2LC5A

Calmodulin-like protein from entamoeba histolytica: solution structure and calcium-binding properties of a partially folded protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
MSEQKKVLTAEEQQEYKEAFQLFDKDNDNKLTAEELGTVMRALGANPTKQKISEIVKDYDKDNSGKFDQETFLTIMLEYGQEVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, putative
publication title Calmodulin like protein from Entamoeba histolytica: solution structure and calcium binding properties of a partially folded protein.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Metal binding protein
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2011-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lc5A00
5D69A 2MRDA 2KGRA 3BUNB 1FI5A 1F55A 4P2YB 4Q04A 3JVTC 1MF8B 1SCMC 3EKHA 1XFWO 2KAYA 1XA5A 4WQ2A 4I5NB 1JWDA 3DF0A 1K90D 5CSNA 5PALA 3PFVA 2QACA 1BMOA 3BXKA 4QJ4B 4I5LB 1QX2A 4N1FA 3PSRA 4OR9B 2ZN8A 3I5FB 1PVBA 3IF7A 5AEQA 2O60A 3O4YA 3OX6A 1H8BA 1M46A 1R6PA 2MA2A 3DF0B 4YGEB 4GFTA 3WXAA 1QVIZ 1YX8A 1X02A 2F2OA 4WRIA 2ISDA 3H4SE 2M3WA 1GQMA 3JTDB 1LXFC 1NUBA 4D1EA 1M63B 1YUTA 2L50A 2PSRA 4HSZA 2M1KB 2JXLA 1DJGA 1TIZA 3GOFA 1G8IA 3TZ1A 1NWDA 2FJUB 4YGAA 2HETA 4NDDA 3AAKA 1L2OB 2BCXA 1DJIA 2BL0B 4DCKA 3LK0A 1Y0VH 1MWNA 1SY9A 2ZKMX 3SG3A 3KHEA 4F0ZB 1BLQA 1ALWA 3JVTB 4PHJA 2O5GA 2I94A 3WHUB 1B8LA 1XO5A 2M1UA 5HLVA 2M7NA 1Y1AA 3VRQA 2LVIA 2EGDA 2GGMA 2NCOA 1A75A 5CSJA 1CNPA 2KQ6A 1RK9A 1QTXA 1RJVA 1K8UA 2MBXA 2ZN9A 2MHHA 1KK7Z 1MXEA 1QASA 1QX5B 3CR5X 1FI6A 1XFYO 2EC6C 2JNXA 1QV0A 4N5XA 1EXRA 3KF9A 3OB1B 4ORBB 2JC2A 5J3XA 4PE7A 1A75B 2TN4A 1WRLA 1NSHA 3PN7C 3BUXB 4PCWA 2ZNDA 3I5IC 1SL8A 1M39A 1IG5A 4JQ0D 2BBNA 2NXQA 4MZJA 2K7CA 3TDZA 1BR1B 4C0LA 1KQVA 1N65A 2Y5IA 4BY4A 2HF5A 2KI6D 1NPQA 1BT6A 1OSAA 2IS9A 4FTGA 3SG6A 1KQMC 4AOMA 3VRPA 1KWOC 1YRTB 2COLB 4FQOA 1NCZA 1MR8A 2K7OA 2Q4UA 3CLNA 1JBAA 1OZOA 1KSOA 2HQ8A 3KPXA 3EVRA 4CFQA 1RROA 3C1VA 4AQJA 1ALVA 1VRKA 3PALA 4UPGA 4MZLA 2K2FA 4N1GA 1UURA 1WY9A 1N2DA 3PLFB 2JPTA 1QVIY 1LA3A 1FBVA 4YGCB 2LV7A 2BE6A 4C0KA 1JFKA 1XVJA 2EC6B 2LP2A 2OTGB 1DGUA 2WORA 2V53A 3M0WA 1FF1A 2M8UA 3DD4A 3NSKA 2ZRSA 1MHOA 3NXAA 1CM4A 1KK8C 3AAJA 3CR2A 1DJZA 1WRZA 2WCFA 2P6BB 1K9PA 1QIVA 1UHIA 1YVHA 5JJGA 1WLMA 1IWQA 1EL4A 2OS8B 3A4UB 2JWWA 1JF2A 1B8CA 1MXLC 4A4BA 3JTDC 4MN0A 1RTP1 1PK0D 2KYFA 1F4QA 3EK8A 5HKZA 3DVMA 1F71A 1PSRA 2L0PA 3E3RA 1QATA 1W7JB 1HQVA 3BQ3A 2H61A 3DVEA 3TDUA 1NX1A 1KFXS 3PM8A 3SJSA 1A2XA 1EG3A 4PALA 1NP8A 1KK7Y 1L2OC 2BL0C 5IBWA 3TUYB 1NX3A 1QJTA 2M7LA 3WHTB 1Y6WA 2K7DA 2JXCA 2BECA 5DKNA 1DVIA 1ZFSA 1S6JA 1BJFA 2FOTA 1JUOA 4JWQA 2BKIB 1CB1A 1GJYA 1SCVA 3OX5A 4TNCA 3FS7A 4ETOA 2LVJA 1EJ3A 1C7VA 5G08A 1MQ1A 1YUUA 2PALA 4NDBA 5FYXA 2M29A 1SL7A 1J7RA 4CLNA 3O2PA 1B9AA 1U5IA 4M2OA 1SKTA 5GQQC 4AQIA 2CT9A 2G9BA 2KGBC 2LVKA 1EG4A 1SYMA 5AXIA 2LMTA 1W7IB 2KBIA 4MSPA 1KK8B 3WNXB 1CMGA 2BKHB 5D7FA 