1B4CA

Solution structure of rat apo-s100b using dipolar couplings
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN (S-100 PROTEIN, BETA CHAIN)
publication title The use of dipolar couplings for determining the solution structure of rat apo-S100B(betabeta).
pubmed rcsb
source organism Rattus norvegicus
total genus 24
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b4cA00
3AAJA 2BCAA 2K7BA 4ORCB 3BUOB 4AOMA 1EG4A 2JT3A 2MA2A 4WQ2A 3KPXA 1F4QA 2LM5A 4C0KA 3JTDB 2B1UA 1QV1A 2Q4UA 1F8HA 5JJGA 3I5IC 2MLEC 3O78A 1IRJA 4GGFA 4ORBB 4PHKA 3TS5B 1JF0A 5HLVA 1KWOB 5AANA 1SRAA 4MZJA 4YRUA 2LUCA 2KI6D 4PE1A 1HQVA 1V1GA 2KBMA 3O4YA 3DD4A 2LVKA 2BCXA 2M29A 3WXAA 1YX8A 4GPLB 4GAOA 2JPTA 1GGWA 1SL8A 2FCDA 2OS8B 3FS7A 1IJ5A 1J1DA 1M46A 2QPTA 3SG6A 1ZACA 4MRXA 1DJHA 3O6BA 3AAKA 1GGZA 5HKZA 3JVTB 3BUXB 4PHNA 1CFDA 2LUXA 1NP8A 3D10A 3EVRA 2SASA 1CLBA 1TOPA 4CPVA 3E3RA 1EL4A 3BYAA 1B7TZ 2BL0C 3IF7A 4GGFC 2LMUA 3EK7A 2KDHA 1UHJA 1IG5A 4M2OA 4R1EA 1BMOA 1QVIY 2L4HA 2LMTA 4CIDA 1KFUS 2EGDA 1YVLA 2KI6C 4I5NB 5CSIA 1MUXA 1ODBA 1YURA 2L5XB 1UHIA 2LANA 1SBJA 1XFUO 2K7DA 2KFHA 3FIAA 2K2FA 4OVNF 3ZNIA 3TS5C 1MXEA 1ALVA 3DVMA 5AFPA 5DKNA 4M2QA 1OMDA 2BCBA 4N5XA 3SG7A 2LVJA 1BODA 1AP4A 2JT8A 3BXKA 4I5LB 4YGCB 1GQMA 1RJVA 2LMVA 1R2UA 2P6BB 2HETA 5GQQC 2G9BA 1QV0A 3OX6A 3K21A 4GBAA 2H61A 2L51A 3NSLA 1X02A 4NQGA 2KAVA 3FWCA 3D0YB 2BE6A 1K9KA 3SG5A 5D69A 2VRGA 4A4BA 1A75B 1F4OA 2JC2A 1S36A 2LVVA 3EK4A 3O2PA 4NDBA 3TDIA 4CLNA 1BU3A 5K89A 3HX4A 1CFCA 4D1EA 5FYXA 4NDDA 1NCZA 2KGBC 4XJKA 3GK2A 4JQ0D 1DF0B 3DF0B 1B8RA 1LA0A 1QX5B 1K94A 1KK8C 1RWYA 1UHHA 2FJUB 4C0JA 4QJ4B 1IH0A 1XO5A 3BQ3A 3TDUA 1OSAA 1DT7B 1WDCB 3CR2A 4CFQA 1WRLA 1FBVA 3M0WA 1LXFC 1BR4B 2Y5IA 2H61C 4GGNA 1AVSA 1WRKA 4YBHB 4QJ5B 2GV5A 2JZIA 1D1OA 3PFVA 2D8NA 3CWGA 3LLEA 2ZN9A 1B9AA 2O5GA 1K90D 3OHMB 1DF0A 3CLNA 1LINA 2KAYA 1Y1XA 2M7LA 1AHRA 4PE4A 2BKHB 2MJWB 2V53A 4PDZA 2CBLA 5I2LA 2K0JA 4PHJA 4C0LA 5AERA 1XK4A 2M8UA 1F54A 3I5GC 1SCMC 3CTNA 4XYNA 1MQ1A 1TIZA 1GJYA 1PVAA 2NZ0A 1PALA 1Q80A 2H2KA 1DGVA 1MXLC 3WHUB 2EC6B 3WHTB 1CMFA 2JXCA 2KYFA 1FW4A 1SL7A 1TNQA 1J7OA 1QX2A 3CGAA 1AJ5A 1OZSA 2MAZA 3KEVA 4ICBA 1LA3A 1CNPA 4BY5A 1KQMB 1A29A 1H4BA 1CLLA 4DS7A 1NSHA 2GGMA 2ISDA 1YR5A 1KFUL 5ER5A 1QTXA 2JULA 1U5IA 5B8IB 1BR1B 1K2HA 1CTRA 1G33A 1M39A 1YUTA 2R2IA 3BUWB 2LV7A 1XK4C 1EH2A 3HCMA 5DKRA 2M7NA 1YTZC 1RECA 1CDLA 1NX2A 1JUOA 3PATA 1S5GY 2FOTA 2KSPA 2F33A 4WQ3A 2LVIA 1CFFA 1L2OB 1OMRA 4ZCVA 1VRKA 1C7VA 4MZLA 2IS9A 1Y1AA 2WOSA 3PALA 1IJ6A 1FF1A 2KHNA 3F45A 1OZOA 4L9MA 4YI8A 3DVJA 3PN7B 1C07A 2BECA 3PLFB 1CKKA 2JQ6A 2KNEA 3A4UB 3OB2B 2K7OA 1CDPA 1B1GA 1PVBA 2KQ6A 2EC6C 2KYCA 1A03A 2G2BA 2LAPA 2MHHA 1DJXA 1CFPA 1AUIB 2KI4B 5TNCA 2LHLA 1J55A 1DJZA 1MF8B 1KQVA 3EVUA 1KQMC 4YGDB 1OQPA 4ETOA 1WLZA 2LCPA 1KFXS 3JTDC 3NXAA 4USLA 1F55A 2NCOA 3QRXA 1EXRA 3SG2A 5JOLA 2WORA 2KQYA 2F3YA 1K95A 1KWOC 3TZ1A 1JSAA 2L2EA 2L50A 3EKJA 1WRZA 4PE0A 2HF5A 4AQIA 1N65A 1BG1A 5I2OA 3VGOA 4F0ZB 2LLUA 4FQOA 1QVIZ 1Y1UA 1QIWA 1L2OC 2OS8C 1XFZO 1SK6D 1XVJA 1ZFSA 5AEQA 2LHIA 4N1FA 1TN4A 2K2AA 3JVTC 4A4CA 1BT6A 2L0PA 4P5OE 1LKJA 4DUQA 5BPJA 3PN7C 2PASA 4U8DA 2E30A 4ORAB 2OPOA 1SNLA 1QX7A 3SIBA 2Y4QA 1JF2A 1UWOA 1TNPA 4MSPA 2KAXA 3ICBA 3PSRA 1J1EA 2NXQA 1HT9A 3VRRA 1QLKA 3RM1A 1QIVA 2F8PA 1NWDA 2ZNEA 2KI4C 3D0YA 1PULA 1DTLA 5CPVA 1N0YA 4GUKA 4JPZB 4PE7A 1PSRA 3FWBA 1A75A 3KHEA 2DOQA 5F6TA 3KO0A 2M3WA 1SY9A 2Q91A 1OOJA 1EJ3A 1KK7Y 2BE4A 1UURA 1YX7A 3AKAA 5IBWA 1WY9A 3BUMB 4MN0A 1NUBA 2JWWA 4HRGA 5G08A 2LLSA 2SCPA 1RFJA 2CT9A 1S1EA 3DF0A 1TCFA 3LCPC 4CFRA 1K93D 1NIWA 4ZCUA 1YRTB 2KOTA 1BJFA 1OE9B 1TCOB 1IQ5A 3A8RA 3ZWHA 4YI9A 2JOJA 4JWQA 2M49B 2JRFA 3I5IB 3VRQA 1IKUA 1K9UA 2BBNA 1TTXA 3PM8A 1TRFA 1BOCA 4MEWA 1UUSA 1KK7Z 1NX0A 1YUUA 2I2RE 4P2YB 1SW8A 1XYDA 2HQ8A 4Q04A 4YGEB 1V1FA 2COLB 4UPGA 3H4SE 3CZTX 4N1GA 2LNKA 2NLNA 1IGVA 3RLZA 4IL1A 1CMGA 5HLOA 1SL9A 5AXIA 5HYDA 1SYMA 1WDCC 2K8MB 1G8IA 3NSOA 1WLMA 1NPQA 2BL0B 1XFWO 3BOWB 4I5KA 1J7QA 1RK9A 1NCYA 1Y0VH 5KTYA 2WNDA 1NX3A 4DRWA 1SCVA 1FI5A 2K61A 2CCMA 1TNWA 1R6PA 5D7FA 2NCPA 3LK0A 4MBEA 1JFJA 1KCYA 1CLMA 1PSBA 2A4JA 2LP3A 5CSJA 2MRDA 5HKYA 3I5FB 1F71A 1BLQA 1S6IA 1M45A 2CTNA 3OX5A 4DIRA 3BOWA 4OKHA 3I5HB 1CM1A 1C7WA 4GFTA 3DVEA 1B7TY 2EHBA 2I94A 2HQWA 2F2OA 1KSOA 1S5GZ 2KBIA 1B4CA 1XFYO 2M97A 1PRWA 2PVBA 1MWNA 1SR6B 2M1KB 2F2PA 2GGZA 4TNCA 1FI6A 1DJYA 2WCFA 1LVCD 3DVKA 4HRHA 4DCKA 4MRYA 3SG3A 4WRIA 2JXLA 1M31A 2JTTA 1N2DA 1JFKA 2BBMA 4MLWA 1CB1A 5KSZA 3CS1A 1B8LA 3TDZA 1E8AA 2PMYA 2BKIB 3IQOA 2ZRTA 3OP0A 2AUCA 3VROA 2KFFA 1QASA 1MR8A 2MLFC 4FTGA 1F70A 1YRUB 2JNXA 1IWQA 2FCEA 1KK8B 3VRPA 1ALWA 3LL8B 2AMIA 1QXPA 2K7CA 2CXJA 1DJGA 2WCEA 3CR4X 5I2QA 2L4IA 4HSZA 5ER4X 1RTP1 1H8BA 1B47A 1DGUA 1W7JB 3I5FC 2CNPA 3GOFA 2OTGB 4PCWA 2QACA 5HKWA 3NSIA 1S6JA 3I5HC 1ZMZA 1MHOA 4AQJA 1CDMA 1K96A 1OMVA 5DKQA 1FPWA 1W7IB 3BUNB 1QLSA 1TNXA 1YVHA 2MBXA 3EK8A 2I7AA 4XJKB 3SG4A 1BF5A 1SR6C 1XFVO 4PALA 1G4YR 5J3XA 2ZRSA 4GNKB 1RROA 2F3ZA 3I5GB 1SCMB 1JC2A 5I8NA 3TUYB 1DVIA 5CSFA 1AK8A 3MSEB 1XA5A 4BY4A 1YUSA 1ZUZA 1UP5A 1DJIA 5CSNA 1JBAA 2WCBA 1CM4A 1S26D 3WNXB 2LE9B 2PALA 2ZNDA 3C1VA 2WC8A 1Y6WA 2O60A 2HPSA 4MZKA 3AKBA 3CR5X 1SMGA 2PSRA 2E6WA 1L7ZA 1PK0D 1J7PA 2JU0A 4OV2A 1QJTA 5PALA 4YGAA 1A2XA 3GK1A 4MVFA 2M1UA 2LLTA 3VRNA 1CDNA 2Y1NA 1K8UA 1NX1A 5KU1A 2Y1MA 2JTZA 4PHMA 1DJWA 1KSMA 2JT0A 3SIAA 4E68A 3LK1A 1JWDA 2OTGC 3SJSA 1AJ4A 2I18A 1QATA 1XFXO 2TN4A 1B8CA 1NYAA 3EVVA 1SKTA 1A4PA 2PRUA 2KGRA 3EKHA 3OB1B 2AAOA 2KFGA 1QS7A 3GK4X 3KF9A 2ZKMX 4HREE 4NDCA 1S6CA 2M0RA 2M9GA 4I5JA 1UHNA 1NCXA 1M63B 1J7RA 2ZFDA 4YGBB 1IQ3A 2ZN8A 1DMOA 2JNFA 3TUYC 3NSKA 2L98A 4OR9B 1KFXL 1U5IB 1UHKA 4OCIA 3IQQA 1SPYA 2LP2A 4QJ3B 1ZOTB 2RGIA 1S3PA 2LC5A 1EG3A 1K9PA 4M2PA
