4MRYA

Crystal structure of ca(2+)- discharged y138f obelin mutant from obelia longissima at 1.30 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
187
structure length
187
Chain Sequence
LKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAFGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Structures of the Ca2+-regulated photoprotein obelin Y138F mutant before and after bioluminescence support the catalytic function of a water molecule in the reaction
doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 80
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mryA00
2NCPA 4OVNF 2MAZA 3HCMA 3D10A 2JT0A 4U8DA 1M63B 1J55A 1JBAA 2M0RA 1S1EA 3EK8A 1NWDA 1MR8A 2NXQA 2CCMA 4I5KA 2L0PA 5PALA 1YR5A 2KDHA 4GGFC 4ICBA 1LVCD 4PCWA 2LVJA 3OB1B 4A4BA 1CKKA 3SIBA 1MUXA 3AKAA 3EVRA 2QACA 2Q4UA 3I5FC 3CR4X 3EVVA 1WLZA 3I5FB 1K95A 1H4BA 1DTLA 3DF0A 1LXFC 1SBJA 1J1EA 1ZOTB 1N65A 3CLNA 1NP8A 4GUKA 1LINA 4BY5A 2HQ8A 3CR2A 1YVLA 2JNFA 2I94A 2LUCA 3D0YA 3SG6A 2WCFA 1YX7A 1F8HA 2CBLA 1W7IB 2HETA 4HSZA 2K0JA 5AERA 1QX2A 2A4JA 1U5IA 1R2UA 2JQ6A 1XVJA 1B8CA 1FBVA 2DOQA 4GPLB 2L98A 2JT3A 1D1OA 3O78A 1JFKA 1DJGA 3PFVA 1DJIA 1A03A 1IGVA 3ZWHA 2SASA 1GQMA 2LVVA 2JPTA 5HLOA 2MBXA 3AAKA 1Y1UA 2PMYA 1N0YA 1XYDA 1AK8A 3I5IC 1N2DA 1NCXA 1QX7A 2KAVA 2WORA 4XJKB 3RM1A 3I5IB 5I8NA 1RECA 2JU0A 4DUQA 1QX5B 1OE9B 2EC6C 2G2BA 1OMVA 1BG1A 1SNLA 2KBIA 2EC6B 1AP4A 2LE9B 1XFZO 1RFJA 4CFQA 2EHBA 2O5GA 3SG3A 2L4IA 3DD4A 5B8IB 1QTXA 2IS9A 1CTRA 4M2PA 4OCIA 4OR9B 1VRKA 1NSHA 4D1EA 1QV0A 1CMFA 1DJHA 5J3XA 3BUOB 3LK0A 1QIVA 5DKQA 2ZNEA 3EKJA 4CIDA 1PSRA 2KI6D 1S6CA 3VRNA 4PALA 4PE4A 1RWYA 4ZCVA 1GJYA 1KFUL 1Y1AA 2KFHA 5JOLA 1M39A 2OS8B 5K89A 1TNQA 4Q04A 1PRWA 1F70A 2LP2A 2K61A 5IBWA 2MLFC 2OPOA 1CB1A 5G08A 1QATA 1SCMC 1DVIA 2BE6A 1ODBA 1L2OC 2KOTA 2ZNDA 3EK4A 4GNKB 3SG4A 1L2OB 2M3WA 1KK7Y 1QV1A 5CSIA 1EG3A 3NXAA 3LK1A 2NZ0A 1A29A 1HQVA 2BL0C 3H4SE 1AVSA 4ZCUA 4C0JA 3CS1A 2BL0B 1RJVA 1SCVA 4CLNA 4DRWA 1XFUO 1K9KA 4C0KA 1YUUA 1CMGA 2KGBC 2WOSA 4NQGA 4FTGA 4PHNA 2M8UA 2KGRA 3DF0B 1G4YR 1BU3A 2HPSA 1RROA 2PRUA 2D8NA 4N1GA 5JJGA 1K9PA 2K2AA 1MXEA 2KAYA 5CSFA 3JVTC 4BY4A 3JVTB 4TNCA 3FWCA 3OHMB 4MEWA 2BKIB 1S5GZ 1W7JB 3IQOA 3D0YB 1GGZA 2LM5A 2ZFDA 1DJWA 2JNXA 3NSIA 4YI9A 2Q91A 3I5GC 2KSPA 5I2LA 3I5GB 3PALA 2LMTA 1SL8A 2NCOA 1KSOA 1SKTA 1GGWA 1FW4A 1PALA 1U5IB 2BE4A 1JC2A 2M1UA 4PDZA 1A2XA 3PATA 1MHOA 3KHEA 2LUXA 5ER5A 1TN4A 2JT8A 4ETOA 4ORBB 4NDDA 4NDBA 1DJYA 5DKRA 2JTZA 1NCZA 1IRJA 2LLSA 2GGZA 5TNCA 1G33A 1SL7A 2MA2A 1XFWO 2H2KA 2AAOA 3IQQA 3BOWA 2OTGC 3O6BA 2L5XB 1KK8C 2OTGB 4MLWA 1KWOC 1PVBA 4N5XA 4YGAA 1KK8B 3DVKA 4HRGA 1KWOB 2CT9A 2FCDA 2E6WA 3VRQA 2L51A 2BCBA 3PN7C 3PN7B 1OMDA 2NLNA 3WXAA 4XYNA 1JUOA 1MQ1A 1X02A 1IQ3A 2BCAA 4QJ3B 1M46A 1S6JA 2JULA 1C7VA 2PALA 1CM1A 2EGDA 4PHKA 1RK9A 4YI8A 1F4OA 1QS7A 3SJSA 5I2QA 1TRFA 1NUBA 1S26D 1SYMA 2BECA 3AAJA 3O2PA 1AUIB 1S6IA 1XO5A 2K7CA 1DGVA 1KQMC 5DKNA 3I5HC 1KQMB 1CFDA 1KFXS 5CPVA 4CPVA 1K96A 1EJ3A 2F33A 3FS7A 4JQ0D 2Y4QA 2LNKA 1Y0VH 4R1EA 1NX3A 2KAXA 1WDCC 4CFRA 1WDCB 2F2PA 4UPGA 2F3ZA 2LP3A 2O60A 1B9AA 1SMGA 5HKZA 1HT9A 3VROA 3LLEA 2JTTA 2LAPA 3A8RA 2L50A 3EK7A 1B7TY 1ZUZA 3CZTX 3FIAA 1BODA 2JC2A 1SW8A 3CWGA 3ZNIA 2LLTA 3SG5A 1CNPA 1QVIY 4YGBB 2LMVA 3TUYC 3TUYB 1V1GA 3OX5A 2WC8A 3SIAA 1YUSA 4PE7A 2LANA 4ORCB 1YRUB 4WRIA 2F2OA 2M1KB 2RGIA 3LL8B 3WHUB 3HX4A 1XA5A 2H61A 5AEQA 1J7OA 1DF0A 3KO0A 1UURA 3C1VA 3PLFB 1JF2A 2SCPA 4MZKA 2FCEA 3CTNA 1NIWA 1RTP1 1OQPA 2I2RE 2PSRA 2V53A 2ZRSA 3RLZA 3LCPC 1QJTA 3F45A 1YX8A 1K2HA 2K7BA 4P5OE 1NCYA 3O4YA 1SCMB 3QRXA 4AQJA 1OOJA 3TDUA 1J7RA 1J7QA 1QLKA 3FWBA 4YBHB 2KYFA 4PE1A 1OSAA 1IJ6A 4L9MA 2KI6C 2M97A 1C7WA 2ZKMX 3CGAA 1IQ5A 3BOWB 4WQ2A 1L7ZA 1UP5A 2LLUA 2KQYA 1BR1B 3K21A 4DCKA 1IJ5A 3OP0A 1CM4A 3JTDC 3IF7A 2M7LA 3JTDB 1B47A 1F4QA 2Y1NA 2JOJA 4I5NB 1SR6C 5GQQC 2GGMA 1WRZA 1EXRA 2Y5IA 2KYCA 4MZJA 2LHLA 1PSBA 4YGEB 3GK1A 1K90D 3TZ1A 1TOPA 1BLQA 1M45A 1Y6WA 3NSLA 5HYDA 1FF1A 1CFCA 3OX6A 3VGOA 2BKHB 2KBMA 4JWQA 1CLLA 2MLEC 4AQIA 2HQWA 2F3YA 2F8PA 3BQ3A 1TIZA 2M9GA 2JXCA 3BYAA 1KQVA 3DVEA 2COLB 1SPYA 1TTXA 2E30A 1BMOA 4USLA 4F0ZB 2P6BB 5AFPA 1B4CA 3VRRA 1H8BA 4PHMA 1NX1A 2CXJA 1KCYA 2BBMA 2ZN8A 1AHRA 2FJUB 1KFUS 2KFGA 3A4UB 3ICBA 4PE0A 4JPZB 2WCEA 3DVMA 5CSJA 1NPQA 1SY9A 1XFYO 1CLBA 1WRLA 4M2QA 1TNPA 5AANA 5D69A 4FQOA 2CTNA 4QJ4B 5KSZA 4DS7A 3AKBA 2KI4C 3TS5C 5KTYA 2KI4B 3SG2A 3TS5B 4M2OA 1A75A 4PHJA 1TNXA 1OZOA 2M49B 2WNDA 2R2IA 1R6PA 4A4CA 1C07A 1NX0A 4GAOA 2WCBA 4QJ5B 1LA0A 1XK4A 1F55A 2H61C 1YTZC 1JF0A 1KK7Z 3EKHA 1DF0B 4N1FA 1JFJA 4MN0A 3EVUA 1QXPA 1DGUA 1UHIA 1UHHA 3NSOA 1J7PA 1B8RA 2L4HA 3KEVA 3M0WA 1YURA 1JWDA 1WLMA 1AJ4A 4OKHA 2JRFA 2BCXA 1NX2A 2KHNA 3I5HB 1BJFA 1BOCA 3GK4X 2PVBA 1BT6A 2K2FA 3KPXA 1UWOA 1YVHA 1IWQA 2LV7A 3OB2B 4MZLA 2M7NA 1MXLC 2QPTA 1CDNA 5D7FA 2JXLA 1OMRA 3BXKA 1K93D 1TNWA 1PVAA 1QIWA 2JZIA 4MBEA 4NDCA 1E8AA 1CDPA 1S5GY 3BUMB 2MJWB 3GK2A 4C0LA 1QLSA 4HREE 1B1GA 2VRGA 2GV5A 2LC5A 1CFPA 1EH2A 1NYAA 3KF9A 2L2EA 1G8IA 4GGFA 1LKJA 1SK6D 1DT7B 1BF5A 4WQ3A 1DMOA 5I2OA 1Q80A 1XFVO 1SRAA 3NSKA 2LVIA 2ZRTA 3DVJA 5KU1A 1UHNA 2LCPA 5ER4X 1S36A 1CDLA 1ZFSA 4YRUA 3BUWB 4MRXA 1JSAA 2JWWA 1F54A 2AMIA 3MSEB 1EG4A 3WNXB 1SL9A 1UHKA 1CFFA 3VRPA 1MWNA 2HF5A 4I5LB 1BR4B 1XFXO 1DJZA 2AUCA 1FI5A 1IH0A 4ORAB 4E68A 5BPJA 1IG5A 1DJXA 1LA3A 2LHIA 3E3RA 2FOTA 1FPWA 1EL4A 4GGNA 3PM8A 4MRYA 2KQ6A 3CR5X 1Y1XA 2BBNA 2OS8C 1S3PA 2I18A 2LMUA 1QASA 2LVKA 1UUSA 3TDZA 1YUTA 1KSMA 1ALWA 3PSRA 3GOFA 5CSNA 4GBAA 1SR6B 1A4PA 5FYXA 4AOMA 1A75B 1UHJA 3TDIA 1F71A 1ZMZA 1PK0D 4XJKA 4MVFA 1XK4C 1K9UA 1TCOB 4GFTA 4I5JA 4YGCB 5HKWA 3WHTB 2ISDA 1B8LA 4MSPA 1TCFA 2K7DA 5HKYA 4P2YB 5F6TA 2MHHA 1FI6A 1K8UA 1OZSA 4HRHA 5AXIA 4DIRA 4YGDB 3BUXB 1AJ5A 4IL1A 2PASA 1WRKA 2Y1MA 2B1UA 2G9BA 1ZACA 1B7TZ 2I7AA 2K8MB 2TN4A 1KFXL 1YRTB 1IKUA 1MF8B 2CNPA 1CLMA 1M31A 1WY9A 4OV2A 2MRDA 1QVIZ 1V1FA 2KFFA 3BUNB 5HLVA 2K7OA 3SG7A 2M29A 1CDMA 1J1DA 1K94A 2KNEA 2ZN9A 1ALVA 1PULA
