1CFPA

S100b (s100beta) nmr data was collected from a sample of calcium free protein at ph 6.3 and a temperature of 311 k and 1.7-6.9 mm concentration, 25 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100B
publication title The solution structure of the bovine S100B protein dimer in the calcium-free state.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 23
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cfpA00
1CFPA 4GPLB 2F3ZA 1F8HA 4USLA 1BOCA 2LCPA 4OKHA 1MF8B 5F6TA 2WCEA 1K95A 2MLEC 4MZJA 1N2DA 3RM1A 1V1GA 2ZRSA 1LA3A 2SCPA 2K0JA 1SBJA 1NSHA 2EC6B 1FBVA 2L4HA 4OV2A 1XFVO 1K9KA 1WLZA 3BYAA 1UHIA 5CSJA 1QATA 1NUBA 1CLMA 3ZNIA 1EL4A 1QIWA 4YGEB 4UPGA 3NSOA 2K7CA 2LV7A 1AUIB 1X02A 3LLEA 1W7IB 5AEQA 2JOJA 1RK9A 2LUXA 1J7RA 1YX7A 1WRLA 5I2QA 1XA5A 1JSAA 1R2UA 3LK1A 2KI4C 2KI6D 1IRJA 1KWOC 3TUYB 2CXJA 2JQ6A 4WQ3A 1KQVA 1L7ZA 5J3XA 2JNXA 2JULA 3CLNA 2BL0B 4C0KA 1SCMC 4GGFA 2K7OA 4DIRA 3BXKA 2LNKA 4N1FA 1TNXA 2JXCA 3FS7A 3O6BA 2MRDA 2M9GA 1C7VA 1JF2A 3I5IC 1J7OA 5GQQC 2ZN9A 1V1FA 1GJYA 3I5GB 1ZUZA 1FPWA 1NCZA 1QIVA 1SNLA 2KFHA 1NP8A 1IJ6A 2BBNA 2M7LA 1BMOA 2L51A 3OB1B 1K93D 2BKIB 4P5OE 2BCAA 4C0JA 2LC5A 2QACA 3FWBA 3CZTX 1K8UA 4FTGA 1ODBA 2JC2A 2JU0A 1JC2A 4A4CA 3KEVA 1D1OA 2BE4A 3CR5X 3EVRA 4PCWA 3GOFA 1SKTA 2PALA 4L9MA 3WXAA 1CFFA 1NYAA 2AUCA 1CM4A 1IKUA 1J7QA 1TCOB 4JPZB 1J55A 1W7JB 1G33A 2TN4A 4MSPA 1S6CA 1JF0A 1ZOTB 1PK0D 1QTXA 3BUXB 3QRXA 2BE6A 4HSZA 1YUUA 3O2PA 4IL1A 2HPSA 5ER4X 1CLBA 4MZKA 5CSNA 4PALA 2BCBA 4PHMA 1RFJA 1NX1A 1OE9B 3IF7A 1OMVA 2NCOA 1FI6A 3IQOA 1XFUO 1NX0A 1Y0VH 3NSLA 1KK8C 3CTNA 1M31A 1KFXL 2KGBC 3I5HC 4YBHB 1B4CA 2JT8A 1MR8A 2M97A 1S6IA 3KHEA 1LKJA 1N65A 4MLWA 2H2KA 5I2LA 2D8NA 3GK2A 2L50A 3JVTB 1CFDA 2I94A 2OS8C 1Y1XA 3FWCA 1XFYO 1FW4A 2O5GA 1H8BA 1BU3A 1R6PA 3MSEB 2MBXA 3BOWB 1OZSA 1QS7A 1SL8A 4A4BA 2H61C 4HRHA 3VROA 2NCPA 3CR2A 4E68A 1TNPA 1B47A 1BR1B 3I5FC 1CB1A 3JTDC 3E3RA 3TDIA 4F0ZB 5HYDA 4ICBA 1NCYA 2ISDA 1FI5A 1LVCD 3EK4A 2JTZA 1S6JA 4MZLA 4NDBA 4FQOA 2FJUB 3BOWA 4NQGA 1J1DA 1XFXO 2LUCA 1KCYA 1SY9A 2K7BA 2ZNDA 2KSPA 1OMRA 4JQ0D 3LK0A 1CKKA 3AAJA 5D69A 1B8RA 1LA0A 1SR6C 1WLMA 1KWOB 1QLSA 4YRUA 1BODA 2F3YA 4AOMA 1TNWA 1M63B 2Y5IA 1TRFA 3BQ3A 1SPYA 5HLOA 1SW8A 5DKQA 2EGDA 2HQ8A 1SCMB 2KQYA 3PFVA 1NIWA 5BPJA 1IWQA 2GGZA 2CCMA 1EXRA 1UHJA 2KFFA 2WCBA 2NXQA 1DJGA 1MXLC 3I5IB 5HKZA 2M49B 3GK4X 1BR4B 3EVUA 3TS5C 2JPTA 2NZ0A 1B8LA 1KK7Z 4N1GA 2COLB 3EK7A 3GK1A 1EG3A 1LINA 2KI6C 2L4IA 1KFUL 3O4YA 2LANA 1DTLA 2VRGA 5I8NA 2HETA 4GAOA 1M46A 1CTRA 1M39A 1PULA 2ZFDA 3A8RA 2E6WA 3NSKA 3SG2A 5KTYA 5KU1A 2FCEA 1DT7B 1CDLA 1WDCC 2P6BB 1AJ5A 1JUOA 1YRUB 1DVIA 2PRUA 1CM1A 3CGAA 3PN7C 4YI9A 1UHHA 1B9AA 1SYMA 1XK4A 2GGMA 3NSIA 4GUKA 5AXIA 3ICBA 3TDUA 4ZCUA 4PE7A 3VRNA 1CMFA 1OOJA 2L98A 2L5XB 3O78A 1GQMA 3RLZA 2AAOA 3LCPC 2I2RE 2MHHA 2WCFA 1KSMA 2JWWA 2OTGC 3HCMA 1WRZA 3SG3A 1HQVA 2JTTA 2E30A 1BLQA 1H4BA 4YI8A 3AKBA 1C07A 1CNPA 1EJ3A 2G2BA 2BBMA 2CBLA 4I5NB 1Q80A 1QX7A 3DVKA 1K9PA 1AHRA 2KDHA 3PSRA 1UHKA 3C1VA 4OVNF 4MEWA 4QJ3B 5HLVA 4BY4A 2M8UA 4MRYA 1CMGA 5CSFA 4GGFC 1EH2A 4DS7A 3WHUB 4D1EA 1CLLA 1XVJA 2PSRA 4I5LB 1KQMB 2BECA 1S1EA 2KBIA 4ORCB 1TNQA 1YVHA 1IG5A 3OX6A 1F70A 1S3PA 5I2OA 2G9BA 2AMIA 2BL0C 3DVMA 4CIDA 2F2PA 5PALA 1BF5A 1A4PA 2DOQA 2LLSA 3D0YB 3EKHA 5AERA 2B1UA 4ORAB 3IQQA 1DJIA 1ZMZA 3JTDB 3K21A 1MXEA 2LE9B 1KFUS 1DJYA 1L2OB 4PE4A 1FF1A 1QASA 2M1KB 1U5IB 3SJSA 4CPVA 1E8AA 5CSIA 4ETOA 2H61A 3D0YA 2ZRTA 4PDZA 1IJ5A 3OP0A 4WQ2A 1K90D 2MJWB 2F33A 1RECA 2ZNEA 2HF5A 4PE0A 2KYCA 2M1UA 4QJ5B 2KFGA 4QJ4B 1AVSA 1DJZA 1S26D 1RWYA 5AANA 2KYFA 1U5IA 2GV5A 2L2EA 2KAVA 3KF9A 2Y1NA 2LM5A 1NPQA 2KQ6A 3VRQA 2KHNA 1SL7A 1IQ3A 1ALVA 1YURA 2WORA 3NXAA 5DKRA 1N0YA 1HT9A 1DMOA 2LAPA 3PM8A 1RROA 1NX2A 2PASA 4CLNA 2LVKA 2ZN8A 4PHJA 3AAKA 1C7WA 2V53A 4M2PA 5CPVA 3EVVA 3TDZA 3TS5B 4M2QA 3OHMB 3BUNB 1S5GY 4I5JA 1TCFA 4NDDA 2KI4B 4PHKA 3SG6A 1A2XA 4HREE 1SRAA 4XYNA 3BUOB 4TNCA 1JWDA 3F45A 1KK7Y 2LLUA 5IBWA 2K8MB 5DKNA 1M45A 5ER5A 1ZACA 2LVVA 2OPOA 2EHBA 2JXLA 2LVJA 4U8DA 4BY5A 1S5GZ 1F54A 1WDCB 3M0WA 1F4OA 4CFRA 3PN7B 2F2OA 2O60A 1PVAA 2MA2A 1KFXS 1QXPA 4GFTA 1TOPA 3ZWHA 2KNEA 1NWDA 2FCDA 3SG4A 2OTGB 4DUQA 1UP5A 4I5KA 1WY9A 3PATA 3VGOA 2R2IA 4P2YB 5AFPA 1UHNA 2F8PA 4OCIA 1VRKA 1JFKA 1QX2A 1DJWA 2RGIA 3TZ1A 1BJFA 1DGVA 1RTP1 2LP2A 1A03A 4R1EA 4DRWA 1B7TY 1PVBA 3D10A 1YVLA 2L0PA 2JZIA 2HQWA 4YGAA 1NX3A 1SMGA 4JWQA 1G8IA 2KAXA 3EKJA 1MHOA 3KO0A 4HRGA 2MLFC 1YX8A 3OX5A 2LVIA 4M2OA 2LMVA 3OB2B 1UUSA 2WC8A 1B7TZ 4ORBB 2M3WA 2Y1MA 1IGVA 1QVIY 1TN4A 1KSOA 5K89A 3FIAA 1LXFC 1QJTA 1XO5A 1SL9A 2JNFA 4PHNA 2WOSA 1KK8B 2JT3A 3DD4A 4OR9B 1PSBA 1QLKA 2EC6C 5JJGA 4YGDB 1BT6A 1B1GA 3I5HB 3WHTB 5HKWA 1CFCA 3DVEA 3SG7A 1CDNA 2MAZA 1OMDA 1QVIZ 1XFWO 1QV1A 2JT0A 2LLTA 3DF0B 3SG5A 1YRTB 1AJ4A 2M0RA 2OS8B 2PMYA 1AK8A 1XK4C 3TUYC 2IS9A 3HX4A 2SASA 5TNCA 3VRPA 4ZCVA 1QV0A 1OSAA 1YR5A 2LHLA 2CT9A 3DF0A 4GGNA 3I5FB 1TTXA 2K61A 1S36A 3DVJA 4MRXA 2LP3A 3CS1A 4C0LA 1F55A 1PALA 2KOTA 3CWGA 2JRFA 1MQ1A 1OQPA 5KSZA 4NDCA 3I5GC 3SIBA 5JOLA 1Y1UA 1GGZA 1DF0B 2CNPA 1B8CA 1K9UA 3VRRA 2KBMA 2QPTA 1XFZO 4MBEA 2I18A 4MN0A 1DJXA 2K7DA 1QX5B 4GNKB 1SR6B 3EK8A 3PLFB 4AQJA 2KAYA 1OZOA 4MVFA 1SCVA 2Y4QA 1AP4A 4XJKB 3LL8B 3H4SE 1DF0A 3BUWB 4WRIA 1YUSA 1YTZC 4YGBB 2M7NA 1F71A 1KQMC 1MUXA 1IQ5A 1NCXA 1WRKA 4GBAA 3BUMB 2K2AA 5HKYA 2NLNA 1IH0A 1J7PA 1F4QA 5FYXA 1CDPA 1ZFSA 4DCKA 3CR4X 4CFQA 3PALA 3SIAA 1JBAA 1RJVA 1A75B 1MWNA 4XJKA 2M29A 2KGRA 1A29A 1J1EA 2BCXA 1UURA 4YGCB 1EG4A 1UWOA 1PRWA 1CDMA 1K94A 5B8IB 1DJHA 1DGUA 1SK6D 2PVBA 4AQIA 2WNDA 2BKHB 1L2OC 2CTNA 2I7AA 2FOTA 4PE1A 3WNXB 3KPXA 1A75A 2LMTA 1TIZA 2A4JA 2ZKMX 2Q91A 1JFJA 3JVTC 2LHIA 1GGWA 1K2HA 1YUTA 1Y6WA 3AKAA 2K2FA 4N5XA 4Q04A 5G08A 1PSRA 3A4UB 1K96A 1BG1A 1Y1AA 1ALWA 2LMUA 1XYDA 5D7FA 1G4YR 2Q4UA
