOH A;  1F8H A;  3O78 A;  1L7Z A;  1LKJ A;  1U5I A;  1XFW O;  3I5F B;  1IG5 A;  3GOF A;  2WOR A;  3SG4 A;  1QJT A;  4JQ0 D;  5FYX A;  1DMO A;  2JT3 A;  3IQQ A;  4ORA B;  3VRQ A;  1CB1 A;  3S0E A;  2LM5 A;  1K9K A;  5I8N A;  2BE4 A;  3JTD C;  4PE1 A;  3R1P A;  2OTG C;  4ZCV A;  2WCB A;  5HL1 A;  1SPY A;  1YUS A;  1NWD A;  2JPO A;  2BL0 B;  1KCY A;  3CZ2 A;  4JPZ B;  1EG4 A;  1F4Q A;  2JC2 A;  3BUM B;  3BOW A;  3DZT A;  2ISD A;  1FW4 A;  4ORC B;  3QRX A;  3B6X A;  3CYZ A;  1YX7 A;  2M3W A;  2JPT A;  1TOP A;  3LCP C;  4WQ3 A;  2JZI A;  1QVI Y;  1DF0 A;  3EKH A;  1SRA A;  1QIV A;  2M0R A;  1FI6 A;  1RTP 1;  3BUN B;  1N0Y A;  2HQ8 A;  3CZ1 A;  1SSE B;  3O2P A;  1GJY A;  3TDI A;  3PAL A;  4OVN F;  3K21 A;  5GQQ C;  3ZNI A;  3BQ3 A;  1WRZ A;  3CDN A;  3KHE A;  1K95 A;  1KWO C;  1JC2 A;  1M31 A;  2M97 A;  2BCX A;  4OZD A;  5DIC A;  1CLB A;  1TNX A;  2D8N A;  1CDN A;  1K90 D;  1MHO A;  1IWQ A;  1OOG A;  2CXJ A;  1YTZ C;  1S1E A;  3R1V A;  2Q4U A;  4PT1 A;  2DOQ A;  1SW8 A;  2JT8 A;  5F6T A;  1DJZ A;  3TUY B;  2GTE A;  1QLS A;  3KPX A;  1D1O A;  2LC5 A;  1TNQ A;  1ZMZ A;  3D75 A;  2B1U A;  3FIA A;  4QJ5 B;  1A75 B;  2HET A;  1K8U A;  1XFZ O;  1QX7 A;  2JTZ A;  1K94 A;  5FI6 A;  1IQ5 A;  1MUX A;  1TUJ A;  2Y4Q A;  4A4C A;  4PE4 A;  4FQO A;  1CFF A;  1PK0 D;  1IQ3 A;  2K0J A;  3OBV A;  1WRL A;  3UO9 A;  1B9A A;  3PLF B;  2Q91 A;  1TNP A;  2ZRS A;  3FWB A;  2KFH A;  2F2O A;  1C3Y A;  2LVI A;  3WHT B;  3OB1 B;  1KSO A;  1OZO A;  5CSJ A;  1C07 A;  4MZL A;  1UHJ A;  3BXK A;  3CR2 A;  3I5H B;  2M7L A;  1XFU O;  1U5I B;  5D69 A;  4MRX A;  4AOM A;  3CS1 A;  1XVJ A;  3CR4 X;  3TS5 B;  4E68 A;  4GFT A;  1S3P A;  3D78 A;  3SG3 A;  4FQT A;  2AUC A;  4CFR A;  4XJK B;  1J1D A;  4IL1 A;  4HSZ A;  4QJ4 B;  3DYE A;  1IJ6 A;  1JFJ A;  1UHH A;  1B8C A;  3PSR A;  2KNE A;  4PHN A;  4YGA A;  5CSI A;  1NX0 A;  5EL2 A;  4PHJ A;  2JQ6 A;  4GPL B;  3SS5 A;  1XFV O;  1UWO A;  1XFX O;  2K2A A;  2M8U A;  5ER5 A;  2L0P A;  1DJW A;  2KAV A;  3BFH A;  5D3O A;  3JVT B;  2NCP A;  1BR4 B;  3I5F C;  3KEV A;  4OR9 B;  1B47 