2LC5A

Calmodulin-like protein from entamoeba histolytica: solution structure and calcium-binding properties of a partially folded protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
MSEQKKVLTAEEQQEYKEAFQLFDKDNDNKLTAEELGTVMRALGANPTKQKISEIVKDYDKDNSGKFDQETFLTIMLEYGQEVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin, putative
publication title Calmodulin like protein from Entamoeba histolytica: solution structure and calcium binding properties of a partially folded protein.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2011-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lc5A00
4MBEA 3TZ1A 1C7VA 2JZIA 1UP5A 3AAKA 1ALWA 1FBVA 2H2KA 2TN4A 2LVIA 4P2YB 1ZUZA 2JQ6A 1MUXA 1YUTA 1S26D 2M9GA 1FI6A 3CR2A 3F45A 2A4JA 1ODBA 1SPYA 5CSFA 3I5GC 2M7NA 4CIDA 2P6BB 2Q91A 2PASA 3BQ3A 2PSRA 2SASA 3KHEA 1UUSA 1TIZA 1YVLA 1B47A 2GGZA 3JTDC 2KDHA 2EGDA 4MRYA 5HKZA 1QV0A 2ISDA 3KEVA 4FQOA 1AUIB 1NP8A 3FIAA 1M63B 2WOSA 5KU1A 2JNXA 1XFZO 1S1EA 1PSBA 1UWOA 3EKJA 2B1UA 1F55A 1QXPA 1F4QA 1WLMA 2LP3A 1IG5A 2JTZA 3BOWB 2LVKA 2LUCA 1UHIA 1Y0VH 1MHOA 3DD4A 2WCFA 1QVIZ 1F71A 2KFHA 2L4IA 3I5GB 4AQJA 4DCKA 1B8RA 1A4PA 2NZ0A 2F3ZA 5CPVA 4C0LA 1J7RA 4USLA 1NCYA 2KGBC 1QX2A 1FPWA 3JTDB 1JUOA 5JOLA 1UHKA 1RK9A 1UHNA 4CFQA 1NIWA 4MZJA 4ICBA 1JC2A 2ZRSA 3DVMA 4OR9B 2Y5IA 2ZN9A 1J7OA 1S5GY 1G4YR 2PALA 1KQMC 1OZOA 5DKQA 4DRWA 2KQ6A 4YBHB 1EG3A 4A4BA 1MWNA 1XVJA 2LNKA 4E68A 1TCOB 2ZNDA 4GUKA 2L4HA 1B8LA 4ORCB 2BCAA 2K7CA 3GK4X 4MVFA 1WRZA 4PCWA 1SKTA 2LLTA 4FTGA 1C07A 1ZMZA 2KGRA 4MSPA 4P5OE 3LL8B 3GK1A 1YUSA 2LVVA 5KTYA 1DGVA 1KK7Y 1CLLA 2M0RA 3BUWB 2JNFA 3CR4X 1KQMB 2F2OA 4QJ4B 1A75A 2I94A 1BG1A 1QV1A 1K9UA 1A29A 4PHKA 4PE1A 1QASA 2BKIB 1A03A 2QACA 2PMYA 1KSOA 5AANA 2EHBA 2OS8C 2BCXA 2F33A 1L2OC 3NSOA 4PHNA 2JXLA 1MQ1A 1BODA 4QJ5B 3HCMA 2K7BA 4GGFA 1B1GA 4XJKB 2BE6A 1CFCA 1OOJA 2KYCA 1OQPA 4WRIA 3FS7A 1IQ3A 1H8BA 3PLFB 1QX5B 3I5FC 2LHLA 2LP2A 1DJGA 1EJ3A 2BKHB 4GBAA 1FF1A 4GNKB 1WRKA 1YUUA 3CZTX 2KFGA 1PK0D 1NPQA 1NX3A 1OMDA 3O6BA 2L98A 2IS9A 2K0JA 1CTRA 1JF0A 1S3PA 2OS8B 1E8AA 1BOCA 3CR5X 1XYDA 1L2OB 5B8IB 1J55A 2LV7A 1BR1B 3I5IC 3LLEA 4MN0A 1XFYO 1CFDA 1UURA 3PN7C 5AEQA 1B7TZ 1PRWA 2JPTA 2MLFC 4M2PA 2FJUB 4CFRA 3I5FB 1K8UA 2CNPA 1TRFA 1WRLA 1N0YA 3EK4A 1M46A 3O2PA 2Y1NA 2M49B 3SG4A 4MZKA 1XA5A 2JXCA 1XFXO 3BUOB 1W7IB 5FYXA 3PATA 2O60A 1SR6C 1OMRA 1PSRA 1XK4A 3CGAA 2EC6C 3ICBA 3LK1A 1M45A 1DJZA 5HLOA 2LLUA 1QATA 1AVSA 3I5IB 1YR5A 1CMFA 3WHTB 3PN7B 2I7AA 4ORBB 1QS7A 2M1KB 4GGFC 1J7QA 1LINA 2JRFA 2LUXA 1LVCD 3WNXB 2OPOA 1DMOA 1Q80A 1A75B 3VRQA 1KFXS 1M39A 1AJ5A 1BJFA 1D1OA 1AJ4A 2HQWA 4YGEB 4QJ3B 4HSZA 2SCPA 1TNXA 1K93D 1CLBA 1W7JB 1EL4A 1QVIY 1SR6B 4M2OA 1QTXA 4YGBB 2EC6B 5CSIA 1IJ5A 1DF0A 1M31A 5I2OA 1B9AA 1DJWA 1K9PA 1N65A 2JTTA 1DJYA 5HKYA 1H4BA 1MF8B 2LAPA 1SL8A 2Y4QA 5G08A 2ZRTA 2AAOA 2BCBA 3OX5A 2H61C 1RROA 3MSEB 1NCXA 2LHIA 3TUYC 1SK6D 1OE9B 2LE9B 1LA3A 1PALA 4OCIA 3D0YA 2E30A 1XFVO 1XO5A 1GGWA 3KPXA 3VRPA 1ZFSA 3PM8A 1FI5A 2KQYA 1UHHA 1IJ6A 3NSKA 1RECA 2HF5A 2ZNEA 1YTZC 2ZKMX 3AKBA 1XK4C 5IBWA 1DJXA 1F8HA 2JT8A 2Q4UA 4A4CA 1YVHA 3CLNA 2L50A 4DS7A 5AFPA 2MHHA 3OHMB 1S6JA 2NLNA 5ER4X 2FCEA 2LM5A 4GPLB 2F3YA 3TUYB 1SBJA 1ZOTB 1EXRA 1LA0A 1NX2A 5AXIA 2KYFA 1YRTB 2KHNA 1BR4B 4DUQA 2JU0A 3EVRA 1U5IA 2JOJA 3SG7A 2M97A 2MA2A 2NCOA 4MEWA 1V1FA 2LVJA 4C0KA 4TNCA 2HPSA 3FWBA 2OTGC 2WCEA 2FOTA 3PFVA 1DJIA 2BBNA 3KF9A 1X02A 2LLSA 4NQGA 1QLKA 1KK8C 1IKUA 2PVBA 1R2UA 1LKJA 2G2BA 1LXFC 2WCBA 1KCYA 1OSAA 4OKHA 1NX0A 1DJHA 4JWQA 3A8RA 3C1VA 1DT7B 3PALA 2I18A 1TNWA 1YRUB 3BUNB 3QRXA 4IL1A 1PULA 3PSRA 4M2QA 3IQQA 3DVKA 1CFPA 5D7FA 2MBXA 1BLQA 3VROA 3GOFA 2LANA 2V53A 1K9KA 4GGNA 1OZSA 1HQVA 3NSIA 3TS5C 2WC8A 4NDDA 2MJWB 2OTGB 3JVTC 1AK8A 1JFKA 1MR8A 1SCVA 2HETA 1UHJA 4I5LB 2WORA 4HRGA 1KK8B 2GV5A 3VRRA 2F8PA 5HYDA 2MAZA 1ZACA 3BUXB 3A4UB 2KBMA 4BY5A 1B7TY 2M1UA 1ALVA 5PALA 3D0YB 1WDCC 1NWDA 1QIWA 1K95A 2NCPA 2JT0A 1SL9A 2K2AA 2R2IA 1BT6A 1KQVA 2JULA 3IQOA 1KFUS 3HX4A 1CDMA 2BL0C 3TS5B 4AQIA 2WNDA 2K2FA 1CM1A 4NDCA 3JVTB 2Y1MA 1K90D 3BUMB 1V1GA 2LCPA 4WQ2A 3OX6A 4JQ0D 2MRDA 4GFTA 4ZCVA 1JSAA 1J1EA 5I2QA 1IH0A 3OB1B 3OB2B 3O78A 1SW8A 1JWDA 2LMVA 3TDZA 3GK2A 1WDCB 4C0JA 3M0WA 3ZNIA 1KFUL 1JF2A 5GQQC 4CLNA 5I8NA 3CTNA 4PE4A 2HQ8A 2L5XB 1KSMA 1U5IB 1Y1UA 2K8MB 3IF7A 4ETOA 3SIAA 4Q04A 3SG6A 2BL0B 3WXAA 1NX1A 1TCFA 1Y1AA 2JT3A 2KI6C 1IQ5A 4PHMA 1IWQA 4YI8A 1AHRA 1JBAA 1G8IA 1G33A 2D8NA 1XFUO 3FWCA 4NDBA 2O5GA 1YX8A 1NSHA 1DVIA 4PDZA 4YGAA 1CMGA 4ZCUA 2KFFA 3DVJA 1Y1XA 1NCZA 4N1GA 1C7WA 1FW4A 4XJKA 2COLB 1KFXL 2L2EA 3E3RA 5I2LA 1CLMA 2QPTA 1TN4A 2L51A 1TNQA 4YGDB 1PVBA 3RLZA 1R6PA 2KBIA 2GGMA 1CKKA 1SMGA 1J1DA 3SG3A 3BYAA 4U8DA 4HREE 1CB1A 1OMVA 1L7ZA 3CWGA 1MXLC 1CDNA 1GQMA 1B8CA 1IGVA 1F4OA 4MZLA 1B4CA 1F70A 1JFJA 1CDPA 2KAYA 1S36A 1HT9A 5D69A 1DTLA 3EK7A 5TNCA 3LK0A 2JWWA 5JJGA 2BECA 1SRAA 4YI9A 3SG2A 1QIVA 1DGUA 1Y6WA 2ZFDA 3O4YA 1K2HA 3OP0A 3CS1A 3DF0A 5KSZA 2MLEC 1YURA 2JC2A 2L0PA 1S5GZ 1SY9A 3SIBA 2PRUA 1WY9A 2KNEA 2LC5A 3AAJA 1NYAA 3EVUA 2M3WA 3NXAA 4JPZB 4MLWA 2CBLA 3DVEA 2E6WA 4YGCB 2K7OA 2VRGA 2FCDA 4OV2A 2I2RE 2KSPA 4BY4A 4N1FA 2AUCA 1S6CA 2RGIA 4WQ3A 1CFFA 4PE7A 3SG5A 3EVVA 4ORAB 3EKHA 1CM4A 2KOTA 1CNPA 4L9MA 1KK7Z 1TOPA 3NSLA 4AOMA 5DKNA 5BPJA 1IRJA 4HRHA 2NXQA 1SYMA 1S6IA 4F0ZB 5DKRA 3WHUB 3EK8A 4N5XA 4I5NB 2DOQA 5F6TA 4UPGA 3TDUA 1SCMC 1QLSA 4XYNA 3BOWA 1TTXA 1YX7A 4OVNF 1GJYA 1MXEA 5HLVA 2F2PA 2CTNA 2KI6D 2K61A 4R1EA 1DF0B 2CXJA 1KWOC 1PVAA 1NUBA 2LMTA 2LMUA 3RM1A 1QJTA 3I5HC 2KI4C 4PALA 4YRUA 2BBMA 1A2XA 1K94A 1VRKA 1N2DA 3LCPC 1SL7A 1BF5A 2BE4A 5CSJA 2M8UA 1EG4A 2AMIA 4I5KA 2M7LA 4PE0A 2CT9A 2KAXA 4DIRA 1RTP1 1RFJA 3VGOA 2M29A 2CCMA 4I5JA 3TDIA 1RWYA 2K7DA 5J3XA 4D1EA 3D10A 2G9BA 2ZN8A 3KO0A 4MRXA 1J7PA 1QX7A 1SCMB 1CDLA 5HKWA 1WLZA 3VRNA 1SNLA 5AERA 5CSNA 1GGZA 1KWOB 1TNPA 5ER5A 4CPVA 1BMOA 1AP4A 5K89A 3I5HB 2KAVA 2KI4B 1RJVA 3AKAA 3BXKA 1K96A 1XFWO 3H4SE 4GAOA 2H61A 3ZWHA 1EH2A 3K21A 1F54A 1BU3A 4PHJA 3SJSA 3DF0B