chains in the Genus database with same CATH superfamily
1CFPA 3NHIA 4GPLB 2F3ZA 1F8HA 4USLA 1BOCA 2LCPA 3OGNA 1MF8B 4OKHA 5F6TA 2WCEA 1K95A 2MLEC 4MZJA 1N2DA 3RM1A 1V1GA 2ZRSA 1LA3A 2SCPA 2K0JA 1SBJA 1NSHA 2EC6B 3NHTA 1FBVA 2L4HA 4OV2A 3CZ1A 1XFVO 1K9KA 1WLZA 3BYAA 1UHIA 3B87A 5CSJA 1C3YA 1QATA 1NUBA 4KYNA 1CLMA 3ZNIA 1EL4A 1QIWA 2P70A 4YGEB 4UPGA 3NSOA 2K7CA 2LV7A 1AUIB 1X02A 3LLEA 1W7IB 5AEQA 2JOJA 1RK9A 2LUXA 1J7RA 1YX7A 1WRLA 5I2QA 1XA5A 1JSAA 1R2UA 3LK1A 3D78A 2KI4C 2KI6D 1IRJA 1KWOC 3TUYB 2CXJA 2JQ6A 4WQ3A 2KLEA 1L7ZA 3CABA 5J3XA 1KQVA 2JNXA 2JULA 3B88A 3CLNA 2BL0B 3DY9A 4C0KA 1OW4A 3UNWA 1SCMC 4GGFA 3BFBA 2K7OA 4DIRA 4JD9A 3BXKA 2LNKA 4N1FA 1TNXA 4IJ7A 2JXCA 3FS7A 3O6BA 1DELA 2MRDA 2M9GA 1C7VA 3BFHA 1JF2A 3I5IC 1J7OA 5GQQC 2ZN9A 1V1FA 1GJYA 3I5GB 1ZUZA 1FPWA 2FJYA 1NCZA 1QIVA 1SNLA 2KFHA 1NP8A 1IJ6A 2BBNA 2M7LA 1DC1A 1BMOA 2L51A 3OB1B 1K93D 2BKIB 2YGUA 4P5OE 2BCAA 4C0JA 2LC5A 2QACA 2WC6A 3FWBA 3CZTX 3VB1A 1K8UA 4FTGA 1ODBA 2JC2A 2JU0A 1JC2A 4A4CA 3KEVA 1D1OA 2BE4A 3CR5X 3EVRA 4PCWA 3GOFA 1SKTA 2PALA 4L9MA 3WXAA 1CFFA 2L2CA 1NYAA 2AUCA 1CM4A 1IKUA 1J7QA 1TCOB 4JPZB 1J55A 1W7JB 3L4LA 1G33A 2TN4A 4MSPA 1S6CA 1JF0A 1ZOTB 1PK0D 1QTXA 3BUXB 3QRXA 2BE6A 4HSZA 1YUUA 3O2PA 4IL1A 2HPSA 5ER4X 1CLBA 4MZKA 5CSNA 4PALA 2BCBA 4PHMA 1RFJA 1NX1A 1OE9B 3IF7A 1OMVA 2NCOA 1FI6A 3IQOA 1XFUO 1NX0A 1Y0VH 1Z4HA 3NSLA 1KK8C 3CTNA 1M31A 1KFXL 2KGBC 3I5HC 3S0BA 4YBHB 1B4CA 2JT8A 3DZTA 1MR8A 2M97A 1S6IA 3KHEA 1LKJA 1N65A 4MLWA 2H2KA 5I2LA 2D8NA 3B7AA 3GK2A 2L50A 3JVTB 1CFDA 2L5YA 2I94A 2OS8C 1Y1XA 3FWCA 1XFYO 5HL1A 1FW4A 2O5GA 1H8BA 1BU3A 1R6PA 3D77A 3Q8IA 3MSEB 2MBXA 3BOWB 1OZSA 1QS7A 1SL8A 4A4BA 2H61C 4HRHA 3VROA 3EG5B 2NCPA 3CR2A 4E68A 1TNPA 1B47A 1BR1B 3I5FC 1CB1A 3JTDC 3BFAA 3E3RA 3TDIA 4F0ZB 5HYDA 1Z2CB 3CYZA 3D75A 4ICBA 1NCYA 2ISDA 1FI5A 1LVCD 3EK4A 2JTZA 1S6JA 4MZLA 3FE6A 4NDBA 4FQOA 2FJUB 3BOWA 3S0EA 4NQGA 1J1DA 1XFXO 2WCHA 2LUCA 1KCYA 1SY9A 2K7BA 2ZNDA 5EL2A 3DYEA 2KSPA 1OMRA 2JPOA 4JQ0D 3R1OA 3LK0A 1CKKA 2QEBA 3AAJA 5D69A 1B8RA 1LA0A 1SR6C 1WLMA 1KWOB 1QLSA 4YRUA 1BODA 2F3YA 4AOMA 1TNWA 1M63B 2Y5IA 1TRFA 3BQ3A 1SPYA 1OOFA 5HLOA 1SW8A 5DKQA 2EGDA 2HQ8A 1SCMB 2KQYA 3PFVA 1NIWA 3CZ0A 3NGVA 5BPJA 1IWQA 2GGZA 2CCMA 5FI7A 1EXRA 1UHJA 2KFFA 2WCBA 2NXQA 1DJGA 3FE9A 1MXLC 3I5IB 5HKZA 2M49B 3GK4X 3PM2A 1BR4B 3EVUA 3TS5C 2JPTA 2NZ0A 1B8LA 1KK7Z 2QEVA 4N1GA 2COLB 3EK7A 3GK1A 1EG3A 1LINA 2KI6C 2L4IA 1KFUL 3O4YA 2LANA 1DTLA 2VRGA 5I8NA 2HETA 4GAOA 2KPHA 1M46A 5FI6A 1CTRA 1M39A 1PULA 2ZFDA 3A8RA 2E6WA 3NSKA 3SG2A 5KTYA 5KU1A 2FCEA 1DT7B 1CDLA 1WDCC 2P6BB 1AJ5A 1JUOA 1YRUB 1DVIA 2PRUA 1CM1A 3CGAA 3S0AA 3D74A 3PN7C 4YI9A 1UHHA 1B9AA 1SYMA 1XK4A 2GGMA 3NSIA 4GUKA 5AXIA 3ICBA 3TDUA 4ZCUA 4PE7A 3VRNA 1CMFA 1OOJA 2L98A 2L5XB 3O78A 1GQMA 2K60A 3RLZA 2AAOA 3LCPC 2I2RE 2MHHA 2WCFA 1KSMA 2JWWA 2OTGC 3HCMA 1WRZA 3SG3A 1HQVA 2JTTA 2E30A 2KLDA 3IVTA 1BLQA 1H4BA 4YI8A 3AKBA 1C07A 1CNPA 1EJ3A 2G2BA 2BBMA 2CBLA 4I5NB 1Q80A 1QX7A 3DVKA 1K9PA 1AHRA 2KDHA 3S0GA 3PSRA 1UHKA 3C1VA 4OVNF 4MEWA 3V2LA 4QJ3B 5HLVA 4BY4A 2M8UA 4MRYA 1CMGA 3PJIA 5CSFA 3B86A 4GGFC 1EH2A 4DS7A 3WHUB 4D1EA 5I94A 1CLLA 1XVJA 2PSRA 4I5LB 1KQMB 2BECA 1S1EA 2KBIA 4ORCB 3CDNA 1TNQA 1YVHA 1IG5A 3OX6A 1F70A 1S3PA 3DXLA 1TUZA 2QEHA 2G9BA 4OZDA 5I2OA 2AMIA 2BL0C 3DVMA 3S0DA 2F2PA 5PALA 3UO9A 4CIDA 1BF5A 1T14A 1A4PA 2DOQA 2LLSA 3D0YB 3EKHA 5AERA 2B1UA 4ORAB 3IQQA 1IIOA 1DJIA 1OOHA 4PT1A 1ZMZA 3JTDB 3K21A 4F7FA 1MXEA 2LE9B 1KFUS 1DJYA 1L2OB 4PE4A 1FF1A 1TUJA 1QASA 2M1KB 2QEOA 1U5IB 3SJSA 4CPVA 1E8AA 3D76A 4INXA 5CSIA 2H61A 4ETOA 3D0YA 2WCMA 2ZRTA 4PDZA 1IJ5A 3OP0A 4WQ2A 1OOIX 1K90D 2MJWB 2F33A 1RECA 2ZNEA 2HF5A 4PE0A 2KYCA 2M1UA 4QJ5B 2KFGA 4QJ4B 1AVSA 1DJZA 1S26D 1RWYA 1OOGA 3N7HA 2WCLA 2KYFA 1U5IA 2GV5A 5AANA 2L2EA 2KAVA 3KF9A 2Y1NA 1SSEB 2LM5A 1NPQA 2KQ6A 3VRQA 2KHNA 1SL7A 1IQ3A 1ALVA 5D3OA 1YURA 2WORA 3NXAA 5DKRA 1N0YA 1HT9A 1DMOA 2LAPA 3PM8A 1RROA 1NX2A 2PASA 4CLNA 2LVKA 2ZN8A 4PHJA 3AAKA 1GM0A 1C7WA 2GTEA 2V53A 4M2PA 3EVVA 5CPVA 3TDZA 3TS5B 4M2QA 3OHMB 3BUNB 1S5GY 4I5JA 1TCFA 4NDDA 2KI4B 3FE8A 4PHKA 3SG6A 1A2XA 4HREE 1SRAA 4XYNA 3BUOB 4TNCA 1JWDA 3F45A 1KK7Y 2LLUA 5IBWA 2K8MB 5DKNA 1M45A 1W9ZA 5ER5A 1ZACA 2LVVA 2OPOA 2EHBA 2JXLA 2LVJA 4U8DA 4BY5A 1S5GZ 1F54A 1WDCB 3M0WA 1F4OA 4CFRA 3PN7B 3CZ2A 2F2OA 2O60A 1PVAA 2MA2A 2P71A 1KFXS 1QXPA 4GFTA 1TOPA 3ZWHA 2KNEA 1NWDA 2FCDA 3SG4A 2OTGB 1QWVA 1UP5A 4DUQA 4I5KA 1TWOA 1WY9A 3PATA 3VGOA 2R2IA 4P2YB 5AFPA 3S0FA 1UHNA 2F8PA 4OCIA 1VRKA 1JFKA 1QX2A 1DJWA 2RGIA 3TZ1A 1BJFA 1DGVA 1RTP1 2LP2A 1A03A 4R1EA 4DRWA 1B7TY 1PVBA 3D10A 1YVLA 3R1PA 2L0PA 2JZIA 2HQWA 4YGAA 1NX3A 1SMGA 3O4XA 4JWQA 3RZSA 1G8IA 1P28A 2ERBA 2KAXA 3EKJA 1MHOA 3KO0A 4HRGA 2MLFC 1YX8A 3OX5A 1C3ZA 3K1EA 2LVIA 4M2OA 2LMVA 3OB2B 2QDIA 1UUSA 3SS4A 2WC8A 1B7TZ 4ORBB 2M3WA 2Y1MA 1IGVA 1QVIY 1TN4A 1KSOA 5K89A 3FIAA 1LXFC 1QJTA 1XO5A 1SL9A 2JNFA 4PHNA 2WOSA 1KK8B 2JT3A 3DD4A 4OR9B 1PSBA 1QLKA 2EC6C 5JJGA 4YGDB 1BT6A 