A;  1N65 A;  1NCX A;  4OV2 A;  1J7O A;  3VRN A;  1FI5 A;  3FE9 A;  2FJU B;  5DKQ A;  1DF0 B;  2WOS A;  3EVV A;  1DGU A;  5AFP A;  1OMR A;  3LK1 A;  5FI2 A;  1L2O B;  2LAP A;  4WQ2 A;  4I5L B;  2WCK A;  2MJW B;  3OX6 A;  2BL0 C;  2KI6 D;  1Y1X A;  2SCP A;  4INW A;  1MF8 B;  3L4A A;  1UHI A;  4KYN A;  5IBW A;  3O6B A;  1NP8 A;  4YGD B;  2H8V A;  5I2Q A;  1J55 A;  2BEC A;  1IKU A;  2WCL A;  2LVV A;  3D73 A;  3PM2 A;  2O60 A;  1DTL A;  2WC6 A;  2KGR A;  1A75 A;  2JT0 A;  1CFC A;  4IJ7 A;  4CFQ A;  3AKB A;  3BFB A;  4YGB B;  1AJ5 A;  2JTT A;  3RLZ A;  3TZ1 A;  5I94 A;  4PHM A;  2P71 A;  1AJ4 A;  2QDI A;  1LA0 A;  2JUL A;  3CLN A;  1REC A;  2LP3 A;  1JFK A;  2KI6 C;  3BJH A;  1QV0 A;  2L4H A;  1PVB A;  1S5G Z;  1DJH A;  1W7I B;  2CT9 A;  2CBL A;  1FBV A;  4C0K A;  1WDC B;  1YVL A;  3PN7 B;  2LMT A;  3TUY C;  3M0W A;  2JNX A;  3RM1 A;  1YR5 A;  2JU0 A;  2KOT A;  2K7O A;  5AAN A;  5HKW A;  1NX2 A;  1XO5 A;  1NYA A;  2BAP A;  2L5X B;  2NCO A;  1Y0V H;  2LVK A;  4XJK A;  3AKA A;  3EK8 A;  2LE9 B;  5DKN A;  1G33 A;  1H8B A;  4GGF A;  1CM4 A;  2AMI A;  2KAX A;  1T14 A;  4CLN A;  1TNW A;  1XK4 A;  3O4X A;  3NSO A;  1J1E A;  3SG2 A;  1RK9 A;  1ZAC A;  1ALW A;  2IS9 A;  1GGW A;  1LIN A;  3GK1 A;  1RRO A;  3F45 A;  4MRY A;  1S6J A;  5KU1 A;  3DXL A;  1J7P A;  1Y1A A;  3DVJ A;  1DEK A;  2LLU A;  2E30 A;  2QEB A;  1F4O A;  2I94 A;  3I5H C;  2KLD A;  3BUO B;  3DVE A;  2KI4 C;  1JF0 A;  3TS5 C;  1K9P A;  2WCJ A;  2OS8 B;  2LHI A;  1SL8 A;  1UHN A;  4N1G A;  3WXA A;  3QME A;  2LCP A;  4I5J A;  2G9B A;  3VB1 A;  1QTX A;  2WCM A;  1YUR A;  2K8M B;  3OP0 A;  3SG5 A;  1LA3 A;  1GQM A;  2MLF C;  2EC6 B;  4GGN A;  3TDU A;  2A4J A;  2H2K A;  1AP4 A;  3NSK A;  2PVB A;  2LLS A;  1XFY O;  2OPO A;  3SS4 A;  4M2P A;  2M1K B;  5D7F A;  5JOL A;  1IGV A;  2RGI A;  1WY9 A;  5B8I B;  1S36 A;  3NSI A;  4M2O A;  1W7J B;  1DT7 B;  3JVT C;  3IQO A;  3CWG A;  1SKT A;  1PVA A;  2L98 A;  2TN4 A;  1QS7 A;  3BUW B;  1CMF A;  2FJY A;  1QAS A;  1PAL A;  1CNP A;  2Y1N A;  3R1O A;  1OOF A;  2KBM A;  4MBE A;  1KQM B;  5AXI A;  