1CFPA

S100b (s100beta) nmr data was collected from a sample of calcium free protein at ph 6.3 and a temperature of 311 k and 1.7-6.9 mm concentration, 25 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords S100B
publication title The solution structure of the bovine S100B protein dimer in the calcium-free state.
pubmed doi rcsb
source organism Bos taurus
total genus 23
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cfpA00
3KHEA 3ZNIA 2FJUB 1H8BA 5I2LA 1EXRA 1A03A 1HQVA 1WRLA 2O60A 2WORA 5HYDA 2P6BB 2R2IA 4NDCA 3LCPC 2LM5A 4C0KA 3TS5C 1KK7Z 3AKBA 2FCDA 1NX0A 1R6PA 3FS7A 1AJ5A 2PALA 4PHNA 1TNQA 1TNWA 2BBMA 2SCPA 2PRUA 2WOSA 1CFDA 2SASA 1KFXL 2ZKMX 4M2QA 3I5FB 3QRXA 1KK8B 1R2UA 4BY5A 1XFYO 1ZACA 2WCBA 5AFPA 2LLTA 3LLEA 1QVIY 2H61A 1WRZA 2JWWA 3EVRA 3BUWB 4MRXA 5ER5A 5BPJA 1WDCB 1AP4A 1B4CA 1BT6A 3JTDC 3KF9A 2AMIA 2A4JA 1CDLA 1CTRA 1LINA 2I94A 2JNXA 4HREE 1SR6C 4YI9A 1JFJA 2H2KA 2I18A 3EVUA 1CDMA 2LVKA 1KFUL 3NSOA 3SJSA 1JFKA 1K9KA 3E3RA 1GJYA 4MBEA 1JSAA 3NSIA 1CLBA 3VRPA 5I8NA 2M8UA 1K95A 1IQ3A 2BKIB 4GFTA 2OS8B 1QVIZ 1NYAA 2CT9A 3TUYC 3A4UB 1XYDA 1SK6D 1KSOA 2BL0C 1TN4A 1PVAA 1RFJA 4OCIA 2LMTA 3OHMB 4CLNA 1M39A 1EH2A 1CB1A 1BLQA 2JXCA 4I5NB 4JPZB 1XK4A 1A2XA 1BMOA 4PE1A 1ODBA 4DCKA 4IL1A 2M1KB 3BUXB 2K61A 4OKHA 2F33A 2JZIA 2G9BA 1WY9A 2KOTA 1Q80A 5CSFA 1PALA 2G2BA 3VGOA 1YUUA 1F4OA 1G33A 2FCEA 2HF5A 4MLWA 2K7DA 5IBWA 1B7TY 1SKTA 1YURA 1B9AA 1KQMC 3DF0A 1BU3A 2JOJA 1IJ5A 4GUKA 1QX2A 1MUXA 2K2AA 1UUSA 1BOCA 3BUOB 1UHIA 1BG1A 1SL7A 3FWBA 1ALWA 5DKRA 2IS9A 2KSPA 3SG5A 2COLB 2MLEC 3TDZA 1S6IA 1FBVA 3KEVA 4F0ZB 4AQJA 4Q04A 1DJGA 1UP5A 2OTGC 1B7TZ 3IQQA 3TDUA 1IQ5A 2LUXA 4ZCVA 1CMGA 3BUNB 4YGBB 4WQ2A 1DJYA 4MZKA 1MF8B 2L0PA 2JU0A 2K7OA 2KNEA 2HQ8A 2L50A 4GGFC 1MXEA 1OMVA 2L5XB 3DVKA 4WQ3A 2KI6D 5B8IB 4ZCUA 3SG6A 1KQVA 1W7JB 3D10A 1S3PA 1NSHA 1CM4A 2KDHA 3PN7C 4N5XA 1X02A 1OZSA 1KFXS 1RTP1 2L98A 4WRIA 3PATA 1C7WA 3NXAA 1K9PA 1QIWA 1QTXA 1SMGA 5J3XA 1J7OA 1IWQA 2WNDA 3LK1A 2BL0B 1M45A 2MAZA 3EVVA 3PALA 1AK8A 3LK0A 5HKWA 4YI8A 1MWNA 2LVJA 1UWOA 4YGEB 1AUIB 5CSNA 2AAOA 4AQIA 1QJTA 2KGBC 1M63B 2Y1NA 3PFVA 2KAYA 2LUCA 2PASA 2DOQA 3OP0A 4ORBB 1KSMA 2V53A 1S6CA 3M0WA 4MRYA 1XFXO 1XO5A 2K7BA 1K96A 3DVMA 1KWOB 1SW8A 1ZOTB 4PE7A 5F6TA 1Y6WA 4CPVA 1F55A 3I5HC 2F2OA 1QIVA 1J7RA 2GGZA 2LP2A 3BOWA 2F3ZA 1IJ6A 1RROA 2KFFA 2LAPA 4PE4A 4MEWA 1XFVO 2ZRSA 4I5LB 1Y1UA 2CBLA 2JXLA 2ZNDA 1PVBA 3AKAA 1A75A 2KAVA 1GGZA 1F4QA 1MHOA 4MZLA 1L2OC 5JJGA 2ZNEA 1JF2A 2TN4A 1PSRA 1FPWA 5DKQA 3CS1A 2KBMA 2F3YA 2JULA 2LC5A 1OOJA 2KYFA 3AAJA 4FTGA 3I5GC 4U8DA 1XA5A 1OZOA 1CFFA 4ORAB 4NDDA 3DF0B 1CNPA 2L2EA 1G4YR 1B47A 3SIAA 1W7IB 1QX5B 2F2PA 2LANA 4AOMA 1SNLA 1U5IA 3DVJA 2JT0A 3SG4A 1K90D 2AUCA 2M7LA 1CDNA 1SCMC 1YRTB 4HRHA 3PLFB 2Y5IA 1J55A 3I5IB 3JVTB 1NPQA 4GNKB 3RLZA 1NCYA 1K8UA 2EC6B 1CM1A 3CTNA 1IG5A 4ETOA 2KI4C 2ZFDA 3CLNA 2LP3A 3EK7A 1DGUA 2WCEA 3D0YB 4M2OA 2D8NA 1JF0A 2HQWA 5D7FA 2MRDA 1CKKA 1C07A 3WNXB 4PHKA 4OV2A 2MBXA 2GV5A 4NQGA 1QLSA 4JWQA 1S36A 1OMRA 3O78A 5AANA 1M31A 1NIWA 3EK8A 3TS5B 1DMOA 1DTLA 4MZJA 4PDZA 2LMVA 1JUOA 1QV0A 1UHKA 1NX3A 3GK1A 1S6JA 1DF0B 5D69A 5GQQC 2KQYA 2L4HA 1FI6A 2KGRA 4PCWA 2BBNA 2BKHB 4GBAA 1YVLA 2KBIA 2E6WA 4GGFA 2KHNA 3I5FC 1KK8C 4UPGA 1K93D 4HSZA 1SL8A 1V1GA 5I2QA 1TCOB 2JTZA 3A8RA 4ICBA 3CWGA 4BY4A 3WHUB 1S26D 3EKJA 1TIZA 1N2DA 1ZMZA 1J7QA 1QX7A 1V1FA 3BXKA 5CSIA 3HCMA 3ZWHA 1WDCC 1NCXA 5AXIA 4E68A 1L7ZA 1NP8A 2KFGA 4MN0A 1IKUA 1JBAA 3JTDB 1A4PA 1OSAA 2CXJA 1RWYA 1WRKA 2OPOA 4PE0A 4DIRA 2JRFA 1SR6B 1N0YA 5FYXA 4D1EA 4ORCB 1YUTA 2BECA 3OX5A 1NWDA 2ISDA 4DS7A 1DJIA 3BOWB 2OS8C 1WLMA 1TNPA 3BUMB 3FIAA 1TCFA 2JPTA 2F8PA 2KYCA 3H4SE 3TUYB 2M7NA 1D1OA 4I5KA 4PHJA 1UHJA 2Q4UA 1M46A 3OB2B 2CCMA 2JT8A 3KPXA 1EG4A 1ZUZA 4CFRA 1OMDA 1NCZA 1Y1XA 2K2FA 5AEQA 2LE9B 2LMUA 1BJFA 3VRQA 1B8RA 1B8LA 2O5GA 4M2PA 1OQPA 1PSBA 1CFPA 2M49B 2B1UA 2ZN9A 3IF7A 1GQMA 5DKNA 1IGVA 5TNCA 3WXAA 3SG3A 1UHHA 3C1VA 4L9MA 5CSJA 4OVNF 3OB1B 1KFUS 1RECA 2BE6A 1YRUB 4JQ0D 2MHHA 2M9GA 3O4YA 3K21A 1GGWA 2Y4QA 4A4BA 1YR5A 4NDBA 1EG3A 4YBHB 1SBJA 1JWDA 1U5IB 2PVBA 4XJKA 2JT3A 3FWCA 1QV1A 2EHBA 5KTYA 1SCVA 1XFWO 1XFZO 3GK2A 1CLLA 2MJWB 1KQMB 4GPLB 3CGAA 3IQOA 1LA0A 1UURA 2MLFC 3VRNA 3VRRA 4CIDA 3GK4X 1DVIA 2Q91A 5HKZA 1DJWA 1YTZC 1EL4A 4XYNA 1J7PA 3BQ3A 1ZFSA 2KI6C 4A4CA 1SY9A 1PK0D 2VRGA 1UHNA 1VRKA 1DT7B 4MSPA 1MXLC 5KSZA 4USLA 1BR4B 1CDPA 2NCOA 2GGMA 1G8IA 1RJVA 3DVEA 2KFHA 1RK9A 4TNCA 2OTGB 2WC8A 3O2PA 5KU1A 1SL9A 2BCBA 4QJ4B 1YVHA 1JC2A 1NX2A 2I7AA 2M1UA 2CTNA 2LLSA 2QACA 1E8AA 3NSLA 1MR8A 2BE4A 1QATA 5HLOA 1BODA 3NSKA 1K94A 1F70A 1A29A 2ZRTA 1IH0A 2H61C 3SIBA 3EK4A 3SG2A 3PN7B 1C7VA 3PSRA 2E30A 5G08A 1DJHA 5PALA 1KCYA 4YRUA 3TZ1A 3VROA 1TOPA 3RM1A 1PULA 2JC2A 2KQ6A 3CR5X 4YGDB 4QJ3B 1LA3A 4MVFA 1LVCD 2LV7A 1QXPA 3CR2A 1F71A 1K2HA 2Y1MA 4DRWA 3MSEB 1LXFC 4N1FA 4PHMA 1DGVA 1TRFA 2LCPA 3SG7A 1S5GY 2MA2A 1N65A 1KWOC 2I2RE 1B8CA 1WLZA 3GOFA 2BCAA 3AAKA 2LLUA 2LNKA 1XVJA 2HPSA 3I5HB 1S1EA 1LKJA 1NX1A 1YUSA 1YX8A 2L51A 2PSRA 4YGAA 2ZN8A 1CFCA 1DJXA 1F54A 1J1EA 1XK4C 4I5JA 1TTXA 3LL8B 1AHRA 3KO0A 1F8HA 2BCXA 2NXQA 4N1GA 2JQ6A 1IRJA 2M3WA 1QLKA 1ALVA 1FW4A 2CNPA 4YGCB 1L2OB 1S5GZ 3PM8A 2RGIA 3ICBA 2LVIA 4P5OE 2L4IA 1OE9B 1TNXA 3O6BA 1Y0VH 1SYMA 3BYAA 4CFQA 4XJKB 2LHLA 1BR1B 1BF5A 1CMFA 2WCFA 3I5GB 2M29A 1FI5A 1AJ4A 1PRWA 1DJZA 2HETA 1EJ3A 1QASA 2M97A 5ER4X 4C0JA 1J1DA 4FQOA 1YX7A 2JTTA 1A75B 1CLMA 3D0YA 1H4BA 2PMYA 2K8MB 2NLNA 2JNFA 3CZTX 5AERA 5HKYA 1QS7A 2K7CA 4P2YB 3DD4A 1MQ1A 2NCPA 3F45A 1B1GA 3OX6A 2M0RA 1K9UA 1SRAA 3TDIA 4C0LA 1KK7Y 5K89A 3I5IC 5CPVA 3JVTC 1SCMB 2NZ0A 3HX4A 1XFUO 4HRGA 3CR4X 1NUBA 2EC6C 1HT9A 1Y1AA 1DF0A 2K0JA 2EGDA 1SPYA 4GGNA 1AVSA 4DUQA 3EKHA 3WHTB 4PALA 2KAXA 5HLVA 4R1EA 4OR9B 5I2OA 5JOLA 2FOTA 2KI4B 4GAOA 1FF1A 4QJ5B 2LHIA 2LVVA 2QPTA