1B1GA 3I5HB 3WHTB 4FQTA 5HKWA 2BNXA 1CFCA 3DVEA 3SG7A 1CDNA 2MAZA 1OMDA 1QVIZ 1XFWO 1QV1A 2JT0A 2LLTA 3DF0B 3SS5A 3SG5A 1YRTB 1AJ4A 3SS3A 2M0RA 2OS8B 2PMYA 1AK8A 2PYQA 1XK4C 3TUYC 2IS9A 3HX4A 2SASA 3BJHA 5TNCA 3VRPA 4ZCVA 1QV0A 1OSAA 3D73A 3R1VA 1YR5A 2LHLA 2CT9A 3DF0A 4GGNA 3I5FB 1TTXA 2K61A 1S36A 3DVJA 4MRXA 2LP3A 3CS1A 4C0LA 1F55A 1PALA 2KOTA 3CWGA 2JRFA 1ORGA 1MQ1A 1OQPA 2BAPA 5KSZA 4NDCA 3I5GC 3SIBA 5JOLA 1Y1UA 1GGZA 1DF0B 1B8CA 2CNPA 1K9UA 3VRRA 2KBMA 1DQEA 2QPTA 1XFZO 4MBEA 2I18A 2H8VA 2WCJA 4MN0A 1DJXA 2K7DA 1QX5B 4GNKB 1SR6B 3EK8A 2PQLA 3PLFB 4AQJA 2KAYA 5DICA 1OZOA 4MVFA 1SCVA 2Y4QA 1AP4A 4XJKB 3LL8B 3H4SE 1DF0A 3BUWB 3R72A 4WRIA 1YUSA 2WCKA 1YTZC 4YGBB 2M7NA 1F71A 4INWA 1KQMC 1MUXA 1IQ5A 1NCXA 1WRKA 4GBAA 3BUMB 2K2AA 5HKYA 2NLNA 2WC5A 1J7PA 1IH0A 1F4QA 5FYXA 1CDPA 1ZFSA 4DCKA 3CR4X 5FI2A 4CFQA 3PALA 3SIAA 1JBAA 1RJVA 3L47A 1A75B 1XFRA 1MWNA 4XJKA 2M29A 2KGRA 1A29A 1J1EA 2BCXA 1UURA 4YGCB 1EG4A 1UWOA 1PRWA 1CDMA 1K94A 5B8IB 1DJHA 1DGUA 1SK6D 2PVBA 4AQIA 2WNDA 2BKHB 1L2OC 2CTNA 2I7AA 2FOTA 4PE1A 3WNXB 3L4AA 3KPXA 1A75A 2LMTA 1TIZA 2A4JA 2ZKMX 2Q91A 3B6XA 3JVTC 3OBVA 1JFJA 4JKTA 2LHIA 1GGWA 1K2HA 1YUTA 1Y6WA 3AKAA 2K2FA 4N5XA 4Q04A 5G08A 1LS8A 1PSRA 3A4UB 1K96A 1DEKA 3QMEA 1BG1A 1Y1AA 1ALWA 2LMUA 1XYDA 5D7FA 1G4YR 2Q4UA
chains in the Genus database with same CATH topology
1CFPA 4GPLB 2F3ZA 1F8HA 4USLA 1BOCA 2LCPA 4OKHA 1MF8B 5F6TA 2WCEA 1K95A 2MLEC 4MZJA 1N2DA 3RM1A 1V1GA 2ZRSA 1LA3A 2SCPA 2K0JA 1SBJA 1NSHA 2EC6B 1FBVA 2L4HA 4OV2A 1XFVO 1K9KA 1WLZA 3BYAA 1UHIA 5CSJA 1QATA 1NUBA 1CLMA 3ZNIA 1EL4A 1QIWA 4YGEB 4UPGA 3NSOA 2K7CA 2LV7A 1AUIB 1X02A 3LLEA 1W7IB 5AEQA 2JOJA 1RK9A 2LUXA 1J7RA 1YX7A 1WRLA 5I2QA 1XA5A 1JSAA 1R2UA 3LK1A 2KI4C 2KI6D 1IRJA 1KWOC 3TUYB 2CXJA 2JQ6A 4WQ3A 1KQVA 1L7ZA 5J3XA 2JNXA 2JULA 3CLNA 2BL0B 4C0KA 1SCMC 4GGFA 2K7OA 4DIRA 3BXKA 2LNKA 4N1FA 1TNXA 2JXCA 3FS7A 3O6BA 2MRDA 2M9GA 1C7VA 1JF2A 3I5IC 1J7OA 5GQQC 2ZN9A 1V1FA 1GJYA 3I5GB 1ZUZA 1FPWA 1NCZA 1QIVA 1SNLA 2KFHA 1NP8A 1IJ6A 2BBNA 2M7LA 1BMOA 2L51A 3OB1B 1K93D 2BKIB 4P5OE 2BCAA 4C0JA 2LC5A 2QACA 3FWBA 3CZTX 1K8UA 4FTGA 1ODBA 2JC2A 2JU0A 1JC2A 4A4CA 3KEVA 1D1OA 2BE4A 3CR5X 3EVRA 4PCWA 3GOFA 1SKTA 2PALA 4L9MA 3WXAA 1CFFA 1NYAA 2AUCA 1CM4A 1IKUA 1J7QA 1TCOB 4JPZB 1J55A 1W7JB 1G33A 2TN4A 4MSPA 1S6CA 1JF0A 1ZOTB 1PK0D 1QTXA 3BUXB 3QRXA 2BE6A 4HSZA 1YUUA 3O2PA 4IL1A 2HPSA 5ER4X 1CLBA 4MZKA 5CSNA 4PALA 2BCBA 4PHMA 1RFJA 1NX1A 1OE9B 3IF7A 1OMVA 2NCOA 1FI6A 3IQOA 1XFUO 1NX0A 1Y0VH 3NSLA 1KK8C 3CTNA 1M31A 1KFXL 2KGBC 3I5HC 4YBHB 1B4CA 2JT8A 1MR8A 2M97A 1S6IA 3KHEA 1LKJA 1N65A 4MLWA 2H2KA 5I2LA 2D8NA 3GK2A 2L50A 3JVTB 1CFDA 2I94A 2OS8C 1Y1XA 3FWCA 1XFYO 1FW4A 2O5GA 1H8BA 1BU3A 1R6PA 3MSEB 2MBXA 3BOWB 1OZSA 1QS7A 1SL8A 4A4BA 2H61C 4HRHA 3VROA 2NCPA 3CR2A 4E68A 1TNPA 1B47A 1BR1B 3I5FC 1CB1A 3JTDC 3E3RA 3TDIA 4F0ZB 5HYDA 4ICBA 1NCYA 2ISDA 1FI5A 1LVCD 3EK4A 2JTZA 1S6JA 4MZLA 4NDBA 4FQOA 2FJUB 3BOWA 4NQGA 1J1DA 1XFXO 2LUCA 1KCYA 1SY9A 2K7BA 2ZNDA 2KSPA 1OMRA 4JQ0D 3LK0A 1CKKA 3AAJA 5D69A 1B8RA 1LA0A 1SR6C 1WLMA 1KWOB 1QLSA 4YRUA 1BODA 2F3YA 4AOMA 1TNWA 1M63B 2Y5IA 1TRFA 3BQ3A 1SPYA 5HLOA 1SW8A 5DKQA 2EGDA 2HQ8A 1SCMB 2KQYA 3PFVA 1NIWA 5BPJA 1IWQA 2GGZA 2CCMA 1EXRA 1UHJA 2KFFA 2WCBA 2NXQA 1DJGA 1MXLC 3I5IB 5HKZA 2M49B 3GK4X 1BR4B 3EVUA 3TS5C 2JPTA 2NZ0A 1B8LA 1KK7Z 4N1GA 2COLB 3EK7A 3GK1A 1EG3A 1LINA 2KI6C 2L4IA 1KFUL 3O4YA 2LANA 1DTLA 2VRGA 5I8NA 2HETA 4GAOA 1M46A 1CTRA 1M39A 1PULA 2ZFDA 3A8RA 2E6WA 3NSKA 3SG2A 5KTYA 5KU1A 2FCEA 1DT7B 1CDLA 1WDCC 2P6BB 1AJ5A 1JUOA 1YRUB 1DVIA 2PRUA 1CM1A 3CGAA 3PN7C 4YI9A 1UHHA 1B9AA 1SYMA 1XK4A 2GGMA 3NSIA 4GUKA 5AXIA 3ICBA 3TDUA 4ZCUA 4PE7A 3VRNA 1CMFA 1OOJA 2L98A 2L5XB 3O78A 1GQMA 3RLZA 2AAOA 3LCPC 2I2RE 2MHHA 2WCFA 1KSMA 2JWWA 2OTGC 3HCMA 1WRZA 3SG3A 1HQVA 2JTTA 2E30A 1BLQA 1H4BA 4YI8A 3AKBA 1C07A 1CNPA 1EJ3A 2G2BA 2BBMA 2CBLA 4I5NB 1Q80A 1QX7A 3DVKA 1K9PA 1AHRA 2KDHA 3PSRA 1UHKA 3C1VA 4OVNF 4MEWA 4QJ3B 5HLVA 4BY4A 2M8UA 4MRYA 1CMGA 5CSFA 4GGFC 1EH2A 4DS7A 3WHUB 4D1EA 1CLLA 1XVJA 2PSRA 4I5LB 1KQMB 2BECA 1S1EA 2KBIA 4ORCB 1TNQA 1YVHA 1IG5A 3OX6A 1F70A 1S3PA 5I2OA 2G9BA 2AMIA 2BL0C 3DVMA 4CIDA 2F2PA 5PALA 1BF5A 1A4PA 2DOQA 2LLSA 3D0YB 3EKHA 5AERA 2B1UA 4ORAB 3IQQA 1DJIA 1ZMZA 3JTDB 3K21A 1MXEA 2LE9B 1KFUS 1DJYA 1L2OB 4PE4A 1FF1A 1QASA 2M1KB 1U5IB 3SJSA 4CPVA 1E8AA 5CSIA 4ETOA 2H61A 3D0YA 2ZRTA 4PDZA 1IJ5A 3OP0A 4WQ2A 1K90D 2MJWB 2F33A 1RECA 2ZNEA 2HF5A 4PE0A 2KYCA 2M1UA 4QJ5B 2KFGA 4QJ4B 1AVSA 1DJZA 1S26D 1RWYA 5AANA 2KYFA 1U5IA 2GV5A 2L2EA 2KAVA 3KF9A 2Y1NA 2LM5A 1NPQA 2KQ6A 3VRQA 2KHNA 1SL7A 1IQ3A 1ALVA 1YURA 2WORA 3NXAA 5DKRA 1N0YA 1HT9A 1DMOA 2LAPA 3PM8A 1RROA 1NX2A 2PASA 4CLNA 2LVKA 2ZN8A 4PHJA 3AAKA 1C7WA 2V53A 4M2PA 5CPVA 3EVVA 3TDZA 3TS5B 4M2QA 3OHMB 3BUNB 1S5GY 4I5JA 1TCFA 4NDDA 2KI4B 4PHKA 3SG6A 1A2XA 4HREE 1SRAA 4XYNA 3BUOB 4TNCA 1JWDA 3F45A 1KK7Y 2LLUA 5IBWA 2K8MB 5DKNA 1M45A 5ER5A 1ZACA 2LVVA 2OPOA 2EHBA 2JXLA 2LVJA 4U8DA 4BY5A 1S5GZ 1F54A 1WDCB 3M0WA 1F4OA 4CFRA 3PN7B 2F2OA 2O60A 1PVAA 2MA2A 1KFXS 1QXPA 4GFTA 1TOPA 3ZWHA 2KNEA 1NWDA 2FCDA 3SG4A 2OTGB 4DUQA 1UP5A 4I5KA 1WY9A 3PATA 3VGOA 2R2IA 4P2YB 5AFPA 1UHNA 2F8PA 4OCIA 1VRKA 1JFKA 1QX2A 1DJWA 2RGIA 3TZ1A 1BJFA 1DGVA 1RTP1 2LP2A 1A03A 4R1EA 4DRWA 1B7TY 1PVBA 3D10A 1YVLA 2L0PA 2JZIA 2HQWA 4YGAA 1NX3A 1SMGA 4JWQA 1G8IA 2KAXA 3EKJA 1MHOA 3KO0A 4HRGA 2MLFC 1YX8A 3OX5A 2LVIA 