1NIW A;  2PSR A;  5KTY A;  1WRK A;  4MSP A;  5HKZ A;  1L2O C;  1B7T Y;  1UHK A;  1V1F A;  1AUI B;  1DJG A;  2BCB A;  2SAS A;  2WC8 A;  1UUS A;  2YGU A;  2L4I A;  1ALV A;  2LVJ A;  2NZ0 A;  4PDZ A;  2M9G A;  4ETO A;  5PAL A;  3D0Y B;  1BOD A;  3LLE A;  1V1G A;  2BNX A;  3GK4 X;  1CFD A;  1QWV A;  5KSZ A;  1JUO A;  1B7T Z;  1SY9 A;  2KDH A;  1IJ5 A;  1QIW A;  2GV5 A;  2KBI A;  2BKH B;  1WLZ A;  3PAT A;  2BBM A;  3NSL A;  1UUR A;  2M1U A;  2KI4 B;  1H4B A;  3CTN A;  1M39 A;  4PHK A;  2O5G A;  3LL8 B;  3KO0 A;  2H61 A;  2Y1M A;  3NHI A;  3N7H A;  2QEO A;  4DS7 A;  2I7A A;  1GM0 A;  3CZT X;  4AQI A;  5HLV A;  1IRJ A;  2BBN A;  5HKY A;  1WDC C;  1BR1 B;  3NHT A;  3PJI A;  1QXP A;  1PSR A;  3PN7 C;  4YGE B;  1YUU A;  4PE7 A;  4C0J A;  2LAN A;  2ZN9 A;  1AVS A;  1N2D A;  2L51 A;  2PMY A;  5DKR A;  3BYA A;  3D74 A;  4N5X A;  2KPH A;  4JD9 A;  1J7R A;  2LMV A;  1VRK A;  3DD4 A;  1B8L A;  3SG7 A;  2CNP A;  3LK0 A;  4BY4 A;  2LUC A;  1HQV A;  3C1V A;  2H61 C;  2QEV A;  4CPV A;  5BPJ A;  1CKK A;  2QAC A;  1JF2 A;  2KYC A;  2M7N A;  1AHR A;  2K7C A;  5J3X A;  4JWQ A;  4DIR A;  4MLW A;  4MEW A;  3Q8I A;  4P2Y B;  1SR6 B;  5ER4 X;  1SBJ A;  5I2O A;  1DQE A;  4YI9 A;  5CSN A;  1GGZ A;  3B87 A;  1KK7 Z;  1S6I A;  2WCE A;  1KFU L;  2OS8 C;  1S5G Y;  2EGD A;  1R2U A;  2KSP A;  2PQL A;  3E3R A;  4L9M A;  1TIZ A;  1YVH A;  2COL B;  1EJ3 A;  3B7A A;  3D76 A;  1BG1 A;  4YGC B;  3L47 A;  1OW4 A;  1TN4 A;  2EC6 C;  1FPW A;  1J7Q A;  2FOT A;  2WCH A;  1S6C A;  3OB2 B;  1ZOT B;  4HRG A;  1A4P A;  1CLL A;  2PYQ A;  3D0Y A;  3V2L A;  1B4C A;  1B8R A;  2ZKM X;  2LNK A;  2K60 A;  2P70 A;  2QPT A;  1BF5 A;  1OOJ A;  1RJV A;  5CSF A;  3VGO A;  4A4B A;  3H4S E;  1XFR A;  3CGA A;  3IVT A;  2ZND A;  1M63 B;  4OKH A;  3SJS A;  1JSA A;  2K7D A;  1RFJ A;  1XYD A;  4BY5 A;  1NSH A;  1KQM C;  2F33 A;  2VRG A;  1KFU S;  4YBH B;  2GGZ A;  1QLK A;  2KAY A;  3FS7 A;  4WRI A;  3UNW A;  1MQ1 A;  4N1F A;  1K93 D;  2KQ6 A;  4MN0 A;  3SG6 A;  3CR5 X;  4D1E A;  5K89 A;  4P5O E;  1EH2 A;  2M29 A;  3PM8 A;  2NXQ A;  1S26 D;  2G2B A;  2LUX A;  1OQP A;  1DC1 A;  3OX5 A;  1F54 A;  1BOC A;  3S0F A;  2WC5 A;  1DJI A;  1P28 A;  2K61 A;  2ZN8 A;  1SCM B;  3CAB A;  3DVK A;  3SIA A;  2FCD A;  2L2C A;  1TUZ A;  3K1E A;  2KGB C;  4GUK A;  2ZFD A;  1A2X A;  1YUT A;  2ZNE A;  1FF1 A;  1OSA A;  1M45 A;  1ORG A;  4HRH A;  2K7B A;  3EVR A; 