chains in the Genus database with same CATH superfamily
4MBEA 3TZ1A 1C7VA 2JZIA 1UP5A 3AAKA 2WC5A 1ALWA 1FBVA 2H2KA 2TN4A 2LVIA 3DY9A 4P2YB 1ZUZA 2JQ6A 1MUXA 1YUTA 1S26D 2M9GA 3S0BA 1FI6A 2WCMA 3CR2A 3IVTA 3F45A 2A4JA 1ODBA 1SPYA 1OOIX 3QMEA 5CSFA 3I5GC 2KLEA 2M7NA 2P6BB 2Q91A 4CIDA 2PASA 3BQ3A 2PSRA 2SASA 3KHEA 1UUSA 3RZSA 1TIZA 1YVLA 1B47A 2GGZA 3JTDC 2KDHA 2EGDA 4MRYA 1TUJA 1QV0A 5HKZA 2ISDA 3KEVA 4FQOA 1AUIB 1NP8A 3FIAA 1M63B 2WOSA 5KU1A 2JNXA 1XFZO 1S1EA 1PSBA 1UWOA 3EKJA 2B1UA 3R1VA 1F55A 1QXPA 1F4QA 1WLMA 2LP3A 1IG5A 2JTZA 3BOWB 2LVKA 2LUCA 1DC1A 1UHIA 1Y0VH 1MHOA 3DD4A 2WCFA 1QVIZ 1F71A 2KFHA 2L4IA 3I5GB 4AQJA 4DCKA 1B8RA 1A4PA 2NZ0A 2F3ZA 5CPVA 4C0LA 1J7RA 4USLA 1NCYA 2KGBC 1QX2A 1FPWA 3JTDB 1JUOA 5JOLA 1UHKA 1RK9A 1UHNA 4CFQA 1NIWA 4MZJA 3L4LA 4ICBA 1JC2A 2ZRSA 3DVMA 3CZ2A 4OR9B 2Y5IA 2ZN9A 1J7OA 1S5GY 1G4YR 2PALA 1KQMC 1OZOA 5DKQA 3BJHA 1Z4HA 2P71A 4DRWA 1TWOA 2KQ6A 3FE9A 1EG3A 4YBHB 4A4BA 1MWNA 1XVJA 2LNKA 1TUZA 1TCOB 4E68A 3DYEA 2ZNDA 4GUKA 2L4HA 1B8LA 4ORCB 2BCAA 4PT1A 1GM0A 2K7CA 3GK4X 4MVFA 1WRZA 4PCWA 1SKTA 2LLTA 4FTGA 1C07A 1ZMZA 2KGRA 4MSPA 4P5OE 3LL8B 3GK1A 1YUSA 2LVVA 5KTYA 1DGVA 1KK7Y 5FI6A 1CLLA 2H8VA 2M0RA 3BUWB 2JNFA 3CR4X 3OGNA 1KQMB 3B86A 1C3YA 2ERBA 2F2OA 3N7HA 1A75A 4QJ4B 2I94A 3Q8IA 1BG1A 1QV1A 1K9UA 1OOGA 1A29A 4PHKA 4PE1A 1QASA 2BKIB 1A03A 2QACA 2PMYA 1ORGA 1KSOA 5FI2A 5AANA 2EHBA 3S0DA 2OS8C 2BCXA 2F33A 1DEKA 2WC6A 1L2OC 3NSOA 4PHNA 1IIOA 2JXLA 1MQ1A 3BFAA 1BODA 4QJ5B 2JPOA 3D75A 3HCMA 2K7BA 5D3OA 4GGFA 1B1GA 4XJKB 2BE6A 1CFCA 1OOJA 2KYCA 1OQPA 4WRIA 3FS7A 1IQ3A 1H8BA 3PLFB 1QX5B 1C3ZA 2LHLA 2LP2A 3I5FC 3DZTA 3UNWA 1DJGA 1EJ3A 2BKHB 4GBAA 1FF1A 3OBVA 4GNKB 2PYQA 1WRKA 1YUUA 3CZTX 2QEBA 2KFGA 3R1OA 1PK0D 1NPQA 1NX3A 1OMDA 3O6BA 2L98A 2QDIA 2IS9A 2K0JA 1CTRA 1JF0A 1S3PA 2OS8B 1E8AA 1BOCA 3CR5X 1XYDA 3PM2A 1L2OB 1T14A 3R1PA 5B8IB 1J55A 2LV7A 1BR1B 3I5IC 3LLEA 4MN0A 1XFYO 1CFDA 1UURA 3PN7C 5AEQA 2QEOA 1B7TZ 1PRWA 2JPTA 2MLFC 4M2PA 2FJUB 4CFRA 3I5FB 1K8UA 2CNPA 1TRFA 1WRLA 1N0YA 3EK4A 1M46A 2WCHA 3O2PA 2Y1NA 2M49B 3SG4A 4MZKA 1XA5A 2JXCA 1XFXO 3BUOB 1W7IB 5FYXA 3PATA 2O60A 1SR6C 1OMRA 1PSRA 1XK4A 3CGAA 2EC6C 2L5YA 3ICBA 3LK1A 1M45A 1DJZA 5HLOA 2LLUA 1QATA 1AVSA 3I5IB 1YR5A 4INXA 1EH2A 1CMFA 3WHTB 3PN7B 2I7AA 4ORBB 1QS7A 2M1KB 4GGFC 1J7QA 1LINA 2JRFA 2LUXA 1LVCD 3WNXB 2OPOA 1DMOA 1Q80A 1A75B 3VRQA 1KFXS 1M39A 1AJ5A 1BJFA 3PJIA 1D1OA 1AJ4A 2HQWA 4YGEB 4QJ3B 4HSZA 2SCPA 1TNXA 1K93D 1CLBA 1W7JB 1EL4A 1QVIY 1SR6B 4M2OA 1QTXA 2QEHA 4YGBB 2L2CA 2EC6B 5CSIA 3DXLA 1IJ5A 1DF0A 1M31A 5I2OA 1B9AA 1DJWA 1K9PA 1N65A 2JTTA 1DJYA 5HKYA 1H4BA 1MF8B 2LAPA 1SL8A 2Y4QA 5G08A 2ZRTA 2AAOA 2BCBA 3OX5A 3FE8A 2BAPA 2H61C 1RROA 3MSEB 1NCXA 2LHIA 3TUYC 1SK6D 1OE9B 2LE9B 1LA3A 1PALA 4OCIA 3D0YA 2E30A 1XFVO 1XO5A 4KYNA 1GGWA 3KPXA 3VRPA 1ZFSA 3PM8A 2FJYA 1FI5A 1LS8A 2KQYA 1UHHA 1IJ6A 3NSKA 1RECA 2HF5A 2ZNEA 1YTZC 2ZKMX 3AKBA 1XK4C 5IBWA 1DJXA 3L4AA 1F8HA 2JT8A 2Q4UA 4A4CA 1YVHA 3CLNA 2L50A 3B7AA 4DS7A 5AFPA 2MHHA 3L47A 3OHMB 1S6JA 3D77A 2NLNA 5ER4X 2FCEA 2LM5A 4GPLB 2F3YA 1OW4A 3TUYB 1SBJA 3D73A 1ZOTB 1EXRA 1LA0A 1NX2A 5AXIA 2KYFA 1YRTB 2KHNA 1BR4B 4DUQA 3B6XA 2JU0A 3EVRA 1U5IA 2JOJA 3S0EA 3SG7A 2M97A 2MA2A 2NCOA 4MEWA 1V1FA 2LVJA 4C0KA 4TNCA 2HPSA 1XFRA 3FWBA 2OTGC 2WCEA 2FOTA 3PFVA 1DJIA 2BBNA 3FE6A 3KF9A 1X02A 2LLSA 4NQGA 1QLKA 1KK8C 1IKUA 2PVBA 1R2UA 1LKJA 2G2BA 1LXFC 2WCBA 1KCYA 1OSAA 1W9ZA 4OKHA 1NX0A 1DJHA 4JWQA 5I94A 3A8RA 3C1VA 1DT7B 3PALA 2I18A 1TNWA 1YRUB 3BUNB 3QRXA 4IL1A 1PULA 3PSRA 4M2QA 3IQQA 3DVKA 1OOHA 1DELA 1CFPA 3CDNA 5D7FA 2MBXA 1BLQA 3VROA 3GOFA 2LANA 2V53A 1K9KA 4GGNA 1OZSA 1HQVA 3NSIA 3TS5C 2WC8A 4NDDA 2MJWB 4F7FA 2OTGB 3JVTC 1AK8A 1JFKA 1MR8A 1SCVA 2HETA 1UHJA 4I5LB 2WORA 4HRGA 1KK8B 2GV5A 2WCLA 3VRRA 2F8PA 5HYDA 5FI7A 2MAZA 1ZACA 3BUXB 3A4UB 2KBMA 4BY5A 1B7TY 2M1UA 1ALVA 5PALA 3D0YB 1NWDA 1WDCC 1QIWA 1K95A 2NCPA 3D76A 2JT0A 1SL9A 2K2AA 2R2IA 1BT6A 3UO9A 2JULA 1KQVA 3IQOA 1KFUS 3HX4A 1CDMA 2BL0C 3BFBA 3TS5B 2WNDA 4AQIA 2K2FA 1CM1A 4NDCA 3JVTB 2Y1MA 1K90D 3BUMB 3CYZA 5EL2A 1V1GA 2LCPA 4WQ2A 3OX6A 4JQ0D 2MRDA 4GFTA 4ZCVA 1JSAA 1J1EA 5I2QA 1IH0A 3OB1B 2YGUA 3OB2B 3O78A 2PQLA 1SW8A 2WCJA 1JWDA 2LMVA 3TDZA 3GK2A 1WDCB 3NHIA 4C0JA 3M0WA 3ZNIA 1KFUL 1JF2A 5GQQC 4CLNA 5I8NA 3CTNA 4PE4A 2HQ8A 2L5XB 1KSMA 1U5IB 1Y1UA 2K8MB 3IF7A 4ETOA 3SIAA 4Q04A 3SG6A 2BL0B 3WXAA 1NX1A 1TCFA 1Y1AA 3CZ1A 2JT3A 1OOFA 1Z2CB 2KI6C 1IQ5A 4PHMA 1IWQA 4YI8A 4OZDA 1AHRA 1JBAA 1G8IA 1G33A 2D8NA 1XFUO 3FWCA 4NDBA 2O5GA 1YX8A 1NSHA 1DVIA 4PDZA 4YGAA 1CMGA 4ZCUA 2KFFA 3DVJA 1Y1XA 1NCZA 4N1GA 1C7WA 1FW4A 4XJKA 2COLB 2K60A 1KFXL 2L2EA 2BNXA 3E3RA 1CLMA 2QPTA 5I2LA 1TN4A 2L51A 1TNQA 4YGDB 1PVBA 3RLZA 1SSEB 1R6PA 2KBIA 2GGMA 1CKKA 1DQEA 1SMGA 1J1DA 3R72A 3SG3A 3BFHA 3BYAA 4U8DA 4HREE 1CB1A 1OMVA 1L7ZA 3CWGA 1MXLC 1CDNA 1GQMA 1B8CA 