4M2OA 2LMVA 3OB2B 1UUSA 2WC8A 1B7TZ 4ORBB 2M3WA 2Y1MA 1IGVA 1QVIY 1TN4A 1KSOA 5K89A 3FIAA 1LXFC 1QJTA 1XO5A 1SL9A 2JNFA 4PHNA 2WOSA 1KK8B 2JT3A 3DD4A 4OR9B 1PSBA 1QLKA 2EC6C 5JJGA 4YGDB 1BT6A 1B1GA 3I5HB 3WHTB 5HKWA 1CFCA 3DVEA 3SG7A 1CDNA 2MAZA 1OMDA 1QVIZ 1XFWO 1QV1A 2JT0A 2LLTA 3DF0B 3SG5A 1YRTB 1AJ4A 2M0RA 2OS8B 2PMYA 1AK8A 1XK4C 3TUYC 2IS9A 3HX4A 2SASA 5TNCA 3VRPA 4ZCVA 1QV0A 1OSAA 1YR5A 2LHLA 2CT9A 3DF0A 4GGNA 3I5FB 1TTXA 2K61A 1S36A 3DVJA 4MRXA 2LP3A 3CS1A 4C0LA 1F55A 1PALA 2KOTA 3CWGA 2JRFA 1MQ1A 1OQPA 5KSZA 4NDCA 3I5GC 3SIBA 5JOLA 1Y1UA 1GGZA 1DF0B 2CNPA 1B8CA 1K9UA 3VRRA 2KBMA 2QPTA 1XFZO 4MBEA 2I18A 4MN0A 1DJXA 2K7DA 1QX5B 4GNKB 1SR6B 3EK8A 3PLFB 4AQJA 2KAYA 1OZOA 4MVFA 1SCVA 2Y4QA 1AP4A 4XJKB 3LL8B 3H4SE 1DF0A 3BUWB 4WRIA 1YUSA 1YTZC 4YGBB 2M7NA 1F71A 1KQMC 1MUXA 1IQ5A 1NCXA 1WRKA 4GBAA 3BUMB 2K2AA 5HKYA 2NLNA 1IH0A 1J7PA 1F4QA 5FYXA 1CDPA 1ZFSA 4DCKA 3CR4X 4CFQA 3PALA 3SIAA 1JBAA 1RJVA 1A75B 1MWNA 4XJKA 2M29A 2KGRA 1A29A 1J1EA 2BCXA 1UURA 4YGCB 1EG4A 1UWOA 1PRWA 1CDMA 1K94A 5B8IB 1DJHA 1DGUA 1SK6D 2PVBA 4AQIA 2WNDA 2BKHB 1L2OC 2CTNA 2I7AA 2FOTA 4PE1A 3WNXB 3KPXA 1A75A 2LMTA 1TIZA 2A4JA 2ZKMX 2Q91A 1JFJA 3JVTC 2LHIA 1GGWA 1K2HA 1YUTA 1Y6WA 3AKAA 2K2FA 4N5XA 4Q04A 5G08A 1PSRA 3A4UB 1K96A 1BG1A 1Y1AA 1ALWA 2LMUA 1XYDA 5D7FA 1G4YR 2Q4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFP A;  4GPL B;  2F3Z A;  1F8H A;  4USL A;  1BOC A;  2LCP A;  4OKH A;  1MF8 B;  5F6T A;  2WCE A;  1K95 A;  2MLE C;  4MZJ A;  1N2D A;  3RM1 A;  1V1G A;  2ZRS A;  1LA3 A;  2SCP A;  2K0J A;  1SBJ A;  1NSH A;  2EC6 B;  1FBV A;  2L4H A;  4OV2 A;  1XFV O;  1K9K A;  1WLZ A;  3BYA A;  1UHI A;  5CSJ A;  1QAT A;  1NUB A;  1CLM A;  3ZNI A;  1EL4 A;  1QIW A;  4YGE B;  4UPG A;  3NSO A;  2K7C A;  2LV7 A;  1AUI B;  1X02 A;  3LLE A;  1W7I B;  5AEQ A;  2JOJ A;  1RK9 A;  2LUX A;  1J7R A;  1YX7 A;  1WRL A;  5I2Q A;  1XA5 A;  1JSA A;  1R2U A;  3LK1 A;  2KI4 C;  2KI6 D;  1IRJ A;  1KWO C;  3TUY B;  2CXJ A;  2JQ6 A;  4WQ3 A;  1KQV A;  1L7Z A;  5J3X A;  2JNX A;  2JUL A;  3CLN A;  2BL0 B;  4C0K A;  1SCM C;  4GGF A;  2K7O A;  4DIR A;  3BXK A;  2LNK A;  4N1F A;  1TNX A;  2JXC A;  3FS7 A;  3O6B A;  2MRD A;  2M9G A;  1C7V A;  1JF2 A;  3I5I C;  1J7O A;  5GQQ C;  2ZN9 A;  1V1F A;  1GJY A;  3I5G B;  1ZUZ A;  1FPW A;  1NCZ A;  1QIV A;  1SNL A;  2KFH A;  1NP8 A;  1IJ6 A;  2BBN A;  2M7L A;  1BMO A;  2L51 A;  3OB1 B;  1K93 D;  2BKI B;  4P5O E;  2BCA A;  4C0J A;  2LC5 A;  2QAC A;  3FWB A;  3CZT X;  1K8U A;  4FTG A;  1ODB A;  2JC2 A;  2JU0 A;  1JC2 A;  4A4C A;  3KEV A;  1D1O A;  2BE4 A;  3CR5 X;  3EVR A;  4PCW A;  3GOF A;  1SKT A;  2PAL A;  4L9M A;  3WXA A;  1CFF A;  1NYA A;  2AUC A;  1CM4 A;  1IKU A;  1J7Q A;  1TCO B;  4JPZ B;  1J55 A;  1W7J B;  1G33 A;  2TN4 A;  4MSP A;  1S6C A;  1JF0 A;  1ZOT B;  1PK0 D;  1QTX A;  3BUX B;  3QRX A;  2BE6 A;  4HSZ A;  1YUU A;  3O2P A;  4IL1 A;  2HPS A;  5ER4 X;  1CLB A;  4MZK A;  5CSN A;  4PAL A;  2BCB A;  4PHM A;  1RFJ A;  1NX1 A;  1OE9 B;  3IF7 A;  1OMV A;  2NCO A;  1FI6 A;  3IQO A;  1XFU O;  1NX0 A;  1Y0V H;  3NSL A;  1KK8 C;  3CTN A;  1M31 A;  1KFX L;  2KGB C;  3I5H C;  4YBH B;  1B4C A;  2JT8 A;  1MR8 A;  2M97 A;  1S6I A;  3KHE A;  1LKJ A;  1N65 A;  4MLW A;  2H2K A;  5I2L A;  2D8N A;  3GK2 A;  2L50 A;  3JVT B;  1CFD A;  2I94 A;  2OS8 C;  1Y1X A;  3FWC A;  1XFY O;  1FW4 A;  2O5G A;  1H8B A;  1BU3 A;  1R6P A;  3MSE B;  2MBX A;  3BOW B;  1OZS A;  1QS7 A;  1SL8 A;  4A4B A;  2H61 C;  4HRH A;  3VRO A;  2NCP A;  3CR2 A;  4E68 A;  1TNP A;  1B47 A;  1BR1 B;  3I5F C;  1CB1 A;  3JTD C;  3E3R A;  3TDI A;  4F0Z B;  5HYD A;  4ICB A;  1NCY A;  2ISD A;  1FI5 A;  1LVC D;  3EK4 A;  2JTZ A;  1S6J A;  4MZL A;  4NDB A;  4FQO A;  2FJU B;  3BOW A;  4NQG A;  1J1D A;  1XFX O;  2LUC A;  1KCY A;  1SY9 A;  2K7B A;  2ZND A;  2KSP A;  1OMR A;  4JQ0 D;  3LK0 A;  1CKK A;  3AAJ A;  5D69 A;  1B8R A;  1LA0 A;  1SR6 C;  1WLM A;  1KWO B;  1QLS A;  4YRU A;  1BOD A;  2F3Y A;  4AOM A;  1TNW A;  1M63 B;  2Y5I A;  1TRF A;  3BQ3 A;  1SPY A;  5HLO A;  1SW8 A;  5DKQ A;  2EGD A;  2HQ8 A;  1SCM B;  2KQY A;  3PFV A;  1NIW A;  5BPJ A;  1IWQ A;  2GGZ A;  2CCM A;  1EXR A;  1UHJ A;  2KFF A;  2WCB A;  2NXQ A;  1DJG A;  1MXL C;  3I5I B;  5HKZ A;  2M49 B;  3GK4 X;  1BR4 B;  3EVU A;  3TS5 C;  2JPT A;  2NZ0 A;  1B8L A;  1KK7 Z;  4N1G A;  2COL B;  3EK7 A;  3GK1 A;  1EG3 A;  1LIN A;  2KI6 C;  2L4I A;  1KFU L;  3O4Y A;  2LAN A;  1DTL A;  2VRG A;  5I8N A;  2HET A;  4GAO A;  1M46 A;  1CTR A;  1M39 A;  1PUL A;  2ZFD A;  3A8R A;  2E6W A;  3NSK A;  3SG2 A;  5KTY A;  5KU1 A;  2FCE A;  1DT7 B;  1CDL A;  1WDC C;  2P6B B;  1AJ5 A;  1JUO A;  1YRU B;  1DVI A;  2PRU A;  1CM1 A;  3CGA A;  3PN7 C;  4YI9 A;  1UHH A;  1B9A A;  1SYM A;  1XK4 A;  2GGM A;  3NSI A;  4GUK A;  5AXI A;  3ICB A;  3TDU A;  4ZCU A;  4PE7 A;  3VRN A;  1CMF A;  1OOJ A;  2L98 A;  2L5X B;  3O78 A;  1GQM A;  3RLZ A;  2AAO A;  3LCP C;  2I2R E;  2MHH A;  2WCF A;  1KSM A;  2JWW A;  2OTG C;  3HCM A;  1WRZ A;  3SG3 A;  1HQV A;  2JTT A;  2E30 A;  1BLQ A;  1H4B A;  4YI8 A;  3AKB A;  1C07 A;  1CNP A;  1EJ3 A;  2G2B A;  2BBM A;  2CBL A;  4I5N B;  1Q80 A;  1QX7 A;  3DVK A;  1K9P A;  1AHR A;  2KDH A;  3PSR A;  1UHK A;  3C1V A;  4OVN F;  4MEW A;  4QJ3 B;  5HLV A;  4BY4 A;  2M8U A;  4MRY A;  1CMG A;  5CSF A;  4GGF C;  1EH2 A;  4DS7 A;  3WHU B;  4D1E A;  1CLL