#chains in the Genus database with same CATH homology
 4TNC A;  5TNC A;  2F8P A;  2GGM A;  4GNK B;  2KQY A;  1F55 A;  4GGF C;  5JJG A;  5AER A;  3AAJ A;  1TCO B;  1CDM A;  3AAK A;  5CPV A;  1XK4 C;  2BE6 A;  1QV1 A;  2LP2 A;  1DJX A;  2MBX A;  1C7V A;  2PRU A;  2HF5 A;  1JWD A;  1NX3 A;  2MLE C;  4USL A;  2LMU A;  3TDZ A;  2HQW A;  2KFG A;  3HX4 A;  3VRO A;  1TTX A;  2R2I A;  3ZWH A;  1PSB A;  1SYM A;  4MZK A;  2MRD A;  1BJF A;  5G08 A;  4AQJ A;  1IH0 A;  1A29 A;  2V53 A;  4DRW A;  4UPG A;  2K2F A;  1XA5 A;  1PRW A;  1KQV A;  1AK8 A;  2PAS A;  1UP5 A;  3DF0 A;  1SMG A;  2ZRT A;  3I5I B;  1BLQ A;  2KYF A;  1CDL A;  1QVI Z;  1SR6 C;  3KF9 A;  2P6B B;  2I18 A;  1EL4 A;  3OHM B;  3HCM A;  1G8I A;  3EK4 A;  2F3Y A;  1BT6 A;  2Y5I A;  4ORB B;  1E8A A;  1OMD A;  2WND A;  4Q04 A;  1BU3 A;  1Y6W A;  2EHB A;  4I5N B;  4C0L A;  1M46 A;  3IF7 A;  3O4Y A;  3SIB A;  3PFV A;  2FCE A;  1DJY A;  1SNL A;  1LVC D;  1MXE A;  5HLO A;  3EVU A;  1PUL A;  1NCY A;  1OZS A;  1R6P A;  2LLT A;  3EKJ A;  3FWC A;  3JTD B;  2L50 A;  2OTG B;  1G4Y R;  1NPQ A;  4GAO A;  3MSE B;  1LXF C;  1CFP A;  4HRE E;  1K9U A;  4NDB A;  1SL9 A;  2I2R E;  4XYN A;  1HT9 A;  3BUX B;  1NUB A;  1CM1 A;  4F0Z B;  1RWY A;  1F70 A;  4PE0 A;  1BMO A;  1DGV A;  2KHN A;  3D10 A;  4MZJ A;  2CTN A;  4M2Q A;  4DUQ A;  5HYD A;  2NLN A;  1KK7 Y;  1KK8 C;  1MWN A;  2LV7 A;  1YRU B;  1EG3 A;  1SCM C;  2MAZ A;  1KWO B;  1SK6 D;  2JNF A;  4U8D A;  3NXA A;  1WLM A;  4ZCU A;  5I2L A;  3BOW B;  4OCI A;  3EK7 A;  3I5G C;  4I5K A;  2F2P A;  1CTR A;  2JWW A;  2BKI B;  2M49 B;  1TCF A;  1YX8 A;  1SCV A;  1QX2 A;  1QX5 B;  1KFX L;  2HPS A;  4MVF A;  1JBA A;  1NCZ A;  2JXC A;  3WHU B;  4DCK A;  1ZFS A;  2KFF A;  3ICB A;  4PAL A;  3WNX B;  4NDD A;  2MA2 A;  