1CFPA 3BUOB 1OE9B 2KFFA 4XYNA 1BR4B 2ZFDA 4GGFA 2HQWA 5KTYA 1ZOTB 1U5IB 1NX2A 1OMVA 2LUCA 1R2UA 1DJYA 1NX0A 2Y1MA 3DVKA 4MLWA 3EK4A 2HPSA 1JC2A 1AJ5A 1OMRA 5KSZA 2F3ZA 2LLUA 1N0YA 4OVNF 4IL1A 2JT3A 3K21A 5HLOA 3VROA 1F70A 2L98A 1TNPA 2LM5A 1CDLA 1A03A 3DVJA 2LMVA 1PRWA 4GGNA 2LP3A 2WOSA 1QLSA 2PRUA 1GGWA 2GGZA 1K95A 1TNQA 5HKWA 2WCBA 3O78A 4ORCB 4CPVA 2MLEC 5I8NA 1HT9A 1TNXA 5I2LA 2I18A 1QV1A 1V1GA 1NCXA 1K93D 3EVVA 3I5HB 4DS7A 2L51A 1CFCA 2Y4QA 1DJHA 1XFXO 1KFXL 4R1EA 1S3PA 1YURA 2OTGC 2JT0A 5AANA 1C07A 2FCDA 2K61A 1CTRA 2JRFA 4DRWA 4YBHB 4MRXA 4M2QA 2D8NA 1WLZA 1IJ6A 2BCAA 2NLNA 4A4CA 2LLTA 4MEWA 1SK6D 2OS8C 2L4HA 1BG1A 1CM1A 1XK4A 2KNEA 2LNKA 3SIBA 2Y1NA 4GBAA 3VRRA 1S26D 4I5KA 1TOPA 1K2HA 3AKBA 1SRAA 1G4YR 3EVUA 4YGBB 3MSEB 5TNCA 2JZIA 1OMDA 3TUYC 3TS5B 1B1GA 4WQ3A 1PULA 1YUSA 2LUXA 5CSIA 3OB2B 2KI4B 1UUSA 1K94A 1AHRA 1OZSA 1YX7A 2H61C 2PASA 1EH2A 4YI8A 1A4PA 2A4JA 1PSBA 2CBLA 5I2QA 1QXPA 4DUQA 2BBMA 1DT7B 2JOJA 2L5XB 1OQPA 1LVCD 5HKYA 1CFFA 2AMIA 2SASA 1CFDA 1NIWA 2GV5A 2L2EA 2MAZA 3CS1A 1J55A 1J1DA 1SBJA 1Y1UA 1V1FA 4PDZA 5CPVA 1M31A 1AJ4A 1PALA 1S5GZ 3GK1A 1CDMA 5HYDA 1WDCB 4QJ5B 1JSAA 2K7BA 1B8RA 3LCPC 2LCPA 1TNWA 4YRUA 4OCIA 2Q91A 1AUIB 1J7PA 4PE4A 5F6TA 2FCEA 2LC5A 2LE9B 2KOTA 4XJKA 2OPOA 1J7OA 4GGFC 1SNLA 1UHNA 1SW8A 1YR5A 1QLKA 1LKJA 1LA0A 1B4CA 2DOQA 3ZWHA 3SG7A 1IRJA 2L4IA 1XFUO 1KFUS 2JT8A 3FWBA 4XJKB 1SPYA 5CSFA 1B7TZ 1QIWA 2AUCA 1WRKA 3FIAA 1TCOB 1UWOA 3CTNA 3OHMB 4GPLB 1IKUA 3NSIA 1SMGA 2M0RA 5DKQA 3GK4X 3I5HC 3QRXA 4M2PA 1IJ5A 5I2OA 4PE1A 4PHKA 4GUKA 1G33A 5DKRA 1FPWA 3CZTX 4NDCA 2KFHA 4CIDA 1GGZA 4YI9A 1J1EA 2LLSA 4GAOA 1DTLA 2E6WA 3SIAA 3SG4A 1AK8A 1Y1XA 4HRHA 5JOLA 3LLEA 1SR6B 1UHHA 3ICBA 2H2KA 1DJWA 2LHIA 2KBMA 1A29A 1IH0A 3I5GB 3SG2A 2JQ6A 5ER4X 2JULA 5KU1A 3CR4X 2F3YA 1TCFA 3VRNA 1B47A 4E68A 1RECA 1BU3A 1YTZC 2LANA 5B8IB 1DGVA 2LVVA 5AERA 3HX4A 1ODBA 2KYCA 1K9KA 3TS5C 1XK4C 1K9UA 2LMUA 1DJXA 2KI6C 1NYAA 2I7AA 2KI4C 1OOJA 5AFPA 4OV2A 2MLFC 1S5GY 2K0JA 1CDNA 2I2RE 2JTZA 1C7WA 4GNKB 3KEVA 4JPZB 2CTNA 2JNFA 1SL9A 1F4OA 1F8HA 1CLLA 1YRUB 1BODA 2NZ0A 3KO0A 4ZCUA 4C0JA 2F2PA 1ZMZA 2F8PA 3EK7A 4MZKA 3IQOA 3D0YA 1SCMB 1JFJA 3NSOA 2WCEA 1KFUL 2RGIA 3FWCA 2G2BA 4BY5A 3ZNIA 3OP0A 1WDCC 2LHLA 1L7ZA 3BYAA 3BOWA 4YGDB 2F33A 5BPJA 2M97A 1Q80A 3F45A 1B7TY 4OKHA 3LK1A 1S1EA 3D0YB 1IQ3A 1RFJA 2KDHA 3BUWB 3IQQA 2KSPA 1MUXA 1NCYA 1TRFA 4MRYA 3GK2A 2WNDA 3BOWB 1LINA 2M49B 3RLZA 1XFVO 2B1UA 3O6BA 1UP5A 1TN4A 2SCPA 3PATA 1K96A 2R2IA 1UHJA 4USLA 3D10A 2JTTA 2KFGA 2KAXA 4MVFA 1YVLA 1DF0A 2KAVA 5ER5A 4CFRA 3BUMB 4I5JA 1QS7A 1BF5A 1D1OA 5K89A 1S36A 1E8AA 1ZUZA 4HREE 4ICBA 1M45A 2PVBA 4NQGA 1ZACA 2K8MB 1S6CA 2CXJA 4L9MA 1QX7A 1S6IA 1CKKA 1DF0B 3A8RA 2PMYA 1IGVA 2BCBA 3HCMA 2EHBA 4P5OE 3CGAA 1BOCA 1CLBA 2LAPA 4MBEA 3NSLA 3RM1A 1SR6C 1KCYA 4PHNA 3I5GC 2KHNA 3VGOA 2ZNEA 1KSMA 1DMOA 4ZCVA 2K2AA 2VRGA 2NCPA 1PVAA 2ZRTA 1XYDA 2KQYA 3PN7B 4HRGA 4ORAB 1UHKA 1FW4A 2M9GA 4U8DA 1J7QA 2QPTA 3I5IB 3I5FC 1H4BA 3LL8B 1CMFA 3AKAA 2MJWB 1CDPA 3TDIA 2CCMA 3EKJA 1XFZO 1IQ5A 1AVSA 2CNPA 2E30A 2AAOA 1JF0A 2WC8A 4PE0A 2JU0A 4PHMA 1AP4A 3SG5A 1KQMB 4DIRA 1KWOB 3CWGA 4QJ3B 2BE4A 1F54A 1TTXA 1RWYA 1CLMA