chains in the Genus database with same CATH superfamily
3KHEA 3ZNIA 2FJUB 1H8BA 5I2LA 1EXRA 1A03A 1HQVA 1WRLA 2O60A 2WORA 5HYDA 3B7AA 2P6BB 2R2IA 4NDCA 2P71A 3UNWA 3LCPC 2LM5A 4C0KA 3DXLA 3TS5C 3B86A 1KK7Z 2QEHA 3AKBA 2FCDA 1NX0A 1R6PA 3FS7A 4IJ7A 1AJ5A 2PALA 4PHNA 1TNQA 1TNWA 2BBMA 2SCPA 2PRUA 2WOSA 1CFDA 2SASA 1KFXL 2ZKMX 4M2QA 3I5FB 2WCHA 3QRXA 1KK8B 1R2UA 4BY5A 1XFYO 1ZACA 2WCBA 5AFPA 2LLTA 3LLEA 1QVIY 2H61A 1WRZA 2JWWA 3EVRA 3BUWB 4MRXA 5ER5A 3L4AA 5BPJA 1WDCB 1AP4A 1B4CA 1DEKA 1BT6A 3JTDC 3KF9A 1CDLA 1CTRA 1LINA 2A4JA 2AMIA 2I94A 2JNXA 4HREE 1SR6C 4YI9A 1JFJA 2H2KA 2I18A 3EVUA 3O4XA 1CDMA 2LVKA 1KFUL 3NSOA 1QWVA 3SJSA 1JFKA 1K9KA 3E3RA 1GJYA 4MBEA 1JSAA 3NSIA 5DICA 2WC5A 5I94A 1CLBA 3VRPA 5I8NA 2M8UA 1K95A 1IQ3A 2BKIB 4GFTA 1OOFA 2BAPA 2OS8B 1QVIZ 1NYAA 2CT9A 3TUYC 3A4UB 1XYDA 3DY9A 1SK6D 2ERBA 1KSOA 2BL0C 1TN4A 1PVAA 1RFJA 4OCIA 2LMTA 3OHMB 4CLNA 1LS8A 1M39A 1EH2A 1CB1A 1BLQA 2FJYA 2JXCA 4I5NB 4JPZB 1XK4A 1A2XA 1BMOA 3L4LA 1ODBA 4PE1A 4DCKA 4IL1A 2BNXA 2M1KB 3BUXB 2K61A 3NHTA 1GM0A 3S0FA 4OKHA 2F33A 2JZIA 3B6XA 3OGNA 2G9BA 1WY9A 2KOTA 1Q80A 5CSFA 3N7HA 3UO9A 1PALA 2G2BA 4FQTA 3VGOA 1YUUA 1F4OA 4F7FA 1G33A 2FCEA 2HF5A 4MLWA 2K7DA 5IBWA 1B7TY 1SKTA 1YURA 1B9AA 1KQMC 1IIOA 3V2LA 3DF0A 1BU3A 2JOJA 1IJ5A 4GUKA 1DC1A 1QX2A 1MUXA 3CDNA 5D3OA 2K2AA 1UUSA 1BOCA 3BUOB 1UHIA 1BG1A 1SL7A 3FWBA 1ALWA 5DKRA 2IS9A 2KSPA 2QEBA 2COLB 2MLEC 4KYNA 3SG5A 1S6IA 3TDZA 1FBVA 3KEVA 4F0ZB 3DZTA 4AQJA 4Q04A 1P28A 1DJGA 3B88A 1UP5A 2OTGC 1B7TZ 3IQQA 3TDUA 1IQ5A 2LUXA 4ZCVA 1CMGA 3PM2A 3BUNB 4YGBB 4WQ2A 1DJYA 2QEOA 4MZKA 1MF8B 2L0PA 2JU0A 2K7OA 2KNEA 2HQ8A 2L50A 4GGFC 1MXEA 3R1PA 1OMVA 2L5XB 3DVKA 4WQ3A 2KI6D 3R72A 5B8IB 4ZCUA 3SG6A 1KQVA 1W7JB 3D10A 1S3PA 1NSHA 3S0AA 1CM4A 2KDHA 3PN7C 4N5XA 1X02A 1OZSA 1KFXS 1RTP1 2L98A 4WRIA 3PATA 1C7WA 3NXAA 1K9PA 1QIWA 1QTXA 1SMGA 5J3XA 1J7OA 1IWQA 2WNDA 3LK1A 2BL0B 1M45A 2MAZA 3EVVA 3PALA 1AK8A 3LK0A 5HKWA 4YI8A 1MWNA 2LVJA 1UWOA 4YGEB 1AUIB 3D78A 5CSNA 2AAOA 4AQIA 1QJTA 2KGBC 1M63B 2Y1NA 3PFVA 2KAYA 2LUCA 2PASA 2DOQA 3OP0A 4ORBB 1KSMA 2V53A 1S6CA 3M0WA 3D75A 1XFXO 2WCLA 1XO5A 4MRYA 2K7BA 1K96A 3DVMA 1KWOB 1SW8A 5FI2A 1ZOTB 4PE7A 5F6TA 1Y6WA 4CPVA 1F55A 3I5HC 2F2OA 1QIVA 1SSEB 1J7RA 2GGZA 2LP2A 3BOWA 5EL2A 2F3ZA 1IJ6A 1RROA 2KFFA 2LAPA 4PE4A 4MEWA 1XFVO 2ZRSA 4I5LB 1OOIX 1Y1UA 2CBLA 2JXLA 2ZNDA 1PVBA 3AKAA 1A75A 2KAVA 2GTEA 1GGZA 1F4QA 1MHOA 4MZLA 1L2OC 5JJGA 2ZNEA 1JF2A 2TN4A 1PSRA 1FPWA 5DKQA 3CS1A 2KBMA 2F3YA 2JULA 2LC5A 1OOJA 2KYFA 3BFAA 2KPHA 3AAJA 4FTGA 3I5GC 1XFRA 4U8DA 1XA5A 1OZOA 1CFFA 4ORAB 4NDDA 3DF0B 1CNPA 2L2EA 1G4YR 3BJHA 1B47A 3SIAA 1W7IB 1QX5B 2F2PA 2LANA 3SS4A 4AOMA 1SNLA 1U5IA 3DVJA 2JT0A 3SG4A 1K90D 3S0BA 2AUCA 2M7LA 1CDNA 1SCMC 1YRTB 4HRHA 3PLFB 2Y5IA 1J55A 3I5IB 3JVTB 1NPQA 1C3YA 4GNKB 3RLZA 1NCYA 1K8UA 2EC6B 1CM1A 3Q8IA 3CTNA 2QDIA 1IG5A 2WC6A 4ETOA 2KI4C 2ZFDA 1ORGA 3CLNA 2LP3A 3EK7A 1DGUA 2WCEA 3D0YB 4M2OA 2D8NA 1JF0A 2HQWA 5D7FA 2MRDA 1CKKA 1C07A 3WNXB 3BFHA 4PHKA 3D76A 4OV2A 2MBXA 2GV5A 4NQGA 1QLSA 3S0GA 4JWQA 1S36A 1OMRA 3O78A 5AANA 1M31A 1NIWA 1OOGA 3EK8A 3TS5B 1DMOA 1DTLA 4MZJA 4PDZA 2LMVA 1JUOA 1QV0A 1UHKA 1NX3A 3GK1A 1S6JA 1DF0B 5D69A 5GQQC 2KQYA 2L4HA 1FI6A 2KGRA 4PCWA 2BBNA 2BKHB 4GBAA 1YVLA 2KBIA 2E6WA 3PJIA 4GGFA 2KHNA 3I5FC 1KK8C 4UPGA 2JPOA 1K93D 4HSZA 1SL8A 1V1GA 3BFBA 5I2QA 1TCOB 2JTZA 1DELA 3A8RA 4ICBA 3CWGA 4BY4A 3WHUB 1S26D 2PYQA 3EKJA 1TIZA 1N2DA 1ZMZA 1J7QA 1QX7A 1V1FA 3BXKA 5CSIA 3HCMA 3ZWHA 1WDCC 1NCXA 5AXIA 4E68A 1L7ZA 1NP8A 2KFGA 4MN0A 1IKUA 1JBAA 3JTDB 1A4PA 1OSAA 2CXJA 1RWYA 1WRKA 2OPOA 3D73A 4PE0A 2JRFA 4DIRA 1SR6B 1N0YA 5FYXA 4D1EA 4ORCB 1TUZA 1YUTA 2BECA 3OX5A 1NWDA 2ISDA 4DS7A 1DJIA 3R1OA 3DYEA 3BOWB 3S0EA 2OS8C 1WLMA 1TNPA 1W9ZA 3BUMB 1TCFA 2JPTA 2F8PA 2KYCA 3FIAA 3H4SE 3QMEA 3TUYB 2M7NA 1D1OA 3NHIA 4I5KA 4PHJA 1UHJA 2Q4UA 1M46A 3OB2B 2CCMA 2JT8A 3KPXA 1EG4A 1ZUZA 3FE6A 5HL1A 4CFRA 1OMDA 1NCZA 1Y1XA 2K2FA 5AEQA 2LE9B 2LMUA 1BJFA 4OZDA 3VRQA 1B8RA 1B8LA 2O5GA 2L2CA 4M2PA 1OQPA 1PSBA 1CFPA 2M49B 2B1UA 2ZN9A 3IF7A 1GQMA 5DKNA 1IGVA 5TNCA 3WXAA 3EG5B 3SG3A 1UHHA 3C1VA 3CABA 3D77A 4L9MA 4OVNF 3OB1B 5CSJA 1KFUS 4INXA 1RECA 2BE6A 3L47A 1YRUB 4JQ0D 2MHHA 2M9GA 3O4YA 3K21A 1GGWA 2Y4QA 4A4BA 2WCKA 3CZ1A 1YR5A 4NDBA 1EG3A 4YBHB 1SBJA 1JWDA 1U5IB 1DQEA 2PVBA 4XJKA 2JT3A 3FWCA 1QV1A 2EHBA 5KTYA 2WCMA 1SCVA 1XFWO 1XFZO 3GK2A 1CLLA 1T14A 2MJWB 1TUJA 1KQMB 4GPLB 3CGAA 3IQOA 1LA0A 2QEVA 1UURA 2MLFC 3VRNA 3VRRA 4CIDA 3GK4X 1DVIA 2Q91A 5HKZA 1DJWA 1YTZC 1EL4A 4XYNA 1J7PA 2L5YA 1OOHA 3BQ3A 1ZFSA 2KI6C 4A4CA 1SY9A 1PK0D 1C3ZA 1UHNA 1VRKA 2VRGA 1DT7B 4MSPA 1MXLC 5KSZA 4USLA 1BR4B 1CDPA 2NCOA 2GGMA 1G8IA 1RJVA 3DVEA 5FI7A 2KFHA 1RK9A 4TNCA 2OTGB 2WC8A 3O2PA 5KU1A 1SL9A 2BCBA 4QJ4B 1YVHA 2H8VA 1JC2A 1NX2A 2I7AA 2M1UA 2CTNA 2LLSA 2QACA 1E8AA 3NSLA 1MR8A 2BE4A 1QATA 2WCJA 5HLOA 3CZ2A 1BODA 2PQLA 1K94A 3NSKA 1F70A 1A29A 2ZRTA 1IH0A 2H61C 3SIBA 3EK4A 3SG2A 3PN7B 1C7VA 3PSRA 2E30A 5G08A 