1IGVA 1F4OA 4MZLA 3SS5A 1B4CA 1F70A 3D74A 1JFJA 1CDPA 2KAYA 1S36A 1HT9A 5D69A 3SS4A 1DTLA 3EK7A 3CZ0A 5TNCA 3LK0A 2JWWA 2GTEA 5JJGA 2BECA 1SRAA 4YI9A 3SG2A 1QIVA 1DGUA 1Y6WA 2QEVA 2ZFDA 3O4YA 1K2HA 3OP0A 3CS1A 3DF0A 2KPHA 3K1EA 2MLEC 5KSZA 1YURA 2JC2A 2L0PA 1S5GZ 1SY9A 3SIBA 2PRUA 1WY9A 2KNEA 2LC5A 3AAJA 1NYAA 3EVUA 2M3WA 3NXAA 4JPZB 4MLWA 2CBLA 3DVEA 2E6WA 4YGCB 2K7OA 2VRGA 2FCDA 3CABA 2I2RE 4OV2A 2KSPA 4BY4A 4N1FA 2AUCA 1S6CA 4INWA 2RGIA 4WQ3A 1CFFA 4PE7A 3SG5A 3EVVA 4ORAB 3EKHA 1CM4A 2KOTA 1CNPA 4L9MA 1KK7Z 3B88A 1TOPA 3NSLA 4AOMA 5DKNA 5BPJA 1IRJA 4HRHA 2NXQA 3VB1A 1SYMA 1S6IA 4F0ZB 5DKRA 3WHUB 3EK8A 4N5XA 4I5NB 2DOQA 5F6TA 2KLDA 4UPGA 3TDUA 1SCMC 1QLSA 4XYNA 3BOWA 3EG5B 1TTXA 1YX7A 4OVNF 1GJYA 1MXEA 2WCKA 5HLVA 2F2PA 2CTNA 2KI6D 2K61A 3B87A 3NHTA 4R1EA 1QWVA 1DF0B 2CXJA 1KWOC 1PVAA 1NUBA 2LMTA 2LMUA 3RM1A 1QJTA 3I5HC 2KI4C 4PALA 4YRUA 2BBMA 1A2XA 1K94A 3S0FA 1VRKA 1N2DA 3LCPC 1SL7A 1BF5A 2BE4A 5CSJA 2M8UA 1EG4A 2AMIA 4I5KA 2M7LA 4PE0A 2CT9A 2KAXA 4JD9A 1RTP1 1RFJA 3VGOA 4DIRA 4JKTA 2M29A 2CCMA 4I5JA 3TDIA 5DICA 1RWYA 2K7DA 5J3XA 5HL1A 4D1EA 3D10A 2G9BA 1P28A 2ZN8A 3KO0A 4MRXA 1QX7A 1J7PA 1SCMB 3NGVA 1CDLA 5HKWA 1WLZA 3VRNA 1SNLA 5AERA 5CSNA 1GGZA 3D78A 3O4XA 4IJ7A 1KWOB 1TNPA 5ER5A 4CPVA 3SS3A 1BMOA 1AP4A 5K89A 3I5HB 2KAVA 2KI4B 1RJVA 3AKAA 3BXKA 1K96A 1XFWO 3H4SE 4FQTA 4GAOA 2H61A 2P70A 3V2LA 3K21A 3ZWHA 3S0AA 1BU3A 4PHJA 3S0GA 3SJSA 1F54A 3DF0B
chains in the Genus database with same CATH topology
4MBEA 3TZ1A 1C7VA 2JZIA 1UP5A 3AAKA 1ALWA 1FBVA 2H2KA 2TN4A 2LVIA 4P2YB 1ZUZA 2JQ6A 1MUXA 1YUTA 1S26D 2M9GA 1FI6A 3CR2A 3F45A 2A4JA 1ODBA 1SPYA 5CSFA 3I5GC 2M7NA 4CIDA 2P6BB 2Q91A 2PASA 3BQ3A 2PSRA 2SASA 3KHEA 1UUSA 1TIZA 1YVLA 1B47A 2GGZA 3JTDC 2KDHA 2EGDA 4MRYA 5HKZA 1QV0A 2ISDA 3KEVA 4FQOA 1AUIB 1NP8A 3FIAA 1M63B 2WOSA 5KU1A 2JNXA 1XFZO 1S1EA 1PSBA 1UWOA 3EKJA 2B1UA 1F55A 1QXPA 1F4QA 1WLMA 2LP3A 1IG5A 2JTZA 3BOWB 2LVKA 2LUCA 1UHIA 1Y0VH 1MHOA 3DD4A 2WCFA 1QVIZ 1F71A 2KFHA 2L4IA 3I5GB 4AQJA 4DCKA 1B8RA 1A4PA 2NZ0A 2F3ZA 5CPVA 4C0LA 1J7RA 4USLA 1NCYA 2KGBC 1QX2A 1FPWA 3JTDB 1JUOA 5JOLA 1UHKA 1RK9A 1UHNA 4CFQA 1NIWA 4MZJA 4ICBA 1JC2A 2ZRSA 3DVMA 4OR9B 2Y5IA 2ZN9A 1J7OA 1S5GY 1G4YR 2PALA 1KQMC 1OZOA 5DKQA 4DRWA 2KQ6A 4YBHB 1EG3A 4A4BA 1MWNA 1XVJA 2LNKA 4E68A 1TCOB 2ZNDA 4GUKA 2L4HA 1B8LA 4ORCB 2BCAA 2K7CA 3GK4X 4MVFA 1WRZA 4PCWA 1SKTA 2LLTA 4FTGA 1C07A 1ZMZA 2KGRA 4MSPA 4P5OE 3LL8B 3GK1A 1YUSA 2LVVA 5KTYA 1DGVA 1KK7Y 1CLLA 2M0RA 3BUWB 2JNFA 3CR4X 1KQMB 2F2OA 4QJ4B 1A75A 2I94A 1BG1A 1QV1A 1K9UA 1A29A 4PHKA 4PE1A 1QASA 2BKIB 1A03A 2QACA 2PMYA 1KSOA 5AANA 2EHBA 2OS8C 2BCXA 2F33A 1L2OC 3NSOA 4PHNA 2JXLA 1MQ1A 1BODA 4QJ5B 3HCMA 2K7BA 4GGFA 1B1GA 4XJKB 2BE6A 1CFCA 1OOJA 2KYCA 1OQPA 4WRIA 3FS7A 1IQ3A 1H8BA 3PLFB 1QX5B 3I5FC 2LHLA 2LP2A 1DJGA 1EJ3A 2BKHB 4GBAA 1FF1A 4GNKB 1WRKA 1YUUA 3CZTX 2KFGA 1PK0D 1NPQA 1NX3A 1OMDA 3O6BA 2L98A 2IS9A 2K0JA 1CTRA 1JF0A 1S3PA 2OS8B 1E8AA 1BOCA 3CR5X 1XYDA 1L2OB 5B8IB 1J55A 2LV7A 1BR1B 3I5IC 3LLEA 4MN0A 1XFYO 1CFDA 1UURA 3PN7C 5AEQA 1B7TZ 1PRWA 2JPTA 2MLFC 4M2PA 2FJUB 4CFRA 3I5FB 1K8UA 2CNPA 1TRFA 1WRLA 1N0YA 3EK4A 1M46A 3O2PA 2Y1NA 2M49B 3SG4A 4MZKA 1XA5A 2JXCA 1XFXO 3BUOB 1W7IB 5FYXA 3PATA 2O60A 1SR6C 1OMRA 1PSRA 1XK4A 3CGAA 2EC6C 3ICBA 3LK1A 1M45A 1DJZA 5HLOA 2LLUA 1QATA 1AVSA 3I5IB 1YR5A 1CMFA 3WHTB 3PN7B 2I7AA 4ORBB 1QS7A 2M1KB 4GGFC 1J7QA 1LINA 2JRFA 2LUXA 1LVCD 3WNXB 2OPOA 1DMOA 1Q80A 1A75B 3VRQA 1KFXS 1M39A 1AJ5A 1BJFA 1D1OA 1AJ4A 2HQWA 4YGEB 4QJ3B 4HSZA 2SCPA 1TNXA 1K93D 1CLBA 1W7JB 1EL4A 1QVIY 1SR6B 4M2OA 1QTXA 4YGBB 2EC6B 5CSIA 1IJ5A 1DF0A 1M31A 5I2OA 1B9AA 1DJWA 1K9PA 1N65A 2JTTA 1DJYA 5HKYA 1H4BA 1MF8B 2LAPA 1SL8A 2Y4QA 5G08A 2ZRTA 2AAOA 2BCBA 3OX5A 2H61C 1RROA 3MSEB 1NCXA 2LHIA 3TUYC 1SK6D 1OE9B 2LE9B 1LA3A 1PALA 4OCIA 3D0YA 2E30A 1XFVO 1XO5A 1GGWA 3KPXA 3VRPA 1ZFSA 3PM8A 1FI5A 2KQYA 1UHHA 1IJ6A 3NSKA 1RECA 2HF5A 2ZNEA 1YTZC 2ZKMX 3AKBA 1XK4C 5IBWA 1DJXA 1F8HA 2JT8A 2Q4UA 4A4CA 1YVHA 3CLNA 2L50A 4DS7A 5AFPA 2MHHA 3OHMB 1S6JA 2NLNA 5ER4X 2FCEA 2LM5A 4GPLB 2F3YA 3TUYB 1SBJA 1ZOTB 1EXRA 1LA0A 1NX2A 5AXIA 2KYFA 1YRTB 2KHNA 1BR4B 4DUQA 2JU0A 3EVRA 1U5IA 2JOJA 3SG7A 2M97A 2MA2A 2NCOA 4MEWA 1V1FA 2LVJA 4C0KA 4TNCA 2HPSA 3FWBA 2OTGC 2WCEA 2FOTA 3PFVA 1DJIA 2BBNA 3KF9A 1X02A 2LLSA 4NQGA 1QLKA 1KK8C 1IKUA 2PVBA 1R2UA 1LKJA 2G2BA 1LXFC 2WCBA 1KCYA 1OSAA 4OKHA 1NX0A 1DJHA 4JWQA 3A8RA 3C1VA 1DT7B 3PALA 2I18A 1TNWA 1YRUB 3BUNB 3QRXA 4IL1A 1PULA 3PSRA 4M2QA 3IQQA 3DVKA 1CFPA 5D7FA 2MBXA 1BLQA 3VROA 3GOFA 2LANA 2V53A 1K9KA 4GGNA 1OZSA 1HQVA 3NSIA 3TS5C 2WC8A 4NDDA 2MJWB 2OTGB 3JVTC 1AK8A 1JFKA 1MR8A 1SCVA 2HETA 1UHJA 4I5LB 2WORA 4HRGA 1KK8B 2GV5A 3VRRA 2F8PA 5HYDA 2MAZA 1ZACA 3BUXB 3A4UB 2KBMA 4BY5A 1B7TY 2M1UA 1ALVA 5PALA 3D0YB 1WDCC 1NWDA 1QIWA 1K95A 2NCPA 2JT0A 1SL9A 2K2AA 2R2IA 1BT6A 1KQVA 2JULA 3IQOA 1KFUS 3HX4A 1CDMA 2BL0C 3TS5B 4AQIA 2WNDA 2K2FA 1CM1A 4NDCA 3JVTB 2Y1MA 1K90D 3BUMB 1V1GA 2LCPA 4WQ2A 3OX6A 4JQ0D 2MRDA 4GFTA 4ZCVA 1JSAA 1J1EA 5I2QA 1IH0A 3OB1B 3OB2B 3O78A 1SW8A 1JWDA 2LMVA 3TDZA 3GK2A 1WDCB 4C0JA 3M0WA 3ZNIA 1KFUL 1JF2A 5GQQC 4CLNA 5I8NA 3CTNA 4PE4A 2HQ8A 2L5XB 1KSMA 1U5IB 1Y1UA 2K8MB 3IF7A 4ETOA 3SIAA 4Q04A 3SG6A 2BL0B 3WXAA 1NX1A 1TCFA 1Y1AA 2JT3A 2KI6C 1IQ5A 4PHMA 1IWQA 4YI8A 1AHRA 1JBAA 1G8IA 1G33A 2D8NA 1XFUO 3FWCA 4NDBA 2O5GA 1YX8A 1NSHA 1DVIA 4PDZA 4YGAA 1CMGA 4ZCUA 2KFFA 3DVJA 1Y1XA 1NCZA 4N1GA 1C7WA 