chains in the Genus database with same CATH superfamily
3AAJA 2BCAA 2K7BA 4ORCB 3BUOB 4AOMA 1EG4A 2JT3A 2MA2A 4WQ2A 3KPXA 1F4QA 2LM5A 3CZ1A 5FI7A 4C0KA 3JTDB 2B1UA 1QV1A 2Q4UA 1F8HA 5JJGA 3I5IC 2MLEC 3O78A 1IRJA 1Z2CB 4GGFA 4ORBB 4PHKA 3TS5B 1JF0A 3NHIA 5HLVA 1KWOB 5AANA 1SRAA 4MZJA 4YRUA 1LS8A 2LUCA 2KI6D 4PE1A 1HQVA 1V1GA 2KBMA 3O4YA 3DD4A 3OGNA 2LVKA 2BCXA 2M29A 2KLDA 3WXAA 1YX8A 4GPLB 4GAOA 2JPTA 5DICA 1SL8A 2FCDA 2OS8B 1GGWA 3FS7A 4OZDA 1IJ5A 1J1DA 1M46A 2QPTA 3SG6A 1ZACA 4MRXA 1DJHA 3O6BA 4IJ7A 3AAKA 1GGZA 5HKZA 3JVTB 3BUXB 4PHNA 1CFDA 2LUXA 5HL1A 1NP8A 3D10A 3EVRA 2SASA 1CLBA 1TOPA 3SS4A 4CPVA 3E3RA 1EL4A 3BYAA 1B7TZ 2BL0C 3IF7A 4GGFC 3V2LA 3CYZA 2LMUA 3EK7A 2KDHA 1UHJA 1IG5A 4M2OA 4R1EA 1BMOA 2GTEA 1DELA 1QVIY 1DC1A 2L4HA 2LMTA 4CIDA 1KFUS 2EGDA 1YVLA 2KI6C 3PM2A 4I5NB 5CSIA 1MUXA 1ODBA 1YURA 2L5XB 1UHIA 2LANA 1SBJA 1XFUO 2K7DA 2KFHA 3FIAA 2QEVA 2K2FA 4OVNF 3ZNIA 3TS5C 1MXEA 1ALVA 3DVMA 5AFPA 2QEHA 5DKNA 4M2QA 1OMDA 2BCBA 4N5XA 3SG7A 2LVJA 1BODA 1AP4A 2JT8A 3BXKA 4I5LB 4YGCB 1GQMA 1RJVA 2LMVA 1R2UA 2P6BB 2HETA 5GQQC 2G9BA 1OW4A 1QV0A 3OX6A 3K21A 4GBAA 2H61A 2L51A 3NSLA 1X02A 4NQGA 2KAVA 3FWCA 3D0YB 3VB1A 2WC5A 2BE6A 1K9KA 2QEOA 3SG5A 5D69A 3RZSA 2VRGA 4A4BA 1A75B 1F4OA 2JC2A 1S36A 2LVVA 3EK4A 3O2PA 4NDBA 3TDIA 4CLNA 1BU3A 5K89A 3HX4A 1CFCA 4D1EA 5FYXA 4NDDA 1NCZA 2KGBC 4XJKA 3GK2A 4JQ0D 1XFRA 1DF0B 3DF0B 1B8RA 1LA0A 1QX5B 1K94A 1KK8C 1RWYA 1UHHA 2FJUB 2JPOA 3DZTA 1OOHA 4C0JA 1XO5A 4QJ4B 3BQ3A 3L47A 3TDUA 1OSAA 1DT7B 1WDCB 3CR2A 4CFQA 1WRLA 1FBVA 3M0WA 1LXFC 1BR4B 2Y5IA 2H61C 4GGNA 2PYQA 1AVSA 2WCKA 1WRKA 4YBHB 4QJ5B 2GV5A 2JZIA 1D1OA 3PFVA 2D8NA 3CWGA 3LLEA 2ZN9A 1B9AA 2O5GA 1K90D 1ORGA 3OHMB 1DF0A 3CLNA 4PT1A 1LINA 2KAYA 1Y1XA 2M7LA 1AHRA 1TUZA 3K1EA 4PE4A 5D3OA 1T14A 2BKHB 2MJWB 2V53A 4INWA 2CBLA 4PDZA 3B7AA 5I2LA 2K0JA 3OBVA 2P70A 4PHJA 4C0LA 5AERA 1XK4A 2M8UA 1F54A 3I5GC 1SCMC 3CTNA 4XYNA 1MQ1A 1TIZA 2L2CA 1GJYA 1PVAA 2NZ0A 1PALA 1Q80A 2H2KA 1DGVA 1MXLC 3WHUB 2EC6B 3WHTB 1CMFA 2KLEA 2JXCA 2KYFA 2QDIA 1FW4A 1SL7A 1TNQA 1J7OA 4JKTA 1QX2A 3CGAA 1AJ5A 1OZSA 2MAZA 3KEVA 4ICBA 1LA3A 1CNPA 4BY5A 1KQMB 1A29A 1H4BA 1CLLA 4DS7A 1NSHA 2GGMA 2ISDA 1YR5A 1KFUL 5ER5A 1QTXA 2JULA 1U5IA 5B8IB 1BR1B 1K2HA 1CTRA 1G33A 1C3ZA 1M39A 1YUTA 2R2IA 3BUWB 2LV7A 2P71A 1XK4C 2YGUA 1EH2A 3HCMA 5DKRA 2M7NA 1YTZC 1RECA 1CDLA 1NX2A 1JUOA 3D73A 3PATA 1S5GY 4JD9A 2FOTA 2KSPA 2F33A 4WQ3A 2LVIA 1CFFA 3PJIA 1L2OB 1OMRA 4ZCVA 3SS5A 1VRKA 1C7VA 4MZLA 2IS9A 1Y1AA 2WOSA 3PALA 1IJ6A 1FF1A 2KHNA 3F45A 1OZOA 5I94A 4L9MA 4YI8A 3DVJA 3PN7B 1C07A 2BECA 3PLFB 1CKKA 2JQ6A 2KNEA 3A4UB 3OB2B 2KPHA 2K7OA 1CDPA 1B1GA 1PVBA 2KQ6A 2EC6C 2KYCA 1A03A 3BFHA 2G2BA 2LAPA 2MHHA 1DJXA 1CFPA 1AUIB 2KI4B 5TNCA 2PQLA 2LHLA 1J55A 1DJZA 1MF8B 1KQVA 4INXA 3EVUA 1KQMC 4YGDB 1OQPA 4ETOA 1WLZA 2LCPA 1KFXS 3B6XA 3JTDC 3NXAA 4USLA 1F55A 1OOIX 2NCOA 3QRXA 1EXRA 3SG2A 5JOLA 2WORA 2KQYA 3N7HA 2F3YA 1K95A 1KWOC 3TZ1A 1JSAA 2L2EA 2L50A 3EKJA 1WRZA 4FQTA 4PE0A 2HF5A 4AQIA 1N65A 1BG1A 5FI6A 3VGOA 4F0ZB 3L4AA 5I2OA 2LLUA 4FQOA 1QVIZ 1Y1UA 1QIWA 3B87A 1DEKA 1L2OC 2OS8C 1XFZO 1SK6D 1XVJA 1ZFSA 5AEQA 3UNWA 2LHIA 4N1FA 1TN4A 2K2AA 3JVTC 4A4CA 1BT6A 2L0PA 4P5OE 1LKJA 4DUQA 5BPJA 3PN7C 2PASA 4U8DA 2E30A 4ORAB 2OPOA 1SNLA 1QX7A 1W9ZA 3SIBA 2Y4QA 1JF2A 1UWOA 1TNPA 4MSPA 2KAXA 3ICBA 3PSRA 1J1EA 2NXQA 1HT9A 3VRRA 1QLKA 3RM1A 1QIVA 2F8PA 1NWDA 2ZNEA 2KI4C 3D0YA 1PULA 1DTLA 2WCHA 1N0YA 5CPVA 3BFBA 4GUKA 3FE9A 4JPZB 4PE7A 1PSRA 3FWBA 1A75A 3KHEA 2DOQA 5F6TA 3KO0A 2M3WA 1SY9A 2Q91A 1OOJA 1EJ3A 1KK7Y 2BE4A 1UURA 2WCJA 1YX7A 3AKAA 5IBWA 1WY9A 3BUMB 4MN0A 1NUBA 2JWWA 4HRGA 3FE6A 2LLSA 2SCPA 5G08A 3S0EA 1RFJA 3B88A 2CT9A 1S1EA 2WCLA 1TCFA 3DF0A 3LCPC 4CFRA 1K93D 1NIWA 4ZCUA 1YRTB 2KOTA 1BJFA 1OE9B 1TCOB 1IQ5A 3A8RA 3ZWHA 4YI9A 2JOJA 3R1PA 2M49B 2JRFA 3I5IB 4JWQA 3VRQA 1IKUA 1K9UA 2BBNA 3S0BA 1TTXA 3PM8A 1TRFA 3D74A 4MEWA 1BOCA 1UUSA 2WCMA 1KK7Z 1NX0A 1YUUA 2I2RE 4P2YB 1OOFA 1SW8A 1XYDA 2HQ8A 4Q04A 4YGEB 1V1FA 2COLB 4UPGA 3H4SE 3CZTX 4N1GA 2LNKA 3CZ2A 2NLNA 1IGVA 3RLZA 4IL1A 1CMGA 5HLOA 1SL9A 3DY9A 5AXIA 3DXLA 3BJHA 5HYDA 1SYMA 1WDCC 2K8MB 1G8IA 3NSOA 1WLMA 1NPQA 2BL0B 3IVTA 1XFWO 3BOWB 4I5KA 1J7QA 1RK9A 1IH0A 1NCYA 1Y0VH 3CZ0A 5KTYA 2WNDA 1NX3A 4DRWA 1SCVA 1FI5A 2K61A 2CCMA 1TNWA 3CABA 1R6PA 3BFAA 5D7FA 2NCPA 3LK0A 4MBEA 1JFJA 1KCYA 1CLMA 1PSBA 2A4JA 2LP3A 5CSJA 2MRDA 5HKYA 4KYNA 4F7FA 2BNXA 3I5FB 1F71A 1BLQA 1S6IA 1GM0A 1M45A 2CTNA 3D77A 3NHTA 3OX5A 3FE8A 3BOWA 4DIRA 4OKHA 3I5HB 1CM1A 1C7WA 3NGVA 3DVEA 4GFTA 1B7TY 2EHBA 2I94A 2HQWA 2F2OA 1KSOA 3EG5B 1S5GZ 2KBIA 1B4CA 1XFYO 2M97A 1PRWA 2PVBA 1MWNA 1SR6B 2M1KB 2F2PA 2GGZA 4TNCA 1FI6A 1DJYA 2WCFA 1LVCD 3DVKA 4HRHA 4DCKA 4MRYA 3R1OA 3SG3A 3R72A 4WRIA 2JXLA 1M31A 2JTTA 1N2DA 2K60A 3O4XA 1JFKA 2BBMA 4MLWA 1CB1A 5KSZA 3CS1A 1B8LA 3TDZA 1E8AA 2PMYA 2BKIB 3IQOA 2ZRTA 3OP0A 3R1VA 2AUCA 3VROA 2KFFA 1QASA 1MR8A 2MLFC 4FTGA 1F70A 1YRUB 1TUJA 2JNXA 1IWQA 2FCEA 1KK8B 3VRPA 3S0DA 1ALWA 3LL8B 2AMIA 1QXPA 2K7CA 2CXJA 1DJGA 