1DJHA 5PALA 1KCYA 4YRUA 3FE9A 3TZ1A 3VROA 1TOPA 3RM1A 2KLEA 1PULA 2JC2A 2KQ6A 3CR5X 4YGDB 4QJ3B 1LA3A 4MVFA 1LVCD 2LV7A 1QXPA 3CR2A 1F71A 1K2HA 2Y1MA 4DRWA 3SS3A 3MSEB 1LXFC 4N1FA 4PHMA 1Z4HA 1DGVA 1TRFA 3S0DA 2LCPA 2YGUA 3SG7A 1S5GY 2MA2A 1N65A 1KWOC 3D74A 2I2RE 2P70A 3IVTA 1B8CA 1WLZA 3RZSA 3GOFA 2BCAA 3AAKA 2LLUA 2LNKA 1XVJA 2HPSA 3I5HB 1S1EA 1LKJA 1NX1A 1YUSA 1YX8A 2L51A 2PSRA 4YGAA 2ZN8A 1CFCA 1DJXA 1F54A 1J1EA 1XK4C 4I5JA 1TTXA 3LL8B 3NGVA 4INWA 1AHRA 3KO0A 3R1VA 1F8HA 2BCXA 2NXQA 4N1GA 2JQ6A 1IRJA 2M3WA 4JKTA 1QLKA 1ALVA 1FW4A 2CNPA 4YGCB 1L2OB 3CZ0A 1S5GZ 3PM8A 2RGIA 3ICBA 2K60A 2LVIA 4P5OE 2L4IA 1OE9B 5FI6A 1TNXA 3O6BA 1Y0VH 1SYMA 3BYAA 4CFQA 4PT1A 4XJKB 2LHLA 1BR1B 1BF5A 1CMFA 2WCFA 3I5GB 2M29A 1FI5A 1AJ4A 1PRWA 1DJZA 2HETA 1EJ3A 1QASA 2M97A 5ER4X 4C0JA 1J1DA 4FQOA 1YX7A 2JTTA 1A75B 1CLMA 3D0YA 4JD9A 2PMYA 1H4BA 2K8MB 2NLNA 2JNFA 3CZTX 5AERA 5HKYA 1QS7A 2K7CA 4P2YB 3VB1A 3DD4A 1MQ1A 2NCPA 3F45A 3FE8A 1B1GA 3OBVA 3OX6A 2M0RA 1K9UA 1SRAA 2KLDA 3TDIA 4C0LA 1KK7Y 5K89A 3I5IC 5CPVA 3JVTC 1SCMB 2NZ0A 3HX4A 1XFUO 4HRGA 3CYZA 3CR4X 1Z2CB 1NUBA 2EC6C 1HT9A 1Y1AA 1DF0A 3K1EA 2K0JA 2EGDA 1SPYA 4GGNA 1AVSA 1OW4A 3EKHA 3WHTB 4DUQA 4PALA 2KAXA 5HLVA 4R1EA 4OR9B 3B87A 5I2OA 5JOLA 1TWOA 2FOTA 2KI4B 4GAOA 3SS5A 4QJ5B 1FF1A 2LHIA 2LVVA 2QPTA
chains in the Genus database with same CATH topology
3KHEA 3ZNIA 2FJUB 1H8BA 5I2LA 1EXRA 1A03A 1HQVA 1WRLA 2O60A 2WORA 5HYDA 2P6BB 2R2IA 4NDCA 3LCPC 2LM5A 4C0KA 3TS5C 1KK7Z 3AKBA 2FCDA 1NX0A 1R6PA 3FS7A 1AJ5A 2PALA 4PHNA 1TNQA 1TNWA 2BBMA 2SCPA 2PRUA 2WOSA 1CFDA 2SASA 1KFXL 2ZKMX 4M2QA 3I5FB 3QRXA 1KK8B 1R2UA 4BY5A 1XFYO 1ZACA 2WCBA 5AFPA 2LLTA 3LLEA 1QVIY 2H61A 1WRZA 2JWWA 3EVRA 3BUWB 4MRXA 5ER5A 5BPJA 1WDCB 1AP4A 1B4CA 1BT6A 3JTDC 3KF9A 2AMIA 2A4JA 1CDLA 1CTRA 1LINA 2I94A 2JNXA 4HREE 1SR6C 4YI9A 1JFJA 2H2KA 2I18A 3EVUA 1CDMA 2LVKA 1KFUL 3NSOA 3SJSA 1JFKA 1K9KA 3E3RA 1GJYA 4MBEA 1JSAA 3NSIA 1CLBA 3VRPA 5I8NA 2M8UA 1K95A 1IQ3A 2BKIB 4GFTA 2OS8B 1QVIZ 1NYAA 2CT9A 3TUYC 3A4UB 1XYDA 1SK6D 1KSOA 2BL0C 1TN4A 1PVAA 1RFJA 4OCIA 2LMTA 3OHMB 4CLNA 1M39A 1EH2A 1CB1A 1BLQA 2JXCA 4I5NB 4JPZB 1XK4A 1A2XA 1BMOA 4PE1A 1ODBA 4DCKA 4IL1A 2M1KB 3BUXB 2K61A 4OKHA 2F33A 2JZIA 2G9BA 1WY9A 2KOTA 1Q80A 5CSFA 1PALA 2G2BA 3VGOA 1YUUA 1F4OA 1G33A 2FCEA 2HF5A 4MLWA 2K7DA 5IBWA 1B7TY 1SKTA 1YURA 1B9AA 1KQMC 3DF0A 1BU3A 2JOJA 1IJ5A 4GUKA 1QX2A 1MUXA 2K2AA 1UUSA 1BOCA 3BUOB 1UHIA 1BG1A 1SL7A 3FWBA 1ALWA 5DKRA 2IS9A 2KSPA 3SG5A 2COLB 2MLEC 3TDZA 1S6IA 1FBVA 3KEVA 4F0ZB 4AQJA 4Q04A 1DJGA 1UP5A 2OTGC 1B7TZ 3IQQA 3TDUA 1IQ5A 2LUXA 4ZCVA 1CMGA 3BUNB 4YGBB 4WQ2A 1DJYA 4MZKA 1MF8B 2L0PA 2JU0A 2K7OA 2KNEA 2HQ8A 2L50A 4GGFC 1MXEA 1OMVA 2L5XB 3DVKA 4WQ3A 2KI6D 5B8IB 4ZCUA 3SG6A 1KQVA 1W7JB 3D10A 1S3PA 1NSHA 1CM4A 2KDHA 3PN7C 4N5XA 1X02A 1OZSA 1KFXS 1RTP1 2L98A 4WRIA 3PATA 1C7WA 3NXAA 1K9PA 1QIWA 1QTXA 1SMGA 5J3XA 1J7OA 1IWQA 2WNDA 3LK1A 2BL0B 1M45A 2MAZA 3EVVA 3PALA 1AK8A 3LK0A 5HKWA 4YI8A 1MWNA 2LVJA 1UWOA 4YGEB 1AUIB 5CSNA 2AAOA 4AQIA 1QJTA 2KGBC 1M63B 2Y1NA 3PFVA 2KAYA 2LUCA 2PASA 2DOQA 3OP0A 4ORBB 1KSMA 2V53A 1S6CA 3M0WA 4MRYA 1XFXO 1XO5A 2K7BA 1K96A 3DVMA 1KWOB 1SW8A 1ZOTB 4PE7A 5F6TA 1Y6WA 4CPVA 1F55A 3I5HC 2F2OA 1QIVA 1J7RA 2GGZA 2LP2A 3BOWA 2F3ZA 1IJ6A 1RROA 2KFFA 2LAPA 4PE4A 4MEWA 1XFVO 2ZRSA 4I5LB 1Y1UA 2CBLA 2JXLA 2ZNDA 1PVBA 3AKAA 1A75A 2KAVA 1GGZA 1F4QA 1MHOA 4MZLA 1L2OC 5JJGA 2ZNEA 1JF2A 2TN4A 1PSRA 1FPWA 5DKQA 3CS1A 2KBMA 2F3YA 2JULA 2LC5A 1OOJA 2KYFA 3AAJA 4FTGA 3I5GC 4U8DA 1XA5A 1OZOA 1CFFA 4ORAB 4NDDA 3DF0B 1CNPA 2L2EA 1G4YR 1B47A 3SIAA 1W7IB 1QX5B 2F2PA 2LANA 4AOMA 1SNLA 1U5IA 3DVJA 2JT0A 3SG4A 1K90D 2AUCA 2M7LA 1CDNA 1SCMC 1YRTB 4HRHA 3PLFB 2Y5IA 1J55A 3I5IB 3JVTB 1NPQA 4GNKB 3RLZA 1NCYA 1K8UA 2EC6B 1CM1A 3CTNA 1IG5A 4ETOA 2KI4C 2ZFDA 3CLNA 2LP3A 3EK7A 1DGUA 2WCEA 3D0YB 4M2OA 2D8NA 1JF0A 2HQWA 5D7FA 2MRDA 1CKKA 1C07A 3WNXB 4PHKA 4OV2A 2MBXA 2GV5A 4NQGA 1QLSA 4JWQA 1S36A 1OMRA 3O78A 5AANA 1M31A 1NIWA 3EK8A 3TS5B 1DMOA 1DTLA 4MZJA 4PDZA 2LMVA 1JUOA 1QV0A 1UHKA 1NX3A 3GK1A 1S6JA 1DF0B 5D69A 5GQQC 2KQYA 2L4HA 1FI6A 2KGRA 4PCWA 2BBNA 2BKHB 4GBAA 1YVLA 2KBIA 2E6WA 4GGFA 2KHNA 3I5FC 1KK8C 4UPGA 1K93D 4HSZA 1SL8A 1V1GA 5I2QA 1TCOB 2JTZA 3A8RA 4ICBA 3CWGA 4BY4A 3WHUB 1S26D 3EKJA 1TIZA 1N2DA 1ZMZA 1J7QA 1QX7A 1V1FA 3BXKA 5CSIA 3HCMA 3ZWHA 1WDCC 1NCXA 5AXIA 4E68A 1L7ZA 1NP8A 2KFGA 4MN0A 1IKUA 1JBAA 3JTDB 1A4PA 1OSAA 2CXJA 1RWYA 1WRKA 2OPOA 4PE0A 4DIRA 2JRFA 1SR6B 1N0YA 5FYXA 4D1EA 4ORCB 1YUTA 2BECA 3OX5A 1NWDA 2ISDA 4DS7A 1DJIA 3BOWB 2OS8C 1WLMA 1TNPA 3BUMB 3FIAA 1TCFA 2JPTA 2F8PA 2KYCA 3H4SE 3TUYB 2M7NA 1D1OA 4I5KA 4PHJA 1UHJA 2Q4UA 1M46A 3OB2B 2CCMA 2JT8A 3KPXA 1EG4A 1ZUZA 4CFRA 1OMDA 1NCZA 1Y1XA 2K2FA 5AEQA 2LE9B 2LMUA 1BJFA 3VRQA 1B8RA 1B8LA 2O5GA 4M2PA 1OQPA 1PSBA 1CFPA 2M49B 2B1UA 2ZN9A 3IF7A 1GQMA 5DKNA 1IGVA 5TNCA 3WXAA 3SG3A 1UHHA 3C1VA 4L9MA 5CSJA 4OVNF 3OB1B 1KFUS 1RECA 2BE6A 1YRUB 4JQ0D 2MHHA 2M9GA 3O4YA 3K21A 1GGWA 2Y4QA 4A4BA 1YR5A 4NDBA 1EG3A 4YBHB 1SBJA 1JWDA 1U5IB 2PVBA 4XJKA 2JT3A 3FWCA 1QV1A 2EHBA 5KTYA 1SCVA 1XFWO 1XFZO 3GK2A 1CLLA 2MJWB 1KQMB 4GPLB 3CGAA 3IQOA 1LA0A 1UURA 2MLFC 3VRNA 3VRRA 4CIDA 3GK4X 1DVIA 2Q91A 5HKZA 1DJWA 1YTZC 1EL4A 4XYNA 1J7PA 3BQ3A 1ZFSA 2KI6C 4A4CA 1SY9A 1PK0D 2VRGA 1UHNA 1VRKA 1DT7B 4MSPA 1MXLC 5KSZA 4USLA 1BR4B 1CDPA 2NCOA 2GGMA 1G8IA 1RJVA 3DVEA 2KFHA 1RK9A 4TNCA 2OTGB 2WC8A 3O2PA 5KU1A 