1FW4A 4XJKA 2COLB 1KFXL 2L2EA 3E3RA 5I2LA 1CLMA 2QPTA 1TN4A 2L51A 1TNQA 4YGDB 1PVBA 3RLZA 1R6PA 2KBIA 2GGMA 1CKKA 1SMGA 1J1DA 3SG3A 3BYAA 4U8DA 4HREE 1CB1A 1OMVA 1L7ZA 3CWGA 1MXLC 1CDNA 1GQMA 1B8CA 1IGVA 1F4OA 4MZLA 1B4CA 1F70A 1JFJA 1CDPA 2KAYA 1S36A 1HT9A 5D69A 1DTLA 3EK7A 5TNCA 3LK0A 2JWWA 5JJGA 2BECA 1SRAA 4YI9A 3SG2A 1QIVA 1DGUA 1Y6WA 2ZFDA 3O4YA 1K2HA 3OP0A 3CS1A 3DF0A 5KSZA 2MLEC 1YURA 2JC2A 2L0PA 1S5GZ 1SY9A 3SIBA 2PRUA 1WY9A 2KNEA 2LC5A 3AAJA 1NYAA 3EVUA 2M3WA 3NXAA 4JPZB 4MLWA 2CBLA 3DVEA 2E6WA 4YGCB 2K7OA 2VRGA 2FCDA 4OV2A 2I2RE 2KSPA 4BY4A 4N1FA 2AUCA 1S6CA 2RGIA 4WQ3A 1CFFA 4PE7A 3SG5A 3EVVA 4ORAB 3EKHA 1CM4A 2KOTA 1CNPA 4L9MA 1KK7Z 1TOPA 3NSLA 4AOMA 5DKNA 5BPJA 1IRJA 4HRHA 2NXQA 1SYMA 1S6IA 4F0ZB 5DKRA 3WHUB 3EK8A 4N5XA 4I5NB 2DOQA 5F6TA 4UPGA 3TDUA 1SCMC 1QLSA 4XYNA 3BOWA 1TTXA 1YX7A 4OVNF 1GJYA 1MXEA 5HLVA 2F2PA 2CTNA 2KI6D 2K61A 4R1EA 1DF0B 2CXJA 1KWOC 1PVAA 1NUBA 2LMTA 2LMUA 3RM1A 1QJTA 3I5HC 2KI4C 4PALA 4YRUA 2BBMA 1A2XA 1K94A 1VRKA 1N2DA 3LCPC 1SL7A 1BF5A 2BE4A 5CSJA 2M8UA 1EG4A 2AMIA 4I5KA 2M7LA 4PE0A 2CT9A 2KAXA 4DIRA 1RTP1 1RFJA 3VGOA 2M29A 2CCMA 4I5JA 3TDIA 1RWYA 2K7DA 5J3XA 4D1EA 3D10A 2G9BA 2ZN8A 3KO0A 4MRXA 1J7PA 1QX7A 1SCMB 1CDLA 5HKWA 1WLZA 3VRNA 1SNLA 5AERA 5CSNA 1GGZA 1KWOB 1TNPA 5ER5A 4CPVA 1BMOA 1AP4A 5K89A 3I5HB 2KAVA 2KI4B 1RJVA 3AKAA 3BXKA 1K96A 1XFWO 3H4SE 4GAOA 2H61A 3ZWHA 1EH2A 3K21A 1F54A 1BU3A 4PHJA 3SJSA 3DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBE A;  3TZ1 A;  1C7V A;  2JZI A;  1UP5 A;  3AAK A;  1ALW A;  1FBV A;  2H2K A;  2TN4 A;  2LVI A;  4P2Y B;  1ZUZ A;  2JQ6 A;  1MUX A;  1YUT A;  1S26 D;  2M9G A;  1FI6 A;  3CR2 A;  3F45 A;  2A4J A;  1ODB A;  1SPY A;  5CSF A;  3I5G C;  2M7N A;  4CID A;  2P6B B;  2Q91 A;  2PAS A;  3BQ3 A;  2PSR A;  2SAS A;  3KHE A;  1UUS A;  1TIZ A;  1YVL A;  1B47 A;  2GGZ A;  3JTD C;  2KDH A;  2EGD A;  4MRY A;  5HKZ A;  1QV0 A;  2ISD A;  3KEV A;  4FQO A;  1AUI B;  1NP8 A;  3FIA A;  1M63 B;  2WOS A;  5KU1 A;  2JNX A;  1XFZ O;  1S1E A;  1PSB A;  1UWO A;  3EKJ A;  2B1U A;  1F55 A;  1QXP A;  1F4Q A;  1WLM A;  2LP3 A;  1IG5 A;  2JTZ A;  3BOW B;  2LVK A;  2LUC A;  1UHI A;  1Y0V H;  1MHO A;  3DD4 A;  2WCF A;  1QVI Z;  1F71 A;  2KFH A;  2L4I A;  3I5G B;  4AQJ A;  4DCK A;  1B8R A;  1A4P A;  2NZ0 A;  2F3Z A;  5CPV A;  4C0L A;  1J7R A;  4USL A;  1NCY A;  2KGB C;  1QX2 A;  1FPW A;  3JTD B;  1JUO A;  5JOL A;  1UHK A;  1RK9 A;  1UHN A;  4CFQ A;  1NIW A;  4MZJ A;  4ICB A;  1JC2 A;  2ZRS A;  3DVM A;  4OR9 B;  2Y5I A;  2ZN9 A;  1J7O A;  1S5G Y;  1G4Y R;  2PAL A;  1KQM C;  1OZO A;  5DKQ A;  4DRW A;  2KQ6 A;  4YBH B;  1EG3 A;  4A4B A;  1MWN A;  1XVJ A;  2LNK A;  4E68 A;  1TCO B;  2ZND A;  4GUK A;  2L4H A;  1B8L A;  4ORC B;  2BCA A;  2K7C A;  3GK4 X;  4MVF A;  1WRZ A;  4PCW A;  1SKT A;  2LLT A;  4FTG A;  1C07 A;  1ZMZ A;  2KGR A;  4MSP A;  4P5O E;  3LL8 B;  3GK1 A;  1YUS A;  2LVV A;  5KTY A;  1DGV A;  1KK7 Y;  1CLL A;  2M0R A;  3BUW B;  2JNF A;  3CR4 X;  1KQM B;  2F2O A;  4QJ4 B;  1A75 A;  2I94 A;  1BG1 A;  1QV1 A;  1K9U A;  1A29 A;  4PHK A;  4PE1 A;  1QAS A;  2BKI B;  1A03 A;  2QAC A;  2PMY A;  1KSO A;  5AAN A;  2EHB A;  2OS8 C;  2BCX A;  2F33 A;  1L2O C;  3NSO A;  4PHN A;  2JXL A;  1MQ1 A;  1BOD A;  4QJ5 B;  3HCM A;  2K7B A;  4GGF A;  1B1G A;  4XJK B;  2BE6 A;  1CFC A;  1OOJ A;  2KYC A;  1OQP A;  4WRI A;  3FS7 A;  1IQ3 A;  1H8B A;  3PLF B;  1QX5 B;  3I5F C;  2LHL A;  2LP2 A;  1DJG A;  1EJ3 A;  2BKH B;  4GBA A;  1FF1 A;  4GNK B;  1WRK A;  1YUU A;  3CZT X;  2KFG A;  1PK0 D;  1NPQ A;  1NX3 A;  1OMD A;  3O6B A;  2L98 A;  2IS9 A;  2K0J A;  1CTR A;  1JF0 A;  1S3P A;  2OS8 B;  1E8A A;  1BOC A;  3CR5 X;  1XYD A;  1L2O B;  5B8I B;  1J55 A;  2LV7 A;  1BR1 B;  3I5I C;  3LLE A;  4MN0 A;  1XFY O;  1CFD A;  1UUR A;  3PN7 C;  5AEQ A;  1B7T Z;  1PRW A;  2JPT A;  2MLF C;  4M2P A;  2FJU B;  4CFR A;  3I5F B;  1K8U A;  2CNP A;  1TRF A;  1WRL A;  1N0Y A;  3EK4 A;  1M46 A;  3O2P A;  2Y1N A;  2M49 B;  3SG4 A;  4MZK A;  1XA5 A;  2JXC A;  1XFX O;  3BUO B;  1W7I B;  5FYX A;  3PAT A;  2O60 A;  1SR6 C;  1OMR A;  1PSR A;  1XK4 A;  3CGA A;  2EC6 C;  3ICB A;  3LK1 A;  1M45 A;  1DJZ A;  5HLO A;  2LLU A;  1QAT A;  1AVS A;  3I5I B;  1YR5 A;  1CMF A;  3WHT B;  3PN7 B;  2I7A A;  4ORB B;  1QS7 A;  2M1K B;  4GGF C;  1J7Q A;  1LIN A;  2JRF A;  2LUX A;  1LVC D;  3WNX B;  2OPO A;  1DMO A;  1Q80 A;  1A75 B;  3VRQ A;  1KFX S;  1M39 A;  1AJ5 A;  1BJF A;  1D1O A;  1AJ4 A;  2HQW A;  4YGE B;  4QJ3 B;  4HSZ A;  2SCP A;  1TNX A;  1K93 D;  1CLB A;  1W7J B;  1EL4 A;  1QVI Y;  1SR6 B;  4M2O A;  1QTX A;  4YGB B;  2EC6 B;  5CSI A;  1IJ5 A;  1DF0 A;  1M31 A;  5I2O A;  1B9A A;  1DJW A;  1K9P A;  1N65 A;  2JTT A;  1DJY A;  5HKY A;  1H4B A;  1MF8 B;  2LAP A;  1SL8 A;  2Y4Q A;  5G08 A;  2ZRT A;  2AAO A;  2BCB A;  3OX5 A;  2H61 C;  1RRO A;  3MSE B;  1NCX A;  2LHI A;  3TUY C;  1SK6 D;  1OE9 B;  2LE9 B;  1LA3 A;  1PAL A;  4OCI A;  3D0Y A;  2E30 A;  1XFV O;  1XO5 A;  1GGW A;  3KPX A;  3VRP A;  1ZFS A;  3PM8 A;  1FI5 A;  2KQY A;  1UHH A;  1IJ6 A;  3NSK A;  1REC A;  2HF5 A;  2ZNE A;  1YTZ C;  2ZKM X;  3AKB A;  1XK4 C;  5IBW A;  1DJX A;  1F8H A;  2JT8 A;  2Q4U A;  4A4C A;  1YVH A;  3CLN A;  2L50 A;  4DS7 A;  5AFP A;  2MHH A;  3OHM B;  1S6J A;  2NLN A;  5ER4 X;  2FCE A;  2LM5 A;  4GPL B;  2F3Y A;  3TUY B;  1SBJ A;  1ZOT B;  1EXR A;  1LA0 A;  1NX2 A;  5AXI A;  