chains in the Genus database with same CATH superfamily
2BNXA 3VB1A 2NCPA 4OVNF 2MAZA 3HCMA 5FI6A 3D10A 2JT0A 2WCKA 4U8DA 1M63B 1J55A 3FE9A 1JBAA 2M0RA 1DC1A 1S1EA 3EK8A 1NWDA 1MR8A 2NXQA 2CCMA 3DYEA 3PM2A 4I5KA 2L0PA 5PALA 1YR5A 2KDHA 4GGFC 4ICBA 1LVCD 4PCWA 2L2CA 2LVJA 3OB1B 4A4BA 1CKKA 3SIBA 1MUXA 3AKAA 3EVRA 2QACA 2Q4UA 3D78A 3CR4X 3EVVA 3I5FC 1WLZA 3I5FB 1K95A 1H4BA 1DTLA 3DF0A 3K1EA 1LXFC 1OOGA 1SBJA 1J1EA 1ZOTB 1N65A 3CLNA 1NP8A 4GUKA 1LINA 4BY5A 2HQ8A 3CR2A 1YVLA 1C3YA 2JNFA 2I94A 2L5YA 2LUCA 3D0YA 1OW4A 3SG6A 2WCFA 1YX7A 2QEVA 1F8HA 2CBLA 1W7IB 3B87A 2HETA 4HSZA 2K0JA 2WC6A 5AERA 1QX2A 2A4JA 1U5IA 1R2UA 2JQ6A 1XVJA 1B8CA 1FBVA 2DOQA 4GPLB 2L98A 2JT3A 1D1OA 3O78A 1JFKA 1DJGA 3PFVA 2QDIA 1DJIA 1A03A 1IGVA 3ZWHA 2SASA 1GQMA 2LVVA 2JPTA 5HLOA 2MBXA 3AAKA 1Y1UA 1C3ZA 1N0YA 1XYDA 2PMYA 1AK8A 3I5IC 1N2DA 1NCXA 1QX7A 2KAVA 2WORA 4XJKB 3RM1A 3I5IB 3R72A 5I8NA 1RECA 2JU0A 4DUQA 1QX5B 1OE9B 2EC6C 2G2BA 1OMVA 3R1PA 1BG1A 1SNLA 2KBIA 2EC6B 1AP4A 2LE9B 4JKTA 1GM0A 1XFZO 1RFJA 1QWVA 4CFQA 2EHBA 2O5GA 3SG3A 2L4IA 3DD4A 3B7AA 5B8IB 1QTXA 2IS9A 1CTRA 4M2PA 4OCIA 4OR9B 1VRKA 1NSHA 4D1EA 2WC5A 1OOIX 1QV0A 1CMFA 1DJHA 5J3XA 3BUOB 3R1OA 3D75A 3LK0A 1QIVA 1OOHA 3L4AA 3L4LA 2ZNEA 4FQTA 5DKQA 3EKJA 3IVTA 4CIDA 1PSRA 2FJYA 2KI6D 3B86A 4F7FA 3DXLA 1S6CA 3VRNA 4PALA 4PE4A 1RWYA 4ZCVA 1GJYA 1KFUL 1Y1AA 2KFHA 5JOLA 1M39A 2OS8B 5K89A 1TNQA 1W9ZA 4Q04A 1PRWA 1F70A 2LP2A 2K61A 5IBWA 2MLFC 2OPOA 1CB1A 5G08A 1QATA 1SCMC 1DVIA 2BE6A 1ODBA 1L2OC 2KOTA 2PYQA 2ZNDA 3EK4A 4GNKB 3SG4A 1L2OB 2M3WA 4IJ7A 1KK7Y 1QV1A 5CSIA 3RZSA 1EG3A 3UNWA 3NXAA 3LK1A 2NZ0A 1A29A 1HQVA 2BL0C 3H4SE 1AVSA 4ZCUA 4C0JA 3CS1A 1SCVA 1RJVA 2BL0B 4CLNA 4DRWA 1XFUO 1K9KA 4C0KA 1YUUA 1CMGA 2KGBC 2WOSA 3OGNA 4NQGA 4FTGA 4PHNA 2M8UA 2KGRA 3DF0B 1G4YR 1BU3A 2HPSA 1RROA 2KLDA 2D8NA 2PRUA 4N1GA 5JJGA 1K9PA 2K2AA 1MXEA 2KAYA 4PT1A 3JVTC 5CSFA 4BY4A 3JVTB 4TNCA 3FWCA 3OHMB 4MEWA 2BKIB 3SS4A 1S5GZ 3N7HA 1W7JB 3IQOA 3D0YB 1GGZA 2LM5A 2ZFDA 1DJWA 2JNXA 3NSIA 4YI9A 3QMEA 2Q91A 3I5GC 2KSPA 3BFHA 5I2LA 3I5GB 3PALA 2LMTA 1SL8A 2NCOA 1KSOA 2WCLA 1SKTA 1GGWA 1FW4A 1PALA 1U5IB 2BE4A 1JC2A 2M1UA 4PDZA 1A2XA 3PATA 1MHOA 3KHEA 3NHTA 2LUXA 3PJIA 5ER5A 1TN4A 2JT8A 4ETOA 4ORBB 4NDDA 4NDBA 1DJYA 5DKRA 2JTZA 1NCZA 1IRJA 2LLSA 2GGZA 3B88A 1G33A 5TNCA 1SL7A 3UO9A 2MA2A 1XFWO 2H2KA 2AAOA 3IQQA 3BOWA 2OTGC 3O6BA 2L5XB 1KK8C 2OTGB 4MLWA 1KWOC 1PVBA 4N5XA 4YGAA 1KK8B 3DVKA 4HRGA 1KWOB 2CT9A 2FCDA 2E6WA 3CDNA 3VRQA 2L51A 2BCBA 3D73A 3PN7C 3PN7B 1OMDA 2NLNA 3WXAA 3FE8A 4XYNA 1JUOA 1MQ1A 3FE6A 1X02A 1IQ3A 2BCAA 4QJ3B 3S0AA 1M46A 1S6JA 2QEOA 2JULA 1C7VA 2PALA 1CM1A 2EGDA 4PHKA 1RK9A 4YI8A 1F4OA 1QS7A 3Q8IA 3SJSA 5I2QA 1TRFA 2WCJA 1NUBA 1S26D 1SYMA 2BECA 3AAJA 3O2PA 3NGVA 1AUIB 1S6IA 1XO5A 2K7CA 1DGVA 1KQMC 4INWA 5DKNA 3I5HC 1KQMB 2YGUA 1CFDA 1KFXS 5CPVA 4CPVA 1K96A 1EJ3A 4INXA 2F33A 3FS7A 4JQ0D 2Y4QA 3CZ0A 2LNKA 3BFBA 1Y0VH 4R1EA 1LS8A 5I94A 1NX3A 1TUJA 2KAXA 2ERBA 3S0FA 1WDCC 1JWDA 4CFRA 1WDCB 2F2PA 4UPGA 2F3ZA 2LP3A 2O60A 1B9AA 1SMGA 5HKZA 1HT9A 3VROA 3LLEA 2JTTA 2LAPA 3A8RA 2L50A 3EK7A 1B7TY 1ZUZA 3CZTX 3FIAA 1BODA 2JC2A 1SW8A 3CWGA 3ZNIA 2LLTA 3NHIA 3SG5A 1CNPA 1QVIY 4YGBB 2LMVA 3TUYC 1ORGA 3S0DA 3TUYB 1V1GA 3OX5A 2WC8A 3SIAA 1YUSA 4PE7A 2LANA 4ORCB 1YRUB 4WRIA 2F2OA 2M1KB 2RGIA 3LL8B 3WHUB 3HX4A 2PQLA 1XA5A 2H61A 5AEQA 1J7OA 3EG5B 1DF0A 3KO0A 1UURA 3C1VA 5D3OA 3PLFB 1JF2A 2SCPA 4MZKA 2FCEA 3CTNA 1NIWA 1RTP1 1OQPA 2I2RE 2PSRA 2V53A 2ZRSA 3BJHA 3LCPC 1QJTA 3F45A 3SS3A 1YX8A 1K2HA 2K7BA 4P5OE 1NCYA 3O4YA 2BAPA 1SCMB 3QRXA 4AQJA 1OOJA 3TDUA 3SS5A 1J7RA 1J7QA 1QLKA 3FWBA 4YBHB 2KYFA 3D76A 4PE1A 1OSAA 1IJ6A 4L9MA 2KI6C 2M97A 1C7WA 2ZKMX 3CGAA 1IQ5A 3BOWB 4WQ2A 1L7ZA 1UP5A 2LLUA 2KQYA 1BR1B 3K21A 4DCKA 1IJ5A 3OP0A 1CM4A 3JTDC 1OOFA 3IF7A 2M7LA 3JTDB 1B47A 1F4QA 2KPHA 2Y1NA 2JOJA 4I5NB 1SR6C 5GQQC 2GGMA 1WRZA 1EXRA 2Y5IA 2KYCA 4MZJA 2LHLA 1PSBA 2K60A 4YGEB 1P28A 3GK1A 1K90D 3TZ1A 3DY9A 1TOPA 1BLQA 1M45A 1Y6WA 3NSLA 5HYDA 3CZ1A 1T14A 1FF1A 3B6XA 1CFCA 1SSEB 3OX6A 3VGOA 2BKHB 2KBMA 4JWQA 1CLLA 2MLEC 4AQIA 2HQWA 2F3YA 2F8PA 3BQ3A 1TIZA 2WCHA 2M9GA 2JXCA 3BYAA 5HL1A 1KQVA 3DVEA 2COLB 1SPYA 1TTXA 2E30A 1BMOA 4USLA 4F0ZB 2P6BB 5AFPA 1B4CA 3DZTA 3VRRA 1H8BA 4PHMA 1NX1A 2CXJA 3V2LA 1KCYA 2BBMA 2ZN8A 1AHRA 2FJUB 1KFUS 2KFGA 3A4UB 3ICBA 4PE0A 4JPZB 2WCEA 3DVMA 5CSJA 1NPQA 1SY9A 3O4XA 2P71A 1XFYO 1CLBA 1WRLA 4M2QA 1TNPA 5AANA 4JD9A 4KYNA 5D69A 4FQOA 2CTNA 4QJ4B 5KSZA 4DS7A 3AKBA 2KI4C 3S0EA 3TS5C 5KTYA 2KI4B 3SG2A 3TS5B 4M2OA 1A75A 4PHJA 1TNXA 1OZOA 2M49B 2WNDA 2R2IA 1R6PA 5FI2A 4A4CA 1C07A 1NX0A 4GAOA 2WCBA 4QJ5B 1LA0A 1XK4A 1F55A 2QEBA 2H61C 1YTZC 1JF0A 1KK7Z 5FI7A 3EKHA 1DF0B 4N1FA 3OBVA 1JFJA 4MN0A 3EVUA 1QXPA 1DGUA 1UHIA 1UHHA 3NSOA 1J7PA 1B8RA 2L4HA 3KEVA 3M0WA 1YURA 3CYZA 1WLMA 1AJ4A 1Z2CB 2JRFA 4OKHA 2BCXA 1NX2A 2KHNA 3S0GA 