chains in the Genus database with same CATH superfamily
5D69A 2MRDA 2KGRA 3BUNB 3OGNA 1FI5A 1F55A 4P2YB 4Q04A 3JVTC 1MF8B 1SCMC 3EKHA 1XFWO 2KAYA 1XA5A 4WQ2A 4I5NB 1JWDA 3CABA 3DF0A 1K90D 5CSNA 5PALA 3NHTA 3PFVA 2QACA 1BMOA 3BXKA 4QJ4B 4I5LB 1C3ZA 1QX2A 3NHIA 4N1FA 3PSRA 4OR9B 2ZN8A 3I5FB 1PVBA 3IF7A 3IVTA 5AEQA 2O60A 3O4YA 3OX6A 1H8BA 1M46A 1R6PA 2MA2A 3DF0B 4YGEB 3D73A 4GFTA 3WXAA 1QVIZ 1YX8A 4PT1A 1X02A 2F2OA 4WRIA 2ISDA 3H4SE 2M3WA 1GQMA 3JTDB 1LXFC 1NUBA 4D1EA 1M63B 1YUTA 2L50A 2PSRA 4HSZA 2M1KB 2JXLA 1DJGA 1TIZA 3GOFA 1G8IA 3TZ1A 1NWDA 2FJUB 4YGAA 2HETA 4NDDA 3AAKA 1L2OB 2BCXA 1DJIA 2BL0B 4DCKA 3LK0A 1Y0VH 2QEHA 1MWNA 1SY9A 2ZKMX 3SG3A 3KHEA 4F0ZB 3D76A 1BLQA 1ALWA 3JVTB 4PHJA 2O5GA 2I94A 3WHUB 1B8LA 1XO5A 5FI6A 2M1UA 5HLVA 2M7NA 1Y1AA 3S0DA 2LVIA 2EGDA 2GGMA 2NCOA 3VRQA 1A75A 5CSJA 1CNPA 2KQ6A 1RK9A 1QTXA 1RJVA 1K8UA 2MBXA 2ZN9A 2MHHA 1KK7Z 3Q8IA 1MXEA 1QASA 2P71A 1QX5B 3CR5X 5D3OA 1XFYO 1FI6A 2EC6C 2JNXA 3D75A 1QV0A 3S0AA 4N5XA 1EXRA 3KF9A 3OB1B 3R1PA 3DY9A 4ORBB 4KYNA 2JC2A 5J3XA 4PE7A 1A75B 2TN4A 2WCHA 1WRLA 1NSHA 3PN7C 1GM0A 3BUXB 4PCWA 2ZNDA 3I5IC 1SL8A 1M39A 1ORGA 1IG5A 4JQ0D 2BBNA 2NXQA 4MZJA 2K7CA 3TDZA 1BR1B 4C0LA 1KQVA 1N65A 2Y5IA 4BY4A 2HF5A 2KI6D 1NPQA 1BT6A 1OSAA 3BFHA 2IS9A 4FTGA 3SG6A 1KQMC 4AOMA 3VRPA 1KWOC 1YRTB 2COLB 4FQOA 1NCZA 1MR8A 1P28A 2K7OA 2Q4UA 3L4LA 3SS4A 3B88A 3CLNA 1JBAA 1OZOA 1KSOA 2HQ8A 3KPXA 3EVRA 4CFQA 1T14A 3CZ0A 1RROA 3C1VA 3D78A 4AQJA 1ALVA 1VRKA 3PALA 4UPGA 4MZLA 2K2FA 4N1GA 1UURA 1WY9A 1N2DA 3PLFB 2JPTA 1QVIY 1LA3A 1FBVA 4YGCB 2LV7A 1TWOA 2BE6A 4C0KA 1JFKA 1XVJA 2EC6B 2LP2A 2OTGB 1DGUA 2WORA 2V53A 3M0WA 1FF1A 2M8UA 3DD4A 3NSKA 2ZRSA 1MHOA 3CZ2A 3NXAA 1CM4A 2KLEA 1KK8C 3AAJA 3CR2A 4OZDA 1DJZA 1WRZA 2WCFA 2P6BB 1K9PA 1QIVA 1UHIA 1OOIX 1YVHA 5JJGA 1WLMA 1IWQA 1EL4A 2OS8B 3A4UB 2JWWA 1JF2A 1B8CA 1MXLC 1Z4HA 4A4BA 3JTDC 3CDNA 4MN0A 1RTP1 1PK0D 2KYFA 1F4QA 3EK8A 3FE8A 3DVMA 5HKZA 1F71A 1PSRA 3B7AA 2L0PA 3E3RA 1QATA 1W7JB 1HQVA 3BQ3A 2H61A 2K60A 3SS3A 3DVEA 3TDUA 1NX1A 1KFXS 3PM8A 3SJSA 1A2XA 1EG3A 4PALA 1NP8A 1KK7Y 1L2OC 2BL0C 5IBWA 3TUYB 1NX3A 1QJTA 2M7LA 3DXLA 3WHTB 1Y6WA 2K7DA 2JXCA 2BECA 5DKNA 1DVIA 5HL1A 2PQLA 1ZFSA 3RZSA 3FE6A 4IJ7A 1S6JA 1BJFA 2FOTA 1JUOA 4JWQA 2BKIB 1CB1A 1GJYA 1SCVA 3OX5A 4TNCA 3FS7A 4ETOA 2LVJA 1EJ3A 1C7VA 5G08A 1MQ1A 1YUUA 2PALA 4NDBA 5DICA 5FYXA 2M29A 1SL7A 1J7RA 3BJHA 1DELA 3S0BA 4CLNA 3O2PA 1B9AA 1U5IA 4M2OA 1SKTA 5GQQC 4AQIA 2CT9A 2G9BA 2KGBC 5I94A 2LVKA 1EG4A 1SYMA 5AXIA 2LMTA 3CYZA 1W7IB 2KBIA 4MSPA 1KK8B 3WNXB 1CMGA 2BKHB 5D7FA 1CFPA 