2KYF A;  1YRT B;  2KHN A;  1BR4 B;  4DUQ A;  2JU0 A;  3EVR A;  1U5I A;  2JOJ A;  3SG7 A;  2M97 A;  2MA2 A;  2NCO A;  4MEW A;  1V1F A;  2LVJ A;  4C0K A;  4TNC A;  2HPS A;  3FWB A;  2OTG C;  2WCE A;  2FOT A;  3PFV A;  1DJI A;  2BBN A;  3KF9 A;  1X02 A;  2LLS A;  4NQG A;  1QLK A;  1KK8 C;  1IKU A;  2PVB A;  1R2U A;  1LKJ A;  2G2B A;  1LXF C;  2WCB A;  1KCY A;  1OSA A;  4OKH A;  1NX0 A;  1DJH A;  4JWQ A;  3A8R A;  3C1V A;  1DT7 B;  3PAL A;  2I18 A;  1TNW A;  1YRU B;  3BUN B;  3QRX A;  4IL1 A;  1PUL A;  3PSR A;  4M2Q A;  3IQQ A;  3DVK A;  1CFP A;  5D7F A;  2MBX A;  1BLQ A;  3VRO A;  3GOF A;  2LAN A;  2V53 A;  1K9K A;  4GGN A;  1OZS A;  1HQV A;  3NSI A;  3TS5 C;  2WC8 A;  4NDD A;  2MJW B;  2OTG B;  3JVT C;  1AK8 A;  1JFK A;  1MR8 A;  1SCV A;  2HET A;  1UHJ A;  4I5L B;  2WOR A;  4HRG A;  1KK8 B;  2GV5 A;  3VRR A;  2F8P A;  5HYD A;  2MAZ A;  1ZAC A;  3BUX B;  3A4U B;  2KBM A;  4BY5 A;  1B7T Y;  2M1U A;  1ALV A;  5PAL A;  3D0Y B;  1WDC C;  1NWD A;  1QIW A;  1K95 A;  2NCP A;  2JT0 A;  1SL9 A;  2K2A A;  2R2I A;  1BT6 A;  1KQV A;  2JUL A;  3IQO A;  1KFU S;  3HX4 A;  1CDM A;  2BL0 C;  3TS5 B;  4AQI A;  2WND A;  2K2F A;  1CM1 A;  4NDC A;  3JVT B;  2Y1M A;  1K90 D;  3BUM B;  1V1G A;  2LCP A;  4WQ2 A;  3OX6 A;  4JQ0 D;  2MRD A;  4GFT A;  4ZCV A;  1JSA A;  1J1E A;  5I2Q A;  1IH0 A;  3OB1 B;  3OB2 B;  3O78 A;  1SW8 A;  1JWD A;  2LMV A;  3TDZ A;  3GK2 A;  1WDC B;  4C0J A;  3M0W A;  3ZNI A;  1KFU L;  1JF2 A;  5GQQ C;  4CLN A;  5I8N A;  3CTN A;  4PE4 A;  2HQ8 A;  2L5X B;  1KSM A;  1U5I B;  1Y1U A;  2K8M B;  3IF7 A;  4ETO A;  3SIA A;  4Q04 A;  3SG6 A;  2BL0 B;  3WXA A;  1NX1 A;  1TCF A;  1Y1A A;  2JT3 A;  2KI6 C;  1IQ5 A;  4PHM A;  1IWQ A;  4YI8 A;  1AHR A;  1JBA A;  1G8I A;  1G33 A;  2D8N A;  1XFU O;  3FWC A;  4NDB A;  2O5G A;  1YX8 A;  1NSH A;  1DVI A;  4PDZ A;  4YGA A;  1CMG A;  4ZCU A;  2KFF A;  3DVJ A;  1Y1X A;  1NCZ A;  4N1G A;  1C7W A;  1FW4 A;  4XJK A;  2COL B;  1KFX L;  2L2E A;  3E3R A;  5I2L A;  1CLM A;  2QPT A;  1TN4 A;  2L51 A;  1TNQ A;  4YGD B;  1PVB A;  3RLZ A;  1R6P A;  2KBI A;  2GGM A;  1CKK A;  1SMG A;  1J1D A;  3SG3 A;  3BYA A;  4U8D A;  4HRE E;  1CB1 A;  1OMV A;  1L7Z A;  3CWG A;  1MXL C;  1CDN A;  1GQM A;  1B8C A;  1IGV A;  1F4O A;  4MZL A;  1B4C A;  1F70 A;  1JFJ A;  1CDP A;  2KAY A;  1S36 A;  1HT9 A;  5D69 A;  1DTL A;  3EK7 A;  5TNC A;  3LK0 A;  2JWW A;  5JJG A;  2BEC A;  1SRA A;  4YI9 A;  3SG2 A;  1QIV A;  1DGU A;  1Y6W A;  2ZFD A;  3O4Y A;  1K2H A;  3OP0 A;  3CS1 A;  3DF0 A;  5KSZ A;  2MLE C;  1YUR A;  2JC2 A;  2L0P A;  1S5G Z;  1SY9 A;  3SIB A;  2PRU A;  1WY9 A;  2KNE A;  2LC5 A;  3AAJ A;  1NYA A;  3EVU A;  2M3W A;  3NXA A;  4JPZ B;  4MLW A;  2CBL A;  3DVE A;  2E6W A;  4YGC B;  2K7O A;  2VRG A;  2FCD A;  4OV2 A;  2I2R E;  2KSP A;  4BY4 A;  4N1F A;  2AUC A;  1S6C A;  2RGI A;  4WQ3 A;  1CFF A;  4PE7 A;  3SG5 A;  3EVV A;  4ORA B;  3EKH A;  1CM4 A;  2KOT A;  1CNP A;  4L9M A;  1KK7 Z;  1TOP A;  3NSL A;  4AOM A;  5DKN A;  5BPJ A;  1IRJ A;  4HRH A;  2NXQ A;  1SYM A;  1S6I A;  4F0Z B;  5DKR A;  3WHU B;  3EK8 A;  4N5X A;  4I5N B;  2DOQ A;  5F6T A;  4UPG A;  3TDU A;  1SCM C;  1QLS A;  4XYN A;  3BOW A;  1TTX A;  1YX7 A;  4OVN F;  1GJY A;  1MXE A;  5HLV A;  2F2P A;  2CTN A;  2KI6 D;  2K61 A;  4R1E A;  1DF0 B;  2CXJ A;  1KWO C;  1PVA A;  1NUB A;  2LMT A;  2LMU A;  3RM1 A;  1QJT A;  3I5H C;  2KI4 C;  4PAL A;  4YRU A;  2BBM A;  1A2X A;  1K94 A;  1VRK A;  1N2D A;  3LCP C;  1SL7 A;  1BF5 A;  2BE4 A;  5CSJ A;  2M8U A;  1EG4 A;  2AMI A;  4I5K A;  2M7L A;  4PE0 A;  2CT9 A;  2KAX A;  4DIR A;  1RTP 1;  1RFJ A;  3VGO A;  2M29 A;  2CCM A;  4I5J A;  3TDI A;  1RWY A;  2K7D A;  5J3X A;  4D1E A;  3D10 A;  2G9B A;  2ZN8 A;  3KO0 A;  4MRX A;  1J7P A;  1QX7 A;  1SCM B;  1CDL A;  5HKW A;  1WLZ A;  3VRN A;  1SNL A;  5AER A;  5CSN A;  1GGZ A;  1KWO B;  1TNP A;  5ER5 A;  4CPV A;  1BMO A;  1AP4 A;  5K89 A;  3I5H B;  2KAV A;  2KI4 B;  1RJV A;  3AKA A;  3BXK A;  1K96 A;  1XFW O;  3H4S E;  4GAO A;  2H61 A;  3ZWH A;  1EH2 A;  3K21 A;  1F54 A;  1BU3 A;  4PHJ A;  3SJS A;  3DF0 B; 
#chains in the Genus database with same CATH topology
 4MBE A;  3TZ1 A;  1C7V A;  2JZI A;  1UP5 A;  3AAK A;  2WC5 A;  1ALW A;  1FBV A;  2H2K A;  2TN4 A;  2LVI A;  3DY9 A;  4P2Y B;  1ZUZ A;  2JQ6 A;  1MUX A;  1YUT A;  1S26 D;  2M9G A;  3S0B A;  1FI6 A;  2WCM A;  3CR2 A;  3IVT A;  3F45 A;  2A4J A;  1ODB A;  1SPY A;  1OOI X;  3QME A;  5CSF A;  3I5G C;  2KLE A;  2M7N A;  2P6B B;  2Q91 A;  4CID A;  2PAS A;  3BQ3 A;  2PSR A;  2SAS A;  3KHE A;  1UUS A;  3RZS A;  1TIZ A;  1YVL A;  1B47 A;  2GGZ A;  3JTD C;  2KDH A;  2EGD A;  4MRY A;  1TUJ A;  1QV0 A;  5HKZ A;  2ISD A;  3KEV A;  4FQO A;  1AUI B;  1NP8 A;  3FIA A;  1M63 B;  2WOS A;  5KU1 A;  2JNX A;  1XFZ O;  1S1E A;  1PSB A;  1UWO A;  3EKJ A;  2B1U A;  3R1V A;  1F55 A;  1QXP A;  1F4Q A;  1WLM A;  2LP3 A;  1IG5 A;  2JTZ A;  3BOW B;  2LVK A;  2LUC A;  1DC1 A;  1UHI A;  1Y0V H;  1MHO A;  3DD4 A;  2WCF A;  1QVI Z;  1F71 A;  2KFH A;  2L4I A;  3I5G B;  4AQJ A;  4DCK A;  1B8R A;  1A4P A;  2NZ0 A;  2F3Z A;  5CPV A;  4C0L A;  1J7R A;  4USL A;  1NCY A;  2KGB C;  1QX2 A;  1FPW A;  3JTD B;  1JUO A;  5JOL A;  1UHK A;  1RK9 A;  1UHN A;  4CFQ A;  1NIW A;  4MZJ A;  3L4L A;  4ICB A;  1JC2 A;  2ZRS A;  3DVM A;  3CZ2 A;  4OR9 B;  2Y5I A;  2ZN9 A;  1J7O A;  1S5G Y;  1G4Y R;  2PAL A;  1KQM