A;  1XVJ A;  2PSR A;  4I5L B;  1KQM B;  2BEC A;  1S1E A;  2KBI A;  4ORC B;  1TNQ A;  1YVH A;  1IG5 A;  3OX6 A;  1F70 A;  1S3P A;  5I2O A;  2G9B A;  2AMI A;  2BL0 C;  3DVM A;  4CID A;  2F2P A;  5PAL A;  1BF5 A;  1A4P A;  2DOQ A;  2LLS A;  3D0Y B;  3EKH A;  5AER A;  2B1U A;  4ORA B;  3IQQ A;  1DJI A;  1ZMZ A;  3JTD B;  3K21 A;  1MXE A;  2LE9 B;  1KFU S;  1DJY A;  1L2O B;  4PE4 A;  1FF1 A;  1QAS A;  2M1K B;  1U5I B;  3SJS A;  4CPV A;  1E8A A;  5CSI A;  4ETO A;  2H61 A;  3D0Y A;  2ZRT A;  4PDZ A;  1IJ5 A;  3OP0 A;  4WQ2 A;  1K90 D;  2MJW B;  2F33 A;  1REC A;  2ZNE A;  2HF5 A;  4PE0 A;  2KYC A;  2M1U A;  4QJ5 B;  2KFG A;  4QJ4 B;  1AVS A;  1DJZ A;  1S26 D;  1RWY A;  5AAN A;  2KYF A;  1U5I A;  2GV5 A;  2L2E A;  2KAV A;  3KF9 A;  2Y1N A;  2LM5 A;  1NPQ A;  2KQ6 A;  3VRQ A;  2KHN A;  1SL7 A;  1IQ3 A;  1ALV A;  1YUR A;  2WOR A;  3NXA A;  5DKR A;  1N0Y A;  1HT9 A;  1DMO A;  2LAP A;  3PM8 A;  1RRO A;  1NX2 A;  2PAS A;  4CLN A;  2LVK A;  2ZN8 A;  4PHJ A;  3AAK A;  1C7W A;  2V53 A;  4M2P A;  5CPV A;  3EVV A;  3TDZ A;  3TS5 B;  4M2Q A;  3OHM B;  3BUN B;  1S5G Y;  4I5J A;  1TCF A;  4NDD A;  2KI4 B;  4PHK A;  3SG6 A;  1A2X A;  4HRE E;  1SRA A;  4XYN A;  3BUO B;  4TNC A;  1JWD A;  3F45 A;  1KK7 Y;  2LLU A;  5IBW A;  2K8M B;  5DKN A;  1M45 A;  5ER5 A;  1ZAC A;  2LVV A;  2OPO A;  2EHB A;  2JXL A;  2LVJ A;  4U8D A;  4BY5 A;  1S5G Z;  1F54 A;  1WDC B;  3M0W A;  1F4O A;  4CFR A;  3PN7 B;  2F2O A;  2O60 A;  1PVA A;  2MA2 A;  1KFX S;  1QXP A;  4GFT A;  1TOP A;  3ZWH A;  2KNE A;  1NWD A;  2FCD A;  3SG4 A;  2OTG B;  4DUQ A;  1UP5 A;  4I5K A;  1WY9 A;  3PAT A;  3VGO A;  2R2I A;  4P2Y B;  5AFP A;  1UHN A;  2F8P A;  4OCI A;  1VRK A;  1JFK A;  1QX2 A;  1DJW A;  2RGI A;  3TZ1 A;  1BJF A;  1DGV A;  1RTP 1;  2LP2 A;  1A03 A;  4R1E A;  4DRW A;  1B7T Y;  1PVB A;  3D10 A;  1YVL A;  2L0P A;  2JZI A;  2HQW A;  4YGA A;  1NX3 A;  1SMG A;  4JWQ A;  1G8I A;  2KAX A;  3EKJ A;  1MHO A;  3KO0 A;  4HRG A;  2MLF C;  1YX8 A;  3OX5 A;  2LVI A;  4M2O A;  2LMV A;  3OB2 B;  1UUS A;  2WC8 A;  1B7T Z;  4ORB B;  2M3W A;  2Y1M A;  1IGV A;  1QVI Y;  1TN4 A;  1KSO A;  5K89 A;  3FIA A;  1LXF C;  1QJT A;  1XO5 A;  1SL9 A;  2JNF A;  4PHN A;  2WOS A;  1KK8 B;  2JT3 A;  3DD4 A;  4OR9 B;  1PSB A;  1QLK A;  2EC6 C;  5JJG A;  4YGD B;  1BT6 A;  1B1G A;  3I5H B;  3WHT B;  5HKW A;  1CFC A;  3DVE A;  3SG7 A;  1CDN A;  2MAZ A;  1OMD A;  1QVI Z;  1XFW O;  1QV1 A;  2JT0 A;  2LLT A;  3DF0 B;  3SG5 A;  1YRT B;  1AJ4 A;  2M0R A;  2OS8 B;  2PMY A;  1AK8 A;  1XK4 C;  3TUY C;  2IS9 A;  3HX4 A;  2SAS A;  5TNC A;  3VRP A;  4ZCV A;  1QV0 A;  1OSA A;  1YR5 A;  2LHL A;  2CT9 A;  3DF0 A;  4GGN A;  3I5F B;  1TTX A;  2K61 A;  1S36 A;  3DVJ A;  4MRX A;  2LP3 A;  3CS1 A;  4C0L A;  1F55 A;  1PAL A;  2KOT A;  3CWG A;  2JRF A;  1MQ1 A;  1OQP A;  5KSZ A;  4NDC A;  3I5G C;  3SIB A;  5JOL A;  1Y1U A;  1GGZ A;  1DF0 B;  2CNP A;  1B8C A;  1K9U A;  3VRR A;  2KBM A;  2QPT A;  1XFZ O;  4MBE A;  2I18 A;  4MN0 A;  1DJX A;  2K7D A;  1QX5 B;  4GNK B;  1SR6 B;  3EK8 A;  3PLF B;  4AQJ A;  2KAY A;  1OZO A;  4MVF A;  1SCV A;  2Y4Q A;  1AP4 A;  4XJK B;  3LL8 B;  3H4S E;  1DF0 A;  3BUW B;  4WRI A;  1YUS A;  1YTZ C;  4YGB B;  2M7N A;  1F71 A;  1KQM C;  1MUX A;  1IQ5 A;  1NCX A;  1WRK A;  4GBA A;  3BUM B;  2K2A A;  5HKY A;  2NLN A;  1IH0 A;  1J7P A;  1F4Q A;  5FYX A;  1CDP A;  1ZFS A;  4DCK A;  3CR4 X;  4CFQ A;  3PAL A;  3SIA A;  1JBA A;  1RJV A;  1A75 B;  1MWN A;  4XJK A;  2M29 A;  2KGR A;  1A29 A;  1J1E A;  2BCX A;  1UUR A;  4YGC B;  1EG4 A;  1UWO A;  1PRW A;  1CDM A;  1K94 A;  5B8I B;  1DJH A;  1DGU A;  1SK6 D;  2PVB A;  4AQI A;  2WND A;  2BKH B;  1L2O C;  2CTN A;  2I7A A;  2FOT A;  4PE1 A;  3WNX B;  3KPX A;  1A75 A;  2LMT A;  1TIZ A;  2A4J A;  2ZKM X;  2Q91 A;  1JFJ A;  3JVT C;  2LHI A;  1GGW A;  1K2H A;  1YUT A;  1Y6W A;  3AKA A;  2K2F A;  4N5X A;  4Q04 A;  5G08 A;  1PSR A;  3A4U B;  1K96 A;  1BG1 A;  1Y1A A;  1ALW A;  2LMU A;  1XYD A;  5D7F A;  1G4Y R;  2Q4U A; 
#chains in the Genus database with same CATH topology
 1CFP A;  3NHI A;  4GPL B;  2F3Z A;  1F8H A;  4USL A;  1BOC A;  2LCP A;  3OGN A;  1MF8 B;  4OKH A;  5F6T A;  2WCE A;  1K95 A;  2MLE C;  4MZJ A;  1N2D A;  3RM1 A;  1V1G A;  2ZRS A;  1LA3 A;  2SCP A;  2K0J A;  1SBJ A;  1NSH A;  2EC6 B;  3NHT A;  1FBV A;  2L4H A;  4OV2 A;  3CZ1 A;  1XFV O;  1K9K A;  1WLZ A;  3BYA A;  1UHI A;  3B87 A;  5CSJ A;  1C3Y A;  1QAT A;  1NUB A;  4KYN A;  1CLM A;  3ZNI A;  1EL4 A;  1QIW A;  2P70 A;  4YGE B;  4UPG A;  3NSO A;  2K7C A;  2LV7 A;  1AUI B;  1X02 A;  3LLE A;  1W7I B;  5AEQ A;  2JOJ A;  1RK9 A;  2LUX A;  1J7R A;  1YX7 A;  1WRL A;  5I2Q A;  1XA5 A;  1JSA A;  1R2U A;  3LK1 A;  3D78 A;  2KI4 C;  2KI6 D;  1IRJ A;  1KWO C;  3TUY B;  2CXJ A;  2JQ6 A;  4WQ3 A;  2KLE A;  1L7Z A;  3CAB A;  5J3X A;  1KQV A;  2JNX A;  2JUL A;  3B88 A;  3CLN A;  2BL0 B;  3DY9 A;  4C0K A;  1OW4 A;  3UNW A;  1SCM C;  4GGF A;  3BFB A;  2K7O A;  4DIR A;  4JD9 A;  3BXK A;  2LNK A;  4N1F A;  1TNX A;  4IJ7 A;  2JXC A;  3FS7 A;  3O6B A;  1DEL A;  2MRD A;  2M9G A;  1C7V A;  3BFH A;  1JF2 A;  3I5I C;  1J7O A;  5GQQ C;  2ZN9 A;  1V1F A;  1GJY A;  3I5G B;  1ZUZ A;  1FPW A;  2FJY A;  1NCZ A;  1QIV A;  1SNL A;  2KFH A;  1NP8 A;  1IJ6 A;  2BBN A;  2M7L A;  1DC1 A;  1BMO A;  2L51 A;  3OB1 B;  1K93 D;  2BKI B;  2YGU A;  4P5O E;  2BCA A;  