3BUOB 1OE9B 2KFFA 4XYNA 1BR4B 2ZFDA 4GGFA 1OOHA 2HQWA 5KTYA 1ZOTB 1U5IB 1NX2A 1OMVA 2LUCA 1R2UA 1DJYA 1NX0A 2Y1MA 3DVKA 3D77A 3PJIA 4MLWA 1DC1A 3EK4A 2HPSA 2YGUA 1JC2A 1AJ5A 1OMRA 2P70A 5KSZA 2F3ZA 2LLUA 1N0YA 4OVNF 4IL1A 2JT3A 3K21A 5HLOA 3VROA 1F70A 2L98A 1TNPA 2LM5A 1CDLA 1A03A 3DVJA 3DZTA 2LMVA 1PRWA 4GGNA 2LP3A 2WC6A 2WOSA 1QLSA 2PRUA 1GGWA 2GGZA 1K95A 1TNQA 5HKWA 2WCBA 3O78A 4ORCB 4CPVA 2MLEC 5I8NA 1HT9A 1TNXA 5I2LA 2GTEA 2I18A 1QV1A 1V1GA 1NCXA 1K93D 3B86A 3EVVA 3I5HB 2L51A 4DS7A 3EG5B 3V2LA 1CFCA 2Y4QA 1DJHA 1XFXO 1KFXL 4R1EA 1S3PA 1YURA 2OTGC 2L2CA 2JT0A 5AANA 1C07A 2FCDA 2K61A 1CTRA 2JRFA 4DRWA 4YBHB 3R72A 4MRXA 4M2QA 2D8NA 2FJYA 4INXA 1WLZA 3UO9A 1IJ6A 2BCAA 2NLNA 4A4CA 2LLTA 4MEWA 1SK6D 2OS8C 2L4HA 1BG1A 1CM1A 1XK4A 2QEOA 2KNEA 2LNKA 3SIBA 2Y1NA 4GBAA 3VRRA 1S26D 4I5KA 3CZ1A 1TOPA 1K2HA 3AKBA 1SRAA 1G4YR 2H8VA 3EVUA 4YGBB 3MSEB 5TNCA 2JZIA 1OMDA 3FE9A 3TS5B 3TUYC 1B1GA 4WQ3A 1PULA 1YUSA 2LUXA 2WCKA 5CSIA 3OB2B 2KI4B 1UUSA 1K94A 1AHRA 1OZSA 1YX7A 2JPOA 2H61C 1IIOA 2PASA 1EH2A 4YI8A 1A4PA 2A4JA 1PSBA 2CBLA 3NGVA 5I2QA 1QXPA 4DUQA 2BBMA 1DT7B 2JOJA 2L5XB 1OQPA 1LVCD 5HKYA 1CFFA 2AMIA 2SASA 1CFDA 1Z2CB 1NIWA 2GV5A 2L2EA 2MAZA 2QEVA 1J55A 3CS1A 1J1DA 1SBJA 1Y1UA 1V1FA 4PDZA 5CPVA 1M31A 1AJ4A 1PALA 1S5GZ 3GK1A 1CDMA 5HYDA 1WDCB 4QJ5B 1JSAA 2K7BA 1B8RA 3LCPC 1DQEA 2LCPA 1TNWA 2L5YA 2QEBA 4OCIA 2Q91A 1AUIB 4YRUA 3R1OA 1J7PA 4PE4A 5F6TA 2FCEA 2LC5A 2LE9B 2KOTA 4XJKA 2OPOA 1C3YA 1J7OA 2WCLA 1SNLA 4GGFC 3S0GA 1UHNA 1SW8A 1YR5A 1QLKA 1LKJA 1LA0A 1B4CA 2DOQA 3ZWHA 3SG7A 1IRJA 2L4IA 1XFUO 1KFUS 2JT8A 3FWBA 4XJKB 3L4AA 1SPYA 5CSFA 1B7TZ 1QIWA 2AUCA 1WRKA 3FIAA 1TCOB 1UWOA 1OW4A 3CTNA 3OHMB 4GPLB 1IKUA 2ERBA 3NSIA 1SMGA 2M0RA 5EL2A 5DKQA 3GK4X 3I5HC 3QRXA 4M2PA 1IJ5A 5I2OA 4PE1A 4PHKA 4GUKA 2WCMA 1G33A 5DKRA 1FPWA 3CZTX 4NDCA 3D74A 2KFHA 4CIDA 1GGZA 2QDIA 4YI9A 1J1EA 2LLSA 4GAOA 1DTLA 2E6WA 3SIAA 3SG4A 1AK8A 1Y1XA 4HRHA 5JOLA 1DEKA 3LLEA 1SR6B 1UHHA 3ICBA 2H2KA 1DJWA 2LHIA 2KBMA 1A29A 1LS8A 4JD9A 3I5GB 3N7HA 4JKTA 3SG2A 2JQ6A 5ER4X 1IH0A 2JULA 5KU1A 3CR4X 2F3YA 1TCFA 3PM2A 1B47A 3VRNA 4E68A 2KPHA 1RECA 1BU3A 1YTZC 1TUJA 2LANA 3VB1A 5B8IB 1DGVA 3B6XA 2LVVA 5AERA 3HX4A 1OOFA 1ODBA 2KYCA 1K9KA 3TS5C 1XK4C 1K9UA 2LMUA 1DJXA 2KI6C 3DYEA 1NYAA 2I7AA 2KI4C 1OOJA 5AFPA 4OV2A 1W9ZA 1S5GY 2K0JA 2MLFC 1CDNA 2I2RE 2JTZA 2BAPA 2BNXA 1C7WA 4GNKB 3KEVA 4JPZB 2CTNA 2JNFA 1SL9A 1F4OA 1F8HA 1CLLA 1YRUB 1BODA 2NZ0A 3KO0A 4ZCUA 4C0JA 2F2PA 5FI2A 1ZMZA 2F8PA 3EK7A 4MZKA 3IQOA 3D0YA 1SCMB 1JFJA 3NSOA 2WCEA 1KFUL 2RGIA 3FWCA 1OOGA 2G2BA 4BY5A 3ZNIA 3OP0A 1WDCC 2LHLA 1L7ZA 3BYAA 3BOWA 4YGDB 2F33A 1QWVA 5BPJA 2M97A 1Q80A 3F45A 1B7TY 4OKHA 3LK1A 1S1EA 3D0YB 1IQ3A 1RFJA 2KDHA 3BUWB 3IQQA 2KSPA 1MUXA 1NCYA 1TRFA 4MRYA 3GK2A 2WNDA 3BOWB 1LINA 1SSEB 2M49B 3OBVA 4INWA 3RLZA 1XFRA 1XFVO 2B1UA 3O6BA 1UP5A 1TN4A 2SCPA 3BFBA 3PATA 