C;  1OZO A;  5DKQ A;  3BJH A;  1Z4H A;  2P71 A;  4DRW A;  1TWO A;  2KQ6 A;  3FE9 A;  1EG3 A;  4YBH B;  4A4B A;  1MWN A;  1XVJ A;  2LNK A;  1TUZ A;  1TCO B;  4E68 A;  3DYE A;  2ZND A;  4GUK A;  2L4H A;  1B8L A;  4ORC B;  2BCA A;  4PT1 A;  1GM0 A;  2K7C A;  3GK4 X;  4MVF A;  1WRZ A;  4PCW A;  1SKT A;  2LLT A;  4FTG A;  1C07 A;  1ZMZ A;  2KGR A;  4MSP A;  4P5O E;  3LL8 B;  3GK1 A;  1YUS A;  2LVV A;  5KTY A;  1DGV A;  1KK7 Y;  5FI6 A;  1CLL A;  2H8V A;  2M0R A;  3BUW B;  2JNF A;  3CR4 X;  3OGN A;  1KQM B;  3B86 A;  1C3Y A;  2ERB A;  2F2O A;  3N7H A;  1A75 A;  4QJ4 B;  2I94 A;  3Q8I A;  1BG1 A;  1QV1 A;  1K9U A;  1OOG A;  1A29 A;  4PHK A;  4PE1 A;  1QAS A;  2BKI B;  1A03 A;  2QAC A;  2PMY A;  1ORG A;  1KSO A;  5FI2 A;  5AAN A;  2EHB A;  3S0D A;  2OS8 C;  2BCX A;  2F33 A;  1DEK A;  2WC6 A;  1L2O C;  3NSO A;  4PHN A;  1IIO A;  2JXL A;  1MQ1 A;  3BFA A;  1BOD A;  4QJ5 B;  2JPO A;  3D75 A;  3HCM A;  2K7B A;  5D3O A;  4GGF A;  1B1G A;  4XJK B;  2BE6 A;  1CFC A;  1OOJ A;  2KYC A;  1OQP A;  4WRI A;  3FS7 A;  1IQ3 A;  1H8B A;  3PLF B;  1QX5 B;  1C3Z A;  2LHL A;  2LP2 A;  3I5F C;  3DZT A;  3UNW A;  1DJG A;  1EJ3 A;  2BKH B;  4GBA A;  1FF1 A;  3OBV A;  4GNK B;  2PYQ A;  1WRK A;  1YUU A;  3CZT X;  2QEB A;  2KFG A;  3R1O A;  1PK0 D;  1NPQ A;  1NX3 A;  1OMD A;  3O6B A;  2L98 A;  2QDI A;  2IS9 A;  2K0J A;  1CTR A;  1JF0 A;  1S3P A;  2OS8 B;  1E8A A;  1BOC A;  3CR5 X;  1XYD A;  3PM2 A;  1L2O B;  1T14 A;  3R1P A;  5B8I B;  1J55 A;  2LV7 A;  1BR1 B;  3I5I C;  3LLE A;  4MN0 A;  1XFY O;  1CFD A;  1UUR A;  3PN7 C;  5AEQ A;  2QEO A;  1B7T Z;  1PRW A;  2JPT A;  2MLF C;  4M2P A;  2FJU B;  4CFR A;  3I5F B;  1K8U A;  2CNP A;  1TRF A;  1WRL A;  1N0Y A;  3EK4 A;  1M46 A;  2WCH A;  3O2P A;  2Y1N A;  2M49 B;  3SG4 A;  4MZK A;  1XA5 A;  2JXC A;  1XFX O;  3BUO B;  1W7I B;  5FYX A;  3PAT A;  2O60 A;  1SR6 C;  1OMR A;  1PSR A;  1XK4 A;  3CGA A;  2EC6 C;  2L5Y A;  3ICB A;  3LK1 A;  1M45 A;  1DJZ A;  5HLO A;  2LLU A;  1QAT A;  1AVS A;  3I5I B;  1YR5 A;  4INX A;  1EH2 A;  1CMF A;  3WHT B;  3PN7 B;  2I7A A;  4ORB B;  1QS7 A;  2M1K B;  4GGF C;  1J7Q A;  1LIN A;  2JRF A;  2LUX A;  1LVC D;  3WNX B;  2OPO A;  1DMO A;  1Q80 A;  1A75 B;  3VRQ A;  1KFX S;  1M39 A;  1AJ5 A;  1BJF A;  3PJI A;  1D1O A;  1AJ4 A;  2HQW A;  4YGE B;  4QJ3 B;  4HSZ A;  2SCP A;  1TNX A;  1K93 D;  1CLB A;  1W7J B;  1EL4 A;  1QVI Y;  1SR6 B;  4M2O A;  1QTX A;  2QEH A;  4YGB B;  2L2C A;  2EC6 B;  5CSI A;  3DXL A;  1IJ5 A;  1DF0 A;  1M31 A;  5I2O A;  1B9A A;  1DJW A;  1K9P A;  1N65 A;  2JTT A;  1DJY A;  5HKY A;  1H4B A;  1MF8 B;  2LAP A;  1SL8 A;  2Y4Q A;  5G08 A;  2ZRT A;  2AAO A;  2BCB A;  3OX5 A;  3FE8 A;  2BAP A;  2H61 C;  1RRO A;  3MSE B;  1NCX A;  2LHI A;  3TUY C;  1SK6 D;  1OE9 B;  2LE9 B;  1LA3 A;  1PAL A;  4OCI A;  3D0Y A;  2E30 A;  1XFV O;  1XO5 A;  4KYN A;  1GGW A;  3KPX A;  3VRP A;  1ZFS A;  3PM8 A;  2FJY A;  1FI5 A;  1LS8 A;  2KQY A;  1UHH A;  1IJ6 A;  3NSK A;  1REC A;  2HF5 A;  2ZNE A;  1YTZ C;  2ZKM X;  3AKB A;  1XK4 C;  5IBW A;  1DJX A;  3L4A A;  1F8H A;  2JT8 A;  2Q4U A;  4A4C A;  1YVH A;  3CLN A;  2L50 A;  3B7A A;  4DS7 A;  5AFP A;  2MHH A;  3L47 A;  3OHM B;  1S6J A;  3D77 A;  2NLN A;  5ER4 X;  2FCE A;  2LM5 A;  4GPL B;  2F3Y A;  1OW4 A;  3TUY B;  1SBJ A;  3D73 A;  1ZOT B;  1EXR A;  1LA0 A;  1NX2 A;  5AXI A;  2KYF A;  1YRT B;  2KHN A;  1BR4 B;  4DUQ A;  3B6X A;  2JU0 A;  3EVR A;  1U5I A;  2JOJ A;  3S0E A;  3SG7 A;  2M97 A;  2MA2 A;  2NCO A;  4MEW A;  1V1F A;  2LVJ A;  4C0K A;  4TNC A;  2HPS A;  1XFR A;  3FWB A;  2OTG C;  2WCE A;  2FOT A;  3PFV A;  1DJI A;  2BBN A;  3FE6 A;  3KF9 A;  1X02 A;  2LLS A;  4NQG A;  1QLK A;  1KK8 C;  1IKU A;  2PVB A;  1R2U A;  1LKJ A;  2G2B A;  1LXF C;  2WCB A;  1KCY A;  1OSA A;  1W9Z A;  4OKH A;  1NX0 A;  1DJH A;  4JWQ A;  5I94 A;  3A8R A;  3C1V A;  1DT7 B;  3PAL A;  2I18 A;  1TNW A;  1YRU B;  3BUN B;  3QRX A;  4IL1 A;  1PUL A;  3PSR A;  4M2Q A;  3IQQ A;  3DVK A;  1OOH A;  1DEL A;  1CFP A;  3CDN A;  5D7F A;  2MBX A;  1BLQ A;  3VRO A;  3GOF A;  2LAN A;  2V53 A;  1K9K A;  4GGN A;  1OZS A;  1HQV A;  3NSI A;  3TS5 C;  2WC8 A;  4NDD A;  2MJW B;  4F7F A;  2OTG B;  3JVT C;  1AK8 A;  1JFK A;  1MR8 A;  1SCV A;  2HET A;  1UHJ A;  4I5L B;  2WOR A;  4HRG A;  1KK8 B;  2GV5 A;  2WCL A;  3VRR A;  2F8P A;  5HYD A;  5FI7 A;  2MAZ A;  1ZAC A;  3BUX B;  3A4U B;  2KBM A;  4BY5 A;  1B7T Y;  2M1U A;  1ALV A;  5PAL A;  3D0Y B;  1NWD A;  1WDC C;  1QIW A;  1K95 A;  2NCP A;  3D76 A;  2JT0 A;  1SL9 A;  2K2A A;  2R2I A;  1BT6 A;  3UO9 A;  2JUL A;  1KQV A;  3IQO A;  1KFU S;  3HX4 A;  1CDM A;  2BL0 C;  3BFB A;  3TS5 B;  2WND A;  4AQI A;  2K2F A;  1CM1 A;  4NDC A;  3JVT B;  2Y1M A;  1K90 D;  3BUM B;  3CYZ A;  5EL2 A;  1V1G A;  2LCP A;  4WQ2 A;  3OX6 A;  4JQ0 D;  2MRD A;  4GFT A;  4ZCV A;  1JSA A;  1J1E A;  5I2Q A;  1IH0 A;  3OB1 B;  2YGU A;  3OB2 B;  3O78 A;  2PQL A;  1SW8 A;  2WCJ A;  1JWD A;  2LMV A;  3TDZ A;  3GK2 A;  1WDC B;  3NHI A;  4C0J A;  3M0W A;  3ZNI A;  1KFU L;  1JF2 A;  5GQQ C;  4CLN A;  5I8N A;  3CTN A;  4PE4 A;  2HQ8 A;  2L5X B;  1KSM A;  1U5I B;  1Y1U A;  2K8M B;  3IF7 A;  4ETO A;  3SIA A;  4Q04 A;  3SG6 A;  2BL0 B;  3WXA A;  1NX1 A;  1TCF A;  1Y1A A;  3CZ1 A;  2JT3 A;  1OOF A;  1Z2C B;  2KI6 C;  1IQ5 A;  4PHM A;  1IWQ A;  4YI8 A;  4OZD A;  1AHR A;  1JBA A;  1G8I A;  1G33 A;  2D8N A;  1XFU O;  3FWC