4C0J A;  2LC5 A;  2QAC A;  2WC6 A;  3FWB A;  3CZT X;  3VB1 A;  1K8U A;  4FTG A;  1ODB A;  2JC2 A;  2JU0 A;  1JC2 A;  4A4C A;  3KEV A;  1D1O A;  2BE4 A;  3CR5 X;  3EVR A;  4PCW A;  3GOF A;  1SKT A;  2PAL A;  4L9M A;  3WXA A;  1CFF A;  2L2C A;  1NYA A;  2AUC A;  1CM4 A;  1IKU A;  1J7Q A;  1TCO B;  4JPZ B;  1J55 A;  1W7J B;  3L4L A;  1G33 A;  2TN4 A;  4MSP A;  1S6C A;  1JF0 A;  1ZOT B;  1PK0 D;  1QTX A;  3BUX B;  3QRX A;  2BE6 A;  4HSZ A;  1YUU A;  3O2P A;  4IL1 A;  2HPS A;  5ER4 X;  1CLB A;  4MZK A;  5CSN A;  4PAL A;  2BCB A;  4PHM A;  1RFJ A;  1NX1 A;  1OE9 B;  3IF7 A;  1OMV A;  2NCO A;  1FI6 A;  3IQO A;  1XFU O;  1NX0 A;  1Y0V H;  1Z4H A;  3NSL A;  1KK8 C;  3CTN A;  1M31 A;  1KFX L;  2KGB C;  3I5H C;  3S0B A;  4YBH B;  1B4C A;  2JT8 A;  3DZT A;  1MR8 A;  2M97 A;  1S6I A;  3KHE A;  1LKJ A;  1N65 A;  4MLW A;  2H2K A;  5I2L A;  2D8N A;  3B7A A;  3GK2 A;  2L50 A;  3JVT B;  1CFD A;  2L5Y A;  2I94 A;  2OS8 C;  1Y1X A;  3FWC A;  1XFY O;  5HL1 A;  1FW4 A;  2O5G A;  1H8B A;  1BU3 A;  1R6P A;  3D77 A;  3Q8I A;  3MSE B;  2MBX A;  3BOW B;  1OZS A;  1QS7 A;  1SL8 A;  4A4B A;  2H61 C;  4HRH A;  3VRO A;  3EG5 B;  2NCP A;  3CR2 A;  4E68 A;  1TNP A;  1B47 A;  1BR1 B;  3I5F C;  1CB1 A;  3JTD C;  3BFA A;  3E3R A;  3TDI A;  4F0Z B;  5HYD A;  1Z2C B;  3CYZ A;  3D75 A;  4ICB A;  1NCY A;  2ISD A;  1FI5 A;  1LVC D;  3EK4 A;  2JTZ A;  1S6J A;  4MZL A;  3FE6 A;  4NDB A;  4FQO A;  2FJU B;  3BOW A;  3S0E A;  4NQG A;  1J1D A;  1XFX O;  2WCH A;  2LUC A;  1KCY A;  1SY9 A;  2K7B A;  2ZND A;  5EL2 A;  3DYE A;  2KSP A;  1OMR A;  2JPO A;  4JQ0 D;  3R1O A;  3LK0 A;  1CKK A;  2QEB A;  3AAJ A;  5D69 A;  1B8R A;  1LA0 A;  1SR6 C;  1WLM A;  1KWO B;  1QLS A;  4YRU A;  1BOD A;  2F3Y A;  4AOM A;  1TNW A;  1M63 B;  2Y5I A;  1TRF A;  3BQ3 A;  1SPY A;  1OOF A;  5HLO A;  1SW8 A;  5DKQ A;  2EGD A;  2HQ8 A;  1SCM B;  2KQY A;  3PFV A;  1NIW A;  3CZ0 A;  3NGV A;  5BPJ A;  1IWQ A;  2GGZ A;  2CCM A;  5FI7 A;  1EXR A;  1UHJ A;  2KFF A;  2WCB A;  2NXQ A;  1DJG A;  3FE9 A;  1MXL C;  3I5I B;  5HKZ A;  2M49 B;  3GK4 X;  3PM2 A;  1BR4 B;  3EVU A;  3TS5 C;  2JPT A;  2NZ0 A;  1B8L A;  1KK7 Z;  2QEV A;  4N1G A;  2COL B;  3EK7 A;  3GK1 A;  1EG3 A;  1LIN A;  2KI6 C;  2L4I A;  1KFU L;  3O4Y A;  2LAN A;  1DTL A;  2VRG A;  5I8N A;  2HET A;  4GAO A;  2KPH A;  1M46 A;  5FI6 A;  1CTR A;  1M39 A;  1PUL A;  2ZFD A;  3A8R A;  2E6W A;  3NSK A;  3SG2 A;  5KTY A;  5KU1 A;  2FCE A;  1DT7 B;  1CDL A;  1WDC C;  2P6B B;  1AJ5 A;  1JUO A;  1YRU B;  1DVI A;  2PRU A;  1CM1 A;  3CGA A;  3S0A A;  3D74 A;  3PN7 C;  4YI9 A;  1UHH A;  1B9A A;  1SYM A;  1XK4 A;  2GGM A;  3NSI A;  4GUK A;  5AXI A;  3ICB A;  3TDU A;  4ZCU A;  4PE7 A;  3VRN A;  1CMF A;  1OOJ A;  2L98 A;  2L5X B;  3O78 A;  1GQM A;  2K60 A;  3RLZ A;  2AAO A;  3LCP C;  2I2R E;  2MHH A;  2WCF A;  1KSM A;  2JWW A;  2OTG C;  3HCM A;  1WRZ A;  3SG3 A;  1HQV A;  2JTT A;  2E30 A;  2KLD A;  3IVT A;  1BLQ A;  1H4B A;  4YI8 A;  3AKB A;  1C07 A;  1CNP A;  1EJ3 A;  2G2B A;  2BBM A;  2CBL A;  4I5N B;  1Q80 A;  1QX7 A;  3DVK A;  1K9P A;  1AHR A;  2KDH A;  3S0G A;  3PSR A;  1UHK A;  3C1V A;  4OVN F;  4MEW A;  3V2L A;  4QJ3 B;  5HLV A;  4BY4 A;  2M8U A;  4MRY A;  1CMG A;  3PJI A;  5CSF A;  3B86 A;  4GGF C;  1EH2 A;  4DS7 A;  3WHU B;  4D1E A;  5I94 A;  1CLL A;  1XVJ A;  2PSR A;  4I5L B;  1KQM B;  2BEC A;  1S1E A;  2KBI A;  4ORC B;  3CDN A;  1TNQ A;  1YVH A;  1IG5 A;  3OX6 A;  1F70 A;  1S3P A;  3DXL A;  1TUZ A;  2QEH A;  2G9B A;  4OZD A;  5I2O A;  2AMI A;  2BL0 C;  3DVM A;  3S0D A;  2F2P A;  5PAL A;  3UO9 A;  4CID A;  1BF5 A;  1T14 A;  1A4P A;  2DOQ A;  2LLS A;  3D0Y B;  3EKH A;  5AER A;  2B1U A;  4ORA B;  3IQQ A;  1IIO A;  1DJI A;  1OOH A;  4PT1 A;  1ZMZ A;  3JTD B;  3K21 A;  4F7F A;  1MXE A;  2LE9 B;  1KFU S;  1DJY A;  1L2O B;  4PE4 A;  1FF1 A;  1TUJ A;  1QAS A;  2M1K B;  2QEO A;  1U5I B;  3SJS A;  4CPV A;  1E8A A;  3D76 A;  4INX A;  5CSI A;  2H61 A;  4ETO A;  3D0Y A;  2WCM A;  2ZRT A;  4PDZ A;  1IJ5 A;  3OP0 A;  4WQ2 A;  1OOI X;  1K90 D;  2MJW B;  2F33 A;  1REC A;  2ZNE A;  2HF5 A;  4PE0 A;  2KYC A;  2M1U A;  4QJ5 B;  2KFG A;  4QJ4 B;  1AVS A;  1DJZ A;  1S26 D;  1RWY A;  1OOG A;  3N7H A;  2WCL A;  2KYF A;  1U5I A;  2GV5 A;  5AAN A;  2L2E A;  2KAV A;  3KF9 A;  2Y1N A;  1SSE B;  2LM5 A;  1NPQ A;  2KQ6 A;  3VRQ A;  2KHN A;  1SL7 A;  1IQ3 A;  1ALV A;  5D3O A;  1YUR A;  2WOR A;  3NXA A;  5DKR A;  1N0Y A;  1HT9 A;  1DMO A;  2LAP A;  3PM8 A;  1RRO A;  1NX2 A;  2PAS A;  4CLN A;  2LVK A;  2ZN8 A;  4PHJ A;  3AAK A;  1GM0 A;  1C7W A;  2GTE A;  2V53 A;  4M2P A;  3EVV A;  5CPV A;  3TDZ A;  3TS5 B;  4M2Q A;  3OHM B;  3BUN B;  1S5G Y;  4I5J A;  1TCF A;  4NDD A;  2KI4 B;  3FE8 A;  4PHK A;  3SG6 A;  1A2X A;  4HRE E;  1SRA A;  4XYN A;  3BUO B;  4TNC A;  1JWD A;  3F45 A;  1KK7 Y;  2LLU A;  5IBW A;  2K8M B;  5DKN A;  1M45 A;  1W9Z A;  5ER5 A;  1ZAC A;  2LVV A;  2OPO A;  2EHB A;  2JXL A;  2LVJ A;  4U8D A;  4BY5 A;  1S5G Z;  1F54 A;  1WDC B;  3M0W A;  1F4O A;  4CFR A;  3PN7 B;  3CZ2 A;  2F2O A;  2O60 A;  1PVA A;  2MA2 A;  2P71 A;  1KFX S;  1QXP A;  4GFT A;  1TOP A;  3ZWH A;  2KNE A;  1NWD A;  2FCD A;  3SG4 A;  2OTG B;  1QWV A;  1UP5 A;  4DUQ A;  4I5K A;  1TWO A;  1WY9 A;  3PAT A;  3VGO A;  2R2I A;  4P2Y B;  5AFP A;  3S0F A;  1UHN A;  2F8P A;  4OCI A;  1VRK A;  1JFK A;  1QX2 A;  1DJW A;  2RGI