1SL9A 2BCBA 4QJ4B 1YVHA 1JC2A 1NX2A 2I7AA 2M1UA 2CTNA 2LLSA 2QACA 1E8AA 3NSLA 1MR8A 2BE4A 1QATA 5HLOA 1BODA 3NSKA 1K94A 1F70A 1A29A 2ZRTA 1IH0A 2H61C 3SIBA 3EK4A 3SG2A 3PN7B 1C7VA 3PSRA 2E30A 5G08A 1DJHA 5PALA 1KCYA 4YRUA 3TZ1A 3VROA 1TOPA 3RM1A 1PULA 2JC2A 2KQ6A 3CR5X 4YGDB 4QJ3B 1LA3A 4MVFA 1LVCD 2LV7A 1QXPA 3CR2A 1F71A 1K2HA 2Y1MA 4DRWA 3MSEB 1LXFC 4N1FA 4PHMA 1DGVA 1TRFA 2LCPA 3SG7A 1S5GY 2MA2A 1N65A 1KWOC 2I2RE 1B8CA 1WLZA 3GOFA 2BCAA 3AAKA 2LLUA 2LNKA 1XVJA 2HPSA 3I5HB 1S1EA 1LKJA 1NX1A 1YUSA 1YX8A 2L51A 2PSRA 4YGAA 2ZN8A 1CFCA 1DJXA 1F54A 1J1EA 1XK4C 4I5JA 1TTXA 3LL8B 1AHRA 3KO0A 1F8HA 2BCXA 2NXQA 4N1GA 2JQ6A 1IRJA 2M3WA 1QLKA 1ALVA 1FW4A 2CNPA 4YGCB 1L2OB 1S5GZ 3PM8A 2RGIA 3ICBA 2LVIA 4P5OE 2L4IA 1OE9B 1TNXA 3O6BA 1Y0VH 1SYMA 3BYAA 4CFQA 4XJKB 2LHLA 1BR1B 1BF5A 1CMFA 2WCFA 3I5GB 2M29A 1FI5A 1AJ4A 1PRWA 1DJZA 2HETA 1EJ3A 1QASA 2M97A 5ER4X 4C0JA 1J1DA 4FQOA 1YX7A 2JTTA 1A75B 1CLMA 3D0YA 1H4BA 2PMYA 2K8MB 2NLNA 2JNFA 3CZTX 5AERA 5HKYA 1QS7A 2K7CA 4P2YB 3DD4A 1MQ1A 2NCPA 3F45A 1B1GA 3OX6A 2M0RA 1K9UA 1SRAA 3TDIA 4C0LA 1KK7Y 5K89A 3I5IC 5CPVA 3JVTC 1SCMB 2NZ0A 3HX4A 1XFUO 4HRGA 3CR4X 1NUBA 2EC6C 1HT9A 1Y1AA 1DF0A 2K0JA 2EGDA 1SPYA 4GGNA 1AVSA 4DUQA 3EKHA 3WHTB 4PALA 2KAXA 5HLVA 4R1EA 4OR9B 5I2OA 5JOLA 2FOTA 2KI4B 4GAOA 1FF1A 4QJ5B 2LHIA 2LVVA 2QPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHE A;  3ZNI A;  2FJU B;  1H8B A;  5I2L A;  1EXR A;  1A03 A;  1HQV A;  1WRL A;  2O60 A;  2WOR A;  5HYD A;  2P6B B;  2R2I A;  4NDC A;  3LCP C;  2LM5 A;  4C0K A;  3TS5 C;  1KK7 Z;  3AKB A;  2FCD A;  1NX0 A;  1R6P A;  3FS7 A;  1AJ5 A;  2PAL A;  4PHN A;  1TNQ A;  1TNW A;  2BBM A;  2SCP A;  2PRU A;  2WOS A;  1CFD A;  2SAS A;  1KFX L;  2ZKM X;  4M2Q A;  3I5F B;  3QRX A;  1KK8 B;  1R2U A;  4BY5 A;  1XFY O;  1ZAC A;  2WCB A;  5AFP A;  2LLT A;  3LLE A;  1QVI Y;  2H61 A;  1WRZ A;  2JWW A;  3EVR A;  3BUW B;  4MRX A;  5ER5 A;  5BPJ A;  1WDC B;  1AP4 A;  1B4C A;  1BT6 A;  3JTD C;  3KF9 A;  2AMI A;  2A4J A;  1CDL A;  1CTR A;  1LIN A;  2I94 A;  2JNX A;  4HRE E;  1SR6 C;  4YI9 A;  1JFJ A;  2H2K A;  2I18 A;  3EVU A;  1CDM A;  2LVK A;  1KFU L;  3NSO A;  3SJS A;  1JFK A;  1K9K A;  3E3R A;  1GJY A;  4MBE A;  1JSA A;  3NSI A;  1CLB A;  3VRP A;  5I8N A;  2M8U A;  1K95 A;  1IQ3 A;  2BKI B;  4GFT A;  2OS8 B;  1QVI Z;  1NYA A;  2CT9 A;  3TUY C;  3A4U B;  1XYD A;  1SK6 D;  1KSO A;  2BL0 C;  1TN4 A;  1PVA A;  1RFJ A;  4OCI A;  2LMT A;  3OHM B;  4CLN A;  1M39 A;  1EH2 A;  1CB1 A;  1BLQ A;  2JXC A;  4I5N B;  4JPZ B;  1XK4 A;  1A2X A;  1BMO A;  4PE1 A;  1ODB A;  4DCK A;  4IL1 A;  2M1K B;  3BUX B;  2K61 A;  4OKH A;  2F33 A;  2JZI A;  2G9B A;  1WY9 A;  2KOT A;  1Q80 A;  5CSF A;  1PAL A;  2G2B A;  3VGO A;  1YUU A;  1F4O A;  1G33 A;  2FCE A;  2HF5 A;  4MLW A;  2K7D A;  5IBW A;  1B7T Y;  1SKT A;  1YUR A;  1B9A A;  1KQM C;  3DF0 A;  1BU3 A;  2JOJ A;  1IJ5 A;  4GUK A;  1QX2 A;  1MUX A;  2K2A A;  1UUS A;  1BOC A;  3BUO B;  1UHI A;  1BG1 A;  1SL7 A;  3FWB A;  1ALW A;  5DKR A;  2IS9 A;  2KSP A;  3SG5 A;  2COL B;  2MLE C;  3TDZ A;  1S6I A;  1FBV A;  3KEV A;  4F0Z B;  4AQJ A;  4Q04 A;  1DJG A;  1UP5 A;  2OTG C;  1B7T Z;  3IQQ A;  3TDU A;  1IQ5 A;  2LUX A;  4ZCV A;  1CMG A;  3BUN B;  4YGB B;  4WQ2 A;  1DJY A;  4MZK A;  1MF8 B;  2L0P A;  2JU0 A;  2K7O A;  2KNE A;  2HQ8 A;  2L50 A;  4GGF C;  1MXE A;  1OMV A;  2L5X B;  3DVK A;  4WQ3 A;  2KI6 D;  5B8I B;  4ZCU A;  3SG6 A;  1KQV A;  1W7J B;  3D10 A;  1S3P A;  1NSH A;  1CM4 A;  2KDH A;  3PN7 C;  4N5X A;  1X02 A;  1OZS A;  1KFX S;  1RTP 1;  2L98 A;  4WRI A;  3PAT A;  1C7W A;  3NXA A;  1K9P A;  1QIW A;  1QTX A;  1SMG A;  5J3X A;  1J7O A;  1IWQ A;  2WND A;  3LK1 A;  2BL0 B;  1M45 A;  2MAZ A;  3EVV A;  3PAL A;  1AK8 A;  3LK0 A;  5HKW A;  4YI8 A;  1MWN A;  2LVJ A;  1UWO A;  4YGE B;  1AUI B;  5CSN A;  2AAO A;  4AQI A;  1QJT A;  2KGB C;  1M63 B;  2Y1N A;  3PFV A;  2KAY A;  2LUC A;  2PAS A;  2DOQ A;  3OP0 A;  4ORB B;  1KSM A;  2V53 A;  1S6C A;  3M0W A;  4MRY A;  1XFX O;  1XO5 A;  2K7B A;  1K96 A;  3DVM A;  1KWO B;  1SW8 A;  1ZOT B;  4PE7 A;  5F6T A;  1Y6W A;  4CPV A;  1F55 A;  3I5H C;  2F2O A;  1QIV A;  1J7R A;  2GGZ A;  2LP2 A;  3BOW A;  2F3Z A;  1IJ6 A;  1RRO A;  2KFF A;  2LAP A;  4PE4 A;  4MEW A;  1XFV O;  2ZRS A;  4I5L B;  1Y1U A;  2CBL A;  2JXL A;  2ZND A;  1PVB A;  3AKA A;  1A75 A;  2KAV A;  1GGZ A;  1F4Q A;  1MHO A;  4MZL A;  1L2O C;  5JJG A;  2ZNE A;  1JF2 A;  2TN4 A;  1PSR A;  1FPW A;  5DKQ A;  3CS1 A;  2KBM A;  2F3Y A;  2JUL A;  2LC5 A;  1OOJ A;  2KYF A;  3AAJ A;  4FTG A;  3I5G C;  4U8D A;  1XA5 A;  1OZO A;  1CFF A;  4ORA B;  4NDD A;  3DF0 B;  1CNP A;  2L2E A;  1G4Y R;  1B47 A;  3SIA A;  1W7I B;  1QX5 B;  2F2P A;  2LAN A;  4AOM A;  1SNL A;  1U5I A;  3DVJ A;  2JT0 A;  3SG4 A;  1K90 D;  2AUC A;  2M7L A;  1CDN A;  1SCM C;  1YRT B;  4HRH A;  3PLF B;  2Y5I A;  1J55 A;  3I5I B;  3JVT B;  1NPQ A;  4GNK B;  3RLZ A;  1NCY A;  1K8U A;  2EC6 B;  1CM1 A;  3CTN A;  1IG5 A;  4ETO A;  2KI4 C;  2ZFD A;  3CLN A;  2LP3 A;  3EK7 A;  1DGU A;  2WCE A;  3D0Y B;  4M2O A;  2D8N A;  1JF0 A;  2HQW A;  5D7F A;  2MRD A;  1CKK A;  1C07 A;  3WNX B;  4PHK A;  4OV2 A;  2MBX A;  2GV5 A;  4NQG A;  1QLS A;  4JWQ A;  1S36 A;  1OMR A;  3O78 A;  5AAN A;  1M31 A;  1NIW A;  3EK8 A;  3TS5 B;  1DMO A;  1DTL A;  4MZJ A;  4PDZ A;  2LMV A;  1JUO A;  1QV0 A;  1UHK A;  1NX3 A;  