1K96A 2R2IA 1UHJA 4USLA 3O4XA 1TUZA 3D10A 2JTTA 2WCJA 2KFGA 2KAXA 4MVFA 1YVLA 1DF0A 2KAVA 5ER5A 4CFRA 3BUMB 4I5JA 1QS7A 1BF5A 1D1OA 5K89A 1S36A 1E8AA 1ZUZA 4HREE 4ICBA 1M45A 3S0FA 2PVBA 4NQGA 1ZACA 2K8MB 1S6CA 2CXJA 4L9MA 1QX7A 1S6IA 3K1EA 1CKKA 1DF0B 3A8RA 2PMYA 1IGVA 2BCBA 3HCMA 2EHBA 4FQTA 3CGAA 4P5OE 1BOCA 1CLBA 2LAPA 4MBEA 3NSLA 3RM1A 1SR6C 1KCYA 4PHNA 3S0EA 3I5GC 3B87A 2KHNA 2PYQA 2ZNEA 1KSMA 3VGOA 1DMOA 3R1VA 4ZCVA 2K2AA 2VRGA 2NCPA 1PVAA 2ZRTA 1XYDA 2KQYA 3PN7B 4HRGA 2KLDA 4ORAB 1UHKA 1FW4A 2M9GA 4U8DA 1J7QA 2QPTA 3I5IB 3I5FC 1H4BA 3LL8B 1CMFA 3AKAA 2MJWB 1CDPA 3TDIA 2CCMA 3EKJA 1XFZO 1IQ5A 1AVSA 3SS5A 2CNPA 2E30A 2AAOA 3UNWA 3BFAA 1JF0A 2WC8A 4PE0A 2JU0A 3L47A 4PHMA 1AP4A 3SG5A 1KQMB 2WC5A 4DIRA 1KWOB 3CWGA 4QJ3B 4F7FA 2BE4A 1F54A 1TTXA 3QMEA 5FI7A 1RWYA 1CLMA
chains in the Genus database with same CATH topology
5D69A 2MRDA 2KGRA 3BUNB 1FI5A 1F55A 4P2YB 4Q04A 3JVTC 1MF8B 1SCMC 3EKHA 1XFWO 2KAYA 1XA5A 4WQ2A 4I5NB 1JWDA 3DF0A 1K90D 5CSNA 5PALA 3PFVA 2QACA 1BMOA 3BXKA 4QJ4B 4I5LB 1QX2A 4N1FA 3PSRA 4OR9B 2ZN8A 3I5FB 1PVBA 3IF7A 5AEQA 2O60A 3O4YA 3OX6A 1H8BA 1M46A 1R6PA 2MA2A 3DF0B 4YGEB 4GFTA 3WXAA 1QVIZ 1YX8A 1X02A 2F2OA 4WRIA 2ISDA 3H4SE 2M3WA 1GQMA 3JTDB 1LXFC 1NUBA 4D1EA 1M63B 1YUTA 2L50A 2PSRA 4HSZA 2M1KB 2JXLA 1DJGA 1TIZA 3GOFA 1G8IA 3TZ1A 1NWDA 2FJUB 4YGAA 2HETA 4NDDA 3AAKA 1L2OB 2BCXA 1DJIA 2BL0B 4DCKA 3LK0A 1Y0VH 1MWNA 1SY9A 2ZKMX 3SG3A 3KHEA 4F0ZB 1BLQA 1ALWA 3JVTB 4PHJA 2O5GA 2I94A 3WHUB 1B8LA 1XO5A 2M1UA 5HLVA 2M7NA 1Y1AA 3VRQA 2LVIA 2EGDA 2GGMA 2NCOA 1A75A 5CSJA 1CNPA 2KQ6A 1RK9A 1QTXA 1RJVA 1K8UA 2MBXA 2ZN9A 2MHHA 1KK7Z 1MXEA 1QASA 1QX5B 3CR5X 1FI6A 1XFYO 2EC6C 2JNXA 1QV0A 4N5XA 1EXRA 3KF9A 3OB1B 4ORBB 2JC2A 5J3XA 4PE7A 1A75B 2TN4A 1WRLA 1NSHA 3PN7C 3BUXB 4PCWA 2ZNDA 3I5IC 1SL8A 1M39A 1IG5A 4JQ0D 2BBNA 2NXQA 4MZJA 2K7CA 3TDZA 1BR1B 4C0LA 1KQVA 1N65A 2Y5IA 4BY4A 2HF5A 2KI6D 1NPQA 1BT6A 1OSAA 2IS9A 4FTGA 3SG6A 1KQMC 4AOMA 3VRPA 1KWOC 1YRTB 2COLB 4FQOA 1NCZA 1MR8A 2K7OA 2Q4UA 3CLNA 1JBAA 1OZOA 1KSOA 2HQ8A 3KPXA 3EVRA 4CFQA 1RROA 3C1VA 4AQJA 1ALVA 1VRKA 3PALA 4UPGA 4MZLA 2K2FA 4N1GA 1UURA 1WY9A 1N2DA 3PLFB 2JPTA 1QVIY 1LA3A 1FBVA 4YGCB 2LV7A 2BE6A 4C0KA 1JFKA 1XVJA 2EC6B 2LP2A 2OTGB 1DGUA 2WORA 2V53A 3M0WA 1FF1A 2M8UA 3DD4A 3NSKA 2ZRSA 1MHOA 3NXAA 1CM4A 1KK8C 3AAJA 3CR2A 1DJZA 1WRZA 2WCFA 2P6BB 1K9PA 1QIVA 1UHIA 1YVHA 5JJGA 1WLMA 1IWQA 1EL4A 2OS8B 3A4UB 2JWWA 1JF2A 1B8CA 1MXLC 4A4BA 3JTDC 4MN0A 1RTP1 1PK0D 2KYFA 1F4QA 3EK8A 5HKZA 3DVMA 1F71A 1PSRA 2L0PA 3E3RA 1QATA 1W7JB 1HQVA 3BQ3A 2H61A 3DVEA 3TDUA 1NX1A 1KFXS 3PM8A 3SJSA 1A2XA 1EG3A 4PALA 1NP8A 1KK7Y 1L2OC 2BL0C 5IBWA 3TUYB 1NX3A 1QJTA 2M7LA 3WHTB 1Y6WA 2K7DA 2JXCA 2BECA 5DKNA 1DVIA 1ZFSA 1S6JA 1BJFA 2FOTA 1JUOA 4JWQA 2BKIB 1CB1A 1GJYA 1SCVA 3OX5A 4TNCA 3FS7A 4ETOA 2LVJA 1EJ3A 1C7VA 5G08A 1MQ1A 1YUUA 2PALA 4NDBA 5FYXA 2M29A 