3I5HB 1BJFA 1BOCA 3GK4X 2PVBA 1BT6A 2K2FA 3KPXA 3D77A 1UWOA 1YVHA 1IWQA 2LV7A 3OB2B 4MZLA 2M7NA 2KLEA 1MXLC 2QPTA 1CDNA 5D7FA 2JXLA 1OMRA 3BXKA 1K93D 1TNWA 3D74A 1PVAA 1QIWA 2JZIA 4MBEA 4NDCA 1E8AA 1CDPA 1S5GY 3BUMB 1TWOA 2MJWB 3GK2A 4C0LA 1QLSA 4HREE 1B1GA 2VRGA 2GV5A 2LC5A 3CABA 1CFPA 1EH2A 1NYAA 3KF9A 2L2EA 1G8IA 4GGFA 1LKJA 1SK6D 1DT7B 1BF5A 4WQ3A 3CZ2A 1DMOA 5I2OA 1Q80A 1XFVO 1SRAA 3NSKA 3S0BA 2LVIA 2ZRTA 3DVJA 5KU1A 1UHNA 2LCPA 2P70A 5ER4X 1S36A 2JPOA 1XFRA 1CDLA 1ZFSA 2GTEA 4YRUA 3BUWB 4OZDA 4MRXA 1JSAA 2JWWA 3BFAA 2AMIA 1F54A 3MSEB 1EG4A 3RLZA 3WNXB 1SL9A 1UHKA 1CFFA 3VRPA 1MWNA 2HF5A 4I5LB 1BR4B 1XFXO 1DJZA 1TUZA 2AUCA 1FI5A 1IH0A 4ORAB 2H8VA 5DICA 4E68A 5BPJA 1IG5A 1DJXA 1LA3A 2LHIA 3E3RA 2FOTA 1FPWA 1EL4A 4GGNA 3PM8A 4MRYA 2KQ6A 3CR5X 1Y1XA 2BBNA 3R1VA 2OS8C 1S3PA 2I18A 2LMUA 1QASA 2LVKA 1UUSA 3TDZA 1YUTA 1KSMA 1ALWA 3L47A 3GOFA 3PSRA 5CSNA 1DEKA 4GBAA 1SR6B 1A4PA 5FYXA 4AOMA 1A75B 1UHJA 3TDIA 1F71A 1ZMZA 1PK0D 5EL2A 4XJKA 4MVFA 1XK4C 1DQEA 1K9UA 1TCOB 4GFTA 1DELA 4I5JA 4YGCB 5HKWA 3WHTB 2ISDA 1B8LA 4MSPA 2QEHA 1TCFA 2K7DA 5HKYA 1IIOA 4P2YB 5F6TA 2MHHA 1FI6A 1K8UA 1OZSA 4HRHA 5AXIA 4DIRA 4YGDB 3BUXB 1AJ5A 4IL1A 2PASA 1WRKA 2Y1MA 2B1UA 2G9BA 1ZACA 1B7TZ 2I7AA 2K8MB 2TN4A 1KFXL 1YRTB 1IKUA 1MF8B 2CNPA 1CLMA 1M31A 1WY9A 1Z4HA 4OV2A 2MRDA 1QVIZ 1V1FA 2KFFA 3BUNB 5HLVA 2K7OA 3SG7A 2M29A 1CDMA 1J1DA 1K94A 2WCMA 2KNEA 2ZN9A 1ALVA 1PULA
chains in the Genus database with same CATH topology
2NCPA 4OVNF 2MAZA 3HCMA 3D10A 2JT0A 4U8DA 1M63B 1J55A 1JBAA 2M0RA 1S1EA 3EK8A 1NWDA 1MR8A 2NXQA 2CCMA 4I5KA 2L0PA 5PALA 1YR5A 2KDHA 4GGFC 4ICBA 1LVCD 4PCWA 2LVJA 3OB1B 4A4BA 1CKKA 3SIBA 1MUXA 3AKAA 3EVRA 2QACA 2Q4UA 3I5FC 3CR4X 3EVVA 1WLZA 3I5FB 1K95A 1H4BA 1DTLA 3DF0A 1LXFC 1SBJA 1J1EA 1ZOTB 1N65A 3CLNA 1NP8A 4GUKA 1LINA 4BY5A 2HQ8A 3CR2A 1YVLA 2JNFA 2I94A 2LUCA 3D0YA 3SG6A 2WCFA 1YX7A 1F8HA 2CBLA 1W7IB 2HETA 4HSZA 2K0JA 5AERA 1QX2A 2A4JA 1U5IA 1R2UA 2JQ6A 1XVJA 1B8CA 1FBVA 2DOQA 4GPLB 2L98A 2JT3A 1D1OA 3O78A 1JFKA 1DJGA 3PFVA 1DJIA 1A03A 1IGVA 3ZWHA 2SASA 1GQMA 2LVVA 2JPTA 5HLOA 2MBXA 3AAKA 1Y1UA 2PMYA 1N0YA 1XYDA 1AK8A 3I5IC 1N2DA 1NCXA 1QX7A 2KAVA 2WORA 4XJKB 3RM1A 3I5IB 5I8NA 1RECA 2JU0A 4DUQA 1QX5B 1OE9B 2EC6C 2G2BA 1OMVA 1BG1A 1SNLA 2KBIA 2EC6B 1AP4A 2LE9B 1XFZO 1RFJA 4CFQA 2EHBA 2O5GA 3SG3A 2L4IA 3DD4A 5B8IB 1QTXA 2IS9A 1CTRA 4M2PA 4OCIA 4OR9B 1VRKA 1NSHA 4D1EA 1QV0A 1CMFA 1DJHA 5J3XA 3BUOB 3LK0A 1QIVA 5DKQA 2ZNEA 3EKJA 4CIDA 1PSRA 2KI6D 1S6CA 3VRNA 4PALA 4PE4A 1RWYA 4ZCVA 1GJYA 1KFUL 1Y1AA 2KFHA 5JOLA 1M39A 2OS8B 5K89A 1TNQA 4Q04A 1PRWA 1F70A 2LP2A 2K61A 5IBWA 2MLFC 2OPOA 1CB1A 5G08A 1QATA 1SCMC 1DVIA 2BE6A 1ODBA 1L2OC 2KOTA 2ZNDA 3EK4A 4GNKB 3SG4A 1L2OB 2M3WA 1KK7Y 1QV1A 5CSIA 1EG3A 3NXAA 3LK1A 2NZ0A 1A29A 1HQVA 2BL0C 3H4SE 1AVSA 4ZCUA 4C0JA 3CS1A 2BL0B 1RJVA 1SCVA 4CLNA 4DRWA 1XFUO 1K9KA 4C0KA 1YUUA 1CMGA 2KGBC 2WOSA 4NQGA 4FTGA 4PHNA 2M8UA 2KGRA 3DF0B 1G4YR 1BU3A 2HPSA 1RROA 2PRUA 2D8NA 4N1GA 5JJGA 1K9PA 2K2AA 1MXEA 2KAYA 5CSFA 3JVTC 4BY4A 3JVTB 4TNCA 3FWCA 3OHMB 4MEWA 2BKIB 1S5GZ 1W7JB 3IQOA 3D0YB 1GGZA 2LM5A 2ZFDA 1DJWA 2JNXA 3NSIA 4YI9A 2Q91A 3I5GC 2KSPA 5I2LA 3I5GB 3PALA 2LMTA 1SL8A 2NCOA 1KSOA 1SKTA 1GGWA 1FW4A 1PALA 1U5IB 2BE4A 1JC2A 2M1UA 4PDZA 1A2XA 3PATA 1MHOA 3KHEA 2LUXA 5ER5A 1TN4A 2JT8A 4ETOA 4ORBB 4NDDA 4NDBA 1DJYA 5DKRA 2JTZA 1NCZA 1IRJA 2LLSA 2GGZA 5TNCA 1G33A 1SL7A 2MA2A 1XFWO 2H2KA 2AAOA 3IQQA 3BOWA 2OTGC 3O6BA 2L5XB 1KK8C 2OTGB 4MLWA 1KWOC 1PVBA 4N5XA 4YGAA 1KK8B 3DVKA 4HRGA 1KWOB 2CT9A 2FCDA 2E6WA 3VRQA 2L51A 2BCBA 3PN7C 3PN7B 1OMDA 2NLNA 3WXAA 4XYNA 1JUOA 1MQ1A 1X02A 1IQ3A 2BCAA 4QJ3B 1M46A 1S6JA 2JULA 1C7VA 2PALA 1CM1A 2EGDA 4PHKA 1RK9A 4YI8A 1F4OA 1QS7A 3SJSA 5I2QA 1TRFA 1NUBA 1S26D 1SYMA 2BECA 3AAJA 3O2PA 1AUIB 1S6IA 1XO5A 2K7CA 1DGVA 1KQMC 5DKNA 3I5HC 1KQMB 1CFDA 1KFXS 5CPVA 4CPVA 1K96A 1EJ3A 2F33A 3FS7A 4JQ0D 2Y4QA 2LNKA 1Y0VH 4R1EA 1NX3A 2KAXA 1WDCC 4CFRA 1WDCB 2F2PA 4UPGA 2F3ZA 2LP3A 2O60A 1B9AA 1SMGA 5HKZA 1HT9A 3VROA 3LLEA 2JTTA 2LAPA 3A8RA 2L50A 3EK7A 1B7TY 1ZUZA 3CZTX 3FIAA 1BODA 2JC2A 1SW8A 3CWGA 3ZNIA 2LLTA 3SG5A 1CNPA 1QVIY 4YGBB 2LMVA 3TUYC 3TUYB 1V1GA 3OX5A 2WC8A 3SIAA 1YUSA 4PE7A 2LANA 4ORCB 1YRUB 4WRIA 2F2OA 2M1KB 2RGIA 3LL8B 3WHUB 3HX4A 1XA5A 2H61A 5AEQA 1J7OA 1DF0A 3KO0A 1UURA 3C1VA 3PLFB 1JF2A 2SCPA 4MZKA 2FCEA 3CTNA 1NIWA 1RTP1 1OQPA 2I2RE 2PSRA 2V53A 2ZRSA 3RLZA 3LCPC 1QJTA 3F45A 1YX8A 1K2HA 2K7BA 4P5OE 1NCYA 3O4YA 1SCMB 3QRXA 4AQJA 1OOJA 3TDUA 1J7RA 1J7QA 1QLKA 3FWBA 4YBHB 2KYFA 4PE1A 1OSAA 1IJ6A 4L9MA 2KI6C 2M97A 1C7WA 2ZKMX 3CGAA 1IQ5A 3BOWB 4WQ2A 1L7ZA 1UP5A 2LLUA 2KQYA 1BR1B 3K21A 4DCKA 1IJ5A 3OP0A 1CM4A 3JTDC 3IF7A 2M7LA 3JTDB 1B47A 1F4QA 2Y1NA 2JOJA 4I5NB 1SR6C 5GQQC 2GGMA 1WRZA 1EXRA 2Y5IA 2KYCA 4MZJA 2LHLA 1PSBA 4YGEB 3GK1A 1K90D 3TZ1A 1TOPA 1BLQA 1M45A 1Y6WA 3NSLA 5HYDA 1FF1A 1CFCA 3OX6A 3VGOA 2BKHB 2KBMA 4JWQA 1CLLA 2MLEC 4AQIA 2HQWA 2F3YA 2F8PA 3BQ3A 1TIZA 2M9GA 2JXCA 3BYAA 1KQVA 3DVEA 2COLB 1SPYA 1TTXA 2E30A 1BMOA 4USLA 4F0ZB 2P6BB 5AFPA 1B4CA 3VRRA 1H8BA 4PHMA 1NX1A 2CXJA 1KCYA 2BBMA 2ZN8A 1AHRA 2FJUB 1KFUS 2KFGA 3A4UB 3ICBA 4PE0A 4JPZB 2WCEA 3DVMA 5CSJA 1NPQA 1SY9A 1XFYO 1CLBA 1WRLA 4M2QA 1TNPA 5AANA 5D69A 4FQOA 2CTNA 4QJ4B 5KSZA 4DS7A 3AKBA 2KI4C 3TS5C 5KTYA 2KI4B 3SG2A 3TS5B 4M2OA 1A75A 4PHJA 1TNXA 1OZOA 2M49B 2WNDA 2R2IA 1R6PA 4A4CA 1C07A 1NX0A 4GAOA 2WCBA 4QJ5B 1LA0A 1XK4A 1F55A 2H61C 1YTZC 