3GK1 A;  1S6J A;  1DF0 B;  5D69 A;  5GQQ C;  2KQY A;  2L4H A;  1FI6 A;  2KGR A;  4PCW A;  2BBN A;  2BKH B;  4GBA A;  1YVL A;  2KBI A;  2E6W A;  4GGF A;  2KHN A;  3I5F C;  1KK8 C;  4UPG A;  1K93 D;  4HSZ A;  1SL8 A;  1V1G A;  5I2Q A;  1TCO B;  2JTZ A;  3A8R A;  4ICB A;  3CWG A;  4BY4 A;  3WHU B;  1S26 D;  3EKJ A;  1TIZ A;  1N2D A;  1ZMZ A;  1J7Q A;  1QX7 A;  1V1F A;  3BXK A;  5CSI A;  3HCM A;  3ZWH A;  1WDC C;  1NCX A;  5AXI A;  4E68 A;  1L7Z A;  1NP8 A;  2KFG A;  4MN0 A;  1IKU A;  1JBA A;  3JTD B;  1A4P A;  1OSA A;  2CXJ A;  1RWY A;  1WRK A;  2OPO A;  4PE0 A;  4DIR A;  2JRF A;  1SR6 B;  1N0Y A;  5FYX A;  4D1E A;  4ORC B;  1YUT A;  2BEC A;  3OX5 A;  1NWD A;  2ISD A;  4DS7 A;  1DJI A;  3BOW B;  2OS8 C;  1WLM A;  1TNP A;  3BUM B;  3FIA A;  1TCF A;  2JPT A;  2F8P A;  2KYC A;  3H4S E;  3TUY B;  2M7N A;  1D1O A;  4I5K A;  4PHJ A;  1UHJ A;  2Q4U A;  1M46 A;  3OB2 B;  2CCM A;  2JT8 A;  3KPX A;  1EG4 A;  1ZUZ A;  4CFR A;  1OMD A;  1NCZ A;  1Y1X A;  2K2F A;  5AEQ A;  2LE9 B;  2LMU A;  1BJF A;  3VRQ A;  1B8R A;  1B8L A;  2O5G A;  4M2P A;  1OQP A;  1PSB A;  1CFP A;  2M49 B;  2B1U A;  2ZN9 A;  3IF7 A;  1GQM A;  5DKN A;  1IGV A;  5TNC A;  3WXA A;  3SG3 A;  1UHH A;  3C1V A;  4L9M A;  5CSJ A;  4OVN F;  3OB1 B;  1KFU S;  1REC A;  2BE6 A;  1YRU B;  4JQ0 D;  2MHH A;  2M9G A;  3O4Y A;  3K21 A;  1GGW A;  2Y4Q A;  4A4B A;  1YR5 A;  4NDB A;  1EG3 A;  4YBH B;  1SBJ A;  1JWD A;  1U5I B;  2PVB A;  4XJK A;  2JT3 A;  3FWC A;  1QV1 A;  2EHB A;  5KTY A;  1SCV A;  1XFW O;  1XFZ O;  3GK2 A;  1CLL A;  2MJW B;  1KQM B;  4GPL B;  3CGA A;  3IQO A;  1LA0 A;  1UUR A;  2MLF C;  3VRN A;  3VRR A;  4CID A;  3GK4 X;  1DVI A;  2Q91 A;  5HKZ A;  1DJW A;  1YTZ C;  1EL4 A;  4XYN A;  1J7P A;  3BQ3 A;  1ZFS A;  2KI6 C;  4A4C A;  1SY9 A;  1PK0 D;  2VRG A;  1UHN A;  1VRK A;  1DT7 B;  4MSP A;  1MXL C;  5KSZ A;  4USL A;  1BR4 B;  1CDP A;  2NCO A;  2GGM A;  1G8I A;  1RJV A;  3DVE A;  2KFH A;  1RK9 A;  4TNC A;  2OTG B;  2WC8 A;  3O2P A;  5KU1 A;  1SL9 A;  2BCB A;  4QJ4 B;  1YVH A;  1JC2 A;  1NX2 A;  2I7A A;  2M1U A;  2CTN A;  2LLS A;  2QAC A;  1E8A A;  3NSL A;  1MR8 A;  2BE4 A;  1QAT A;  5HLO A;  1BOD A;  3NSK A;  1K94 A;  1F70 A;  1A29 A;  2ZRT A;  1IH0 A;  2H61 C;  3SIB A;  3EK4 A;  3SG2 A;  3PN7 B;  1C7V A;  3PSR A;  2E30 A;  5G08 A;  1DJH A;  5PAL A;  1KCY A;  4YRU A;  3TZ1 A;  3VRO A;  1TOP A;  3RM1 A;  1PUL A;  2JC2 A;  2KQ6 A;  3CR5 X;  4YGD B;  4QJ3 B;  1LA3 A;  4MVF A;  1LVC D;  2LV7 A;  1QXP A;  3CR2 A;  1F71 A;  1K2H A;  2Y1M A;  4DRW A;  3MSE B;  1LXF C;  4N1F A;  4PHM A;  1DGV A;  1TRF A;  2LCP A;  3SG7 A;  1S5G Y;  2MA2 A;  1N65 A;  1KWO C;  2I2R E;  1B8C A;  1WLZ A;  3GOF A;  2BCA A;  3AAK A;  2LLU A;  2LNK A;  1XVJ A;  2HPS A;  3I5H B;  1S1E A;  1LKJ A;  1NX1 A;  1YUS A;  1YX8 A;  2L51 A;  2PSR A;  4YGA A;  2ZN8 A;  1CFC A;  1DJX A;  1F54 A;  1J1E A;  1XK4 C;  4I5J A;  1TTX A;  3LL8 B;  1AHR A;  3KO0 A;  1F8H A;  2BCX A;  2NXQ A;  4N1G A;  2JQ6 A;  1IRJ A;  2M3W A;  1QLK A;  1ALV A;  1FW4 A;  2CNP A;  4YGC B;  1L2O B;  1S5G Z;  3PM8 A;  2RGI A;  3ICB A;  2LVI A;  4P5O E;  2L4I A;  1OE9 B;  1TNX A;  3O6B A;  1Y0V H;  1SYM A;  3BYA A;  4CFQ A;  4XJK B;  2LHL A;  1BR1 B;  1BF5 A;  1CMF A;  2WCF A;  3I5G B;  2M29 A;  1FI5 A;  1AJ4 A;  1PRW A;  1DJZ A;  2HET A;  1EJ3 A;  1QAS A;  2M97 A;  5ER4 X;  4C0J A;  1J1D A;  4FQO A;  1YX7 A;  2JTT A;  1A75 B;  1CLM A;  3D0Y A;  1H4B A;  2PMY A;  2K8M B;  2NLN A;  2JNF A;  3CZT X;  5AER A;  5HKY A;  1QS7 A;  2K7C A;  4P2Y B;  3DD4 A;  1MQ1 A;  2NCP A;  3F45 A;  1B1G A;  3OX6 A;  2M0R A;  1K9U A;  1SRA A;  3TDI A;  4C0L A;  1KK7 Y;  5K89 A;  3I5I C;  5CPV A;  3JVT C;  1SCM B;  2NZ0 A;  3HX4 A;  1XFU O;  4HRG A;  3CR4 X;  1NUB A;  2EC6 C;  1HT9 A;  1Y1A A;  1DF0 A;  2K0J A;  2EGD A;  1SPY A;  4GGN A;  1AVS A;  4DUQ A;  3EKH A;  3WHT B;  4PAL A;  2KAX A;  5HLV A;  4R1E A;  4OR9 B;  5I2O A;  5JOL A;  2FOT A;  2KI4 B;  4GAO A;  1FF1 A;  4QJ5 B;  2LHI A;  2LVV A;  2QPT A; 
#chains in the Genus database with same CATH topology
 3KHE A;  3ZNI A;  2FJU B;  1H8B A;  5I2L A;  1EXR A;  1A03 A;  1HQV A;  1WRL A;  2O60 A;  2WOR A;  5HYD A;  3B7A A;  2P6B B;  2R2I A;  4NDC A;  2P71 A;  3UNW A;  3LCP C;  2LM5 A;  4C0K A;  3DXL A;  3TS5 C;  3B86 A;  1KK7 Z;  2QEH A;  3AKB A;  2FCD A;  1NX0 A;  1R6P A;  3FS7 A;  4IJ7 A;  1AJ5 A;  2PAL A;  4PHN A;  1TNQ A;  1TNW A;  2BBM A;  2SCP A;  2PRU A;  2WOS A;  1CFD A;  2SAS A;  1KFX L;  2ZKM X;  4M2Q A;  3I5F B;  2WCH A;  3QRX A;  1KK8 B;  1R2U A;  4BY5 A;  1XFY O;  1ZAC A;  2WCB A;  5AFP A;  2LLT A;  3LLE A;  1QVI Y;  2H61 A;  1WRZ A;  2JWW A;  3EVR A;  3BUW B;  4MRX A;  5ER5 A;  3L4A A;  5BPJ A;  1WDC B;  1AP4 A;  1B4C A;  1DEK A;  1BT6 A;  3JTD C;  3KF9 A;  1CDL A;  1CTR A;  1LIN A;  2A4J A;  2AMI A;  2I94 A;  2JNX A;  4HRE E;  1SR6 C;  4YI9 A;  1JFJ A;  2H2K A;  2I18 A;  3EVU A;  3O4X A;  1CDM A;  2LVK A;  1KFU L;  3NSO A;  1QWV A;  3SJS A;  1JFK A;  1K9K A;  3E3R A;  1GJY A;  4MBE A;  1JSA A;  3NSI A;  5DIC A;  2WC5 A;  5I94 A;  1CLB A;  3VRP A;  5I8N A;  2M8U A;  1K95 A;  1IQ3 A;  2BKI B;  4GFT A;  1OOF A;  2BAP A;  2OS8 B;  1QVI Z;  1NYA A;  2CT9 A;  3TUY C;  3A4U B;  1XYD A;  3DY9 A;  1SK6 D;  2ERB A;  1KSO A;  2BL0 C;  1TN4 A;  1PVA A;  1RFJ A;  4OCI A;  2LMT A;  3OHM B;  4CLN A;  1LS8 A;  1M39 A;  1EH2 