A;  3TZ1 A;  1BJF A;  1DGV A;  1RTP 1;  2LP2 A;  1A03 A;  4R1E A;  4DRW A;  1B7T Y;  1PVB A;  3D10 A;  1YVL A;  3R1P A;  2L0P A;  2JZI A;  2HQW A;  4YGA A;  1NX3 A;  1SMG A;  3O4X A;  4JWQ A;  3RZS A;  1G8I A;  1P28 A;  2ERB A;  2KAX A;  3EKJ A;  1MHO A;  3KO0 A;  4HRG A;  2MLF C;  1YX8 A;  3OX5 A;  1C3Z A;  3K1E A;  2LVI A;  4M2O A;  2LMV A;  3OB2 B;  2QDI A;  1UUS A;  3SS4 A;  2WC8 A;  1B7T Z;  4ORB B;  2M3W A;  2Y1M A;  1IGV A;  1QVI Y;  1TN4 A;  1KSO A;  5K89 A;  3FIA A;  1LXF C;  1QJT A;  1XO5 A;  1SL9 A;  2JNF A;  4PHN A;  2WOS A;  1KK8 B;  2JT3 A;  3DD4 A;  4OR9 B;  1PSB A;  1QLK A;  2EC6 C;  5JJG A;  4YGD B;  1BT6 A;  1B1G A;  3I5H B;  3WHT B;  4FQT A;  5HKW A;  2BNX A;  1CFC A;  3DVE A;  3SG7 A;  1CDN A;  2MAZ A;  1OMD A;  1QVI Z;  1XFW O;  1QV1 A;  2JT0 A;  2LLT A;  3DF0 B;  3SS5 A;  3SG5 A;  1YRT B;  1AJ4 A;  3SS3 A;  2M0R A;  2OS8 B;  2PMY A;  1AK8 A;  2PYQ A;  1XK4 C;  3TUY C;  2IS9 A;  3HX4 A;  2SAS A;  3BJH A;  5TNC A;  3VRP A;  4ZCV A;  1QV0 A;  1OSA A;  3D73 A;  3R1V A;  1YR5 A;  2LHL A;  2CT9 A;  3DF0 A;  4GGN A;  3I5F B;  1TTX A;  2K61 A;  1S36 A;  3DVJ A;  4MRX A;  2LP3 A;  3CS1 A;  4C0L A;  1F55 A;  1PAL A;  2KOT A;  3CWG A;  2JRF A;  1ORG A;  1MQ1 A;  1OQP A;  2BAP A;  5KSZ A;  4NDC A;  3I5G C;  3SIB A;  5JOL A;  1Y1U A;  1GGZ A;  1DF0 B;  1B8C A;  2CNP A;  1K9U A;  3VRR A;  2KBM A;  1DQE A;  2QPT A;  1XFZ O;  4MBE A;  2I18 A;  2H8V A;  2WCJ A;  4MN0 A;  1DJX A;  2K7D A;  1QX5 B;  4GNK B;  1SR6 B;  3EK8 A;  2PQL A;  3PLF B;  4AQJ A;  2KAY A;  5DIC A;  1OZO A;  4MVF A;  1SCV A;  2Y4Q A;  1AP4 A;  4XJK B;  3LL8 B;  3H4S E;  1DF0 A;  3BUW B;  3R72 A;  4WRI A;  1YUS A;  2WCK A;  1YTZ C;  4YGB B;  2M7N A;  1F71 A;  4INW A;  1KQM C;  1MUX A;  1IQ5 A;  1NCX A;  1WRK A;  4GBA A;  3BUM B;  2K2A A;  5HKY A;  2NLN A;  2WC5 A;  1J7P A;  1IH0 A;  1F4Q A;  5FYX A;  1CDP A;  1ZFS A;  4DCK A;  3CR4 X;  5FI2 A;  4CFQ A;  3PAL A;  3SIA A;  1JBA A;  1RJV A;  3L47 A;  1A75 B;  1XFR A;  1MWN A;  4XJK A;  2M29 A;  2KGR A;  1A29 A;  1J1E A;  2BCX A;  1UUR A;  4YGC B;  1EG4 A;  1UWO A;  1PRW A;  1CDM A;  1K94 A;  5B8I B;  1DJH A;  1DGU A;  1SK6 D;  2PVB A;  4AQI A;  2WND A;  2BKH B;  1L2O C;  2CTN A;  2I7A A;  2FOT A;  4PE1 A;  3WNX B;  3L4A A;  3KPX A;  1A75 A;  2LMT A;  1TIZ A;  2A4J A;  2ZKM X;  2Q91 A;  3B6X A;  3JVT C;  3OBV A;  1JFJ A;  4JKT A;  2LHI A;  1GGW A;  1K2H A;  1YUT A;  1Y6W A;  3AKA A;  2K2F A;  4N5X A;  4Q04 A;  5G08 A;  1LS8 A;  1PSR A;  3A4U B;  1K96 A;  1DEK A;  3QME A;  1BG1 A;  1Y1A A;  1ALW A;  2LMU A;  1XYD A;  5D7F A;  1G4Y R;  2Q4U A; 
#chains in the Genus database with same CATH homology
 1CFP A;  4GPL B;  2F3Z A;  1F8H A;  4USL A;  1BOC A;  2LCP A;  4OKH A;  1MF8 B;  5F6T A;  2WCE A;  1K95 A;  2MLE C;  4MZJ A;  1N2D A;  3RM1 A;  1V1G A;  2ZRS A;  1LA3 A;  2SCP A;  2K0J A;  1SBJ A;  1NSH A;  2EC6 B;  1FBV A;  2L4H A;  4OV2 A;  1XFV O;  1K9K A;  1WLZ A;  3BYA A;  1UHI A;  5CSJ A;  1QAT A;  1NUB A;  1CLM A;  3ZNI A;  1EL4 A;  1QIW A;  4YGE B;  4UPG A;  3NSO A;  2K7C A;  2LV7 A;  1AUI B;  1X02 A;  3LLE A;  1W7I B;  5AEQ A;  2JOJ A;  1RK9 A;  2LUX A;  1J7R A;  1YX7 A;  1WRL A;  5I2Q A;  1XA5 A;  1JSA A;  1R2U A;  3LK1 A;  2KI4 C;  2KI6 D;  1IRJ A;  1KWO C;  3TUY B;  2CXJ A;  2JQ6 A;  4WQ3 A;  1KQV A;  1L7Z A;  5J3X A;  2JNX A;  2JUL A;  3CLN A;  2BL0 B;  4C0K A;  1SCM C;  4GGF A;  2K7O A;  4DIR A;  3BXK A;  2LNK A;  4N1F A;  1TNX A;  2JXC A;  3FS7 A;  3O6B A;  2MRD A;  2M9G A;  1C7V A;  1JF2 A;  3I5I C;  1J7O A;  5GQQ C;  2ZN9 A;  1V1F A;  1GJY A;  3I5G B;  1ZUZ A;  1FPW A;  1NCZ A;  1QIV A;  1SNL A;  2KFH A;  1NP8 A;  1IJ6 A;  2BBN A;  2M7L A;  1BMO A;  2L51 A;  3OB1 B;  1K93 D;  2BKI B;  4P5O E;  2BCA A;  4C0J A;  2LC5 A;  2QAC A;  3FWB A;  3CZT X;  1K8U A;  4FTG A;  1ODB A;  2JC2 A;  2JU0 A;  1JC2 A;  4A4C A;  3KEV A;  1D1O A;  2BE4 A;  3CR5 X;  3EVR A;  4PCW A;  3GOF A;  1SKT A;  2PAL A;  4L9M A;  3WXA A;  1CFF A;  1NYA A;  2AUC A;  1CM4 A;  1IKU A;  1J7Q A;  1TCO B;  4JPZ B;  1J55 A;  1W7J B;  1G33 A;  2TN4 A;  4MSP A;  1S6C A;  1JF0 A;  1ZOT B;  1PK0 D;  1QTX A;  3BUX B;  3QRX A;  2BE6 A;  4HSZ A;  1YUU A;  3O2P A;  4IL1 A;  2HPS A;  5ER4 X;  1CLB A;  4MZK A;  5CSN A;  4PAL A;  2BCB A;  4PHM A;  1RFJ A;  1NX1 A;  1OE9 B;  3IF7 A;  1OMV A;  2NCO A;  1FI6 A;  3IQO A;  1XFU O;  1NX0 A;  1Y0V H;  3NSL A;  1KK8 C;  3CTN A;  1M31 A;  1KFX L;  2KGB C;  3I5H C;  4YBH B;  1B4C A;  2JT8 A;  1MR8 A;  2M97 A;  1S6I A;  3KHE A;  1LKJ A;  1N65 A;  4MLW A;  2H2K A;  5I2L A;  2D8N A;  3GK2 A;  2L50 A;  3JVT B;  1CFD A;  2I94 A;  2OS8 C;  1Y1X A;  3FWC A;  1XFY O;  1FW4 A;  2O5G A;  1H8B A;  1BU3 A;  1R6P A;  3MSE B;  2MBX A;  3BOW B;  1OZS A;  1QS7 A;  1SL8 A;  4A4B A;  2H61 C;  4HRH A;  3VRO A;  2NCP A;  3CR2 A;  4E68 A;  1TNP A;  1B47 A;  1BR1 B;  3I5F C;  1CB1 A;  3JTD C;  3E3R A;  3TDI A;  4F0Z B;  5HYD A;  4ICB A;  1NCY A;  2ISD A;  1FI5 A;  1LVC D;  3EK4 A;  2JTZ A;  1S6J A;  4MZL A;  4NDB A;  4FQO A;  2FJU B;  3BOW A;  4NQG A;  1J1D A;  1XFX O;  2LUC A;  1KCY A;  1SY9 A;  2K7B A;  2ZND A;  2KSP A;  1OMR A;  4JQ0 D;  3LK0 A;  1CKK A;  3AAJ A;  5D69 A;  1B8R A;  1LA0 A;  1SR6 C;  1WLM A;  1KWO B;  1QLS A;  4YRU A;  1BOD A;  2F3Y A;  4AOM A;  1TNW A;  1M63 B;  2Y5I A;  1TRF A;  3BQ3 A;  1SPY A;  5HLO A;  1SW8 A;  