1JF0A 1KK7Z 3EKHA 1DF0B 4N1FA 1JFJA 4MN0A 3EVUA 1QXPA 1DGUA 1UHIA 1UHHA 3NSOA 1J7PA 1B8RA 2L4HA 3KEVA 3M0WA 1YURA 1JWDA 1WLMA 1AJ4A 4OKHA 2JRFA 2BCXA 1NX2A 2KHNA 3I5HB 1BJFA 1BOCA 3GK4X 2PVBA 1BT6A 2K2FA 3KPXA 1UWOA 1YVHA 1IWQA 2LV7A 3OB2B 4MZLA 2M7NA 1MXLC 2QPTA 1CDNA 5D7FA 2JXLA 1OMRA 3BXKA 1K93D 1TNWA 1PVAA 1QIWA 2JZIA 4MBEA 4NDCA 1E8AA 1CDPA 1S5GY 3BUMB 2MJWB 3GK2A 4C0LA 1QLSA 4HREE 1B1GA 2VRGA 2GV5A 2LC5A 1CFPA 1EH2A 1NYAA 3KF9A 2L2EA 1G8IA 4GGFA 1LKJA 1SK6D 1DT7B 1BF5A 4WQ3A 1DMOA 5I2OA 1Q80A 1XFVO 1SRAA 3NSKA 2LVIA 2ZRTA 3DVJA 5KU1A 1UHNA 2LCPA 5ER4X 1S36A 1CDLA 1ZFSA 4YRUA 3BUWB 4MRXA 1JSAA 2JWWA 1F54A 2AMIA 3MSEB 1EG4A 3WNXB 1SL9A 1UHKA 1CFFA 3VRPA 1MWNA 2HF5A 4I5LB 1BR4B 1XFXO 1DJZA 2AUCA 1FI5A 1IH0A 4ORAB 4E68A 5BPJA 1IG5A 1DJXA 1LA3A 2LHIA 3E3RA 2FOTA 1FPWA 1EL4A 4GGNA 3PM8A 4MRYA 2KQ6A 3CR5X 1Y1XA 2BBNA 2OS8C 1S3PA 2I18A 2LMUA 1QASA 2LVKA 1UUSA 3TDZA 1YUTA 1KSMA 1ALWA 3PSRA 3GOFA 5CSNA 4GBAA 1SR6B 1A4PA 5FYXA 4AOMA 1A75B 1UHJA 3TDIA 1F71A 1ZMZA 1PK0D 4XJKA 4MVFA 1XK4C 1K9UA 1TCOB 4GFTA 4I5JA 4YGCB 5HKWA 3WHTB 2ISDA 1B8LA 4MSPA 1TCFA 2K7DA 5HKYA 4P2YB 5F6TA 2MHHA 1FI6A 1K8UA 1OZSA 4HRHA 5AXIA 4DIRA 4YGDB 3BUXB 1AJ5A 4IL1A 2PASA 1WRKA 2Y1MA 2B1UA 2G9BA 1ZACA 1B7TZ 2I7AA 2K8MB 2TN4A 1KFXL 1YRTB 1IKUA 1MF8B 2CNPA 1CLMA 1M31A 1WY9A 4OV2A 2MRDA 1QVIZ 1V1FA 2KFFA 3BUNB 5HLVA 2K7OA 3SG7A 2M29A 1CDMA 1J1DA 1K94A 2KNEA 2ZN9A 1ALVA 1PULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCP A;  4OVN F;  2MAZ A;  3HCM A;  3D10 A;  2JT0 A;  4U8D A;  1M63 B;  1J55 A;  1JBA A;  2M0R A;  1S1E A;  3EK8 A;  1NWD A;  1MR8 A;  2NXQ A;  2CCM A;  4I5K A;  2L0P A;  5PAL A;  1YR5 A;  2KDH A;  4GGF C;  4ICB A;  1LVC D;  4PCW A;  2LVJ A;  3OB1 B;  4A4B A;  1CKK A;  3SIB A;  1MUX A;  3AKA A;  3EVR A;  2QAC A;  2Q4U A;  3I5F C;  3CR4 X;  3EVV A;  1WLZ A;  3I5F B;  1K95 A;  1H4B A;  1DTL A;  3DF0 A;  1LXF C;  1SBJ A;  1J1E A;  1ZOT B;  1N65 A;  3CLN A;  1NP8 A;  4GUK A;  1LIN A;  4BY5 A;  2HQ8 A;  3CR2 A;  1YVL A;  2JNF A;  2I94 A;  2LUC A;  3D0Y A;  3SG6 A;  2WCF A;  1YX7 A;  1F8H A;  2CBL A;  1W7I B;  2HET A;  4HSZ A;  2K0J A;  5AER A;  1QX2 A;  2A4J A;  1U5I A;  1R2U A;  2JQ6 A;  1XVJ A;  1B8C A;  1FBV A;  2DOQ A;  4GPL B;  2L98 A;  2JT3 A;  1D1O A;  3O78 A;  1JFK A;  1DJG A;  3PFV A;  1DJI A;  1A03 A;  1IGV A;  3ZWH A;  2SAS A;  1GQM A;  2LVV A;  2JPT A;  5HLO A;  2MBX A;  3AAK A;  1Y1U A;  2PMY A;  1N0Y A;  1XYD A;  1AK8 A;  3I5I C;  1N2D A;  1NCX A;  1QX7 A;  2KAV A;  2WOR A;  4XJK B;  3RM1 A;  3I5I B;  5I8N A;  1REC A;  2JU0 A;  4DUQ A;  1QX5 B;  1OE9 B;  2EC6 C;  2G2B A;  1OMV A;  1BG1 A;  1SNL A;  2KBI A;  2EC6 B;  1AP4 A;  2LE9 B;  1XFZ O;  1RFJ A;  4CFQ A;  2EHB A;  2O5G A;  3SG3 A;  2L4I A;  3DD4 A;  5B8I B;  1QTX A;  2IS9 A;  1CTR A;  4M2P A;  4OCI A;  4OR9 B;  1VRK A;  1NSH A;  4D1E A;  1QV0 A;  1CMF A;  1DJH A;  5J3X A;  3BUO B;  3LK0 A;  1QIV A;  5DKQ A;  2ZNE A;  3EKJ A;  4CID A;  1PSR A;  2KI6 D;  1S6C A;  3VRN A;  4PAL A;  4PE4 A;  1RWY A;  4ZCV A;  1GJY A;  1KFU L;  1Y1A A;  2KFH A;  5JOL A;  1M39 A;  2OS8 B;  5K89 A;  1TNQ A;  4Q04 A;  1PRW A;  1F70 A;  2LP2 A;  2K61 A;  5IBW A;  2MLF C;  2OPO A;  1CB1 A;  5G08 A;  1QAT A;  1SCM C;  1DVI A;  2BE6 A;  1ODB A;  1L2O C;  2KOT A;  2ZND A;  3EK4 A;  4GNK B;  3SG4 A;  1L2O B;  2M3W A;  1KK7 Y;  1QV1 A;  5CSI A;  1EG3 A;  3NXA A;  3LK1 A;  2NZ0 A;  1A29 A;  1HQV A;  2BL0 C;  3H4S E;  1AVS A;  4ZCU A;  4C0J A;  3CS1 A;  2BL0 B;  1RJV A;  1SCV A;  4CLN A;  4DRW A;  1XFU O;  1K9K A;  4C0K A;  1YUU A;  1CMG A;  2KGB C;  2WOS A;  4NQG A;  4FTG A;  4PHN A;  2M8U A;  2KGR A;  3DF0 B;  1G4Y R;  1BU3 A;  2HPS A;  1RRO A;  2PRU A;  2D8N A;  4N1G A;  5JJG A;  1K9P A;  2K2A A;  1MXE A;  2KAY A;  5CSF A;  3JVT C;  4BY4 A;  3JVT B;  4TNC A;  3FWC A;  3OHM B;  4MEW A;  2BKI B;  1S5G Z;  1W7J B;  3IQO A;  3D0Y B;  1GGZ A;  2LM5 A;  2ZFD A;  1DJW A;  2JNX A;  3NSI A;  4YI9 A;  2Q91 A;  3I5G C;  2KSP A;  5I2L A;  3I5G B;  3PAL A;  2LMT A;  1SL8 A;  2NCO A;  1KSO A;  1SKT A;  1GGW A;  1FW4 A;  1PAL A;  1U5I B;  2BE4 A;  1JC2 A;  2M1U A;  4PDZ A;  1A2X A;  3PAT A;  1MHO A;  3KHE A;  2LUX A;  5ER5 A;  1TN4 A;  2JT8 A;  4ETO A;  4ORB B;  4NDD A;  4NDB A;  1DJY A;  5DKR A;  2JTZ A;  1NCZ A;  1IRJ A;  2LLS A;  2GGZ A;  5TNC A;  1G33 A;  1SL7 A;  2MA2 A;  1XFW O;  2H2K A;  2AAO A;  3IQQ A;  3BOW A;  2OTG C;  3O6B A;  2L5X B;  1KK8 C;  2OTG B;  4MLW A;  1KWO C;  1PVB A;  4N5X A;  4YGA A;  1KK8 B;  3DVK A;  4HRG A;  1KWO B;  2CT9 A;  2FCD A;  2E6W A;  3VRQ A;  2L51 A;  2BCB A;  3PN7 C;  3PN7 B;  1OMD A;  2NLN A;  3WXA A;  4XYN A;  1JUO A;  1MQ1 A;  1X02 A;  1IQ3 A;  2BCA A;  4QJ3 B;  1M46 A;  1S6J A;  2JUL A;  1C7V A;  2PAL A;  1CM1 A;  2EGD A;  4PHK A;  1RK9 A;  4YI8 A;  1F4O A;  1QS7 A;  3SJS A;  5I2Q A;  1TRF A;  1NUB A;  1S26 D;  1SYM A;  2BEC A;  3AAJ A;  3O2P A;  1AUI B;  1S6I A;  1XO5 A;  2K7C A;  1DGV A;  1KQM C;  5DKN A;  3I5H C;  1KQM B;  1CFD A;  1KFX S;  5CPV A;  4CPV A;  1K96 A;  1EJ3 A;  2F33 A;  3FS7 A;  4JQ0 D;  2Y4Q A;  2LNK A;  1Y0V H;  4R1E A;  1NX3 A;  2KAX A;  1WDC C;  4CFR A;  1WDC B;  2F2P A;  4UPG A;  2F3Z A;  2LP3 A;  2O60 A;  1B9A A;  1SMG A;  5HKZ A;  1HT9 A;  3VRO A;  3LLE A;  2JTT A;  2LAP A;  3A8R A;  2L50 A;  3EK7 A;  1B7T Y;  1ZUZ A;  3CZT X;  3FIA A;  1BOD A;  2JC2 A;  1SW8 A;  3CWG A;  3ZNI