2WCEA 3CR4X 5EL2A 2L4IA 5I2QA 4HSZA 5ER4X 1RTP1 1H8BA 1B47A 1DGUA 1W7JB 3I5FC 2CNPA 1OOGA 1TWOA 2FJYA 3GOFA 2ERBA 2OTGB 4PCWA 2QACA 5HKWA 1C3YA 3NSIA 1S6JA 3I5HC 1ZMZA 1MHOA 4AQJA 1CDMA 1K96A 3L4LA 1OMVA 2L5YA 3D78A 5DKQA 2BAPA 1W7IB 1FPWA 3BUNB 1QLSA 3Q8IA 1TNXA 5FI2A 1YVHA 2MBXA 3EK8A 3S0AA 2I7AA 4XJKB 3SG4A 1BF5A 1SR6C 1XFVO 4PALA 1G4YR 5J3XA 2WC6A 2ZRSA 4GNKB 1RROA 2F3ZA 3I5GB 1SCMB 1JC2A 5I8NA 3TUYB 1DVIA 5CSFA 1AK8A 3MSEB 1XA5A 4BY4A 1YUSA 1ZUZA 1UP5A 1DJIA 5CSNA 3B86A 1JBAA 2WCBA 1CM4A 1S26D 3WNXB 2LE9B 2PALA 2ZNDA 3C1VA 2WC8A 3UO9A 3S0FA 1Y6WA 2O60A 2HPSA 4MZKA 3AKBA 3CR5X 1SMGA 2PSRA 3D75A 2E6WA 1L7ZA 1Z4HA 1PK0D 1J7PA 2JU0A 4OV2A 1QJTA 5PALA 4YGAA 1A2XA 3GK1A 4MVFA 2M1UA 2LLTA 3VRNA 1CDNA 3S0GA 2Y1NA 1K8UA 1NX1A 5KU1A 2Y1MA 2JTZA 4PHMA 1DJWA 1KSMA 2JT0A 3SIAA 4E68A 3LK1A 1JWDA 2OTGC 3DYEA 3SJSA 1AJ4A 1P28A 2I18A 1QATA 1SSEB 1XFXO 2TN4A 3CDNA 1B8CA 3SS3A 1NYAA 3EVVA 1SKTA 1IIOA 1A4PA 2PRUA 2KGRA 3EKHA 3OB1B 2AAOA 2KFGA 1QS7A 2QEBA 3GK4X 3KF9A 2ZKMX 4HREE 3D76A 4NDCA 1S6CA 2M0RA 2M9GA 4I5JA 3QMEA 1UHNA 1NCXA 1M63B 1J7RA 2ZFDA 4YGBB 1IQ3A 2ZN8A 1DMOA 2JNFA 3TUYC 3NSKA 2L98A 4OR9B 1KFXL 1U5IB 1UHKA 4OCIA 3IQQA 1SPYA 2LP2A 4QJ3B 1ZOTB 2RGIA 1QWVA 1S3PA 2LC5A 1DQEA 1EG3A 1K9PA 2H8VA 4M2PA
chains in the Genus database with same CATH topology
3AAJA 2BCAA 2K7BA 4ORCB 3BUOB 4AOMA 1EG4A 2JT3A 2MA2A 4WQ2A 3KPXA 1F4QA 2LM5A 4C0KA 3JTDB 2B1UA 1QV1A 2Q4UA 1F8HA 5JJGA 3I5IC 2MLEC 3O78A 1IRJA 4GGFA 4ORBB 4PHKA 3TS5B 1JF0A 5HLVA 1KWOB 5AANA 1SRAA 4MZJA 4YRUA 2LUCA 2KI6D 4PE1A 1HQVA 1V1GA 2KBMA 3O4YA 3DD4A 2LVKA 2BCXA 2M29A 3WXAA 1YX8A 4GPLB 4GAOA 2JPTA 1GGWA 1SL8A 2FCDA 2OS8B 3FS7A 1IJ5A 1J1DA 1M46A 2QPTA 3SG6A 1ZACA 4MRXA 1DJHA 3O6BA 3AAKA 1GGZA 5HKZA 3JVTB 3BUXB 4PHNA 1CFDA 2LUXA 1NP8A 3D10A 3EVRA 2SASA 1CLBA 1TOPA 4CPVA 3E3RA 1EL4A 3BYAA 1B7TZ 2BL0C 3IF7A 4GGFC 2LMUA 3EK7A 2KDHA 1UHJA 1IG5A 4M2OA 4R1EA 1BMOA 1QVIY 2L4HA 2LMTA 4CIDA 1KFUS 2EGDA 1YVLA 2KI6C 4I5NB 5CSIA 1MUXA 1ODBA 1YURA 2L5XB 1UHIA 2LANA 1SBJA 1XFUO 2K7DA 2KFHA 3FIAA 2K2FA 4OVNF 3ZNIA 3TS5C 1MXEA 1ALVA 3DVMA 5AFPA 5DKNA 4M2QA 1OMDA 2BCBA 4N5XA 3SG7A 2LVJA 1BODA 1AP4A 2JT8A 3BXKA 4I5LB 4YGCB 1GQMA 1RJVA 2LMVA 1R2UA 2P6BB 2HETA 5GQQC 2G9BA 1QV0A 3OX6A 3K21A 4GBAA 2H61A 2L51A 3NSLA 1X02A 4NQGA 2KAVA 3FWCA 3D0YB 2BE6A 1K9KA 3SG5A 5D69A 2VRGA 4A4BA 1A75B 1F4OA 2JC2A 1S36A 2LVVA 3EK4A 3O2PA 4NDBA 3TDIA 4CLNA 1BU3A 5K89A 3HX4A 1CFCA 4D1EA 5FYXA 4NDDA 1NCZA 2KGBC 4XJKA 3GK2A 4JQ0D 1DF0B 3DF0B 1B8RA 1LA0A 1QX5B 1K94A 1KK8C 1RWYA 1UHHA 2FJUB 4C0JA 4QJ4B 1IH0A 1XO5A 3BQ3A 3TDUA 1OSAA 1DT7B 1WDCB 3CR2A 4CFQA 1WRLA 1FBVA 3M0WA 1LXFC 1BR4B 2Y5IA 2H61C 4GGNA 1AVSA 1WRKA 4YBHB 4QJ5B 2GV5A 2JZIA 1D1OA 3PFVA 2D8NA 3CWGA 3LLEA 2ZN9A 1B9AA 2O5GA 1K90D 3OHMB 1DF0A 3CLNA 1LINA 2KAYA 1Y1XA 2M7LA 1AHRA 4PE4A 2BKHB 2MJWB 2V53A 4PDZA 2CBLA 5I2LA 2K0JA 4PHJA 4C0LA 5AERA 1XK4A 2M8UA 1F54A 3I5GC 1SCMC 3CTNA 4XYNA 1MQ1A 1TIZA 1GJYA 1PVAA 2NZ0A 1PALA 1Q80A 2H2KA 1DGVA 1MXLC 3WHUB 2EC6B 3WHTB 1CMFA 2JXCA 2KYFA 1FW4A 1SL7A 1TNQA 1J7OA 1QX2A 3CGAA 1AJ5A 1OZSA 2MAZA 3KEVA 4ICBA 1LA3A 1CNPA 4BY5A 1KQMB 1A29A 1H4BA 1CLLA 4DS7A 1NSHA 2GGMA 2ISDA 1YR5A 1KFUL 5ER5A 1QTXA 2JULA 1U5IA 5B8IB 1BR1B 1K2HA 1CTRA 1G33A 1M39A 1YUTA 2R2IA 3BUWB 2LV7A 1XK4C 1EH2A 3HCMA 5DKRA 2M7NA 1YTZC 1RECA 1CDLA 1NX2A 1JUOA 3PATA 1S5GY 2FOTA 2KSPA 2F33A 4WQ3A 2LVIA 1CFFA 1L2OB 1OMRA 4ZCVA 1VRKA 1C7VA 4MZLA 2IS9A 1Y1AA 2WOSA 3PALA 1IJ6A 1FF1A 2KHNA 3F45A 1OZOA 4L9MA 4YI8A 3DVJA 3PN7B 1C07A 2BECA 3PLFB 1CKKA 2JQ6A 2KNEA 3A4UB 3OB2B 2K7OA 1CDPA 1B1GA 1PVBA 2KQ6A 2EC6C 2KYCA 1A03A 2G2BA 2LAPA 2MHHA 1DJXA 1CFPA 1AUIB 2KI4B 5TNCA 2LHLA 1J55A 1DJZA 1MF8B 1KQVA 3EVUA 1KQMC 4YGDB 1OQPA 4ETOA 1WLZA 2LCPA 1KFXS 3JTDC 3NXAA 4USLA 1F55A 2NCOA 3QRXA 1EXRA 3SG2A 5JOLA 2WORA 2KQYA 2F3YA 1K95A 1KWOC 3TZ1A 1JSAA 2L2EA 2L50A 3EKJA 1WRZA 4PE0A 2HF5A 4AQIA 1N65A 1BG1A 5I2OA 3VGOA 4F0ZB 2LLUA 4FQOA 1QVIZ 1Y1UA 1QIWA 1L2OC 2OS8C 1XFZO 1SK6D 1XVJA 1ZFSA 5AEQA 2LHIA 4N1FA 1TN4A 2K2AA 3JVTC 4A4CA 1BT6A 2L0PA 4P5OE 1LKJA 4DUQA 5BPJA 3PN7C 2PASA 4U8DA 2E30A 4ORAB 2OPOA 1SNLA 1QX7A 3SIBA 2Y4QA 1JF2A 1UWOA 1TNPA 4MSPA 2KAXA 3ICBA 3PSRA 1J1EA 2NXQA 1HT9A 3VRRA 1QLKA 3RM1A 1QIVA 2F8PA 1NWDA 2ZNEA 2KI4C 3D0YA 1PULA 1DTLA 5CPVA 1N0YA 4GUKA 4JPZB 4PE7A 1PSRA 3FWBA 1A75A 3KHEA 2DOQA 5F6TA 3KO0A 2M3WA 1SY9A 2Q91A 1OOJA 1EJ3A 1KK7Y 2BE4A 1UURA 1YX7A 3AKAA 5IBWA 1WY9A 3BUMB 4MN0A 1NUBA 2JWWA 4HRGA 5G08A 2LLSA 2SCPA 1RFJA 2CT9A 1S1EA 3DF0A 1TCFA 3LCPC 4CFRA 1K93D 1NIWA 4ZCUA 1YRTB 2KOTA 1BJFA 1OE9B 1TCOB 1IQ5A 3A8RA 3ZWHA 4YI9A 2JOJA 4JWQA 2M49B 2JRFA 3I5IB 3VRQA 1IKUA 1K9UA 2BBNA 1TTXA 3PM8A 1TRFA 1BOCA 4MEWA 1UUSA 1KK7Z 1NX0A 1YUUA 2I2RE 4P2YB 1SW8A 1XYDA 2HQ8A 4Q04A 4YGEB 1V1FA 2COLB 4UPGA 3H4SE 3CZTX 4N1GA 2LNKA 2NLNA 1IGVA 3RLZA 4IL1A 1CMGA 5HLOA 1SL9A 5AXIA 5HYDA 1SYMA 1WDCC 2K8MB 1G8IA 3NSOA 1WLMA 1NPQA 2BL0B 1XFWO 3BOWB 4I5KA 1J7QA 1RK9A 1NCYA 1Y0VH 5KTYA 2WNDA 1NX3A 4DRWA 1SCVA 1FI5A 2K61A 2CCMA 1TNWA 1R6PA 5D7FA 2NCPA 3LK0A 4MBEA 1JFJA 1KCYA 1CLMA 1PSBA 2A4JA 2LP3A 5CSJA 2MRDA 5HKYA 3I5FB 1F71A 1BLQA 1S6IA 1M45A 2CTNA 3OX5A 4DIRA 3BOWA 4OKHA 3I5HB 1CM1A 1C7WA 4GFTA 3DVEA 1B7TY 2EHBA 2I94A 2HQWA 2F2OA 1KSOA 1S5GZ 2KBIA 1B4CA 1XFYO 2M97A 1PRWA 2PVBA 1MWNA 1SR6B 2M1KB 2F2PA 2GGZA 4TNCA 1FI6A 1DJYA 2WCFA 1LVCD 3DVKA 4HRHA 4DCKA 4MRYA 3SG3A 4WRIA 2JXLA 1M31A 2JTTA 