1Y1U A;  3DF0 B;  1CMG A;  4YI8 A;  2LHL A;  4GBA A;  2JOJ A;  1QAT A;  1DVI A;  3GK2 A;  2F3Z A;  1X02 A;  1CDP A;  2PAL A;  1MR8 A;  3DVM A;  1A03 A;  1ZUZ A;  4FTG A;  1ODB A;  1Q80 A;  4QJ3 B;  1C7W A;  2L2E A;  1KFX S;  1MXL C;  2WCF A;  2MHH A;  4ICB A;  2CCM A;  4NQG A;  1YRT B;  3I5I C;  1KK8 B;  1TRF A;  3VRR A;  4CID A;  2AAO A;  1SL7 A;  1EXR A;  1CLM A;  1K96 A;  4PCW A;  1KSM A;  1NX1 A;  3A4U B;  2JRF A;  4R1E A;  4NDC A;  2E6W A;  1OE9 B;  5AEQ A;  1OMV A;  2BCA A;  3A8R A;  1B1G A;  1K2H A;  3I5G B;  3VRP A;  4YRU A;  2JXL A;  1F71 A;  1F8H A;  3O78 A;  1L7Z A;  1LKJ A;  1U5I A;  1XFW O;  3I5F B;  1IG5 A;  3GOF A;  2WOR A;  3SG4 A;  1QJT A;  4JQ0 D;  5FYX A;  1DMO A;  2JT3 A;  3IQQ A;  4ORA B;  3VRQ A;  1CB1 A;  2LM5 A;  1K9K A;  5I8N A;  2BE4 A;  3JTD C;  4PE1 A;  2OTG C;  4ZCV A;  2WCB A;  1SPY A;  1YUS A;  1NWD A;  1KCY A;  2BL0 B;  4JPZ B;  1EG4 A;  1F4Q A;  2JC2 A;  3BUM B;  3BOW A;  2ISD A;  1FW4 A;  4ORC B;  3QRX A;  1YX7 A;  2M3W A;  2JPT A;  1TOP A;  3LCP C;  4WQ3 A;  2JZI A;  1QVI Y;  1DF0 A;  3EKH A;  1SRA A;  1QIV A;  2M0R A;  1FI6 A;  1RTP 1;  3BUN B;  1N0Y A;  2HQ8 A;  3O2P A;  1GJY A;  3TDI A;  3PAL A;  4OVN F;  3K21 A;  5GQQ C;  3ZNI A;  3BQ3 A;  1WRZ A;  3KHE A;  1K95 A;  1KWO C;  1JC2 A;  1M31 A;  2M97 A;  2BCX A;  1CLB A;  1TNX A;  2D8N A;  1CDN A;  1K90 D;  1MHO A;  1IWQ A;  2CXJ A;  1YTZ C;  1S1E A;  2Q4U A;  2DOQ A;  1SW8 A;  2JT8 A;  5F6T A;  1DJZ A;  3TUY B;  1QLS A;  3KPX A;  1D1O A;  2LC5 A;  1TNQ A;  1ZMZ A;  2B1U A;  3FIA A;  4QJ5 B;  1A75 B;  2HET A;  1K8U A;  1XFZ O;  1QX7 A;  2JTZ A;  1K94 A;  1IQ5 A;  1MUX A;  2Y4Q A;  4A4C A;  4PE4 A;  4FQO A;  1CFF A;  1PK0 D;  1IQ3 A;  2K0J A;  1WRL A;  1B9A A;  3PLF B;  2Q91 A;  1TNP A;  2ZRS A;  3FWB A;  2KFH A;  2F2O A;  2LVI A;  3WHT B;  3OB1 B;  1KSO A;  1OZO A;  5CSJ A;  1C07 A;  4MZL A;  1UHJ A;  3BXK A;  3CR2 A;  3I5H B;  2M7L A;  1XFU O;  1U5I B;  5D69 A;  4MRX A;  4AOM A;  3CS1 A;  1XVJ A;  3CR4 X;  3TS5 B;  4E68 A;  4GFT A;  1S3P A;  3SG3 A;  2AUC A;  4CFR A;  4XJK B;  1J1D A;  4IL1 