A;  2LLT A;  3SG5 A;  1CNP A;  1QVI Y;  4YGB B;  2LMV A;  3TUY C;  3TUY B;  1V1G A;  3OX5 A;  2WC8 A;  3SIA A;  1YUS A;  4PE7 A;  2LAN A;  4ORC B;  1YRU B;  4WRI A;  2F2O A;  2M1K B;  2RGI A;  3LL8 B;  3WHU B;  3HX4 A;  1XA5 A;  2H61 A;  5AEQ A;  1J7O A;  1DF0 A;  3KO0 A;  1UUR A;  3C1V A;  3PLF B;  1JF2 A;  2SCP A;  4MZK A;  2FCE A;  3CTN A;  1NIW A;  1RTP 1;  1OQP A;  2I2R E;  2PSR A;  2V53 A;  2ZRS A;  3RLZ A;  3LCP C;  1QJT A;  3F45 A;  1YX8 A;  1K2H A;  2K7B A;  4P5O E;  1NCY A;  3O4Y A;  1SCM B;  3QRX A;  4AQJ A;  1OOJ A;  3TDU A;  1J7R A;  1J7Q A;  1QLK A;  3FWB A;  4YBH B;  2KYF A;  4PE1 A;  1OSA A;  1IJ6 A;  4L9M A;  2KI6 C;  2M97 A;  1C7W A;  2ZKM X;  3CGA A;  1IQ5 A;  3BOW B;  4WQ2 A;  1L7Z A;  1UP5 A;  2LLU A;  2KQY A;  1BR1 B;  3K21 A;  4DCK A;  1IJ5 A;  3OP0 A;  1CM4 A;  3JTD C;  3IF7 A;  2M7L A;  3JTD B;  1B47 A;  1F4Q A;  2Y1N A;  2JOJ A;  4I5N B;  1SR6 C;  5GQQ C;  2GGM A;  1WRZ A;  1EXR A;  2Y5I A;  2KYC A;  4MZJ A;  2LHL A;  1PSB A;  4YGE B;  3GK1 A;  1K90 D;  3TZ1 A;  1TOP A;  1BLQ A;  1M45 A;  1Y6W A;  3NSL A;  5HYD A;  1FF1 A;  1CFC A;  3OX6 A;  3VGO A;  2BKH B;  2KBM A;  4JWQ A;  1CLL A;  2MLE C;  4AQI A;  2HQW A;  2F3Y A;  2F8P A;  3BQ3 A;  1TIZ A;  2M9G A;  2JXC A;  3BYA A;  1KQV A;  3DVE A;  2COL B;  1SPY A;  1TTX A;  2E30 A;  1BMO A;  4USL A;  4F0Z B;  2P6B B;  5AFP A;  1B4C A;  3VRR A;  1H8B A;  4PHM A;  1NX1 A;  2CXJ A;  1KCY A;  2BBM A;  2ZN8 A;  1AHR A;  2FJU B;  1KFU S;  2KFG A;  3A4U B;  3ICB A;  4PE0 A;  4JPZ B;  2WCE A;  3DVM A;  5CSJ A;  1NPQ A;  1SY9 A;  1XFY O;  1CLB A;  1WRL A;  4M2Q A;  1TNP A;  5AAN A;  5D69 A;  4FQO A;  2CTN A;  4QJ4 B;  5KSZ A;  4DS7 A;  3AKB A;  2KI4 C;  3TS5 C;  5KTY A;  2KI4 B;  3SG2 A;  3TS5 B;  4M2O A;  1A75 A;  4PHJ A;  1TNX A;  1OZO A;  2M49 B;  2WND A;  2R2I A;  1R6P A;  4A4C A;  1C07 A;  1NX0 A;  4GAO A;  2WCB A;  4QJ5 B;  1LA0 A;  1XK4 A;  1F55 A;  2H61 C;  1YTZ C;  1JF0 A;  1KK7 Z;  3EKH A;  1DF0 B;  4N1F A;  1JFJ A;  4MN0 A;  3EVU A;  1QXP A;  1DGU A;  1UHI A;  1UHH A;  3NSO A;  1J7P A;  1B8R A;  2L4H A;  3KEV A;  3M0W A;  1YUR A;  1JWD A;  1WLM A;  1AJ4 A;  4OKH A;  2JRF A;  2BCX A;  1NX2 A;  2KHN A;  3I5H B;  1BJF A;  1BOC A;  3GK4 X;  2PVB A;  1BT6 A;  2K2F A;  3KPX A;  1UWO A;  1YVH A;  1IWQ A;  2LV7 A;  3OB2 B;  4MZL A;  2M7N A;  1MXL C;  2QPT A;  1CDN A;  5D7F A;  2JXL A;  1OMR A;  3BXK A;  1K93 D;  1TNW A;  1PVA A;  1QIW A;  2JZI A;  4MBE A;  4NDC A;  1E8A A;  1CDP A;  1S5G Y;  3BUM B;  2MJW B;  3GK2 A;  4C0L A;  1QLS A;  4HRE E;  1B1G A;  2VRG A;  2GV5 A;  2LC5 A;  1CFP A;  1EH2 A;  1NYA A;  3KF9 A;  2L2E A;  1G8I A;  4GGF A;  1LKJ A;  1SK6 D;  1DT7 B;  1BF5 A;  4WQ3 A;  1DMO A;  5I2O A;  1Q80 A;  1XFV O;  1SRA A;  3NSK A;  2LVI A;  2ZRT A;  3DVJ A;  5KU1 A;  1UHN A;  2LCP A;  5ER4 X;  1S36 A;  1CDL A;  1ZFS A;  4YRU A;  3BUW B;  4MRX A;  1JSA A;  2JWW A;  1F54 A;  2AMI A;  3MSE B;  1EG4 A;  3WNX B;  1SL9 A;  1UHK A;  1CFF A;  3VRP A;  1MWN A;  2HF5 A;  4I5L B;  1BR4 B;  1XFX O;  1DJZ A;  2AUC A;  1FI5 A;  1IH0 A;  4ORA B;  4E68 A;  5BPJ A;  1IG5 A;  1DJX A;  1LA3 A;  2LHI A;  3E3R A;  2FOT A;  1FPW A;  1EL4 A;  4GGN A;  3PM8 A;  4MRY A;  2KQ6 A;  3CR5 X;  1Y1X A;  2BBN A;  2OS8 C;  1S3P A;  2I18 A;  2LMU A;  1QAS A;  2LVK A;  1UUS A;  3TDZ A;  1YUT A;  1KSM A;  1ALW A;  3PSR A;  3GOF A;  5CSN A;  4GBA A;  1SR6 B;  1A4P A;  5FYX A;  4AOM A;  1A75 B;  1UHJ A;  3TDI A;  1F71 A;  1ZMZ A;  1PK0 D;  4XJK A;  4MVF A;  1XK4 C;  1K9U A;  1TCO B;  4GFT A;  4I5J A;  4YGC B;  5HKW A;  3WHT B;  2ISD A;  1B8L A;  4MSP A;  1TCF A;  2K7D A;  5HKY A;  4P2Y B;  5F6T A;  2MHH A;  1FI6 A;  1K8U A;  1OZS A;  4HRH A;  5AXI A;  4DIR A;  4YGD B;  3BUX B;  1AJ5 A;  4IL1 A;  2PAS A;  1WRK A;  2Y1M A;  2B1U A;  2G9B A;  1ZAC A;  1B7T Z;  2I7A A;  2K8M B;  2TN4 A;  1KFX L;  1YRT B;  1IKU A;  1MF8 B;  2CNP A;  1CLM A;  1M31 A;  1WY9 A;  4OV2 A;  2MRD A;  1QVI Z;  1V1F A;  2KFF A;  3BUN B;  5HLV A;  2K7O A;  3SG7 A;  2M29 A;  1CDM A;  1J1D A;  1K94 A;  2KNE A;  2ZN9 A;  1ALV A;  1PUL A; 
#chains in the Genus database with same CATH topology
 2BNX A;  3VB1 A;  2NCP A;  4OVN F;  2MAZ A;  3HCM A;  5FI6 A;  3D10 A;  2JT0 A;  2WCK A;  4U8D A;  1M63 B;  1J55 A;  3FE9 A;  1JBA A;  2M0R A;  1DC1 A;  1S1E A;  3EK8 A;  1NWD A;  1MR8 A;  2NXQ A;  2CCM A;  3DYE A;  3PM2 A;  4I5K A;  2L0P A;  5PAL A;  1YR5 A;  2KDH A;  4GGF C;  4ICB A;  1LVC D;  4PCW A;  2L2C A;  2LVJ A;  3OB1 B;  4A4B A;  1CKK A;  3SIB A;  1MUX A;  3AKA A;  3EVR A;  2QAC A;  2Q4U A;  3D78 A;  3CR4 X;  3EVV A;  3I5F C;  1WLZ A;  3I5F B;  1K95 A;  1H4B A;  1DTL A;  3DF0 A;  3K1E A;  1LXF C;  1OOG A;  1SBJ A;  1J1E A;  1ZOT B;  1N65 A;  3CLN A;  1NP8 A;  4GUK A;  1LIN A;  4BY5 A;  2HQ8 A;  3CR2 A;  1YVL A;  1C3Y A;  2JNF A;  2I94 A;  2L5Y A;  2LUC A;  3D0Y A;  1OW4 A;  3SG6 A;  2WCF A;  1YX7 A;  2QEV A;  1F8H A;  2CBL A;  1W7I B;  3B87 A;  2HET A;  4HSZ A;  2K0J A;  2WC6 A;  5AER A;  1QX2 A;  2A4J A;  1U5I A;  1R2U A;  2JQ6 A;  1XVJ A;  1B8C A;  1FBV A;  2DOQ A;  4GPL B;  2L98 A;  2JT3 A;  1D1O A;  3O78 A;  1JFK A;  1DJG A;  3PFV A;  2QDI A;  1DJI A;  1A03 A;  1IGV A;  3ZWH A;  2SAS A;  1GQM A;  2LVV A;  2JPT A;  5HLO A;  2MBX A;  3AAK A;  1Y1U A;  1C3Z A;  1N0Y A;  1XYD A;  2PMY A;  1AK8 A;  3I5I C;  1N2D A;  1NCX A;  1QX7 A;  2KAV A;  2WOR A;  4XJK