1N2DA 1JFKA 2BBMA 4MLWA 1CB1A 5KSZA 3CS1A 1B8LA 3TDZA 1E8AA 2PMYA 2BKIB 3IQOA 2ZRTA 3OP0A 2AUCA 3VROA 2KFFA 1QASA 1MR8A 2MLFC 4FTGA 1F70A 1YRUB 2JNXA 1IWQA 2FCEA 1KK8B 3VRPA 1ALWA 3LL8B 2AMIA 1QXPA 2K7CA 2CXJA 1DJGA 2WCEA 3CR4X 5I2QA 2L4IA 4HSZA 5ER4X 1RTP1 1H8BA 1B47A 1DGUA 1W7JB 3I5FC 2CNPA 3GOFA 2OTGB 4PCWA 2QACA 5HKWA 3NSIA 1S6JA 3I5HC 1ZMZA 1MHOA 4AQJA 1CDMA 1K96A 1OMVA 5DKQA 1FPWA 1W7IB 3BUNB 1QLSA 1TNXA 1YVHA 2MBXA 3EK8A 2I7AA 4XJKB 3SG4A 1BF5A 1SR6C 1XFVO 4PALA 1G4YR 5J3XA 2ZRSA 4GNKB 1RROA 2F3ZA 3I5GB 1SCMB 1JC2A 5I8NA 3TUYB 1DVIA 5CSFA 1AK8A 3MSEB 1XA5A 4BY4A 1YUSA 1ZUZA 1UP5A 1DJIA 5CSNA 1JBAA 2WCBA 1CM4A 1S26D 3WNXB 2LE9B 2PALA 2ZNDA 3C1VA 2WC8A 1Y6WA 2O60A 2HPSA 4MZKA 3AKBA 3CR5X 1SMGA 2PSRA 2E6WA 1L7ZA 1PK0D 1J7PA 2JU0A 4OV2A 1QJTA 5PALA 4YGAA 1A2XA 3GK1A 4MVFA 2M1UA 2LLTA 3VRNA 1CDNA 2Y1NA 1K8UA 1NX1A 5KU1A 2Y1MA 2JTZA 4PHMA 1DJWA 1KSMA 2JT0A 3SIAA 4E68A 3LK1A 1JWDA 2OTGC 3SJSA 1AJ4A 2I18A 1QATA 1XFXO 2TN4A 1B8CA 1NYAA 3EVVA 1SKTA 1A4PA 2PRUA 2KGRA 3EKHA 3OB1B 2AAOA 2KFGA 1QS7A 3GK4X 3KF9A 2ZKMX 4HREE 4NDCA 1S6CA 2M0RA 2M9GA 4I5JA 1UHNA 1NCXA 1M63B 1J7RA 2ZFDA 4YGBB 1IQ3A 2ZN8A 1DMOA 2JNFA 3TUYC 3NSKA 2L98A 4OR9B 1KFXL 1U5IB 1UHKA 4OCIA 3IQQA 1SPYA 2LP2A 4QJ3B 1ZOTB 2RGIA 1S3PA 2LC5A 1EG3A 1K9PA 4M2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAJ A;  2BCA A;  2K7B A;  4ORC B;  3BUO B;  4AOM A;  1EG4 A;  2JT3 A;  2MA2 A;  4WQ2 A;  3KPX A;  1F4Q A;  2LM5 A;  4C0K A;  3JTD B;  2B1U A;  1QV1 A;  2Q4U A;  1F8H A;  5JJG A;  3I5I C;  2MLE C;  3O78 A;  1IRJ A;  4GGF A;  4ORB B;  4PHK A;  3TS5 B;  1JF0 A;  5HLV A;  1KWO B;  5AAN A;  1SRA A;  4MZJ A;  4YRU A;  2LUC A;  2KI6 D;  4PE1 A;  1HQV A;  1V1G A;  2KBM A;  3O4Y A;  3DD4 A;  2LVK A;  2BCX A;  2M29 A;  3WXA A;  1YX8 A;  4GPL B;  4GAO A;  2JPT A;  1GGW A;  1SL8 A;  2FCD A;  2OS8 B;  3FS7 A;  1IJ5 A;  1J1D A;  1M46 A;  2QPT A;  3SG6 A;  1ZAC A;  4MRX A;  1DJH A;  3O6B A;  3AAK A;  1GGZ A;  5HKZ A;  3JVT B;  3BUX B;  4PHN A;  1CFD A;  2LUX A;  1NP8 A;  3D10 A;  3EVR A;  2SAS A;  1CLB A;  1TOP A;  4CPV A;  3E3R A;  1EL4 A;  3BYA A;  1B7T Z;  2BL0 C;  3IF7 A;  4GGF C;  2LMU A;  3EK7 A;  2KDH A;  1UHJ A;  1IG5 A;  4M2O A;  4R1E A;  1BMO A;  1QVI Y;  2L4H A;  2LMT A;  4CID A;  1KFU S;  2EGD A;  1YVL A;  2KI6 C;  4I5N B;  5CSI A;  1MUX A;  1ODB A;  1YUR A;  2L5X B;  1UHI A;  2LAN A;  1SBJ A;  1XFU O;  2K7D A;  2KFH A;  3FIA A;  2K2F A;  4OVN F;  3ZNI A;  3TS5 C;  1MXE A;  1ALV A;  3DVM A;  5AFP A;  5DKN A;  4M2Q A;  1OMD A;  2BCB A;  4N5X A;  3SG7 A;  2LVJ A;  1BOD A;  1AP4 A;  2JT8 A;  3BXK A;  4I5L B;  4YGC B;  1GQM A;  1RJV A;  2LMV A;  1R2U A;  2P6B B;  2HET A;  5GQQ C;  2G9B A;  1QV0 A;  3OX6 A;  3K21 A;  4GBA A;  2H61 A;  2L51 A;  3NSL A;  1X02 A;  4NQG A;  2KAV A;  3FWC A;  3D0Y B;  2BE6 A;  1K9K A;  3SG5 A;  5D69 A;  2VRG A;  4A4B A;  1A75 B;  1F4O A;  2JC2 A;  1S36 A;  2LVV A;  3EK4 A;  3O2P A;  4NDB A;  3TDI A;  4CLN A;  1BU3 A;  5K89 A;  3HX4 A;  1CFC A;  4D1E A;  5FYX A;  4NDD A;  1NCZ A;  2KGB C;  4XJK A;  3GK2 A;  4JQ0 D;  1DF0 B;  3DF0 B;  1B8R A;  1LA0 A;  1QX5 B;  1K94 A;  1KK8 C;  1RWY A;  1UHH A;  2FJU B;  4C0J A;  4QJ4 B;  1IH0 A;  1XO5 A;  3BQ3 A;  3TDU A;  1OSA A;  1DT7 B;  1WDC B;  3CR2 A;  4CFQ A;  1WRL A;  1FBV A;  3M0W A;  1LXF C;  1BR4 B;  2Y5I A;  2H61 C;  4GGN A;  1AVS A;  1WRK A;  4YBH B;  4QJ5 B;  2GV5 A;  2JZI A;  1D1O A;  3PFV A;  2D8N A;  3CWG A;  3LLE A;  2ZN9 A;  1B9A A;  2O5G A;  1K90 D;  3OHM B;  1DF0 A;  3CLN A;  1LIN A;  2KAY A;  1Y1X A;  2M7L A;  1AHR A;  4PE4 A;  2BKH B;  2MJW B;  2V53 A;  4PDZ A;  2CBL A;  5I2L A;  2K0J A;  4PHJ A;  4C0L A;  5AER A;  1XK4 A;  2M8U A;  1F54 A;  3I5G C;  1SCM C;  3CTN A;  4XYN A;  1MQ1 A;  1TIZ A;  1GJY A;  1PVA A;  2NZ0 A;  1PAL A;  1Q80 A;  2H2K A;  1DGV A;  1MXL C;  3WHU B;  2EC6 B;  3WHT B;  1CMF A;  2JXC A;  2KYF A;  1FW4 A;  1SL7 A;  1TNQ A;  1J7O A;  1QX2 A;  3CGA A;  1AJ5 A;  1OZS A;  2MAZ A;  3KEV A;  4ICB A;  1LA3 A;  1CNP A;  4BY5 A;  1KQM B;  1A29 A;  1H4B A;  1CLL A;  4DS7 A;  1NSH A;  2GGM A;  2ISD A;  1YR5 A;  1KFU L;  5ER5 A;  1QTX A;  2JUL A;  1U5I A;  5B8I B;  1BR1 B;  1K2H A;  1CTR A;  1G33 A;  1M39 A;  1YUT A;  2R2I A;  3BUW B;  2LV7 A;  1XK4 C;  1EH2 A;  3HCM A;  5DKR A;  2M7N A;  1YTZ C;  1REC A;  1CDL A;  1NX2 A;  1JUO A;  3PAT A;  1S5G Y;  2FOT A;  2KSP A;  2F33 A;  4WQ3 A;  2LVI A;  1CFF A;  1L2O B;  1OMR A;  4ZCV A;  1VRK A;  1C7V A;  4MZL A;  2IS9 A;  1Y1A A;  2WOS A;  3PAL A;  1IJ6 A;  1FF1 A;  2KHN A;  3F45 A;  1OZO A;  4L9M A;  4YI8 A;  3DVJ A;  3PN7 B;  1C07 A;  2BEC A;  3PLF B;  1CKK A;  2JQ6 A;  2KNE A;  3A4U B;  3OB2 B;  2K7O A;  1CDP A;  1B1G A;  1PVB A;  2KQ6 A;  2EC6 C;  2KYC A;  1A03 A;  2G2B A;  2LAP A;  2MHH A;  1DJX A;  1CFP A;  1AUI B;  2KI4 B;  5TNC A;  2LHL A;  1J55 A;  1DJZ A;  1MF8 B;  1KQV A;  3EVU A;  1KQM C;  4YGD B;  1OQP A;  4ETO A;  1WLZ A;  2LCP A;  1KFX S;  3JTD C;  3NXA A;  4USL A;  1F55 A;  2NCO A;  3QRX A;  1EXR A;  3SG2 A;  5JOL A;  2WOR A;  2KQY A;  2F3Y A;  1K95 A;  1KWO C;  3TZ1 A;  1JSA A;  2L2E A;  2L50 A;  3EKJ A;  1WRZ A;  4PE0 A;  2HF5 A;  4AQI A;  1N65 A;  1BG1 A;  5I2O A;  3VGO A;  4F0Z B;  2LLU A;  4FQO A;  1QVI Z;  1Y1U A;  1QIW A;  1L2O C;  2OS8 C;  1XFZ O;  1SK6 D;  1XVJ A;  1ZFS A;  5AEQ A;  2LHI A;  4N1F A;  1TN4 A;  