A;  4HSZ A;  4QJ4 B;  1IJ6 A;  1JFJ A;  1UHH A;  1B8C A;  3PSR A;  2KNE A;  4PHN A;  4YGA A;  5CSI A;  1NX0 A;  4PHJ A;  2JQ6 A;  4GPL B;  1XFV O;  1UWO A;  1XFX O;  2K2A A;  2M8U A;  5ER5 A;  2L0P A;  1DJW A;  2KAV A;  3RM1 A;  3VGO A;  3JVT B;  2NCP A;  1BR4 B;  3I5F C;  3KEV A;  4OR9 B;  1B47 A;  1N65 A;  1NCX A;  4OV2 A;  1J7O A;  3VRN A;  1FI5 A;  2FJU B;  5DKQ A;  1DF0 B;  2WOS A;  3EVV A;  1DGU A;  5AFP A;  1OMR A;  3LK1 A;  1L2O B;  2LAP A;  4WQ2 A;  4I5L B;  2MJW B;  3OX6 A;  2BL0 C;  2KI6 D;  1Y1X A;  2SCP A;  1MF8 B;  1UHI A;  5IBW A;  3O6B A;  1NP8 A;  4YGD B;  5I2Q A;  1J55 A;  2BEC A;  1IKU A;  2LVV A;  2O60 A;  1DTL A;  2KGR A;  1A75 A;  2JT0 A;  1CFC A;  4CFQ A;  3AKB A;  4YGB B;  3RLZ A;  1AJ5 A;  2JTT A;  3TZ1 A;  4PHM A;  1AJ4 A;  1LA0 A;  2JUL A;  3CLN A;  1REC A;  2LP3 A;  1JFK A;  2KI6 C;  1QV0 A;  2L4H A;  1PVB A;  1S5G Z;  1DJH A;  1W7I B;  2CT9 A;  2CBL A;  1FBV A;  4C0K A;  1WDC B;  1YVL A;  3PN7 B;  2LMT A;  3TUY C;  3M0W A;  2JNX A;  1YR5 A;  2JU0 A;  2KOT A;  2K7O A;  5AAN A;  5HKW A;  1NX2 A;  1XO5 A;  1NYA A;  2L5X B;  2NCO A;  1Y0V H;  2LVK A;  4XJK A;  3AKA A;  3EK8 A;  2LE9 B;  5DKN A;  1G33 A;  1H8B A;  4GGF A;  1CM4 A;  2AMI A;  2KAX A;  4CLN A;  1TNW A;  1XK4 A;  3NSO A;  1J1E A;  3SG2 A;  1RK9 A;  1ZAC A;  1ALW A;  2IS9 A;  1GGW A;  1LIN A;  3GK1 A;  1RRO A;  3F45 A;  4MRY A;  1S6J A;  5KU1 A;  1J7P A;  1Y1A A;  3DVJ A;  2LLU A;  2E30 A;  1F4O A;  2I94 A;  3I5H C;  3BUO B;  3DVE A;  2KI4 C;  1JF0 A;  3TS5 C;  1K9P A;  2OS8 B;  2LHI A;  1SL8 A;  1UHN A;  4N1G A;  3WXA A;  4I5J A;  2LCP A;  2G9B A;  1QTX A;  1YUR A;  2K8M B;  3OP0 A;  3SG5 A;  1LA3 A;  1GQM A;  2MLF C;  2EC6 B;  4GGN A;  3TDU A;  2A4J A;  2H2K A;  1AP4 A;  3NSK A;  2PVB A;  2LLS A;  1XFY O;  2OPO A;  4M2P A;  2M1K B;  5D7F A;  5JOL A;  1IGV A;  2RGI A;  1WY9 A;  5B8I B;  1S36 A;  3NSI A;  4M2O A;  1W7J B;  1DT7 B;  3JVT C;  3IQO A;  3CWG A;  1SKT A;  1PVA A;  2L98 A;  2TN4 A;  1QS7 A;  3BUW B;  1CMF A;  1QAS A;  1PAL A;  1CNP A;  2Y1N A;  5AXI A;  2KBM A;  4MBE A;  1KQM B;  