B;  3RM1 A;  3I5I B;  3R72 A;  5I8N A;  1REC A;  2JU0 A;  4DUQ A;  1QX5 B;  1OE9 B;  2EC6 C;  2G2B A;  1OMV A;  3R1P A;  1BG1 A;  1SNL A;  2KBI A;  2EC6 B;  1AP4 A;  2LE9 B;  4JKT A;  1GM0 A;  1XFZ O;  1RFJ A;  1QWV A;  4CFQ A;  2EHB A;  2O5G A;  3SG3 A;  2L4I A;  3DD4 A;  3B7A A;  5B8I B;  1QTX A;  2IS9 A;  1CTR A;  4M2P A;  4OCI A;  4OR9 B;  1VRK A;  1NSH A;  4D1E A;  2WC5 A;  1OOI X;  1QV0 A;  1CMF A;  1DJH A;  5J3X A;  3BUO B;  3R1O A;  3D75 A;  3LK0 A;  1QIV A;  1OOH A;  3L4A A;  3L4L A;  2ZNE A;  4FQT A;  5DKQ A;  3EKJ A;  3IVT A;  4CID A;  1PSR A;  2FJY A;  2KI6 D;  3B86 A;  4F7F A;  3DXL A;  1S6C A;  3VRN A;  4PAL A;  4PE4 A;  1RWY A;  4ZCV A;  1GJY A;  1KFU L;  1Y1A A;  2KFH A;  5JOL A;  1M39 A;  2OS8 B;  5K89 A;  1TNQ A;  1W9Z A;  4Q04 A;  1PRW A;  1F70 A;  2LP2 A;  2K61 A;  5IBW A;  2MLF C;  2OPO A;  1CB1 A;  5G08 A;  1QAT A;  1SCM C;  1DVI A;  2BE6 A;  1ODB A;  1L2O C;  2KOT A;  2PYQ A;  2ZND A;  3EK4 A;  4GNK B;  3SG4 A;  1L2O B;  2M3W A;  4IJ7 A;  1KK7 Y;  1QV1 A;  5CSI A;  3RZS A;  1EG3 A;  3UNW A;  3NXA A;  3LK1 A;  2NZ0 A;  1A29 A;  1HQV A;  2BL0 C;  3H4S E;  1AVS A;  4ZCU A;  4C0J A;  3CS1 A;  1SCV A;  1RJV A;  2BL0 B;  4CLN A;  4DRW A;  1XFU O;  1K9K A;  4C0K A;  1YUU A;  1CMG A;  2KGB C;  2WOS A;  3OGN A;  4NQG A;  4FTG A;  4PHN A;  2M8U A;  2KGR A;  3DF0 B;  1G4Y R;  1BU3 A;  2HPS A;  1RRO A;  2KLD A;  2D8N A;  2PRU A;  4N1G A;  5JJG A;  1K9P A;  2K2A A;  1MXE A;  2KAY A;  4PT1 A;  3JVT C;  5CSF A;  4BY4 A;  3JVT B;  4TNC A;  3FWC A;  3OHM B;  4MEW A;  2BKI B;  3SS4 A;  1S5G Z;  3N7H A;  1W7J B;  3IQO A;  3D0Y B;  1GGZ A;  2LM5 A;  2ZFD A;  1DJW A;  2JNX A;  3NSI A;  4YI9 A;  3QME A;  2Q91 A;  3I5G C;  2KSP A;  3BFH A;  5I2L A;  3I5G B;  3PAL A;  2LMT A;  1SL8 A;  2NCO A;  1KSO A;  2WCL A;  1SKT A;  1GGW A;  1FW4 A;  1PAL A;  1U5I B;  2BE4 A;  1JC2 A;  2M1U A;  4PDZ A;  1A2X A;  3PAT A;  1MHO A;  3KHE A;  3NHT A;  2LUX A;  3PJI A;  5ER5 A;  1TN4 A;  2JT8 A;  4ETO A;  4ORB B;  4NDD A;  4NDB A;  1DJY A;  5DKR A;  2JTZ A;  1NCZ A;  1IRJ A;  2LLS A;  2GGZ A;  3B88 A;  1G33 A;  5TNC A;  1SL7 A;  3UO9 A;  2MA2 A;  1XFW O;  2H2K A;  2AAO A;  3IQQ A;  3BOW A;  2OTG C;  3O6B A;  2L5X B;  1KK8 C;  2OTG B;  4MLW A;  1KWO C;  1PVB A;  4N5X A;  4YGA A;  1KK8 B;  3DVK A;  4HRG A;  1KWO B;  2CT9 A;  2FCD A;  2E6W A;  3CDN A;  3VRQ A;  2L51 A;  2BCB A;  3D73 A;  3PN7 C;  3PN7 B;  1OMD A;  2NLN A;  3WXA A;  3FE8 A;  4XYN A;  1JUO A;  1MQ1 A;  3FE6 A;  1X02 A;  1IQ3 A;  2BCA A;  4QJ3 B;  3S0A A;  1M46 A;  1S6J A;  2QEO A;  2JUL A;  1C7V A;  2PAL A;  1CM1 A;  2EGD A;  4PHK A;  1RK9 A;  4YI8 A;  1F4O A;  1QS7 A;  3Q8I A;  3SJS A;  5I2Q A;  1TRF A;  2WCJ A;  1NUB A;  1S26 D;  1SYM A;  2BEC A;  3AAJ A;  3O2P A;  3NGV A;  1AUI B;  1S6I A;  1XO5 A;  2K7C A;  1DGV A;  1KQM C;  4INW A;  5DKN A;  3I5H C;  1KQM B;  2YGU A;  1CFD A;  1KFX S;  5CPV A;  4CPV A;  1K96 A;  1EJ3 A;  4INX A;  2F33 A;  3FS7 A;  4JQ0 D;  2Y4Q A;  3CZ0 A;  2LNK A;  3BFB A;  1Y0V H;  4R1E A;  1LS8 A;  5I94 A;  1NX3 A;  1TUJ A;  2KAX A;  2ERB A;  3S0F A;  1WDC C;  1JWD A;  4CFR A;  1WDC B;  2F2P A;  4UPG A;  2F3Z A;  2LP3 A;  2O60 A;  1B9A A;  1SMG A;  5HKZ A;  1HT9 A;  3VRO A;  3LLE A;  2JTT A;  2LAP A;  3A8R A;  2L50 A;  3EK7 A;  1B7T Y;  1ZUZ A;  3CZT X;  3FIA A;  1BOD A;  2JC2 A;  1SW8 A;  3CWG A;  3ZNI A;  2LLT A;  3NHI A;  3SG5 A;  1CNP A;  1QVI Y;  4YGB B;  2LMV A;  3TUY C;  1ORG A;  3S0D A;  3TUY B;  1V1G A;  3OX5 A;  2WC8 A;  3SIA A;  1YUS A;  4PE7 A;  2LAN A;  4ORC B;  1YRU B;  4WRI A;  2F2O A;  2M1K B;  2RGI A;  3LL8 B;  3WHU B;  3HX4 A;  2PQL A;  1XA5 A;  2H61 A;  5AEQ A;  1J7O A;  3EG5 B;  1DF0 A;  3KO0 A;  1UUR A;  3C1V A;  5D3O A;  3PLF B;  1JF2 A;  2SCP A;  4MZK A;  2FCE A;  3CTN A;  1NIW A;  1RTP 1;  1OQP A;  2I2R E;  2PSR A;  2V53 A;  2ZRS A;  3BJH A;  3LCP C;  1QJT A;  3F45 A;  3SS3 A;  1YX8 A;  1K2H A;  2K7B A;  4P5O E;  1NCY A;  3O4Y A;  2BAP A;  1SCM B;  3QRX A;  4AQJ A;  1OOJ A;  3TDU A;  3SS5 A;  1J7R A;  1J7Q A;  1QLK A;  3FWB A;  4YBH B;  2KYF A;  3D76 A;  4PE1 A;  1OSA A;  1IJ6 A;  4L9M A;  2KI6 C;  2M97 A;  1C7W A;  2ZKM X;  3CGA A;  1IQ5 A;  3BOW B;  4WQ2 A;  1L7Z A;  1UP5 A;  2LLU A;  2KQY A;  1BR1 B;  3K21 A;  4DCK A;  1IJ5 A;  3OP0 A;  1CM4 A;  3JTD C;  1OOF A;  3IF7 A;  2M7L A;  3JTD B;  1B47 A;  1F4Q A;  2KPH A;  2Y1N A;  2JOJ A;  4I5N B;  1SR6 C;  5GQQ C;  2GGM A;  1WRZ A;  1EXR A;  2Y5I A;  2KYC A;  4MZJ A;  2LHL A;  1PSB A;  2K60 A;  4YGE B;  1P28 A;  3GK1 A;  1K90 D;  3TZ1 A;  3DY9 A;  1TOP A;  1BLQ A;  1M45 A;  1Y6W A;  3NSL A;  5HYD A;  3CZ1 A;  1T14 A;  1FF1 A;  3B6X A;  1CFC A;  1SSE B;  3OX6 A;  3VGO A;  2BKH B;  2KBM A;  4JWQ A;  1CLL A;  2MLE C;  4AQI A;  2HQW A;  2F3Y A;  2F8P A;  3BQ3 A;  1TIZ A;  2WCH A;  2M9G A;  2JXC A;  3BYA A;  5HL1 A;  1KQV A;  3DVE A;  2COL B;  1SPY A;  1TTX A;  2E30 A;  1BMO A;  4USL A;  4F0Z B;  2P6B B;  5AFP A;  1B4C A;  3DZT A;  3VRR A;  1H8B A;  4PHM A;  1NX1 A;  2CXJ A;  3V2L A;  1KCY A;  2BBM A;  2ZN8 A;  1AHR A;  2FJU B;  1KFU S;  2KFG A;  3A4U B;  3ICB A;  4PE0 A;  4JPZ B;  2WCE A;  3DVM A;  5CSJ A;  1NPQ A;  1SY9 A;  3O4X A;  2P71 A;  1XFY O;  1CLB A;  1WRL A;  4M2Q A;  1TNP A;  5AAN A;  4JD9 A;  4KYN A;  5D69 A;  4FQO A;  2CTN A;  4QJ4 B;  5KSZ A;  4DS7 A;  3AKB A;  2KI4 C;  3S0E A;  3TS5 C;  5KTY A;  