2K2A A;  3JVT C;  4A4C A;  1BT6 A;  2L0P A;  4P5O E;  1LKJ A;  4DUQ A;  5BPJ A;  3PN7 C;  2PAS A;  4U8D A;  2E30 A;  4ORA B;  2OPO A;  1SNL A;  1QX7 A;  3SIB A;  2Y4Q A;  1JF2 A;  1UWO A;  1TNP A;  4MSP A;  2KAX A;  3ICB A;  3PSR A;  1J1E A;  2NXQ A;  1HT9 A;  3VRR A;  1QLK A;  3RM1 A;  1QIV A;  2F8P A;  1NWD A;  2ZNE A;  2KI4 C;  3D0Y A;  1PUL A;  1DTL A;  5CPV A;  1N0Y A;  4GUK A;  4JPZ B;  4PE7 A;  1PSR A;  3FWB A;  1A75 A;  3KHE A;  2DOQ A;  5F6T A;  3KO0 A;  2M3W A;  1SY9 A;  2Q91 A;  1OOJ A;  1EJ3 A;  1KK7 Y;  2BE4 A;  1UUR A;  1YX7 A;  3AKA A;  5IBW A;  1WY9 A;  3BUM B;  4MN0 A;  1NUB A;  2JWW A;  4HRG A;  5G08 A;  2LLS A;  2SCP A;  1RFJ A;  2CT9 A;  1S1E A;  3DF0 A;  1TCF A;  3LCP C;  4CFR A;  1K93 D;  1NIW A;  4ZCU A;  1YRT B;  2KOT A;  1BJF A;  1OE9 B;  1TCO B;  1IQ5 A;  3A8R A;  3ZWH A;  4YI9 A;  2JOJ A;  4JWQ A;  2M49 B;  2JRF A;  3I5I B;  3VRQ A;  1IKU A;  1K9U A;  2BBN A;  1TTX A;  3PM8 A;  1TRF A;  1BOC A;  4MEW A;  1UUS A;  1KK7 Z;  1NX0 A;  1YUU A;  2I2R E;  4P2Y B;  1SW8 A;  1XYD A;  2HQ8 A;  4Q04 A;  4YGE B;  1V1F A;  2COL B;  4UPG A;  3H4S E;  3CZT X;  4N1G A;  2LNK A;  2NLN A;  1IGV A;  3RLZ A;  4IL1 A;  1CMG A;  5HLO A;  1SL9 A;  5AXI A;  5HYD A;  1SYM A;  1WDC C;  2K8M B;  1G8I A;  3NSO A;  1WLM A;  1NPQ A;  2BL0 B;  1XFW O;  3BOW B;  4I5K A;  1J7Q A;  1RK9 A;  1NCY A;  1Y0V H;  5KTY A;  2WND A;  1NX3 A;  4DRW A;  1SCV A;  1FI5 A;  2K61 A;  2CCM A;  1TNW A;  1R6P A;  5D7F A;  2NCP A;  3LK0 A;  4MBE A;  1JFJ A;  1KCY A;  1CLM A;  1PSB A;  2A4J A;  2LP3 A;  5CSJ A;  2MRD A;  5HKY A;  3I5F B;  1F71 A;  1BLQ A;  1S6I A;  1M45 A;  2CTN A;  3OX5 A;  4DIR A;  3BOW A;  4OKH A;  3I5H B;  1CM1 A;  1C7W A;  4GFT A;  3DVE A;  1B7T Y;  2EHB A;  2I94 A;  2HQW A;  2F2O A;  1KSO A;  1S5G Z;  2KBI A;  1B4C A;  1XFY O;  2M97 A;  1PRW A;  2PVB A;  1MWN A;  1SR6 B;  2M1K B;  2F2P A;  2GGZ A;  4TNC A;  1FI6 A;  1DJY A;  2WCF A;  1LVC D;  3DVK A;  4HRH A;  4DCK A;  4MRY A;  3SG3 A;  4WRI A;  2JXL A;  1M31 A;  2JTT A;  1N2D A;  1JFK A;  2BBM A;  4MLW A;  1CB1 A;  5KSZ A;  3CS1 A;  1B8L A;  3TDZ A;  1E8A A;  2PMY A;  2BKI B;  3IQO A;  2ZRT A;  3OP0 A;  2AUC A;  3VRO A;  2KFF A;  1QAS A;  1MR8 A;  2MLF C;  4FTG A;  1F70 A;  1YRU B;  2JNX A;  1IWQ A;  2FCE A;  1KK8 B;  3VRP A;  1ALW A;  3LL8 B;  2AMI A;  1QXP A;  2K7C A;  2CXJ A;  1DJG A;  2WCE A;  3CR4 X;  5I2Q A;  2L4I A;  4HSZ A;  5ER4 X;  1RTP 1;  1H8B A;  1B47 A;  1DGU A;  1W7J B;  3I5F C;  2CNP A;  3GOF A;  2OTG B;  4PCW A;  2QAC A;  5HKW A;  3NSI A;  1S6J A;  3I5H C;  1ZMZ A;  1MHO A;  4AQJ A;  1CDM A;  1K96 A;  1OMV A;  5DKQ A;  1FPW A;  1W7I B;  3BUN B;  1QLS A;  1TNX A;  1YVH A;  2MBX A;  3EK8 A;  2I7A A;  4XJK B;  3SG4 A;  1BF5 A;  1SR6 C;  1XFV O;  4PAL A;  1G4Y R;  5J3X A;  2ZRS A;  4GNK B;  1RRO A;  2F3Z A;  3I5G B;  1SCM B;  1JC2 A;  5I8N A;  3TUY B;  1DVI A;  5CSF A;  1AK8 A;  3MSE B;  1XA5 A;  4BY4 A;  1YUS A;  1ZUZ A;  1UP5 A;  1DJI A;  5CSN A;  1JBA A;  2WCB A;  1CM4 A;  1S26 D;  3WNX B;  2LE9 B;  2PAL A;  2ZND A;  3C1V A;  2WC8 A;  1Y6W A;  2O60 A;  2HPS A;  4MZK A;  3AKB A;  3CR5 X;  1SMG A;  2PSR A;  2E6W A;  1L7Z A;  1PK0 D;  1J7P A;  2JU0 A;  4OV2 A;  1QJT A;  5PAL A;  4YGA A;  1A2X A;  3GK1 A;  4MVF A;  2M1U A;  2LLT A;  3VRN A;  1CDN A;  2Y1N A;  1K8U A;  1NX1 A;  5KU1 A;  2Y1M A;  2JTZ A;  4PHM A;  1DJW A;  1KSM A;  2JT0 A;  3SIA A;  4E68 A;  3LK1 A;  1JWD A;  2OTG C;  3SJS A;  1AJ4 A;  2I18 A;  1QAT A;  1XFX O;  2TN4 A;  1B8C A;  1NYA A;  3EVV A;  1SKT A;  1A4P A;  2PRU A;  2KGR A;  3EKH A;  3OB1 B;  2AAO A;  2KFG A;  1QS7 A;  3GK4 X;  3KF9 A;  2ZKM X;  4HRE E;  4NDC A;  1S6C A;  2M0R A;  2M9G A;  4I5J A;  1UHN A;  1NCX A;  1M63 B;  1J7R A;  2ZFD A;  4YGB B;  1IQ3 A;  2ZN8 A;  1DMO A;  2JNF A;  3TUY C;  3NSK A;  2L98 A;  4OR9 B;  1KFX L;  1U5I B;  1UHK A;  4OCI A;  3IQQ A;  1SPY A;  2LP2 A;  4QJ3 B;  1ZOT B;  2RGI A;  1S3P A;  2LC5 A;  1EG3 A;  1K9P A;  4M2P A; 
#chains in the Genus database with same CATH topology
 3AAJ A;  2BCA A;  2K7B A;  4ORC B;  3BUO B;  4AOM A;  1EG4 A;  2JT3 A;  2MA2 A;  4WQ2 A;  3KPX A;  1F4Q A;  2LM5 A;  3CZ1 A;  5FI7 A;  4C0K A;  3JTD B;  2B1U A;  1QV1 A;  2Q4U A;  1F8H A;  5JJG A;  3I5I C;  2MLE C;  3O78 A;  1IRJ A;  1Z2C B;  4GGF A;  4ORB B;  4PHK A;  3TS5 B;  1JF0 A;  3NHI A;  5HLV A;  1KWO B;  5AAN A;  1SRA A;  4MZJ A;  4YRU A;  1LS8 A;  2LUC A;  2KI6 D;  4PE1 A;  1HQV A;  1V1G A;  2KBM A;  3O4Y A;  3DD4 A;  3OGN A;  2LVK A;  2BCX A;  2M29 A;  2KLD A;  3WXA A;  1YX8 A;  4GPL B;  4GAO A;  2JPT A;  5DIC A;  1SL8 A;  2FCD A;  2OS8 B;  1GGW A;  3FS7 A;  4OZD A;  1IJ5 A;  1J1D A;  1M46 A;  2QPT A;  3SG6 A;  1ZAC A;  4MRX A;  1DJH A;  3O6B A;  4IJ7 A;  3AAK A;  1GGZ A;  5HKZ A;  3JVT B;  3BUX B;  4PHN A;  1CFD A;  2LUX A;  5HL1 A;  1NP8 A;  3D10 A;  3EVR A;  2SAS A;  1CLB A;  1TOP A;  3SS4 A;  4CPV A;  3E3R A;  1EL4 A;  3BYA A;  1B7T Z;  2BL0 C;  3IF7 A;  4GGF C;  3V2L A;  3CYZ A;  2LMU A;  3EK7 A;  2KDH A;  1UHJ A;  1IG5 A;  4M2O A;  4R1E A;  1BMO A;  2GTE A;  1DEL A;  1QVI Y;  1DC1 A;  2L4H A;  2LMT A;  4CID A;  1KFU S;  2EGD A;  1YVL A;  2KI6 C;  3PM2 A;  4I5N B;  5CSI A;  1MUX A;  1ODB A;  1YUR A;  2L5X B;  1UHI A;  2LAN A;  1SBJ A;  1XFU O;  2K7D A;  2KFH A;  3FIA A;  2QEV A;  2K2F A;  4OVN F;  3ZNI A;  3TS5 C;  1MXE A;  