A;  1CB1 A;  1BLQ A;  2FJY A;  2JXC A;  4I5N B;  4JPZ B;  1XK4 A;  1A2X A;  1BMO A;  3L4L A;  1ODB A;  4PE1 A;  4DCK A;  4IL1 A;  2BNX A;  2M1K B;  3BUX B;  2K61 A;  3NHT A;  1GM0 A;  3S0F A;  4OKH A;  2F33 A;  2JZI A;  3B6X A;  3OGN A;  2G9B A;  1WY9 A;  2KOT A;  1Q80 A;  5CSF A;  3N7H A;  3UO9 A;  1PAL A;  2G2B A;  4FQT A;  3VGO A;  1YUU A;  1F4O A;  4F7F A;  1G33 A;  2FCE A;  2HF5 A;  4MLW A;  2K7D A;  5IBW A;  1B7T Y;  1SKT A;  1YUR A;  1B9A A;  1KQM C;  1IIO A;  3V2L A;  3DF0 A;  1BU3 A;  2JOJ A;  1IJ5 A;  4GUK A;  1DC1 A;  1QX2 A;  1MUX A;  3CDN A;  5D3O A;  2K2A A;  1UUS A;  1BOC A;  3BUO B;  1UHI A;  1BG1 A;  1SL7 A;  3FWB A;  1ALW A;  5DKR A;  2IS9 A;  2KSP A;  2QEB A;  2COL B;  2MLE C;  4KYN A;  3SG5 A;  1S6I A;  3TDZ A;  1FBV A;  3KEV A;  4F0Z B;  3DZT A;  4AQJ A;  4Q04 A;  1P28 A;  1DJG A;  3B88 A;  1UP5 A;  2OTG C;  1B7T Z;  3IQQ A;  3TDU A;  1IQ5 A;  2LUX A;  4ZCV A;  1CMG A;  3PM2 A;  3BUN B;  4YGB B;  4WQ2 A;  1DJY A;  2QEO A;  4MZK A;  1MF8 B;  2L0P A;  2JU0 A;  2K7O A;  2KNE A;  2HQ8 A;  2L50 A;  4GGF C;  1MXE A;  3R1P A;  1OMV A;  2L5X B;  3DVK A;  4WQ3 A;  2KI6 D;  3R72 A;  5B8I B;  4ZCU A;  3SG6 A;  1KQV A;  1W7J B;  3D10 A;  1S3P A;  1NSH A;  3S0A A;  1CM4 A;  2KDH A;  3PN7 C;  4N5X A;  1X02 A;  1OZS A;  1KFX S;  1RTP 1;  2L98 A;  4WRI A;  3PAT A;  1C7W A;  3NXA A;  1K9P A;  1QIW A;  1QTX A;  1SMG A;  5J3X A;  1J7O A;  1IWQ A;  2WND A;  3LK1 A;  2BL0 B;  1M45 A;  2MAZ A;  3EVV A;  3PAL A;  1AK8 A;  3LK0 A;  5HKW A;  4YI8 A;  1MWN A;  2LVJ A;  1UWO A;  4YGE B;  1AUI B;  3D78 A;  5CSN A;  2AAO A;  4AQI A;  1QJT A;  2KGB C;  1M63 B;  2Y1N A;  3PFV A;  2KAY A;  2LUC A;  2PAS A;  2DOQ A;  3OP0 A;  4ORB B;  1KSM A;  2V53 A;  1S6C A;  3M0W A;  3D75 A;  1XFX O;  2WCL A;  1XO5 A;  4MRY A;  2K7B A;  1K96 A;  3DVM A;  1KWO B;  1SW8 A;  5FI2 A;  1ZOT B;  4PE7 A;  5F6T A;  1Y6W A;  4CPV A;  1F55 A;  3I5H C;  2F2O A;  1QIV A;  1SSE B;  1J7R A;  2GGZ A;  2LP2 A;  3BOW A;  5EL2 A;  2F3Z A;  1IJ6 A;  1RRO A;  2KFF A;  2LAP A;  4PE4 A;  4MEW A;  1XFV O;  2ZRS A;  4I5L B;  1OOI X;  1Y1U A;  2CBL A;  2JXL A;  2ZND A;  1PVB A;  3AKA A;  1A75 A;  2KAV A;  2GTE A;  1GGZ A;  1F4Q A;  1MHO A;  4MZL A;  1L2O C;  5JJG A;  2ZNE A;  1JF2 A;  2TN4 A;  1PSR A;  1FPW A;  5DKQ A;  3CS1 A;  2KBM A;  2F3Y A;  2JUL A;  2LC5 A;  1OOJ A;  2KYF A;  3BFA A;  2KPH A;  3AAJ A;  4FTG A;  3I5G C;  1XFR A;  4U8D A;  1XA5 A;  1OZO A;  1CFF A;  4ORA B;  4NDD A;  3DF0 B;  1CNP A;  2L2E A;  1G4Y R;  3BJH A;  1B47 A;  3SIA A;  1W7I B;  1QX5 B;  2F2P A;  2LAN A;  3SS4 A;  4AOM A;  1SNL A;  1U5I A;  3DVJ A;  2JT0 A;  3SG4 A;  1K90 D;  3S0B A;  2AUC A;  2M7L A;  1CDN A;  1SCM C;  1YRT B;  4HRH A;  3PLF B;  2Y5I A;  1J55 A;  3I5I B;  3JVT B;  1NPQ A;  1C3Y A;  4GNK B;  3RLZ A;  1NCY A;  1K8U A;  2EC6 B;  1CM1 A;  3Q8I A;  3CTN A;  2QDI A;  1IG5 A;  2WC6 A;  4ETO A;  2KI4 C;  2ZFD A;  1ORG A;  3CLN A;  2LP3 A;  3EK7 A;  1DGU A;  2WCE A;  3D0Y B;  4M2O A;  2D8N A;  1JF0 A;  2HQW A;  5D7F A;  2MRD A;  1CKK A;  1C07 A;  3WNX B;  3BFH A;  4PHK A;  3D76 A;  4OV2 A;  2MBX A;  2GV5 A;  4NQG A;  1QLS A;  3S0G A;  4JWQ A;  1S36 A;  1OMR A;  3O78 A;  5AAN A;  1M31 A;  1NIW A;  1OOG A;  3EK8 A;  3TS5 B;  1DMO A;  1DTL A;  4MZJ A;  4PDZ A;  2LMV A;  1JUO A;  1QV0 A;  1UHK A;  1NX3 A;  3GK1 A;  1S6J A;  1DF0 B;  5D69 A;  5GQQ C;  2KQY A;  2L4H A;  1FI6 A;  2KGR A;  4PCW A;  2BBN A;  2BKH B;  4GBA A;  1YVL A;  2KBI A;  2E6W A;  3PJI A;  4GGF A;  2KHN A;  3I5F C;  1KK8 C;  4UPG A;  2JPO A;  1K93 D;  4HSZ A;  1SL8 A;  1V1G A;  3BFB A;  5I2Q A;  1TCO B;  2JTZ A;  1DEL A;  3A8R A;  4ICB A;  3CWG A;  4BY4 A;  3WHU B;  1S26 D;  2PYQ A;  3EKJ A;  1TIZ A;  1N2D A;  1ZMZ A;  1J7Q A;  1QX7 A;  1V1F A;  3BXK A;  5CSI A;  3HCM A;  3ZWH A;  1WDC C;  1NCX A;  5AXI A;  4E68 A;  1L7Z A;  1NP8 A;  2KFG A;  4MN0 A;  1IKU A;  1JBA A;  3JTD B;  1A4P A;  1OSA A;  2CXJ A;  1RWY A;  1WRK A;  2OPO A;  3D73 A;  4PE0 A;  2JRF A;  4DIR A;  1SR6 B;  1N0Y A;  5FYX A;  4D1E A;  4ORC B;  1TUZ A;  1YUT A;  2BEC A;  3OX5 A;  1NWD A;  2ISD A;  4DS7 A;  1DJI A;  3R1O A;  3DYE A;  3BOW B;  3S0E A;  2OS8 C;  1WLM A;  1TNP A;  1W9Z A;  3BUM B;  1TCF A;  2JPT A;  2F8P A;  2KYC A;  3FIA A;  3H4S E;  3QME A;  3TUY B;  2M7N A;  1D1O A;  3NHI A;  4I5K A;  4PHJ A;  1UHJ A;  2Q4U A;  1M46 A;  3OB2 B;  2CCM A;  2JT8 A;  3KPX A;  1EG4 A;  1ZUZ A;  3FE6 A;  5HL1 A;  4CFR A;  1OMD A;  1NCZ A;  1Y1X A;  2K2F A;  5AEQ A;  2LE9 B;  2LMU A;  1BJF A;  4OZD A;  3VRQ A;  1B8R A;  1B8L A;  2O5G A;  2L2C A;  4M2P A;  1OQP A;  1PSB A;  1CFP A;  2M49 B;  2B1U A;  2ZN9 A;  3IF7 A;  1GQM A;  5DKN A;  1IGV A;  5TNC A;  3WXA A;  3EG5 B;  3SG3 A;  1UHH A;  3C1V A;  3CAB A;  3D77 A;  4L9M A;  4OVN F;  3OB1 B;  5CSJ A;  1KFU S;  4INX A;  1REC A;  2BE6 A;  3L47 A;  1YRU B;  4JQ0 D;  2MHH A;  2M9G A;  3O4Y A;  3K21 A;  1GGW A;  2Y4Q A;  4A4B A;  2WCK A;  3CZ1 A;  1YR5 A;  4NDB A;  1EG3 A;  4YBH B;  1SBJ A;  1JWD A;  1U5I B;  1DQE A;  2PVB A;  4XJK A;  2JT3 A;  3FWC A;  1QV1 A;  2EHB A;  5KTY A;  2WCM A;  1SCV A;  1XFW O;  1XFZ O;  3GK2 A;  1CLL A;  1T14 A;  2MJW B;  1TUJ A;  1KQM B;  4GPL B;  3CGA A;  3IQO A;  1LA0 A;  2QEV A;  1UUR A;  2MLF C;  3VRN A;  3VRR A;  4CID A;  3GK4 X;  1DVI A;  2Q91 A;  5HKZ A;  1DJW A;  1YTZ C;  1EL4 A;  4XYN A;  1J7P