1SL7A 1J7RA 4CLNA 3O2PA 1B9AA 1U5IA 4M2OA 1SKTA 5GQQC 4AQIA 2CT9A 2G9BA 2KGBC 2LVKA 1EG4A 1SYMA 5AXIA 2LMTA 1W7IB 2KBIA 4MSPA 1KK8B 3WNXB 1CMGA 2BKHB 5D7FA 1CFPA 3BUOB 1OE9B 2KFFA 4XYNA 1BR4B 2ZFDA 4GGFA 2HQWA 5KTYA 1ZOTB 1U5IB 1NX2A 1OMVA 2LUCA 1R2UA 1DJYA 1NX0A 2Y1MA 3DVKA 4MLWA 3EK4A 2HPSA 1JC2A 1AJ5A 1OMRA 5KSZA 2F3ZA 2LLUA 1N0YA 4OVNF 4IL1A 2JT3A 3K21A 5HLOA 3VROA 1F70A 2L98A 1TNPA 2LM5A 1CDLA 1A03A 3DVJA 2LMVA 1PRWA 4GGNA 2LP3A 2WOSA 1QLSA 2PRUA 1GGWA 2GGZA 1K95A 1TNQA 5HKWA 2WCBA 3O78A 4ORCB 4CPVA 2MLEC 5I8NA 1HT9A 1TNXA 5I2LA 2I18A 1QV1A 1V1GA 1NCXA 1K93D 3EVVA 3I5HB 4DS7A 2L51A 1CFCA 2Y4QA 1DJHA 1XFXO 1KFXL 4R1EA 1S3PA 1YURA 2OTGC 2JT0A 5AANA 1C07A 2FCDA 2K61A 1CTRA 2JRFA 4DRWA 4YBHB 4MRXA 4M2QA 2D8NA 1WLZA 1IJ6A 2BCAA 2NLNA 4A4CA 2LLTA 4MEWA 1SK6D 2OS8C 2L4HA 1BG1A 1CM1A 1XK4A 2KNEA 2LNKA 3SIBA 2Y1NA 4GBAA 3VRRA 1S26D 4I5KA 1TOPA 1K2HA 3AKBA 1SRAA 1G4YR 3EVUA 4YGBB 3MSEB 5TNCA 2JZIA 1OMDA 3TUYC 3TS5B 1B1GA 4WQ3A 1PULA 1YUSA 2LUXA 5CSIA 3OB2B 2KI4B 1UUSA 1K94A 1AHRA 1OZSA 1YX7A 2H61C 2PASA 1EH2A 4YI8A 1A4PA 2A4JA 1PSBA 2CBLA 5I2QA 1QXPA 4DUQA 2BBMA 1DT7B 2JOJA 2L5XB 1OQPA 1LVCD 5HKYA 1CFFA 2AMIA 2SASA 1CFDA 1NIWA 2GV5A 2L2EA 2MAZA 3CS1A 1J55A 1J1DA 1SBJA 1Y1UA 1V1FA 4PDZA 5CPVA 1M31A 1AJ4A 1PALA 1S5GZ 3GK1A 1CDMA 5HYDA 1WDCB 4QJ5B 1JSAA 2K7BA 1B8RA 3LCPC 2LCPA 1TNWA 4YRUA 4OCIA 2Q91A 1AUIB 1J7PA 4PE4A 5F6TA 2FCEA 2LC5A 2LE9B 2KOTA 4XJKA 2OPOA 1J7OA 4GGFC 1SNLA 1UHNA 1SW8A 1YR5A 1QLKA 1LKJA 1LA0A 1B4CA 2DOQA 3ZWHA 3SG7A 1IRJA 2L4IA 1XFUO 1KFUS 2JT8A 3FWBA 4XJKB 1SPYA 5CSFA 1B7TZ 1QIWA 2AUCA 1WRKA 3FIAA 1TCOB 1UWOA 3CTNA 3OHMB 4GPLB 1IKUA 3NSIA 1SMGA 2M0RA 5DKQA 3GK4X 3I5HC 3QRXA 4M2PA 1IJ5A 5I2OA 4PE1A 4PHKA 4GUKA 1G33A 5DKRA 1FPWA 3CZTX 4NDCA 2KFHA 4CIDA 1GGZA 4YI9A 1J1EA 2LLSA 4GAOA 1DTLA 2E6WA 3SIAA 3SG4A 1AK8A 1Y1XA 4HRHA 5JOLA 3LLEA 1SR6B 1UHHA 3ICBA 2H2KA 1DJWA 2LHIA 2KBMA 1A29A 1IH0A 3I5GB 3SG2A 2JQ6A 5ER4X 2JULA 5KU1A 3CR4X 2F3YA 1TCFA 3VRNA 1B47A 4E68A 1RECA 1BU3A 1YTZC 2LANA 5B8IB 1DGVA 2LVVA 5AERA 3HX4A 1ODBA 2KYCA 1K9KA 3TS5C 1XK4C 1K9UA 2LMUA 1DJXA 2KI6C 1NYAA 2I7AA 2KI4C 1OOJA 5AFPA 4OV2A 2MLFC 1S5GY 2K0JA 1CDNA 2I2RE 2JTZA 1C7WA 4GNKB 3KEVA 4JPZB 2CTNA 2JNFA 1SL9A 1F4OA 1F8HA 1CLLA 1YRUB 1BODA 2NZ0A 3KO0A 4ZCUA 4C0JA 2F2PA 1ZMZA 2F8PA 3EK7A 4MZKA 3IQOA 3D0YA 1SCMB 1JFJA 3NSOA 2WCEA 1KFUL 2RGIA 3FWCA 2G2BA 4BY5A 3ZNIA 3OP0A 1WDCC 2LHLA 1L7ZA 3BYAA 3BOWA 4YGDB 2F33A 5BPJA 2M97A 1Q80A 3F45A 1B7TY 4OKHA 3LK1A 1S1EA 3D0YB 1IQ3A 1RFJA 2KDHA 3BUWB 3IQQA 2KSPA 1MUXA 1NCYA 1TRFA 4MRYA 3GK2A 2WNDA 3BOWB 1LINA 2M49B 3RLZA 1XFVO 2B1UA 3O6BA 1UP5A 1TN4A 2SCPA 3PATA 1K96A 2R2IA 1UHJA 4USLA 3D10A 2JTTA 2KFGA 2KAXA 4MVFA 1YVLA 1DF0A 2KAVA 5ER5A 4CFRA 3BUMB 4I5JA 1QS7A 1BF5A 1D1OA 5K89A 1S36A 1E8AA 1ZUZA 4HREE 4ICBA 1M45A 2PVBA 4NQGA 1ZACA 2K8MB 1S6CA 2CXJA 4L9MA 1QX7A 1S6IA 1CKKA 1DF0B 