1ALV A;  3DVM A;  5AFP A;  2QEH A;  5DKN A;  4M2Q A;  1OMD A;  2BCB A;  4N5X A;  3SG7 A;  2LVJ A;  1BOD A;  1AP4 A;  2JT8 A;  3BXK A;  4I5L B;  4YGC B;  1GQM A;  1RJV A;  2LMV A;  1R2U A;  2P6B B;  2HET A;  5GQQ C;  2G9B A;  1OW4 A;  1QV0 A;  3OX6 A;  3K21 A;  4GBA A;  2H61 A;  2L51 A;  3NSL A;  1X02 A;  4NQG A;  2KAV A;  3FWC A;  3D0Y B;  3VB1 A;  2WC5 A;  2BE6 A;  1K9K A;  2QEO A;  3SG5 A;  5D69 A;  3RZS A;  2VRG A;  4A4B A;  1A75 B;  1F4O A;  2JC2 A;  1S36 A;  2LVV A;  3EK4 A;  3O2P A;  4NDB A;  3TDI A;  4CLN A;  1BU3 A;  5K89 A;  3HX4 A;  1CFC A;  4D1E A;  5FYX A;  4NDD A;  1NCZ A;  2KGB C;  4XJK A;  3GK2 A;  4JQ0 D;  1XFR A;  1DF0 B;  3DF0 B;  1B8R A;  1LA0 A;  1QX5 B;  1K94 A;  1KK8 C;  1RWY A;  1UHH A;  2FJU B;  2JPO A;  3DZT A;  1OOH A;  4C0J A;  1XO5 A;  4QJ4 B;  3BQ3 A;  3L47 A;  3TDU A;  1OSA A;  1DT7 B;  1WDC B;  3CR2 A;  4CFQ A;  1WRL A;  1FBV A;  3M0W A;  1LXF C;  1BR4 B;  2Y5I A;  2H61 C;  4GGN A;  2PYQ A;  1AVS A;  2WCK A;  1WRK A;  4YBH B;  4QJ5 B;  2GV5 A;  2JZI A;  1D1O A;  3PFV A;  2D8N A;  3CWG A;  3LLE A;  2ZN9 A;  1B9A A;  2O5G A;  1K90 D;  1ORG A;  3OHM B;  1DF0 A;  3CLN A;  4PT1 A;  1LIN A;  2KAY A;  1Y1X A;  2M7L A;  1AHR A;  1TUZ A;  3K1E A;  4PE4 A;  5D3O A;  1T14 A;  2BKH B;  2MJW B;  2V53 A;  4INW A;  2CBL A;  4PDZ A;  3B7A A;  5I2L A;  2K0J A;  3OBV A;  2P70 A;  4PHJ A;  4C0L A;  5AER A;  1XK4 A;  2M8U A;  1F54 A;  3I5G C;  1SCM C;  3CTN A;  4XYN A;  1MQ1 A;  1TIZ A;  2L2C A;  1GJY A;  1PVA A;  2NZ0 A;  1PAL A;  1Q80 A;  2H2K A;  1DGV A;  1MXL C;  3WHU B;  2EC6 B;  3WHT B;  1CMF A;  2KLE A;  2JXC A;  2KYF A;  2QDI A;  1FW4 A;  1SL7 A;  1TNQ A;  1J7O A;  4JKT A;  1QX2 A;  3CGA A;  1AJ5 A;  1OZS A;  2MAZ A;  3KEV A;  4ICB A;  1LA3 A;  1CNP A;  4BY5 A;  1KQM B;  1A29 A;  1H4B A;  1CLL A;  4DS7 A;  1NSH A;  2GGM A;  2ISD A;  1YR5 A;  1KFU L;  5ER5 A;  1QTX A;  2JUL A;  1U5I A;  5B8I B;  1BR1 B;  1K2H A;  1CTR A;  1G33 A;  1C3Z A;  1M39 A;  1YUT A;  2R2I A;  3BUW B;  2LV7 A;  2P71 A;  1XK4 C;  2YGU A;  1EH2 A;  3HCM A;  5DKR A;  2M7N A;  1YTZ C;  1REC A;  1CDL A;  1NX2 A;  1JUO A;  3D73 A;  3PAT A;  1S5G Y;  4JD9 A;  2FOT A;  2KSP A;  2F33 A;  4WQ3 A;  2LVI A;  1CFF A;  3PJI A;  1L2O B;  1OMR A;  4ZCV A;  3SS5 A;  1VRK A;  1C7V A;  4MZL A;  2IS9 A;  1Y1A A;  2WOS A;  3PAL A;  1IJ6 A;  1FF1 A;  2KHN A;  3F45 A;  1OZO A;  5I94 A;  4L9M A;  4YI8 A;  3DVJ A;  3PN7 B;  1C07 A;  2BEC A;  3PLF B;  1CKK A;  2JQ6 A;  2KNE A;  3A4U B;  3OB2 B;  2KPH A;  2K7O A;  1CDP A;  1B1G A;  1PVB A;  2KQ6 A;  2EC6 C;  2KYC A;  1A03 A;  3BFH A;  2G2B A;  2LAP A;  2MHH A;  1DJX A;  1CFP A;  1AUI B;  2KI4 B;  5TNC A;  2PQL A;  2LHL A;  1J55 A;  1DJZ A;  1MF8 B;  1KQV A;  4INX A;  3EVU A;  1KQM C;  4YGD B;  1OQP A;  4ETO A;  1WLZ A;  2LCP A;  1KFX S;  3B6X A;  3JTD C;  3NXA A;  4USL A;  1F55 A;  1OOI X;  2NCO A;  3QRX A;  1EXR A;  3SG2 A;  5JOL A;  2WOR A;  2KQY A;  3N7H A;  2F3Y A;  1K95 A;  1KWO C;  3TZ1 A;  1JSA A;  2L2E A;  2L50 A;  3EKJ A;  1WRZ A;  4FQT A;  4PE0 A;  2HF5 A;  4AQI A;  1N65 A;  1BG1 A;  5FI6 A;  3VGO A;  4F0Z B;  3L4A A;  5I2O A;  2LLU A;  4FQO A;  1QVI Z;  1Y1U A;  1QIW A;  3B87 A;  1DEK A;  1L2O C;  2OS8 C;  1XFZ O;  1SK6 D;  1XVJ A;  1ZFS A;  5AEQ A;  3UNW A;  2LHI A;  4N1F A;  1TN4 A;  2K2A A;  3JVT C;  4A4C A;  1BT6 A;  2L0P A;  4P5O E;  1LKJ A;  4DUQ A;  5BPJ A;  3PN7 C;  2PAS A;  4U8D A;  2E30 A;  4ORA B;  2OPO A;  1SNL A;  1QX7 A;  1W9Z A;  3SIB A;  2Y4Q A;  1JF2 A;  1UWO A;  1TNP A;  4MSP A;  2KAX A;  3ICB A;  3PSR A;  1J1E A;  2NXQ A;  1HT9 A;  3VRR A;  1QLK A;  3RM1 A;  1QIV A;  2F8P A;  1NWD A;  2ZNE A;  2KI4 C;  3D0Y A;  1PUL A;  1DTL A;  2WCH A;  1N0Y A;  5CPV A;  3BFB A;  4GUK A;  3FE9 A;  4JPZ B;  4PE7 A;  1PSR A;  3FWB A;  1A75 A;  3KHE A;  2DOQ A;  5F6T A;  3KO0 A;  2M3W A;  1SY9 A;  2Q91 A;  1OOJ A;  1EJ3 A;  1KK7 Y;  2BE4 A;  1UUR A;  2WCJ A;  1YX7 A;  3AKA A;  5IBW A;  1WY9 A;  3BUM B;  4MN0 A;  1NUB A;  2JWW A;  4HRG A;  3FE6 A;  2LLS A;  2SCP A;  5G08 A;  3S0E A;  1RFJ A;  3B88 A;  2CT9 A;  1S1E A;  2WCL A;  1TCF A;  3DF0 A;  3LCP C;  4CFR A;  1K93 D;  1NIW A;  4ZCU A;  1YRT B;  2KOT A;  1BJF A;  1OE9 B;  1TCO B;  1IQ5 A;  3A8R A;  3ZWH A;  4YI9 A;  2JOJ A;  3R1P A;  2M49 B;  2JRF A;  3I5I B;  4JWQ A;  3VRQ A;  1IKU A;  1K9U A;  2BBN A;  3S0B A;  1TTX A;  3PM8 A;  1TRF A;  3D74 A;  4MEW A;  1BOC A;  1UUS A;  2WCM A;  1KK7 Z;  1NX0 A;  1YUU A;  2I2R E;  4P2Y B;  1OOF A;  1SW8 A;  1XYD A;  2HQ8 A;  4Q04 A;  4YGE B;  1V1F A;  2COL B;  4UPG A;  3H4S E;  3CZT X;  4N1G A;  2LNK A;  3CZ2 A;  2NLN A;  1IGV A;  3RLZ A;  4IL1 A;  1CMG A;  5HLO A;  1SL9 A;  3DY9 A;  5AXI A;  3DXL A;  3BJH A;  5HYD A;  1SYM A;  1WDC C;  2K8M B;  1G8I A;  3NSO A;  1WLM A;  1NPQ A;  2BL0 B;  3IVT A;  1XFW O;  3BOW B;  4I5K A;  1J7Q A;  1RK9 A;  1IH0 A;  1NCY A;  1Y0V H;  3CZ0 A;  5KTY A;  2WND A;  1NX3 A;  4DRW A;  1SCV A;  1FI5 A;  2K61 A;  2CCM A;  1TNW A;  3CAB A;  1R6P A;  3BFA A;  5D7F A;  2NCP A;  3LK0 A;  4MBE A;  1JFJ A;  1KCY A;  1CLM A;  1PSB A;  2A4J A;  2LP3 A;  5CSJ A;  2MRD A;  5HKY A;  4KYN A;  4F7F A;  2BNX A;  3I5F B;  1F71 A;  1BLQ A;  1S6I A;  1GM0 A;  1M45 A;  2CTN A;  3D77 A;  3NHT A;  3OX5 A;  3FE8 A;  3BOW A;  4DIR A;  4OKH A;  3I5H B;  1CM1 A;  1C7W A;  3NGV A;  3DVE A;  4GFT A;  1B7T Y;  