1NIW A;  2PSR A;  5KTY A;  1WRK A;  4MSP A;  5HKZ A;  1L2O C;  1B7T Y;  1UHK A;  1V1F A;  1AUI B;  1DJG A;  2BCB A;  2SAS A;  2WC8 A;  1UUS A;  2L4I A;  1ALV A;  2LVJ A;  2NZ0 A;  4PDZ A;  2M9G A;  4ETO A;  5PAL A;  3D0Y B;  1BOD A;  3LLE A;  1V1G A;  3GK4 X;  1CFD A;  5KSZ A;  1JUO A;  1B7T Z;  1SY9 A;  2KDH A;  1IJ5 A;  1QIW A;  2GV5 A;  2KBI A;  2BKH B;  1WLZ A;  3PAT A;  2BBM A;  3NSL A;  1UUR A;  2M1U A;  2KI4 B;  1H4B A;  3CTN A;  1M39 A;  4PHK A;  2O5G A;  3LL8 B;  3KO0 A;  2H61 A;  2Y1M A;  4DS7 A;  2I7A A;  3CZT X;  4AQI A;  5HLV A;  1IRJ A;  2BBN A;  5HKY A;  1WDC C;  1BR1 B;  3PN7 C;  1QXP A;  1PSR A;  4YGE B;  1YUU A;  4PE7 A;  4C0J A;  2LAN A;  2ZN9 A;  1AVS A;  1N2D A;  2L51 A;  2PMY A;  5DKR A;  3BYA A;  4N5X A;  1J7R A;  2LMV A;  1VRK A;  3DD4 A;  1B8L A;  3SG7 A;  2CNP A;  3LK0 A;  4BY4 A;  2LUC A;  1HQV A;  3C1V A;  2H61 C;  4CPV A;  5BPJ A;  1CKK A;  2QAC A;  1JF2 A;  2KYC A;  2M7N A;  1AHR A;  2K7C A;  5J3X A;  4JWQ A;  4DIR A;  4MLW A;  4MEW A;  4P2Y B;  1SR6 B;  5ER4 X;  1SBJ A;  5I2O A;  4YI9 A;  5CSN A;  1GGZ A;  1KK7 Z;  1S6I A;  2WCE A;  1KFU L;  2OS8 C;  1S5G Y;  2EGD A;  1R2U A;  2KSP A;  3E3R A;  4L9M A;  1TIZ A;  1YVH A;  2COL B;  1EJ3 A;  1BG1 A;  4YGC B;  1TN4 A;  2EC6 C;  1FPW A;  1J7Q A;  2FOT A;  1S6C A;  3OB2 B;  1ZOT B;  4HRG A;  1A4P A;  1CLL A;  3D0Y A;  1B4C A;  1B8R A;  2ZKM X;  2LNK A;  2QPT A;  1BF5 A;  1OOJ A;  1RJV A;  5CSF A;  4A4B A;  3H4S E;  3CGA A;  2ZND A;  1M63 B;  4OKH A;  3SJS A;  1JSA A;  2K7D A;  1RFJ A;  1XYD A;  4BY5 A;  1NSH A;  1KQM C;  2F33 A;  2VRG A;  1KFU S;  4YBH B;  2GGZ A;  1QLK A;  2KAY A;  3FS7 A;  4WRI A;  1MQ1 A;  4N1F A;  1K93 D;  2KQ6 A;  4MN0 A;  3SG6 A;  3CR5 X;  4D1E A;  5K89 A;  4P5O E;  1EH2 A;  2M29 A;  3PM8 A;  2NXQ A;  1S26 D;  2G2B A;  2LUX A;  1OQP A;  3OX5 A;  1F54 A;  1BOC A;  1DJI A;  2ZN8 A;  2K61 A;  3DVK A;  1SCM B;  3SIA A;  2FCD A;  2KGB C;  4GUK A;  2ZFD A;  1A2X A;  1YUT A;  2ZNE A;  1FF1 A;  1OSA A;  1M45 A;  4HRH A;  2K7B A;  3EVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...