3A8RA 2PMYA 1IGVA 2BCBA 3HCMA 2EHBA 4P5OE 3CGAA 1BOCA 1CLBA 2LAPA 4MBEA 3NSLA 3RM1A 1SR6C 1KCYA 4PHNA 3I5GC 2KHNA 3VGOA 2ZNEA 1KSMA 1DMOA 4ZCVA 2K2AA 2VRGA 2NCPA 1PVAA 2ZRTA 1XYDA 2KQYA 3PN7B 4HRGA 4ORAB 1UHKA 1FW4A 2M9GA 4U8DA 1J7QA 2QPTA 3I5IB 3I5FC 1H4BA 3LL8B 1CMFA 3AKAA 2MJWB 1CDPA 3TDIA 2CCMA 3EKJA 1XFZO 1IQ5A 1AVSA 2CNPA 2E30A 2AAOA 1JF0A 2WC8A 4PE0A 2JU0A 4PHMA 1AP4A 3SG5A 1KQMB 4DIRA 1KWOB 3CWGA 4QJ3B 2BE4A 1F54A 1TTXA 1RWYA 1CLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D69 A;  2MRD A;  2KGR A;  3BUN B;  1FI5 A;  1F55 A;  4P2Y B;  4Q04 A;  3JVT C;  1MF8 B;  1SCM C;  3EKH A;  1XFW O;  2KAY A;  1XA5 A;  4WQ2 A;  4I5N B;  1JWD A;  3DF0 A;  1K90 D;  5CSN A;  5PAL A;  3PFV A;  2QAC A;  1BMO A;  3BXK A;  4QJ4 B;  4I5L B;  1QX2 A;  4N1F A;  3PSR A;  4OR9 B;  2ZN8 A;  3I5F B;  1PVB A;  3IF7 A;  5AEQ A;  2O60 A;  3O4Y A;  3OX6 A;  1H8B A;  1M46 A;  1R6P A;  2MA2 A;  3DF0 B;  4YGE B;  4GFT A;  3WXA A;  1QVI Z;  1YX8 A;  1X02 A;  2F2O A;  4WRI A;  2ISD A;  3H4S E;  2M3W A;  1GQM A;  3JTD B;  1LXF C;  1NUB A;  4D1E A;  1M63 B;  1YUT A;  2L50 A;  2PSR A;  4HSZ A;  2M1K B;  2JXL A;  1DJG A;  1TIZ A;  3GOF A;  1G8I A;  3TZ1 A;  1NWD A;  2FJU B;  4YGA A;  2HET A;  4NDD A;  3AAK A;  1L2O B;  2BCX A;  1DJI A;  2BL0 B;  4DCK A;  3LK0 A;  1Y0V H;  1MWN A;  1SY9 A;  2ZKM X;  3SG3 A;  3KHE A;  4F0Z B;  1BLQ A;  1ALW A;  3JVT B;  4PHJ A;  2O5G A;  2I94 A;  3WHU B;  1B8L A;  1XO5 A;  2M1U A;  5HLV A;  2M7N A;  1Y1A A;  3VRQ A;  2LVI A;  2EGD A;  2GGM A;  2NCO A;  1A75 A;  5CSJ A;  1CNP A;  2KQ6 A;  1RK9 A;  1QTX A;  1RJV A;  1K8U A;  2MBX A;  2ZN9 A;  2MHH A;  1KK7 Z;  1MXE A;  1QAS A;  1QX5 B;  3CR5 X;  1FI6 A;  1XFY O;  2EC6 C;  2JNX A;  1QV0 A;  4N5X A;  1EXR A;  3KF9 A;  3OB1 B;  4ORB B;  2JC2 A;  5J3X A;  4PE7 A;  1A75 B;  2TN4 A;  1WRL A;  1NSH A;  3PN7 C;  3BUX B;  4PCW A;  2ZND A;  3I5I C;  1SL8 A;  1M39 A;  1IG5 A;  4JQ0 D;  2BBN A;  2NXQ A;  4MZJ A;  2K7C A;  3TDZ A;  1BR1 B;  4C0L A;  1KQV A;  1N65 A;  2Y5I A;  4BY4 A;  2HF5 A;  2KI6 D;  1NPQ A;  1BT6 A;  1OSA A;  2IS9 A;  4FTG A;  3SG6 A;  1KQM C;  4AOM A;  3VRP A;  1KWO C;  1YRT B;  2COL B;  4FQO A;  1NCZ A;  1MR8 A;  2K7O A;  2Q4U A;  3CLN A;  1JBA A;  1OZO A;  1KSO A;  2HQ8 A;  3KPX A;  3EVR A;  4CFQ A;  1RRO A;  3C1V A;  4AQJ A;  1ALV A;  1VRK A;  3PAL A;  4UPG A;  4MZL A;  2K2F A;  4N1G A;  1UUR A;  1WY9 A;  1N2D A;  3PLF B;  2JPT A;  1QVI Y;  1LA3 A;  1FBV A;  4YGC B;  2LV7 A;  2BE6 A;  4C0K A;  1JFK A;  1XVJ A;  2EC6 B;  2LP2 A;  2OTG B;  1DGU A;  2WOR A;  2V53 A;  3M0W A;  1FF1 A;  2M8U A;  3DD4 A;  3NSK A;  2ZRS A;  1MHO A;  3NXA A;  1CM4 A;  1KK8 C;  3AAJ A;  3CR2 A;  1DJZ A;  1WRZ A;  2WCF A;  2P6B B;  1K9P A;  1QIV A;  1UHI A;  1YVH A;  5JJG A;  1WLM A;  1IWQ A;  1EL4 A;  2OS8 B;  3A4U B;  2JWW A;  1JF2 A;  1B8C A;  1MXL C;  