2EHB A;  2I94 A;  2HQW A;  2F2O A;  1KSO A;  3EG5 B;  1S5G Z;  2KBI A;  1B4C A;  1XFY O;  2M97 A;  1PRW A;  2PVB A;  1MWN A;  1SR6 B;  2M1K B;  2F2P A;  2GGZ A;  4TNC A;  1FI6 A;  1DJY A;  2WCF A;  1LVC D;  3DVK A;  4HRH A;  4DCK A;  4MRY A;  3R1O A;  3SG3 A;  3R72 A;  4WRI A;  2JXL A;  1M31 A;  2JTT A;  1N2D A;  2K60 A;  3O4X A;  1JFK A;  2BBM A;  4MLW A;  1CB1 A;  5KSZ A;  3CS1 A;  1B8L A;  3TDZ A;  1E8A A;  2PMY A;  2BKI B;  3IQO A;  2ZRT A;  3OP0 A;  3R1V A;  2AUC A;  3VRO A;  2KFF A;  1QAS A;  1MR8 A;  2MLF C;  4FTG A;  1F70 A;  1YRU B;  1TUJ A;  2JNX A;  1IWQ A;  2FCE A;  1KK8 B;  3VRP A;  3S0D A;  1ALW A;  3LL8 B;  2AMI A;  1QXP A;  2K7C A;  2CXJ A;  1DJG A;  2WCE A;  3CR4 X;  5EL2 A;  2L4I A;  5I2Q A;  4HSZ A;  5ER4 X;  1RTP 1;  1H8B A;  1B47 A;  1DGU A;  1W7J B;  3I5F C;  2CNP A;  1OOG A;  1TWO A;  2FJY A;  3GOF A;  2ERB A;  2OTG B;  4PCW A;  2QAC A;  5HKW A;  1C3Y A;  3NSI A;  1S6J A;  3I5H C;  1ZMZ A;  1MHO A;  4AQJ A;  1CDM A;  1K96 A;  3L4L A;  1OMV A;  2L5Y A;  3D78 A;  5DKQ A;  2BAP A;  1W7I B;  1FPW A;  3BUN B;  1QLS A;  3Q8I A;  1TNX A;  5FI2 A;  1YVH A;  2MBX A;  3EK8 A;  3S0A A;  2I7A A;  4XJK B;  3SG4 A;  1BF5 A;  1SR6 C;  1XFV O;  4PAL A;  1G4Y R;  5J3X A;  2WC6 A;  2ZRS A;  4GNK B;  1RRO A;  2F3Z A;  3I5G B;  1SCM B;  1JC2 A;  5I8N A;  3TUY B;  1DVI A;  5CSF A;  1AK8 A;  3MSE B;  1XA5 A;  4BY4 A;  1YUS A;  1ZUZ A;  1UP5 A;  1DJI A;  5CSN A;  3B86 A;  1JBA A;  2WCB A;  1CM4 A;  1S26 D;  3WNX B;  2LE9 B;  2PAL A;  2ZND A;  3C1V A;  2WC8 A;  3UO9 A;  3S0F A;  1Y6W A;  2O60 A;  2HPS A;  4MZK A;  3AKB A;  3CR5 X;  1SMG A;  2PSR A;  3D75 A;  2E6W A;  1L7Z A;  1Z4H A;  1PK0 D;  1J7P A;  2JU0 A;  4OV2 A;  1QJT A;  5PAL A;  4YGA A;  1A2X A;  3GK1 A;  4MVF A;  2M1U A;  2LLT A;  3VRN A;  1CDN A;  3S0G A;  2Y1N A;  1K8U A;  1NX1 A;  5KU1 A;  2Y1M A;  2JTZ A;  4PHM A;  1DJW A;  1KSM A;  2JT0 A;  3SIA A;  4E68 A;  3LK1 A;  1JWD A;  2OTG C;  3DYE A;  3SJS A;  1AJ4 A;  1P28 A;  2I18 A;  1QAT A;  1SSE B;  1XFX O;  2TN4 A;  3CDN A;  1B8C A;  3SS3 A;  1NYA A;  3EVV A;  1SKT A;  1IIO A;  1A4P A;  2PRU A;  2KGR A;  3EKH A;  3OB1 B;  2AAO A;  2KFG A;  1QS7 A;  2QEB A;  3GK4 X;  3KF9 A;  2ZKM X;  4HRE E;  3D76 A;  4NDC A;  1S6C A;  2M0R A;  2M9G A;  4I5J A;  3QME A;  1UHN A;  1NCX A;  1M63 B;  1J7R A;  2ZFD A;  4YGB B;  1IQ3 A;  2ZN8 A;  1DMO A;  2JNF A;  3TUY C;  3NSK A;  2L98 A;  4OR9 B;  1KFX L;  1U5I B;  1UHK A;  4OCI A;  3IQQ A;  1SPY A;  2LP2 A;  4QJ3 B;  1ZOT B;  2RGI A;  1QWV A;  1S3P A;  2LC5 A;  1DQE A;  1EG3 A;  1K9P A;  2H8V A;  4M2P A; 
#chains in the Genus database with same CATH homology
 3AAJ A;  2BCA A;  2K7B A;  4ORC B;  3BUO B;  4AOM A;  1EG4 A;  2JT3 A;  2MA2 A;  4WQ2 A;  3KPX A;  1F4Q A;  2LM5 A;  4C0K A;  3JTD B;  2B1U A;  1QV1 A;  2Q4U A;  1F8H A;  5JJG A;  3I5I C;  2MLE C;  3O78 A;  1IRJ A;  4GGF A;  4ORB B;  4PHK A;  3TS5 B;  1JF0 A;  5HLV A;  1KWO B;  5AAN A;  1SRA A;  4MZJ A;  4YRU A;  2LUC A;  2KI6 D;  4PE1 A;  1HQV A;  1V1G A;  2KBM A;  3O4Y A;  3DD4 A;  2LVK A;  2BCX A;  2M29 A;  3WXA A;  1YX8 A;  4GPL B;  4GAO A;  2JPT A;  1GGW A;  1SL8 A;  2FCD A;  2OS8 B;  3FS7 A;  1IJ5 A;  1J1D A;  1M46 A;  2QPT A;  3SG6 A;  1ZAC A;  4MRX A;  1DJH A;  3O6B A;  3AAK A;  1GGZ A;  5HKZ A;  3JVT B;  3BUX B;  4PHN A;  1CFD A;  2LUX A;  1NP8 A;  3D10 A;  3EVR A;  2SAS A;  1CLB A;  1TOP A;  4CPV A;  3E3R A;  1EL4 A;  3BYA A;  1B7T Z;  2BL0 C;  3IF7 A;  4GGF C;  2LMU A;  3EK7 A;  2KDH A;  1UHJ A;  1IG5 A;  4M2O A;  4R1E A;  1BMO A;  1QVI Y;  2L4H A;  2LMT A;  4CID A;  1KFU S;  2EGD A;  1YVL A;  2KI6 C;  4I5N B;  5CSI A;  1MUX A;  1ODB A;  1YUR A;  2L5X B;  1UHI A;  2LAN A;  1SBJ A;  1XFU O;  2K7D A;  2KFH A;  3FIA A;  2K2F A;  4OVN F;  3ZNI A;  3TS5 C;  1MXE A;  1ALV A;  3DVM A;  5AFP A;  5DKN A;  4M2Q A;  1OMD A;  2BCB A;  4N5X A;  3SG7 A;  2LVJ A;  1BOD A;  1AP4 A;  2JT8 A;  3BXK A;  4I5L B;  4YGC B;  1GQM A;  1RJV A;  2LMV A;  1R2U A;  2P6B B;  2HET A;  5GQQ C;  2G9B A;  1QV0 A;  3OX6 A;  3K21 A;  4GBA A;  2H61 A;  2L51 A;  3NSL A;  1X02 A;  4NQG A;  2KAV A;  3FWC A;  3D0Y B;  2BE6 A;  1K9K A;  3SG5 A;  5D69 A;  2VRG A;  4A4B A;  1A75 B;  1F4O A;  2JC2 A;  1S36 A;  2LVV A;  3EK4 A;  3O2P A;  4NDB A;  3TDI A;  4CLN A;  1BU3 A;  5K89 A;  3HX4 A;  1CFC A;  4D1E A;  5FYX A;  4NDD A;  1NCZ A;  2KGB C;  4XJK A;  3GK2 A;  4JQ0 D;  1DF0 B;  3DF0 B;  1B8R A;  1LA0 A;  1QX5 B;  1K94 A;  1KK8 C;  1RWY A;  1UHH A;  2FJU B;  4C0J A;  4QJ4 B;  1IH0 A;  1XO5 A;  3BQ3 A;  3TDU A;  1OSA A;  1DT7 B;  1WDC B;  3CR2 A;  4CFQ A;  1WRL A;  1FBV A;  3M0W A;  1LXF C;  1BR4 B;  2Y5I A;  2H61 C;  4GGN A;  1AVS A;  1WRK A;  4YBH B;  4QJ5 B;  2GV5 A;  2JZI A;  1D1O A;  3PFV A;  2D8N A;  3CWG A;  3LLE A;  2ZN9 A;  1B9A A;  2O5G A;  1K90 D;  3OHM B;  1DF0 A;  3CLN A;  1LIN A;  2KAY A;  1Y1X A;  2M7L A;  1AHR A;  4PE4 A;  2BKH B;  2MJW B;  2V53 A;  4PDZ A;  2CBL A;  5I2L A;  2K0J A;  4PHJ A;  4C0L A;  5AER A;  1XK4 A;  2M8U A;  1F54 A;  3I5G C;  1SCM C;  3CTN A;  4XYN A;  1MQ1 A;  1TIZ A;  1GJY A;  1PVA A;  2NZ0 A;  1PAL A;  1Q80 A;  2H2K A;  1DGV A;  1MXL C;  3WHU B;  2EC6 B;  3WHT B;  1CMF A;  2JXC A;  2KYF A;  1FW4 A;  1SL7 A;  1TNQ A;  1J7O A;  1QX2 A;  3CGA A;  1AJ5 A;  1OZS A;  2MAZ A;  3KEV A;  4ICB A;  1LA3 A;  1CNP A;  4BY5 A;  1KQM