A;  4NDB A;  2O5G A;  1YX8 A;  1NSH A;  1DVI A;  4PDZ A;  4YGA A;  1CMG A;  4ZCU A;  2KFF A;  3DVJ A;  1Y1X A;  1NCZ A;  4N1G A;  1C7W A;  1FW4 A;  4XJK A;  2COL B;  2K60 A;  1KFX L;  2L2E A;  2BNX A;  3E3R A;  1CLM A;  2QPT A;  5I2L A;  1TN4 A;  2L51 A;  1TNQ A;  4YGD B;  1PVB A;  3RLZ A;  1SSE B;  1R6P A;  2KBI A;  2GGM A;  1CKK A;  1DQE A;  1SMG A;  1J1D A;  3R72 A;  3SG3 A;  3BFH A;  3BYA A;  4U8D A;  4HRE E;  1CB1 A;  1OMV A;  1L7Z A;  3CWG A;  1MXL C;  1CDN A;  1GQM A;  1B8C A;  1IGV A;  1F4O A;  4MZL A;  3SS5 A;  1B4C A;  1F70 A;  3D74 A;  1JFJ A;  1CDP A;  2KAY A;  1S36 A;  1HT9 A;  5D69 A;  3SS4 A;  1DTL A;  3EK7 A;  3CZ0 A;  5TNC A;  3LK0 A;  2JWW A;  2GTE A;  5JJG A;  2BEC A;  1SRA A;  4YI9 A;  3SG2 A;  1QIV A;  1DGU A;  1Y6W A;  2QEV A;  2ZFD A;  3O4Y A;  1K2H A;  3OP0 A;  3CS1 A;  3DF0 A;  2KPH A;  3K1E A;  2MLE C;  5KSZ A;  1YUR A;  2JC2 A;  2L0P A;  1S5G Z;  1SY9 A;  3SIB A;  2PRU A;  1WY9 A;  2KNE A;  2LC5 A;  3AAJ A;  1NYA A;  3EVU A;  2M3W A;  3NXA A;  4JPZ B;  4MLW A;  2CBL A;  3DVE A;  2E6W A;  4YGC B;  2K7O A;  2VRG A;  2FCD A;  3CAB A;  2I2R E;  4OV2 A;  2KSP A;  4BY4 A;  4N1F A;  2AUC A;  1S6C A;  4INW A;  2RGI A;  4WQ3 A;  1CFF A;  4PE7 A;  3SG5 A;  3EVV A;  4ORA B;  3EKH A;  1CM4 A;  2KOT A;  1CNP A;  4L9M A;  1KK7 Z;  3B88 A;  1TOP A;  3NSL A;  4AOM A;  5DKN A;  5BPJ A;  1IRJ A;  4HRH A;  2NXQ A;  3VB1 A;  1SYM A;  1S6I A;  4F0Z B;  5DKR A;  3WHU B;  3EK8 A;  4N5X A;  4I5N B;  2DOQ A;  5F6T A;  2KLD A;  4UPG A;  3TDU A;  1SCM C;  1QLS A;  4XYN A;  3BOW A;  3EG5 B;  1TTX A;  1YX7 A;  4OVN F;  1GJY A;  1MXE A;  2WCK A;  5HLV A;  2F2P A;  2CTN A;  2KI6 D;  2K61 A;  3B87 A;  3NHT A;  4R1E A;  1QWV A;  1DF0 B;  2CXJ A;  1KWO C;  1PVA A;  1NUB A;  2LMT A;  2LMU A;  3RM1 A;  1QJT A;  3I5H C;  2KI4 C;  4PAL A;  4YRU A;  2BBM A;  1A2X A;  1K94 A;  3S0F A;  1VRK A;  1N2D A;  3LCP C;  1SL7 A;  1BF5 A;  2BE4 A;  5CSJ A;  2M8U A;  1EG4 A;  2AMI A;  4I5K A;  2M7L A;  4PE0 A;  2CT9 A;  2KAX A;  4JD9 A;  1RTP 1;  1RFJ A;  3VGO A;  4DIR A;  4JKT A;  2M29 A;  2CCM A;  4I5J A;  3TDI A;  5DIC A;  1RWY A;  2K7D A;  5J3X A;  5HL1 A;  4D1E A;  3D10 A;  2G9B A;  1P28 A;  2ZN8 A;  3KO0 A;  4MRX A;  1QX7 A;  1J7P A;  1SCM B;  3NGV A;  1CDL A;  5HKW A;  1WLZ A;  3VRN A;  1SNL A;  5AER A;  5CSN A;  1GGZ A;  3D78 A;  3O4X A;  4IJ7 A;  1KWO B;  1TNP A;  5ER5 A;  4CPV A;  3SS3 A;  1BMO A;  1AP4 A;  5K89 A;  3I5H B;  2KAV A;  2KI4 B;  1RJV A;  3AKA A;  3BXK A;  1K96 A;  1XFW O;  3H4S E;  4FQT A;  4GAO A;  2H61 A;  2P70 A;  3V2L A;  3K21 A;  3ZWH A;  3S0A A;  1BU3 A;  4PHJ A;  3S0G A;  3SJS A;  1F54 A;  3DF0 B; 
#chains in the Genus database with same CATH homology
 4MBE A;  3TZ1 A;  1C7V A;  2JZI A;  1UP5 A;  3AAK A;  1ALW A;  1FBV A;  2H2K A;  2TN4 A;  2LVI A;  4P2Y B;  1ZUZ A;  2JQ6 A;  1MUX A;  1YUT A;  1S26 D;  2M9G A;  1FI6 A;  3CR2 A;  3F45 A;  2A4J A;  1ODB A;  1SPY A;  5CSF A;  3I5G C;  2M7N A;  4CID A;  2P6B B;  2Q91 A;  2PAS A;  3BQ3 A;  2PSR A;  2SAS A;  3KHE A;  1UUS A;  1TIZ A;  1YVL A;  1B47 A;  2GGZ A;  3JTD C;  2KDH A;  2EGD A;  4MRY A;  5HKZ A;  1QV0 A;  2ISD A;  3KEV A;  4FQO A;  1AUI B;  1NP8 A;  3FIA A;  1M63 B;  2WOS A;  5KU1 A;  2JNX A;  1XFZ O;  1S1E A;  1PSB A;  1UWO A;  3EKJ A;  2B1U A;  1F55 A;  1QXP A;  1F4Q A;  1WLM A;  2LP3 A;  1IG5 A;  2JTZ A;  3BOW B;  2LVK A;  2LUC A;  1UHI A;  1Y0V H;  1MHO A;  3DD4 A;  2WCF A;  1QVI Z;  1F71 A;  2KFH A;  2L4I A;  3I5G B;  4AQJ A;  4DCK A;  1B8R A;  1A4P A;  2NZ0 A;  2F3Z A;  5CPV A;  4C0L A;  1J7R A;  4USL A;  1NCY A;  2KGB C;  1QX2 A;  1FPW A;  3JTD B;  1JUO A;  5JOL A;  1UHK A;  1RK9 A;  1UHN A;  4CFQ A;  1NIW A;  4MZJ A;  4ICB A;  1JC2 A;  2ZRS A;  3DVM A;  4OR9 B;  2Y5I A;  2ZN9 A;  1J7O A;  1S5G Y;  1G4Y R;  2PAL A;  1KQM C;  1OZO A;  5DKQ A;  4DRW A;  2KQ6 A;  4YBH B;  1EG3 A;  4A4B A;  1MWN A;  1XVJ A;  2LNK A;  4E68 A;  1TCO B;  2ZND A;  4GUK A;  2L4H A;  1B8L A;  4ORC B;  2BCA A;  2K7C A;  3GK4 X;  4MVF A;  1WRZ A;  4PCW A;  1SKT A;  2LLT A;  4FTG A;  1C07 A;  1ZMZ A;  2KGR A;  4MSP A;  4P5O E;  3LL8 B;  3GK1 A;  1YUS A;  2LVV A;  5KTY A;  1DGV A;  1KK7 Y;  1CLL A;  2M0R A;  3BUW B;  2JNF A;  3CR4 X;  1KQM B;  2F2O A;  4QJ4 B;  1A75 A;  2I94 A;  1BG1 A;  1QV1 A;  1K9U A;  1A29 A;  4PHK A;  4PE1 A;  1QAS A;  2BKI B;  1A03 A;  2QAC A;  2PMY A;  1KSO A;  5AAN A;  2EHB A;  2OS8 C;  2BCX A;  2F33 A;  1L2O C;  3NSO A;  4PHN A;  2JXL A;  1MQ1 A;  1BOD A;  4QJ5 B;  3HCM A;  2K7B A;  4GGF A;  1B1G A;  4XJK B;  2BE6 A;  1CFC A;  1OOJ A;  2KYC A;  1OQP A;  4WRI A;  3FS7 A;  1IQ3 A;  1H8B A;  3PLF B;  1QX5 B;  3I5F C;  2LHL A;  2LP2 A;  1DJG A;  1EJ3 A;  2BKH B;  4GBA A;  1FF1 A;  4GNK B;  1WRK A;  1YUU A;  3CZT X;  2KFG A;  1PK0 D;  1NPQ A;  1NX3 A;  1OMD A;  3O6B A;  2L98 A;  2IS9 A;  2K0J A;  1CTR A;  1JF0 A;  1S3P A;  2OS8 B;  1E8A A;  1BOC A;  3CR5 X;  1XYD A;  1L2O B;  5B8I B;  1J55 A;  2LV7 A;  1BR1 B;  3I5I C;  3LLE A;  4MN0 A;  1XFY O;  1CFD A;  1UUR A;  3PN7 C;  5AEQ A;  1B7T Z;  1PRW A;  2JPT A;  2MLF C;  4M2P A;  2FJU B;  4CFR A;  3I5F B;  1K8U A;  2CNP A;  1TRF A;  1WRL A;  1N0Y A;  3EK4 A;  1M46 A;  3O2P A;  2Y1N A;  2M49 B;  3SG4 A;  4MZK A;  1XA5 A;  2JXC A;  1XFX O;  3BUO B;  1W7I B;  5FYX A;  3PAT A;  2O60 A;  1SR6 C;  1OMR A;  1PSR A;  1XK4 A;  3CGA A;  2EC6 C;  3ICB A;  3LK1 