5DKQ A;  2EGD A;  2HQ8 A;  1SCM B;  2KQY A;  3PFV A;  1NIW A;  5BPJ A;  1IWQ A;  2GGZ A;  2CCM A;  1EXR A;  1UHJ A;  2KFF A;  2WCB A;  2NXQ A;  1DJG A;  1MXL C;  3I5I B;  5HKZ A;  2M49 B;  3GK4 X;  1BR4 B;  3EVU A;  3TS5 C;  2JPT A;  2NZ0 A;  1B8L A;  1KK7 Z;  4N1G A;  2COL B;  3EK7 A;  3GK1 A;  1EG3 A;  1LIN A;  2KI6 C;  2L4I A;  1KFU L;  3O4Y A;  2LAN A;  1DTL A;  2VRG A;  5I8N A;  2HET A;  4GAO A;  1M46 A;  1CTR A;  1M39 A;  1PUL A;  2ZFD A;  3A8R A;  2E6W A;  3NSK A;  3SG2 A;  5KTY A;  5KU1 A;  2FCE A;  1DT7 B;  1CDL A;  1WDC C;  2P6B B;  1AJ5 A;  1JUO A;  1YRU B;  1DVI A;  2PRU A;  1CM1 A;  3CGA A;  3PN7 C;  4YI9 A;  1UHH A;  1B9A A;  1SYM A;  1XK4 A;  2GGM A;  3NSI A;  4GUK A;  5AXI A;  3ICB A;  3TDU A;  4ZCU A;  4PE7 A;  3VRN A;  1CMF A;  1OOJ A;  2L98 A;  2L5X B;  3O78 A;  1GQM A;  3RLZ A;  2AAO A;  3LCP C;  2I2R E;  2MHH A;  2WCF A;  1KSM A;  2JWW A;  2OTG C;  3HCM A;  1WRZ A;  3SG3 A;  1HQV A;  2JTT A;  2E30 A;  1BLQ A;  1H4B A;  4YI8 A;  3AKB A;  1C07 A;  1CNP A;  1EJ3 A;  2G2B A;  2BBM A;  2CBL A;  4I5N B;  1Q80 A;  1QX7 A;  3DVK A;  1K9P A;  1AHR A;  2KDH A;  3PSR A;  1UHK A;  3C1V A;  4OVN F;  4MEW A;  4QJ3 B;  5HLV A;  4BY4 A;  2M8U A;  4MRY A;  1CMG A;  5CSF A;  4GGF C;  1EH2 A;  4DS7 A;  3WHU B;  4D1E A;  1CLL A;  1XVJ A;  2PSR A;  4I5L B;  1KQM B;  2BEC A;  1S1E A;  2KBI A;  4ORC B;  1TNQ A;  1YVH A;  1IG5 A;  3OX6 A;  1F70 A;  1S3P A;  5I2O A;  2G9B A;  2AMI A;  2BL0 C;  3DVM A;  4CID A;  2F2P A;  5PAL A;  1BF5 A;  1A4P A;  2DOQ A;  2LLS A;  3D0Y B;  3EKH A;  5AER A;  2B1U A;  4ORA B;  3IQQ A;  1DJI A;  1ZMZ A;  3JTD B;  3K21 A;  1MXE A;  2LE9 B;  1KFU S;  1DJY A;  1L2O B;  4PE4 A;  1FF1 A;  1QAS A;  2M1K B;  1U5I B;  3SJS A;  4CPV A;  1E8A A;  5CSI A;  4ETO A;  2H61 A;  3D0Y A;  2ZRT A;  4PDZ A;  1IJ5 A;  3OP0 A;  4WQ2 A;  1K90 D;  2MJW B;  2F33 A;  1REC A;  2ZNE A;  2HF5 A;  4PE0 A;  2KYC A;  2M1U A;  4QJ5 B;  2KFG A;  4QJ4 B;  1AVS A;  1DJZ A;  1S26 D;  1RWY A;  5AAN A;  2KYF A;  1U5I A;  2GV5 A;  2L2E A;  2KAV A;  3KF9 A;  2Y1N A;  2LM5 A;  1NPQ A;  2KQ6 A;  3VRQ A;  2KHN A;  1SL7 A;  1IQ3 A;  1ALV A;  1YUR A;  2WOR A;  3NXA A;  5DKR A;  1N0Y A;  1HT9 A;  1DMO A;  2LAP A;  3PM8 A;  1RRO A;  1NX2 A;  2PAS A;  4CLN A;  2LVK A;  2ZN8 A;  4PHJ A;  3AAK A;  1C7W A;  2V53 A;  4M2P A;  5CPV A;  3EVV A;  3TDZ A;  3TS5 B;  4M2Q A;  3OHM B;  3BUN B;  1S5G Y;  4I5J A;  1TCF A;  4NDD A;  2KI4 B;  4PHK A;  3SG6 A;  1A2X A;  4HRE E;  1SRA A;  4XYN A;  3BUO B;  4TNC A;  1JWD A;  3F45 A;  1KK7 Y;  2LLU A;  5IBW A;  2K8M B;  5DKN A;  1M45 A;  5ER5 A;  1ZAC A;  2LVV A;  2OPO A;  2EHB A;  2JXL A;  2LVJ A;  4U8D A;  4BY5 A;  1S5G Z;  1F54 A;  1WDC B;  3M0W A;  1F4O A;  4CFR A;  3PN7 B;  2F2O A;  2O60 A;  1PVA A;  2MA2 A;  1KFX S;  1QXP A;  4GFT A;  1TOP A;  3ZWH A;  2KNE A;  1NWD A;  2FCD A;  3SG4 A;  2OTG B;  4DUQ A;  1UP5 A;  4I5K A;  1WY9 A;  3PAT A;  3VGO A;  2R2I A;  4P2Y B;  5AFP A;  1UHN A;  2F8P A;  4OCI A;  1VRK A;  1JFK A;  1QX2 A;  1DJW A;  2RGI A;  3TZ1 A;  1BJF A;  1DGV A;  1RTP 1;  2LP2 A;  1A03 A;  4R1E A;  4DRW A;  1B7T Y;  1PVB A;  3D10 A;  1YVL A;  2L0P A;  2JZI A;  2HQW A;  4YGA A;  1NX3 A;  1SMG A;  4JWQ A;  1G8I A;  2KAX A;  3EKJ A;  1MHO A;  3KO0 A;  4HRG A;  2MLF C;  1YX8 A;  3OX5 A;  2LVI A;  4M2O A;  2LMV A;  3OB2 B;  1UUS A;  2WC8 A;  1B7T Z;  4ORB B;  2M3W A;  2Y1M A;  1IGV A;  1QVI Y;  1TN4 A;  1KSO A;  5K89 A;  3FIA A;  1LXF C;  1QJT A;  1XO5 A;  1SL9 A;  2JNF A;  4PHN A;  2WOS A;  1KK8 B;  2JT3 A;  3DD4 A;  4OR9 B;  1PSB A;  1QLK A;  2EC6 C;  5JJG A;  4YGD B;  1BT6 A;  1B1G A;  3I5H B;  3WHT B;  5HKW A;  1CFC A;  3DVE A;  3SG7 A;  1CDN A;  2MAZ A;  1OMD A;  1QVI Z;  1XFW O;  1QV1 A;  2JT0 A;  2LLT A;  3DF0 B;  3SG5 A;  1YRT B;  1AJ4 A;  2M0R A;  2OS8 B;  2PMY A;  1AK8 A;  1XK4 C;  3TUY C;  2IS9 A;  3HX4 A;  2SAS A;  5TNC A;  3VRP A;  4ZCV A;  1QV0 A;  1OSA A;  1YR5 A;  2LHL A;  2CT9 A;  3DF0 A;  4GGN A;  3I5F B;  1TTX A;  2K61 A;  1S36 A;  3DVJ A;  4MRX A;  2LP3 A;  3CS1 A;  4C0L A;  1F55 A;  1PAL A;  2KOT A;  3CWG A;  2JRF A;  1MQ1 A;  1OQP A;  5KSZ A;  4NDC A;  3I5G C;  3SIB A;  5JOL A;  1Y1U A;  1GGZ A;  1DF0 B;  2CNP A;  1B8C A;  1K9U A;  3VRR A;  2KBM A;  2QPT A;  1XFZ O;  4MBE A;  2I18 A;  4MN0 A;  1DJX A;  2K7D A;  1QX5 B;  4GNK B;  1SR6 B;  3EK8 A;  3PLF B;  4AQJ A;  2KAY A;  1OZO A;  4MVF A;  1SCV A;  2Y4Q A;  1AP4 A;  4XJK B;  3LL8 B;  3H4S E;  1DF0 A;  3BUW B;  4WRI A;  1YUS A;  1YTZ C;  4YGB B;  2M7N A;  1F71 A;  1KQM C;  1MUX A;  1IQ5 A;  1NCX A;  1WRK A;  4GBA A;  3BUM B;  2K2A A;  5HKY A;  2NLN A;  1IH0 A;  1J7P A;  1F4Q A;  5FYX A;  1CDP A;  1ZFS A;  4DCK A;  3CR4 X;  4CFQ A;  3PAL A;  3SIA A;  1JBA A;  1RJV A;  1A75 B;  1MWN A;  4XJK A;  2M29 A;  2KGR A;  1A29 A;  1J1E A;  2BCX A;  1UUR A;  4YGC B;  1EG4 A;  1UWO A;  1PRW A;  1CDM A;  1K94 A;  5B8I B;  1DJH A;  1DGU A;  1SK6 D;  2PVB A;  4AQI A;  2WND A;  2BKH B;  1L2O C;  2CTN A;  2I7A A;  2FOT A;  4PE1 A;  3WNX B;  3KPX A;  1A75 A;  2LMT A;  1TIZ A;  2A4J A;  2ZKM X;  2Q91 A;  1JFJ A;  3JVT C;  2LHI A;  1GGW A;  1K2H A;  1YUT A;  1Y6W A;  3AKA A;  2K2F A;  4N5X A;  4Q04 A;  5G08 A;  1PSR A;  3A4U B;  1K96 A;  1BG1 A;  1Y1A A;  1ALW A;  2LMU A;  1XYD A;  5D7F A;  1G4Y R;  2Q4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...