A;  2L5Y A;  1OOH A;  3BQ3 A;  1ZFS A;  2KI6 C;  4A4C A;  1SY9 A;  1PK0 D;  1C3Z A;  1UHN A;  1VRK A;  2VRG A;  1DT7 B;  4MSP A;  1MXL C;  5KSZ A;  4USL A;  1BR4 B;  1CDP A;  2NCO A;  2GGM A;  1G8I A;  1RJV A;  3DVE A;  5FI7 A;  2KFH A;  1RK9 A;  4TNC A;  2OTG B;  2WC8 A;  3O2P A;  5KU1 A;  1SL9 A;  2BCB A;  4QJ4 B;  1YVH A;  2H8V A;  1JC2 A;  1NX2 A;  2I7A A;  2M1U A;  2CTN A;  2LLS A;  2QAC A;  1E8A A;  3NSL A;  1MR8 A;  2BE4 A;  1QAT A;  2WCJ A;  5HLO A;  3CZ2 A;  1BOD A;  2PQL A;  1K94 A;  3NSK A;  1F70 A;  1A29 A;  2ZRT A;  1IH0 A;  2H61 C;  3SIB A;  3EK4 A;  3SG2 A;  3PN7 B;  1C7V A;  3PSR A;  2E30 A;  5G08 A;  1DJH A;  5PAL A;  1KCY A;  4YRU A;  3FE9 A;  3TZ1 A;  3VRO A;  1TOP A;  3RM1 A;  2KLE A;  1PUL A;  2JC2 A;  2KQ6 A;  3CR5 X;  4YGD B;  4QJ3 B;  1LA3 A;  4MVF A;  1LVC D;  2LV7 A;  1QXP A;  3CR2 A;  1F71 A;  1K2H A;  2Y1M A;  4DRW A;  3SS3 A;  3MSE B;  1LXF C;  4N1F A;  4PHM A;  1Z4H A;  1DGV A;  1TRF A;  3S0D A;  2LCP A;  2YGU A;  3SG7 A;  1S5G Y;  2MA2 A;  1N65 A;  1KWO C;  3D74 A;  2I2R E;  2P70 A;  3IVT A;  1B8C A;  1WLZ A;  3RZS A;  3GOF A;  2BCA A;  3AAK A;  2LLU A;  2LNK A;  1XVJ A;  2HPS A;  3I5H B;  1S1E A;  1LKJ A;  1NX1 A;  1YUS A;  1YX8 A;  2L51 A;  2PSR A;  4YGA A;  2ZN8 A;  1CFC A;  1DJX A;  1F54 A;  1J1E A;  1XK4 C;  4I5J A;  1TTX A;  3LL8 B;  3NGV A;  4INW A;  1AHR A;  3KO0 A;  3R1V A;  1F8H A;  2BCX A;  2NXQ A;  4N1G A;  2JQ6 A;  1IRJ A;  2M3W A;  4JKT A;  1QLK A;  1ALV A;  1FW4 A;  2CNP A;  4YGC B;  1L2O B;  3CZ0 A;  1S5G Z;  3PM8 A;  2RGI A;  3ICB A;  2K60 A;  2LVI A;  4P5O E;  2L4I A;  1OE9 B;  5FI6 A;  1TNX A;  3O6B A;  1Y0V H;  1SYM A;  3BYA A;  4CFQ A;  4PT1 A;  4XJK B;  2LHL A;  1BR1 B;  1BF5 A;  1CMF A;  2WCF A;  3I5G B;  2M29 A;  1FI5 A;  1AJ4 A;  1PRW A;  1DJZ A;  2HET A;  1EJ3 A;  1QAS A;  2M97 A;  5ER4 X;  4C0J A;  1J1D A;  4FQO A;  1YX7 A;  2JTT A;  1A75 B;  1CLM A;  3D0Y A;  4JD9 A;  2PMY A;  1H4B A;  2K8M B;  2NLN A;  2JNF A;  3CZT X;  5AER A;  5HKY A;  1QS7 A;  2K7C A;  4P2Y B;  3VB1 A;  3DD4 A;  1MQ1 A;  2NCP A;  3F45 A;  3FE8 A;  1B1G A;  3OBV A;  3OX6 A;  2M0R A;  1K9U A;  1SRA A;  2KLD A;  3TDI A;  4C0L A;  1KK7 Y;  5K89 A;  3I5I C;  5CPV A;  3JVT C;  1SCM B;  2NZ0 A;  3HX4 A;  1XFU O;  4HRG A;  3CYZ A;  3CR4 X;  1Z2C B;  1NUB A;  2EC6 C;  1HT9 A;  1Y1A A;  1DF0 A;  3K1E A;  2K0J A;  2EGD A;  1SPY A;  4GGN A;  1AVS A;  1OW4 A;  3EKH A;  3WHT B;  4DUQ A;  4PAL A;  2KAX A;  5HLV A;  4R1E A;  4OR9 B;  3B87 A;  5I2O A;  5JOL A;  1TWO A;  2FOT A;  2KI4 B;  4GAO A;  3SS5 A;  4QJ5 B;  1FF1 A;  2LHI A;  2LVV A;  2QPT A; 
#chains in the Genus database with same CATH homology
 3KHE A;  3ZNI A;  2FJU B;  1H8B A;  5I2L A;  1EXR A;  1A03 A;  1HQV A;  1WRL A;  2O60 A;  2WOR A;  5HYD A;  2P6B B;  2R2I A;  4NDC A;  3LCP C;  2LM5 A;  4C0K A;  3TS5 C;  1KK7 Z;  3AKB A;  2FCD A;  1NX0 A;  1R6P A;  3FS7 A;  1AJ5 A;  2PAL A;  4PHN A;  1TNQ A;  1TNW A;  2BBM A;  2SCP A;  2PRU A;  2WOS A;  1CFD A;  2SAS A;  1KFX L;  2ZKM X;  4M2Q A;  3I5F B;  3QRX A;  1KK8 B;  1R2U A;  4BY5 A;  1XFY O;  1ZAC A;  2WCB A;  5AFP A;  2LLT A;  3LLE A;  1QVI Y;  2H61 A;  1WRZ A;  2JWW A;  3EVR A;  3BUW B;  4MRX A;  5ER5 A;  5BPJ A;  1WDC B;  1AP4 A;  1B4C A;  1BT6 A;  3JTD C;  3KF9 A;  2AMI A;  2A4J A;  1CDL A;  1CTR A;  1LIN A;  2I94 A;  2JNX A;  4HRE E;  1SR6 C;  4YI9 A;  1JFJ A;  2H2K A;  2I18 A;  3EVU A;  1CDM A;  2LVK A;  1KFU L;  3NSO A;  3SJS A;  1JFK A;  1K9K A;  3E3R A;  1GJY A;  4MBE A;  1JSA A;  3NSI A;  1CLB A;  3VRP A;  5I8N A;  2M8U A;  1K95 A;  1IQ3 A;  2BKI B;  4GFT A;  2OS8 B;  1QVI Z;  1NYA A;  2CT9 A;  3TUY C;  3A4U B;  1XYD A;  1SK6 D;  1KSO A;  2BL0 C;  1TN4 A;  1PVA A;  1RFJ A;  4OCI A;  2LMT A;  3OHM B;  4CLN A;  1M39 A;  1EH2 A;  1CB1 A;  1BLQ A;  2JXC A;  4I5N B;  4JPZ B;  1XK4 A;  1A2X A;  1BMO A;  4PE1 A;  1ODB A;  4DCK A;  4IL1 A;  2M1K B;  3BUX B;  2K61 A;  4OKH A;  2F33 A;  2JZI A;  2G9B A;  1WY9 A;  2KOT A;  1Q80 A;  5CSF A;  1PAL A;  2G2B A;  3VGO A;  1YUU A;  1F4O A;  1G33 A;  2FCE A;  2HF5 A;  4MLW A;  2K7D A;  5IBW A;  1B7T Y;  1SKT A;  1YUR A;  1B9A A;  1KQM C;  3DF0 A;  1BU3 A;  2JOJ A;  1IJ5 A;  4GUK A;  1QX2 A;  1MUX A;  2K2A A;  1UUS A;  1BOC A;  3BUO B;  1UHI A;  1BG1 A;  1SL7 A;  3FWB A;  1ALW A;  5DKR A;  2IS9 A;  2KSP A;  3SG5 A;  2COL B;  2MLE C;  3TDZ A;  1S6I A;  1FBV A;  3KEV A;  4F0Z B;  4AQJ A;  4Q04 A;  1DJG A;  1UP5 A;  2OTG C;  1B7T Z;  3IQQ A;  3TDU A;  1IQ5 A;  2LUX A;  4ZCV A;  1CMG A;  3BUN B;  4YGB B;  4WQ2 A;  1DJY A;  4MZK A;  1MF8 B;  2L0P A;  2JU0 A;  2K7O A;  2KNE A;  2HQ8 A;  2L50 A;  4GGF C;  1MXE A;  1OMV A;  2L5X B;  3DVK A;  4WQ3 A;  2KI6 D;  5B8I B;  4ZCU A;  3SG6 A;  1KQV A;  1W7J B;  3D10 A;  1S3P A;  1NSH A;  1CM4 A;  2KDH A;  3PN7 C;  4N5X A;  1X02 A;  1OZS A;  1KFX S;  1RTP 1;  2L98 A;  4WRI A;  3PAT A;  1C7W A;  3NXA A;  1K9P A;  1QIW A;  1QTX A;  1SMG A;  5J3X A;  1J7O A;  1IWQ A;  2WND A;  3LK1 A;  2BL0 B;  1M45 A;  2MAZ A;  3EVV A;  3PAL A;  1AK8 A;  3LK0 A;  5HKW A;  4YI8 A;  1MWN A;  2LVJ A;  1UWO A;  4YGE B;  1AUI B;  5CSN A;  2AAO A;  4AQI A;  1QJT A;  2KGB C;  1M63 B;  2Y1N A;  3PFV A;  2KAY A;  2LUC A;  2PAS A;  2DOQ A;  3OP0 A;  4ORB B;  1KSM A;  2V53 A;  1S6C A;  3M0W A;  4MRY A;  1XFX O;  1XO5 A;  2K7B A;  1K96 A;  3DVM A;  1KWO B;  1SW8 A;  