2KI4 B;  3SG2 A;  3TS5 B;  4M2O A;  1A75 A;  4PHJ A;  1TNX A;  1OZO A;  2M49 B;  2WND A;  2R2I A;  1R6P A;  5FI2 A;  4A4C A;  1C07 A;  1NX0 A;  4GAO A;  2WCB A;  4QJ5 B;  1LA0 A;  1XK4 A;  1F55 A;  2QEB A;  2H61 C;  1YTZ C;  1JF0 A;  1KK7 Z;  5FI7 A;  3EKH A;  1DF0 B;  4N1F A;  3OBV A;  1JFJ A;  4MN0 A;  3EVU A;  1QXP A;  1DGU A;  1UHI A;  1UHH A;  3NSO A;  1J7P A;  1B8R A;  2L4H A;  3KEV A;  3M0W A;  1YUR A;  3CYZ A;  1WLM A;  1AJ4 A;  1Z2C B;  2JRF A;  4OKH A;  2BCX A;  1NX2 A;  2KHN A;  3S0G A;  3I5H B;  1BJF A;  1BOC A;  3GK4 X;  2PVB A;  1BT6 A;  2K2F A;  3KPX A;  3D77 A;  1UWO A;  1YVH A;  1IWQ A;  2LV7 A;  3OB2 B;  4MZL A;  2M7N A;  2KLE A;  1MXL C;  2QPT A;  1CDN A;  5D7F A;  2JXL A;  1OMR A;  3BXK A;  1K93 D;  1TNW A;  3D74 A;  1PVA A;  1QIW A;  2JZI A;  4MBE A;  4NDC A;  1E8A A;  1CDP A;  1S5G Y;  3BUM B;  1TWO A;  2MJW B;  3GK2 A;  4C0L A;  1QLS A;  4HRE E;  1B1G A;  2VRG A;  2GV5 A;  2LC5 A;  3CAB A;  1CFP A;  1EH2 A;  1NYA A;  3KF9 A;  2L2E A;  1G8I A;  4GGF A;  1LKJ A;  1SK6 D;  1DT7 B;  1BF5 A;  4WQ3 A;  3CZ2 A;  1DMO A;  5I2O A;  1Q80 A;  1XFV O;  1SRA A;  3NSK A;  3S0B A;  2LVI A;  2ZRT A;  3DVJ A;  5KU1 A;  1UHN A;  2LCP A;  2P70 A;  5ER4 X;  1S36 A;  2JPO A;  1XFR A;  1CDL A;  1ZFS A;  2GTE A;  4YRU A;  3BUW B;  4OZD A;  4MRX A;  1JSA A;  2JWW A;  3BFA A;  2AMI A;  1F54 A;  3MSE B;  1EG4 A;  3RLZ A;  3WNX B;  1SL9 A;  1UHK A;  1CFF A;  3VRP A;  1MWN A;  2HF5 A;  4I5L B;  1BR4 B;  1XFX O;  1DJZ A;  1TUZ A;  2AUC A;  1FI5 A;  1IH0 A;  4ORA B;  2H8V A;  5DIC A;  4E68 A;  5BPJ A;  1IG5 A;  1DJX A;  1LA3 A;  2LHI A;  3E3R A;  2FOT A;  1FPW A;  1EL4 A;  4GGN A;  3PM8 A;  4MRY A;  2KQ6 A;  3CR5 X;  1Y1X A;  2BBN A;  3R1V A;  2OS8 C;  1S3P A;  2I18 A;  2LMU A;  1QAS A;  2LVK A;  1UUS A;  3TDZ A;  1YUT A;  1KSM A;  1ALW A;  3L47 A;  3GOF A;  3PSR A;  5CSN A;  1DEK A;  4GBA A;  1SR6 B;  1A4P A;  5FYX A;  4AOM A;  1A75 B;  1UHJ A;  3TDI A;  1F71 A;  1ZMZ A;  1PK0 D;  5EL2 A;  4XJK A;  4MVF A;  1XK4 C;  1DQE A;  1K9U A;  1TCO B;  4GFT A;  1DEL A;  4I5J A;  4YGC B;  5HKW A;  3WHT B;  2ISD A;  1B8L A;  4MSP A;  2QEH A;  1TCF A;  2K7D A;  5HKY A;  1IIO A;  4P2Y B;  5F6T A;  2MHH A;  1FI6 A;  1K8U A;  1OZS A;  4HRH A;  5AXI A;  4DIR A;  4YGD B;  3BUX B;  1AJ5 A;  4IL1 A;  2PAS A;  1WRK A;  2Y1M A;  2B1U A;  2G9B A;  1ZAC A;  1B7T Z;  2I7A A;  2K8M B;  2TN4 A;  1KFX L;  1YRT B;  1IKU A;  1MF8 B;  2CNP A;  1CLM A;  1M31 A;  1WY9 A;  1Z4H A;  4OV2 A;  2MRD A;  1QVI Z;  1V1F A;  2KFF A;  3BUN B;  5HLV A;  2K7O A;  3SG7 A;  2M29 A;  1CDM A;  1J1D A;  1K94 A;  2WCM A;  2KNE A;  2ZN9 A;  1ALV A;  1PUL A; 
#chains in the Genus database with same CATH homology
 2NCP A;  4OVN F;  2MAZ A;  3HCM A;  3D10 A;  2JT0 A;  4U8D A;  1M63 B;  1J55 A;  1JBA A;  2M0R A;  1S1E A;  3EK8 A;  1NWD A;  1MR8 A;  2NXQ A;  2CCM A;  4I5K A;  2L0P A;  5PAL A;  1YR5 A;  2KDH A;  4GGF C;  4ICB A;  1LVC D;  4PCW A;  2LVJ A;  3OB1 B;  4A4B A;  1CKK A;  3SIB A;  1MUX A;  3AKA A;  3EVR A;  2QAC A;  2Q4U A;  3I5F C;  3CR4 X;  3EVV A;  1WLZ A;  3I5F B;  1K95 A;  1H4B A;  1DTL A;  3DF0 A;  1LXF C;  1SBJ A;  1J1E A;  1ZOT B;  1N65 A;  3CLN A;  1NP8 A;  4GUK A;  1LIN A;  4BY5 A;  2HQ8 A;  3CR2 A;  1YVL A;  2JNF A;  2I94 A;  2LUC A;  3D0Y A;  3SG6 A;  2WCF A;  1YX7 A;  1F8H A;  2CBL A;  1W7I B;  2HET A;  4HSZ A;  2K0J A;  5AER A;  1QX2 A;  2A4J A;  1U5I A;  1R2U A;  2JQ6 A;  1XVJ A;  1B8C A;  1FBV A;  2DOQ A;  4GPL B;  2L98 A;  2JT3 A;  1D1O A;  3O78 A;  1JFK A;  1DJG A;  3PFV A;  1DJI A;  1A03 A;  1IGV A;  3ZWH A;  2SAS A;  1GQM A;  2LVV A;  2JPT A;  5HLO A;  2MBX A;  3AAK A;  1Y1U A;  2PMY A;  1N0Y A;  1XYD A;  1AK8 A;  3I5I C;  1N2D A;  1NCX A;  1QX7 A;  2KAV A;  2WOR A;  4XJK B;  3RM1 A;  3I5I B;  5I8N A;  1REC A;  2JU0 A;  4DUQ A;  1QX5 B;  1OE9 B;  2EC6 C;  2G2B A;  1OMV A;  1BG1 A;  1SNL A;  2KBI A;  2EC6 B;  1AP4 A;  2LE9 B;  1XFZ O;  1RFJ A;  4CFQ A;  2EHB A;  2O5G A;  3SG3 A;  2L4I A;  3DD4 A;  5B8I B;  1QTX A;  2IS9 A;  1CTR A;  4M2P A;  4OCI A;  4OR9 B;  1VRK A;  1NSH A;  4D1E A;  1QV0 A;  1CMF A;  1DJH A;  5J3X A;  3BUO B;  3LK0 A;  1QIV A;  5DKQ A;  2ZNE A;  3EKJ A;  4CID A;  1PSR A;  2KI6 D;  1S6C A;  3VRN A;  4PAL A;  4PE4 A;  1RWY A;  4ZCV A;  1GJY A;  1KFU L;  1Y1A A;  2KFH A;  5JOL A;  1M39 A;  2OS8 B;  5K89 A;  1TNQ A;  4Q04 A;  1PRW A;  1F70 A;  2LP2 A;  2K61 A;  5IBW A;  2MLF C;  2OPO A;  1CB1 A;  5G08 A;  1QAT A;  1SCM C;  1DVI A;  2BE6 A;  1ODB A;  1L2O C;  2KOT A;  2ZND A;  3EK4 A;  4GNK B;  3SG4 A;  1L2O B;  2M3W A;  1KK7 Y;  1QV1 A;  5CSI A;  1EG3 A;  3NXA A;  3LK1 A;  2NZ0 A;  1A29 A;  1HQV A;  2BL0 C;  3H4S E;  1AVS A;  4ZCU A;  4C0J A;  3CS1 A;  2BL0 B;  1RJV A;  1SCV A;  4CLN A;  4DRW A;  1XFU O;  1K9K A;  4C0K A;  1YUU A;  1CMG A;  2KGB C;  2WOS A;  4NQG A;  4FTG A;  4PHN A;  2M8U A;  2KGR A;  3DF0 B;  1G4Y R;  1BU3 A;  2HPS A;  1RRO A;  2PRU A;  2D8N A;  4N1G A;  5JJG A;  1K9P A;  2K2A A;  1MXE A;  2KAY A;  5CSF A;  3JVT C;  4BY4 A;  3JVT B;  4TNC A;  3FWC A;  3OHM B;  4MEW A;  2BKI B;  1S5G Z;  1W7J B;  3IQO A;  3D0Y B;  1GGZ A;  2LM5 A;  2ZFD A;  1DJW A;  2JNX A;  3NSI A;  4YI9 A;  2Q91 A;  3I5G C;  2KSP A;  5I2L A;  3I5G B;  3PAL A;  2LMT A;  1SL8 A;  2NCO A;  1KSO A;  1SKT A;  1GGW A;  1FW4 A;  1PAL A;  1U5I B;  2BE4 A;  1JC2 A;  2M1U A;  4PDZ A;  1A2X A;  