A;  1M45 A;  1DJZ A;  5HLO A;  2LLU A;  1QAT A;  1AVS A;  3I5I B;  1YR5 A;  1CMF A;  3WHT B;  3PN7 B;  2I7A A;  4ORB B;  1QS7 A;  2M1K B;  4GGF C;  1J7Q A;  1LIN A;  2JRF A;  2LUX A;  1LVC D;  3WNX B;  2OPO A;  1DMO A;  1Q80 A;  1A75 B;  3VRQ A;  1KFX S;  1M39 A;  1AJ5 A;  1BJF A;  1D1O A;  1AJ4 A;  2HQW A;  4YGE B;  4QJ3 B;  4HSZ A;  2SCP A;  1TNX A;  1K93 D;  1CLB A;  1W7J B;  1EL4 A;  1QVI Y;  1SR6 B;  4M2O A;  1QTX A;  4YGB B;  2EC6 B;  5CSI A;  1IJ5 A;  1DF0 A;  1M31 A;  5I2O A;  1B9A A;  1DJW A;  1K9P A;  1N65 A;  2JTT A;  1DJY A;  5HKY A;  1H4B A;  1MF8 B;  2LAP A;  1SL8 A;  2Y4Q A;  5G08 A;  2ZRT A;  2AAO A;  2BCB A;  3OX5 A;  2H61 C;  1RRO A;  3MSE B;  1NCX A;  2LHI A;  3TUY C;  1SK6 D;  1OE9 B;  2LE9 B;  1LA3 A;  1PAL A;  4OCI A;  3D0Y A;  2E30 A;  1XFV O;  1XO5 A;  1GGW A;  3KPX A;  3VRP A;  1ZFS A;  3PM8 A;  1FI5 A;  2KQY A;  1UHH A;  1IJ6 A;  3NSK A;  1REC A;  2HF5 A;  2ZNE A;  1YTZ C;  2ZKM X;  3AKB A;  1XK4 C;  5IBW A;  1DJX A;  1F8H A;  2JT8 A;  2Q4U A;  4A4C A;  1YVH A;  3CLN A;  2L50 A;  4DS7 A;  5AFP A;  2MHH A;  3OHM B;  1S6J A;  2NLN A;  5ER4 X;  2FCE A;  2LM5 A;  4GPL B;  2F3Y A;  3TUY B;  1SBJ A;  1ZOT B;  1EXR A;  1LA0 A;  1NX2 A;  5AXI A;  2KYF A;  1YRT B;  2KHN A;  1BR4 B;  4DUQ A;  2JU0 A;  3EVR A;  1U5I A;  2JOJ A;  3SG7 A;  2M97 A;  2MA2 A;  2NCO A;  4MEW A;  1V1F A;  2LVJ A;  4C0K A;  4TNC A;  2HPS A;  3FWB A;  2OTG C;  2WCE A;  2FOT A;  3PFV A;  1DJI A;  2BBN A;  3KF9 A;  1X02 A;  2LLS A;  4NQG A;  1QLK A;  1KK8 C;  1IKU A;  2PVB A;  1R2U A;  1LKJ A;  2G2B A;  1LXF C;  2WCB A;  1KCY A;  1OSA A;  4OKH A;  1NX0 A;  1DJH A;  4JWQ A;  3A8R A;  3C1V A;  1DT7 B;  3PAL A;  2I18 A;  1TNW A;  1YRU B;  3BUN B;  3QRX A;  4IL1 A;  1PUL A;  3PSR A;  4M2Q A;  3IQQ A;  3DVK A;  1CFP A;  5D7F A;  2MBX A;  1BLQ A;  3VRO A;  3GOF A;  2LAN A;  2V53 A;  1K9K A;  4GGN A;  1OZS A;  1HQV A;  3NSI A;  3TS5 C;  2WC8 A;  4NDD A;  2MJW B;  2OTG B;  3JVT C;  1AK8 A;  1JFK A;  1MR8 A;  1SCV A;  2HET A;  1UHJ A;  4I5L B;  2WOR A;  4HRG A;  1KK8 B;  2GV5 A;  3VRR A;  2F8P A;  5HYD A;  2MAZ A;  1ZAC A;  3BUX B;  3A4U B;  2KBM A;  4BY5 A;  1B7T Y;  2M1U A;  1ALV A;  5PAL A;  3D0Y B;  1WDC C;  1NWD A;  1QIW A;  1K95 A;  2NCP A;  2JT0 A;  1SL9 A;  2K2A A;  2R2I A;  1BT6 A;  1KQV A;  2JUL A;  3IQO A;  1KFU S;  3HX4 A;  1CDM A;  2BL0 C;  3TS5 B;  4AQI A;  2WND A;  2K2F A;  1CM1 A;  4NDC A;  3JVT B;  2Y1M A;  1K90 D;  3BUM B;  1V1G A;  2LCP A;  4WQ2 A;  3OX6 A;  4JQ0 D;  2MRD A;  4GFT A;  4ZCV A;  1JSA A;  1J1E A;  5I2Q A;  1IH0 A;  3OB1 B;  3OB2 B;  3O78 A;  1SW8 A;  1JWD A;  2LMV A;  3TDZ A;  3GK2 A;  1WDC B;  4C0J A;  3M0W A;  3ZNI A;  1KFU L;  1JF2 A;  5GQQ C;  4CLN A;  5I8N A;  3CTN A;  4PE4 A;  2HQ8 A;  2L5X B;  1KSM A;  1U5I B;  1Y1U A;  2K8M B;  3IF7 A;  4ETO A;  3SIA A;  4Q04 A;  3SG6 A;  2BL0 B;  3WXA A;  1NX1 A;  1TCF A;  1Y1A A;  2JT3 A;  2KI6 C;  1IQ5 A;  4PHM A;  1IWQ A;  4YI8 A;  1AHR A;  1JBA A;  1G8I A;  1G33 A;  2D8N A;  1XFU O;  3FWC A;  4NDB A;  2O5G A;  1YX8 A;  1NSH A;  1DVI A;  4PDZ A;  4YGA A;  1CMG A;  4ZCU A;  2KFF A;  3DVJ A;  1Y1X A;  1NCZ A;  4N1G A;  1C7W A;  1FW4 A;  4XJK A;  2COL B;  1KFX L;  2L2E A;  3E3R A;  5I2L A;  1CLM A;  2QPT A;  1TN4 A;  2L51 A;  1TNQ A;  4YGD B;  1PVB A;  3RLZ A;  1R6P A;  2KBI A;  2GGM A;  1CKK A;  1SMG A;  1J1D A;  3SG3 A;  3BYA A;  4U8D A;  4HRE E;  1CB1 A;  1OMV A;  1L7Z A;  3CWG A;  1MXL C;  1CDN A;  1GQM A;  1B8C A;  1IGV A;  1F4O A;  4MZL A;  1B4C A;  1F70 A;  1JFJ A;  1CDP A;  2KAY A;  1S36 A;  1HT9 A;  5D69 A;  1DTL A;  3EK7 A;  5TNC A;  3LK0 A;  2JWW A;  5JJG A;  2BEC A;  1SRA A;  4YI9 A;  3SG2 A;  1QIV A;  1DGU A;  1Y6W A;  2ZFD A;  3O4Y A;  1K2H A;  3OP0 A;  3CS1 A;  3DF0 A;  5KSZ A;  2MLE C;  1YUR A;  2JC2 A;  2L0P A;  1S5G Z;  1SY9 A;  3SIB A;  2PRU A;  1WY9 A;  2KNE A;  2LC5 A;  3AAJ A;  1NYA A;  3EVU A;  2M3W A;  3NXA A;  4JPZ B;  4MLW A;  2CBL A;  3DVE A;  2E6W A;  4YGC B;  2K7O A;  2VRG A;  2FCD A;  4OV2 A;  2I2R E;  2KSP A;  4BY4 A;  4N1F A;  2AUC A;  1S6C A;  2RGI A;  4WQ3 A;  1CFF A;  4PE7 A;  3SG5 A;  3EVV A;  4ORA B;  3EKH A;  1CM4 A;  2KOT A;  1CNP A;  4L9M A;  1KK7 Z;  1TOP A;  3NSL A;  4AOM A;  5DKN A;  5BPJ A;  1IRJ A;  4HRH A;  2NXQ A;  1SYM A;  1S6I A;  4F0Z B;  5DKR A;  3WHU B;  3EK8 A;  4N5X A;  4I5N B;  2DOQ A;  5F6T A;  4UPG A;  3TDU A;  1SCM C;  1QLS A;  4XYN A;  3BOW A;  1TTX A;  1YX7 A;  4OVN F;  1GJY A;  1MXE A;  5HLV A;  2F2P A;  2CTN A;  2KI6 D;  2K61 A;  4R1E A;  1DF0 B;  2CXJ A;  1KWO C;  1PVA A;  1NUB A;  2LMT A;  2LMU A;  3RM1 A;  1QJT A;  3I5H C;  2KI4 C;  4PAL A;  4YRU A;  2BBM A;  1A2X A;  1K94 A;  1VRK A;  1N2D A;  3LCP C;  1SL7 A;  1BF5 A;  2BE4 A;  5CSJ A;  2M8U A;  1EG4 A;  2AMI A;  4I5K A;  2M7L A;  4PE0 A;  2CT9 A;  2KAX A;  4DIR A;  1RTP 1;  1RFJ A;  3VGO A;  2M29 A;  2CCM A;  4I5J A;  3TDI A;  1RWY A;  2K7D A;  5J3X A;  4D1E A;  3D10 A;  2G9B A;  2ZN8 A;  3KO0 A;  4MRX A;  1J7P A;  1QX7 A;  1SCM B;  1CDL A;  5HKW A;  1WLZ A;  3VRN A;  1SNL A;  5AER A;  5CSN A;  1GGZ A;  1KWO B;  1TNP A;  5ER5 A;  4CPV A;  1BMO A;  1AP4 A;  5K89 A;  3I5H B;  2KAV A;  2KI4 B;  1RJV A;  3AKA A;  3BXK A;  1K96 A;  1XFW O;  3H4S E;  4GAO A;  2H61 A;  3ZWH A;  1EH2 A;  3K21 A;  1F54 A;  1BU3 A;  4PHJ A;  3SJS A;  3DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...