1ZOT B;  4PE7 A;  5F6T A;  1Y6W A;  4CPV A;  1F55 A;  3I5H C;  2F2O A;  1QIV A;  1J7R A;  2GGZ A;  2LP2 A;  3BOW A;  2F3Z A;  1IJ6 A;  1RRO A;  2KFF A;  2LAP A;  4PE4 A;  4MEW A;  1XFV O;  2ZRS A;  4I5L B;  1Y1U A;  2CBL A;  2JXL A;  2ZND A;  1PVB A;  3AKA A;  1A75 A;  2KAV A;  1GGZ A;  1F4Q A;  1MHO A;  4MZL A;  1L2O C;  5JJG A;  2ZNE A;  1JF2 A;  2TN4 A;  1PSR A;  1FPW A;  5DKQ A;  3CS1 A;  2KBM A;  2F3Y A;  2JUL A;  2LC5 A;  1OOJ A;  2KYF A;  3AAJ A;  4FTG A;  3I5G C;  4U8D A;  1XA5 A;  1OZO A;  1CFF A;  4ORA B;  4NDD A;  3DF0 B;  1CNP A;  2L2E A;  1G4Y R;  1B47 A;  3SIA A;  1W7I B;  1QX5 B;  2F2P A;  2LAN A;  4AOM A;  1SNL A;  1U5I A;  3DVJ A;  2JT0 A;  3SG4 A;  1K90 D;  2AUC A;  2M7L A;  1CDN A;  1SCM C;  1YRT B;  4HRH A;  3PLF B;  2Y5I A;  1J55 A;  3I5I B;  3JVT B;  1NPQ A;  4GNK B;  3RLZ A;  1NCY A;  1K8U A;  2EC6 B;  1CM1 A;  3CTN A;  1IG5 A;  4ETO A;  2KI4 C;  2ZFD A;  3CLN A;  2LP3 A;  3EK7 A;  1DGU A;  2WCE A;  3D0Y B;  4M2O A;  2D8N A;  1JF0 A;  2HQW A;  5D7F A;  2MRD A;  1CKK A;  1C07 A;  3WNX B;  4PHK A;  4OV2 A;  2MBX A;  2GV5 A;  4NQG A;  1QLS A;  4JWQ A;  1S36 A;  1OMR A;  3O78 A;  5AAN A;  1M31 A;  1NIW A;  3EK8 A;  3TS5 B;  1DMO A;  1DTL A;  4MZJ A;  4PDZ A;  2LMV A;  1JUO A;  1QV0 A;  1UHK A;  1NX3 A;  3GK1 A;  1S6J A;  1DF0 B;  5D69 A;  5GQQ C;  2KQY A;  2L4H A;  1FI6 A;  2KGR A;  4PCW A;  2BBN A;  2BKH B;  4GBA A;  1YVL A;  2KBI A;  2E6W A;  4GGF A;  2KHN A;  3I5F C;  1KK8 C;  4UPG A;  1K93 D;  4HSZ A;  1SL8 A;  1V1G A;  5I2Q A;  1TCO B;  2JTZ A;  3A8R A;  4ICB A;  3CWG A;  4BY4 A;  3WHU B;  1S26 D;  3EKJ A;  1TIZ A;  1N2D A;  1ZMZ A;  1J7Q A;  1QX7 A;  1V1F A;  3BXK A;  5CSI A;  3HCM A;  3ZWH A;  1WDC C;  1NCX A;  5AXI A;  4E68 A;  1L7Z A;  1NP8 A;  2KFG A;  4MN0 A;  1IKU A;  1JBA A;  3JTD B;  1A4P A;  1OSA A;  2CXJ A;  1RWY A;  1WRK A;  2OPO A;  4PE0 A;  4DIR A;  2JRF A;  1SR6 B;  1N0Y A;  5FYX A;  4D1E A;  4ORC B;  1YUT A;  2BEC A;  3OX5 A;  1NWD A;  2ISD A;  4DS7 A;  1DJI A;  3BOW B;  2OS8 C;  1WLM A;  1TNP A;  3BUM B;  3FIA A;  1TCF A;  2JPT A;  2F8P A;  2KYC A;  3H4S E;  3TUY B;  2M7N A;  1D1O A;  4I5K A;  4PHJ A;  1UHJ A;  2Q4U A;  1M46 A;  3OB2 B;  2CCM A;  2JT8 A;  3KPX A;  1EG4 A;  1ZUZ A;  4CFR A;  1OMD A;  1NCZ A;  1Y1X A;  2K2F A;  5AEQ A;  2LE9 B;  2LMU A;  1BJF A;  3VRQ A;  1B8R A;  1B8L A;  2O5G A;  4M2P A;  1OQP A;  1PSB A;  1CFP A;  2M49 B;  2B1U A;  2ZN9 A;  3IF7 A;  1GQM A;  5DKN A;  1IGV A;  5TNC A;  3WXA A;  3SG3 A;  1UHH A;  3C1V A;  4L9M A;  5CSJ A;  4OVN F;  3OB1 B;  1KFU S;  1REC A;  2BE6 A;  1YRU B;  4JQ0 D;  2MHH A;  2M9G A;  3O4Y A;  3K21 A;  1GGW A;  2Y4Q A;  4A4B A;  1YR5 A;  4NDB A;  1EG3 A;  4YBH B;  1SBJ A;  1JWD A;  1U5I B;  2PVB A;  4XJK A;  2JT3 A;  3FWC A;  1QV1 A;  2EHB A;  5KTY A;  1SCV A;  1XFW O;  1XFZ O;  3GK2 A;  1CLL A;  2MJW B;  1KQM B;  4GPL B;  3CGA A;  3IQO A;  1LA0 A;  1UUR A;  2MLF C;  3VRN A;  3VRR A;  4CID A;  3GK4 X;  1DVI A;  2Q91 A;  5HKZ A;  1DJW A;  1YTZ C;  1EL4 A;  4XYN A;  1J7P A;  3BQ3 A;  1ZFS A;  2KI6 C;  4A4C A;  1SY9 A;  1PK0 D;  2VRG A;  1UHN A;  1VRK A;  1DT7 B;  4MSP A;  1MXL C;  5KSZ A;  4USL A;  1BR4 B;  1CDP A;  2NCO A;  2GGM A;  1G8I A;  1RJV A;  3DVE A;  2KFH A;  1RK9 A;  4TNC A;  2OTG B;  2WC8 A;  3O2P A;  5KU1 A;  1SL9 A;  2BCB A;  4QJ4 B;  1YVH A;  1JC2 A;  1NX2 A;  2I7A A;  2M1U A;  2CTN A;  2LLS A;  2QAC A;  1E8A A;  3NSL A;  1MR8 A;  2BE4 A;  1QAT A;  5HLO A;  1BOD A;  3NSK A;  1K94 A;  1F70 A;  1A29 A;  2ZRT A;  1IH0 A;  2H61 C;  3SIB A;  3EK4 A;  3SG2 A;  3PN7 B;  1C7V A;  3PSR A;  2E30 A;  5G08 A;  1DJH A;  5PAL A;  1KCY A;  4YRU A;  3TZ1 A;  3VRO A;  1TOP A;  3RM1 A;  1PUL A;  2JC2 A;  2KQ6 A;  3CR5 X;  4YGD B;  4QJ3 B;  1LA3 A;  4MVF A;  1LVC D;  2LV7 A;  1QXP A;  3CR2 A;  1F71 A;  1K2H A;  2Y1M A;  4DRW A;  3MSE B;  1LXF C;  4N1F A;  4PHM A;  1DGV A;  1TRF A;  2LCP A;  3SG7 A;  1S5G Y;  2MA2 A;  1N65 A;  1KWO C;  2I2R E;  1B8C A;  1WLZ A;  3GOF A;  2BCA A;  3AAK A;  2LLU A;  2LNK A;  1XVJ A;  2HPS A;  3I5H B;  1S1E A;  1LKJ A;  1NX1 A;  1YUS A;  1YX8 A;  2L51 A;  2PSR A;  4YGA A;  2ZN8 A;  1CFC A;  1DJX A;  1F54 A;  1J1E A;  1XK4 C;  4I5J A;  1TTX A;  3LL8 B;  1AHR A;  3KO0 A;  1F8H A;  2BCX A;  2NXQ A;  4N1G A;  2JQ6 A;  1IRJ A;  2M3W A;  1QLK A;  1ALV A;  1FW4 A;  2CNP A;  4YGC B;  1L2O B;  1S5G Z;  3PM8 A;  2RGI A;  3ICB A;  2LVI A;  4P5O E;  2L4I A;  1OE9 B;  1TNX A;  3O6B A;  1Y0V H;  1SYM A;  3BYA A;  4CFQ A;  4XJK B;  2LHL A;  1BR1 B;  1BF5 A;  1CMF A;  2WCF A;  3I5G B;  2M29 A;  1FI5 A;  1AJ4 A;  1PRW A;  1DJZ A;  2HET A;  1EJ3 A;  1QAS A;  2M97 A;  5ER4 X;  4C0J A;  1J1D A;  4FQO A;  1YX7 A;  2JTT A;  1A75 B;  1CLM A;  3D0Y A;  1H4B A;  2PMY A;  2K8M B;  2NLN A;  2JNF A;  3CZT X;  5AER A;  5HKY A;  1QS7 A;  2K7C A;  4P2Y B;  3DD4 A;  1MQ1 A;  2NCP A;  3F45 A;  1B1G A;  3OX6 A;  2M0R A;  1K9U A;  1SRA A;  3TDI A;  4C0L A;  1KK7 Y;  5K89 A;  3I5I C;  5CPV A;  3JVT C;  1SCM B;  2NZ0 A;  3HX4 A;  1XFU O;  4HRG A;  3CR4 X;  1NUB A;  2EC6 C;  1HT9 A;  1Y1A A;  1DF0 A;  2K0J A;  2EGD A;  1SPY A;  4GGN A;  1AVS A;  4DUQ A;  3EKH A;  3WHT B;  4PAL A;  2KAX A;  5HLV A;  4R1E A;  4OR9 B;  5I2O A;  5JOL A;  2FOT A;  2KI4 B;  4GAO A;  1FF1 A;  4QJ5 B;  2LHI A;  2LVV A;  2QPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...