B;  1A29 A;  1H4B A;  1CLL A;  4DS7 A;  1NSH A;  2GGM A;  2ISD A;  1YR5 A;  1KFU L;  5ER5 A;  1QTX A;  2JUL A;  1U5I A;  5B8I B;  1BR1 B;  1K2H A;  1CTR A;  1G33 A;  1M39 A;  1YUT A;  2R2I A;  3BUW B;  2LV7 A;  1XK4 C;  1EH2 A;  3HCM A;  5DKR A;  2M7N A;  1YTZ C;  1REC A;  1CDL A;  1NX2 A;  1JUO A;  3PAT A;  1S5G Y;  2FOT A;  2KSP A;  2F33 A;  4WQ3 A;  2LVI A;  1CFF A;  1L2O B;  1OMR A;  4ZCV A;  1VRK A;  1C7V A;  4MZL A;  2IS9 A;  1Y1A A;  2WOS A;  3PAL A;  1IJ6 A;  1FF1 A;  2KHN A;  3F45 A;  1OZO A;  4L9M A;  4YI8 A;  3DVJ A;  3PN7 B;  1C07 A;  2BEC A;  3PLF B;  1CKK A;  2JQ6 A;  2KNE A;  3A4U B;  3OB2 B;  2K7O A;  1CDP A;  1B1G A;  1PVB A;  2KQ6 A;  2EC6 C;  2KYC A;  1A03 A;  2G2B A;  2LAP A;  2MHH A;  1DJX A;  1CFP A;  1AUI B;  2KI4 B;  5TNC A;  2LHL A;  1J55 A;  1DJZ A;  1MF8 B;  1KQV A;  3EVU A;  1KQM C;  4YGD B;  1OQP A;  4ETO A;  1WLZ A;  2LCP A;  1KFX S;  3JTD C;  3NXA A;  4USL A;  1F55 A;  2NCO A;  3QRX A;  1EXR A;  3SG2 A;  5JOL A;  2WOR A;  2KQY A;  2F3Y A;  1K95 A;  1KWO C;  3TZ1 A;  1JSA A;  2L2E A;  2L50 A;  3EKJ A;  1WRZ A;  4PE0 A;  2HF5 A;  4AQI A;  1N65 A;  1BG1 A;  5I2O A;  3VGO A;  4F0Z B;  2LLU A;  4FQO A;  1QVI Z;  1Y1U A;  1QIW A;  1L2O C;  2OS8 C;  1XFZ O;  1SK6 D;  1XVJ A;  1ZFS A;  5AEQ A;  2LHI A;  4N1F A;  1TN4 A;  2K2A A;  3JVT C;  4A4C A;  1BT6 A;  2L0P A;  4P5O E;  1LKJ A;  4DUQ A;  5BPJ A;  3PN7 C;  2PAS A;  4U8D A;  2E30 A;  4ORA B;  2OPO A;  1SNL A;  1QX7 A;  3SIB A;  2Y4Q A;  1JF2 A;  1UWO A;  1TNP A;  4MSP A;  2KAX A;  3ICB A;  3PSR A;  1J1E A;  2NXQ A;  1HT9 A;  3VRR A;  1QLK A;  3RM1 A;  1QIV A;  2F8P A;  1NWD A;  2ZNE A;  2KI4 C;  3D0Y A;  1PUL A;  1DTL A;  5CPV A;  1N0Y A;  4GUK A;  4JPZ B;  4PE7 A;  1PSR A;  3FWB A;  1A75 A;  3KHE A;  2DOQ A;  5F6T A;  3KO0 A;  2M3W A;  1SY9 A;  2Q91 A;  1OOJ A;  1EJ3 A;  1KK7 Y;  2BE4 A;  1UUR A;  1YX7 A;  3AKA A;  5IBW A;  1WY9 A;  3BUM B;  4MN0 A;  1NUB A;  2JWW A;  4HRG A;  5G08 A;  2LLS A;  2SCP A;  1RFJ A;  2CT9 A;  1S1E A;  3DF0 A;  1TCF A;  3LCP C;  4CFR A;  1K93 D;  1NIW A;  4ZCU A;  1YRT B;  2KOT A;  1BJF A;  1OE9 B;  1TCO B;  1IQ5 A;  3A8R A;  3ZWH A;  4YI9 A;  2JOJ A;  4JWQ A;  2M49 B;  2JRF A;  3I5I B;  3VRQ A;  1IKU A;  1K9U A;  2BBN A;  1TTX A;  3PM8 A;  1TRF A;  1BOC A;  4MEW A;  1UUS A;  1KK7 Z;  1NX0 A;  1YUU A;  2I2R E;  4P2Y B;  1SW8 A;  1XYD A;  2HQ8 A;  4Q04 A;  4YGE B;  1V1F A;  2COL B;  4UPG A;  3H4S E;  3CZT X;  4N1G A;  2LNK A;  2NLN A;  1IGV A;  3RLZ A;  4IL1 A;  1CMG A;  5HLO A;  1SL9 A;  5AXI A;  5HYD A;  1SYM A;  1WDC C;  2K8M B;  1G8I A;  3NSO A;  1WLM A;  1NPQ A;  2BL0 B;  1XFW O;  3BOW B;  4I5K A;  1J7Q A;  1RK9 A;  1NCY A;  1Y0V H;  5KTY A;  2WND A;  1NX3 A;  4DRW A;  1SCV A;  1FI5 A;  2K61 A;  2CCM A;  1TNW A;  1R6P A;  5D7F A;  2NCP A;  3LK0 A;  4MBE A;  1JFJ A;  1KCY A;  1CLM A;  1PSB A;  2A4J A;  2LP3 A;  5CSJ A;  2MRD A;  5HKY A;  3I5F B;  1F71 A;  1BLQ A;  1S6I A;  1M45 A;  2CTN A;  3OX5 A;  4DIR A;  3BOW A;  4OKH A;  3I5H B;  1CM1 A;  1C7W A;  4GFT A;  3DVE A;  1B7T Y;  2EHB A;  2I94 A;  2HQW A;  2F2O A;  1KSO A;  1S5G Z;  2KBI A;  1B4C A;  1XFY O;  2M97 A;  1PRW A;  2PVB A;  1MWN A;  1SR6 B;  2M1K B;  2F2P A;  2GGZ A;  4TNC A;  1FI6 A;  1DJY A;  2WCF A;  1LVC D;  3DVK A;  4HRH A;  4DCK A;  4MRY A;  3SG3 A;  4WRI A;  2JXL A;  1M31 A;  2JTT A;  1N2D A;  1JFK A;  2BBM A;  4MLW A;  1CB1 A;  5KSZ A;  3CS1 A;  1B8L A;  3TDZ A;  1E8A A;  2PMY A;  2BKI B;  3IQO A;  2ZRT A;  3OP0 A;  2AUC A;  3VRO A;  2KFF A;  1QAS A;  1MR8 A;  2MLF C;  4FTG A;  1F70 A;  1YRU B;  2JNX A;  1IWQ A;  2FCE A;  1KK8 B;  3VRP A;  1ALW A;  3LL8 B;  2AMI A;  1QXP A;  2K7C A;  2CXJ A;  1DJG A;  2WCE A;  3CR4 X;  5I2Q A;  2L4I A;  4HSZ A;  5ER4 X;  1RTP 1;  1H8B A;  1B47 A;  1DGU A;  1W7J B;  3I5F C;  2CNP A;  3GOF A;  2OTG B;  4PCW A;  2QAC A;  5HKW A;  3NSI A;  1S6J A;  3I5H C;  1ZMZ A;  1MHO A;  4AQJ A;  1CDM A;  1K96 A;  1OMV A;  5DKQ A;  1FPW A;  1W7I B;  3BUN B;  1QLS A;  1TNX A;  1YVH A;  2MBX A;  3EK8 A;  2I7A A;  4XJK B;  3SG4 A;  1BF5 A;  1SR6 C;  1XFV O;  4PAL A;  1G4Y R;  5J3X A;  2ZRS A;  4GNK B;  1RRO A;  2F3Z A;  3I5G B;  1SCM B;  1JC2 A;  5I8N A;  3TUY B;  1DVI A;  5CSF A;  1AK8 A;  3MSE B;  1XA5 A;  4BY4 A;  1YUS A;  1ZUZ A;  1UP5 A;  1DJI A;  5CSN A;  1JBA A;  2WCB A;  1CM4 A;  1S26 D;  3WNX B;  2LE9 B;  2PAL A;  2ZND A;  3C1V A;  2WC8 A;  1Y6W A;  2O60 A;  2HPS A;  4MZK A;  3AKB A;  3CR5 X;  1SMG A;  2PSR A;  2E6W A;  1L7Z A;  1PK0 D;  1J7P A;  2JU0 A;  4OV2 A;  1QJT A;  5PAL A;  4YGA A;  1A2X A;  3GK1 A;  4MVF A;  2M1U A;  2LLT A;  3VRN A;  1CDN A;  2Y1N A;  1K8U A;  1NX1 A;  5KU1 A;  2Y1M A;  2JTZ A;  4PHM A;  1DJW A;  1KSM A;  2JT0 A;  3SIA A;  4E68 A;  3LK1 A;  1JWD A;  2OTG C;  3SJS A;  1AJ4 A;  2I18 A;  1QAT A;  1XFX O;  2TN4 A;  1B8C A;  1NYA A;  3EVV A;  1SKT A;  1A4P A;  2PRU A;  2KGR A;  3EKH A;  3OB1 B;  2AAO A;  2KFG A;  1QS7 A;  3GK4 X;  3KF9 A;  2ZKM X;  4HRE E;  4NDC A;  1S6C A;  2M0R A;  2M9G A;  4I5J A;  1UHN A;  1NCX A;  1M63 B;  1J7R A;  2ZFD A;  4YGB B;  1IQ3 A;  2ZN8 A;  1DMO A;  2JNF A;  3TUY C;  3NSK A;  2L98 A;  4OR9 B;  1KFX L;  1U5I B;  1UHK A;  4OCI A;  3IQQ A;  1SPY A;  2LP2 A;  4QJ3 B;  1ZOT B;  2RGI A;  1S3P A;  2LC5 A;  1EG3 A;  1K9P A;  4M2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...