3PAT A;  1MHO A;  3KHE A;  2LUX A;  5ER5 A;  1TN4 A;  2JT8 A;  4ETO A;  4ORB B;  4NDD A;  4NDB A;  1DJY A;  5DKR A;  2JTZ A;  1NCZ A;  1IRJ A;  2LLS A;  2GGZ A;  5TNC A;  1G33 A;  1SL7 A;  2MA2 A;  1XFW O;  2H2K A;  2AAO A;  3IQQ A;  3BOW A;  2OTG C;  3O6B A;  2L5X B;  1KK8 C;  2OTG B;  4MLW A;  1KWO C;  1PVB A;  4N5X A;  4YGA A;  1KK8 B;  3DVK A;  4HRG A;  1KWO B;  2CT9 A;  2FCD A;  2E6W A;  3VRQ A;  2L51 A;  2BCB A;  3PN7 C;  3PN7 B;  1OMD A;  2NLN A;  3WXA A;  4XYN A;  1JUO A;  1MQ1 A;  1X02 A;  1IQ3 A;  2BCA A;  4QJ3 B;  1M46 A;  1S6J A;  2JUL A;  1C7V A;  2PAL A;  1CM1 A;  2EGD A;  4PHK A;  1RK9 A;  4YI8 A;  1F4O A;  1QS7 A;  3SJS A;  5I2Q A;  1TRF A;  1NUB A;  1S26 D;  1SYM A;  2BEC A;  3AAJ A;  3O2P A;  1AUI B;  1S6I A;  1XO5 A;  2K7C A;  1DGV A;  1KQM C;  5DKN A;  3I5H C;  1KQM B;  1CFD A;  1KFX S;  5CPV A;  4CPV A;  1K96 A;  1EJ3 A;  2F33 A;  3FS7 A;  4JQ0 D;  2Y4Q A;  2LNK A;  1Y0V H;  4R1E A;  1NX3 A;  2KAX A;  1WDC C;  4CFR A;  1WDC B;  2F2P A;  4UPG A;  2F3Z A;  2LP3 A;  2O60 A;  1B9A A;  1SMG A;  5HKZ A;  1HT9 A;  3VRO A;  3LLE A;  2JTT A;  2LAP A;  3A8R A;  2L50 A;  3EK7 A;  1B7T Y;  1ZUZ A;  3CZT X;  3FIA A;  1BOD A;  2JC2 A;  1SW8 A;  3CWG A;  3ZNI A;  2LLT A;  3SG5 A;  1CNP A;  1QVI Y;  4YGB B;  2LMV A;  3TUY C;  3TUY B;  1V1G A;  3OX5 A;  2WC8 A;  3SIA A;  1YUS A;  4PE7 A;  2LAN A;  4ORC B;  1YRU B;  4WRI A;  2F2O A;  2M1K B;  2RGI A;  3LL8 B;  3WHU B;  3HX4 A;  1XA5 A;  2H61 A;  5AEQ A;  1J7O A;  1DF0 A;  3KO0 A;  1UUR A;  3C1V A;  3PLF B;  1JF2 A;  2SCP A;  4MZK A;  2FCE A;  3CTN A;  1NIW A;  1RTP 1;  1OQP A;  2I2R E;  2PSR A;  2V53 A;  2ZRS A;  3RLZ A;  3LCP C;  1QJT A;  3F45 A;  1YX8 A;  1K2H A;  2K7B A;  4P5O E;  1NCY A;  3O4Y A;  1SCM B;  3QRX A;  4AQJ A;  1OOJ A;  3TDU A;  1J7R A;  1J7Q A;  1QLK A;  3FWB A;  4YBH B;  2KYF A;  4PE1 A;  1OSA A;  1IJ6 A;  4L9M A;  2KI6 C;  2M97 A;  1C7W A;  2ZKM X;  3CGA A;  1IQ5 A;  3BOW B;  4WQ2 A;  1L7Z A;  1UP5 A;  2LLU A;  2KQY A;  1BR1 B;  3K21 A;  4DCK A;  1IJ5 A;  3OP0 A;  1CM4 A;  3JTD C;  3IF7 A;  2M7L A;  3JTD B;  1B47 A;  1F4Q A;  2Y1N A;  2JOJ A;  4I5N B;  1SR6 C;  5GQQ C;  2GGM A;  1WRZ A;  1EXR A;  2Y5I A;  2KYC A;  4MZJ A;  2LHL A;  1PSB A;  4YGE B;  3GK1 A;  1K90 D;  3TZ1 A;  1TOP A;  1BLQ A;  1M45 A;  1Y6W A;  3NSL A;  5HYD A;  1FF1 A;  1CFC A;  3OX6 A;  3VGO A;  2BKH B;  2KBM A;  4JWQ A;  1CLL A;  2MLE C;  4AQI A;  2HQW A;  2F3Y A;  2F8P A;  3BQ3 A;  1TIZ A;  2M9G A;  2JXC A;  3BYA A;  1KQV A;  3DVE A;  2COL B;  1SPY A;  1TTX A;  2E30 A;  1BMO A;  4USL A;  4F0Z B;  2P6B B;  5AFP A;  1B4C A;  3VRR A;  1H8B A;  4PHM A;  1NX1 A;  2CXJ A;  1KCY A;  2BBM A;  2ZN8 A;  1AHR A;  2FJU B;  1KFU S;  2KFG A;  3A4U B;  3ICB A;  4PE0 A;  4JPZ B;  2WCE A;  3DVM A;  5CSJ A;  1NPQ A;  1SY9 A;  1XFY O;  1CLB A;  1WRL A;  4M2Q A;  1TNP A;  5AAN A;  5D69 A;  4FQO A;  2CTN A;  4QJ4 B;  5KSZ A;  4DS7 A;  3AKB A;  2KI4 C;  3TS5 C;  5KTY A;  2KI4 B;  3SG2 A;  3TS5 B;  4M2O A;  1A75 A;  4PHJ A;  1TNX A;  1OZO A;  2M49 B;  2WND A;  2R2I A;  1R6P A;  4A4C A;  1C07 A;  1NX0 A;  4GAO A;  2WCB A;  4QJ5 B;  1LA0 A;  1XK4 A;  1F55 A;  2H61 C;  1YTZ C;  1JF0 A;  1KK7 Z;  3EKH A;  1DF0 B;  4N1F A;  1JFJ A;  4MN0 A;  3EVU A;  1QXP A;  1DGU A;  1UHI A;  1UHH A;  3NSO A;  1J7P A;  1B8R A;  2L4H A;  3KEV A;  3M0W A;  1YUR A;  1JWD A;  1WLM A;  1AJ4 A;  4OKH A;  2JRF A;  2BCX A;  1NX2 A;  2KHN A;  3I5H B;  1BJF A;  1BOC A;  3GK4 X;  2PVB A;  1BT6 A;  2K2F A;  3KPX A;  1UWO A;  1YVH A;  1IWQ A;  2LV7 A;  3OB2 B;  4MZL A;  2M7N A;  1MXL C;  2QPT A;  1CDN A;  5D7F A;  2JXL A;  1OMR A;  3BXK A;  1K93 D;  1TNW A;  1PVA A;  1QIW A;  2JZI A;  4MBE A;  4NDC A;  1E8A A;  1CDP A;  1S5G Y;  3BUM B;  2MJW B;  3GK2 A;  4C0L A;  1QLS A;  4HRE E;  1B1G A;  2VRG A;  2GV5 A;  2LC5 A;  1CFP A;  1EH2 A;  1NYA A;  3KF9 A;  2L2E A;  1G8I A;  4GGF A;  1LKJ A;  1SK6 D;  1DT7 B;  1BF5 A;  4WQ3 A;  1DMO A;  5I2O A;  1Q80 A;  1XFV O;  1SRA A;  3NSK A;  2LVI A;  2ZRT A;  3DVJ A;  5KU1 A;  1UHN A;  2LCP A;  5ER4 X;  1S36 A;  1CDL A;  1ZFS A;  4YRU A;  3BUW B;  4MRX A;  1JSA A;  2JWW A;  1F54 A;  2AMI A;  3MSE B;  1EG4 A;  3WNX B;  1SL9 A;  1UHK A;  1CFF A;  3VRP A;  1MWN A;  2HF5 A;  4I5L B;  1BR4 B;  1XFX O;  1DJZ A;  2AUC A;  1FI5 A;  1IH0 A;  4ORA B;  4E68 A;  5BPJ A;  1IG5 A;  1DJX A;  1LA3 A;  2LHI A;  3E3R A;  2FOT A;  1FPW A;  1EL4 A;  4GGN A;  3PM8 A;  4MRY A;  2KQ6 A;  3CR5 X;  1Y1X A;  2BBN A;  2OS8 C;  1S3P A;  2I18 A;  2LMU A;  1QAS A;  2LVK A;  1UUS A;  3TDZ A;  1YUT A;  1KSM A;  1ALW A;  3PSR A;  3GOF A;  5CSN A;  4GBA A;  1SR6 B;  1A4P A;  5FYX A;  4AOM A;  1A75 B;  1UHJ A;  3TDI A;  1F71 A;  1ZMZ A;  1PK0 D;  4XJK A;  4MVF A;  1XK4 C;  1K9U A;  1TCO B;  4GFT A;  4I5J A;  4YGC B;  5HKW A;  3WHT B;  2ISD A;  1B8L A;  4MSP A;  1TCF A;  2K7D A;  5HKY A;  4P2Y B;  5F6T A;  2MHH A;  1FI6 A;  1K8U A;  1OZS A;  4HRH A;  5AXI A;  4DIR A;  4YGD B;  3BUX B;  1AJ5 A;  4IL1 A;  2PAS A;  1WRK A;  2Y1M A;  2B1U A;  2G9B A;  1ZAC A;  1B7T Z;  2I7A A;  2K8M B;  2TN4 A;  1KFX L;  1YRT B;  1IKU A;  1MF8 B;  2CNP A;  1CLM A;  1M31 A;  1WY9 A;  4OV2 A;  2MRD A;  1QVI Z;  1V1F A;  2KFF A;  3BUN B;  5HLV A;  2K7O A;  3SG7 A;  2M29 A;  1CDM A;  1J1D A;  1K94 A;  2KNE A;  2ZN9 A;  1ALV A;  1PUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...