4A4B A;  3JTD C;  4MN0 A;  1RTP 1;  1PK0 D;  2KYF A;  1F4Q A;  3EK8 A;  5HKZ A;  3DVM A;  1F71 A;  1PSR A;  2L0P A;  3E3R A;  1QAT A;  1W7J B;  1HQV A;  3BQ3 A;  2H61 A;  3DVE A;  3TDU A;  1NX1 A;  1KFX S;  3PM8 A;  3SJS A;  1A2X A;  1EG3 A;  4PAL A;  1NP8 A;  1KK7 Y;  1L2O C;  2BL0 C;  5IBW A;  3TUY B;  1NX3 A;  1QJT A;  2M7L A;  3WHT B;  1Y6W A;  2K7D A;  2JXC A;  2BEC A;  5DKN A;  1DVI A;  1ZFS A;  1S6J A;  1BJF A;  2FOT A;  1JUO A;  4JWQ A;  2BKI B;  1CB1 A;  1GJY A;  1SCV A;  3OX5 A;  4TNC A;  3FS7 A;  4ETO A;  2LVJ A;  1EJ3 A;  1C7V A;  5G08 A;  1MQ1 A;  1YUU A;  2PAL A;  4NDB A;  5FYX A;  2M29 A;  1SL7 A;  1J7R A;  4CLN A;  3O2P A;  1B9A A;  1U5I A;  4M2O A;  1SKT A;  5GQQ C;  4AQI A;  2CT9 A;  2G9B A;  2KGB C;  2LVK A;  1EG4 A;  1SYM A;  5AXI A;  2LMT A;  1W7I B;  2KBI A;  4MSP A;  1KK8 B;  3WNX B;  1CMG A;  2BKH B;  5D7F A;  1CFP A;  3BUO B;  1OE9 B;  2KFF A;  4XYN A;  1BR4 B;  2ZFD A;  4GGF A;  2HQW A;  5KTY A;  1ZOT B;  1U5I B;  1NX2 A;  1OMV A;  2LUC A;  1R2U A;  1DJY A;  1NX0 A;  2Y1M A;  3DVK A;  4MLW A;  3EK4 A;  2HPS A;  1JC2 A;  1AJ5 A;  1OMR A;  5KSZ A;  2F3Z A;  2LLU A;  1N0Y A;  4OVN F;  4IL1 A;  2JT3 A;  3K21 A;  5HLO A;  3VRO A;  1F70 A;  2L98 A;  1TNP A;  2LM5 A;  1CDL A;  1A03 A;  3DVJ A;  2LMV A;  1PRW A;  4GGN A;  2LP3 A;  2WOS A;  1QLS A;  2PRU A;  1GGW A;  2GGZ A;  1K95 A;  1TNQ A;  5HKW A;  2WCB A;  3O78 A;  4ORC B;  4CPV A;  2MLE C;  5I8N A;  1HT9 A;  1TNX A;  5I2L A;  2I18 A;  1QV1 A;  1V1G A;  1NCX A;  1K93 D;  3EVV A;  3I5H B;  4DS7 A;  2L51 A;  1CFC A;  2Y4Q A;  1DJH A;  1XFX O;  1KFX L;  4R1E A;  1S3P A;  1YUR A;  2OTG C;  2JT0 A;  5AAN A;  1C07 A;  2FCD A;  2K61 A;  1CTR A;  2JRF A;  4DRW A;  4YBH B;  4MRX A;  4M2Q A;  2D8N A;  1WLZ A;  1IJ6 A;  2BCA A;  2NLN A;  4A4C A;  2LLT A;  4MEW A;  1SK6 D;  2OS8 C;  2L4H A;  1BG1 A;  1CM1 A;  1XK4 A;  2KNE A;  2LNK A;  3SIB A;  2Y1N A;  4GBA A;  3VRR A;  1S26 D;  4I5K A;  1TOP A;  1K2H A;  3AKB A;  1SRA A;  1G4Y R;  3EVU A;  4YGB B;  3MSE B;  5TNC A;  2JZI A;  1OMD A;  3TUY C;  3TS5 B;  1B1G A;  4WQ3 A;  1PUL A;  1YUS A;  2LUX A;  5CSI A;  3OB2 B;  2KI4 B;  1UUS A;  1K94 A;  1AHR A;  1OZS A;  1YX7 A;  2H61 C;  2PAS A;  1EH2 A;  4YI8 A;  1A4P A;  2A4J A;  1PSB A;  2CBL A;  5I2Q A;  1QXP A;  4DUQ A;  2BBM A;  1DT7 B;  2JOJ A;  2L5X B;  1OQP A;  1LVC D;  5HKY A;  1CFF A;  2AMI A;  2SAS A;  1CFD A;  1NIW A;  2GV5 A;  2L2E A;  2MAZ A;  3CS1 A;  1J55 A;  1J1D A;  1SBJ A;  1Y1U A;  1V1F A;  4PDZ A;  5CPV A;  1M31 A;  1AJ4 A;  1PAL A;  1S5G Z;  3GK1 A;  1CDM A;  5HYD A;  1WDC B;  4QJ5 B;  1JSA A;  2K7B A;  1B8R A;  3LCP C;  2LCP A;  1TNW A;  4YRU A;  4OCI A;  2Q91 A;  1AUI B;  1J7P A;  4PE4 A;  5F6T A;  2FCE A;  2LC5 A;  2LE9 B;  2KOT A;  4XJK A;  2OPO A;  1J7O A;  4GGF C;  1SNL A;  1UHN A;  1SW8 A;  1YR5 A;  1QLK A;  1LKJ A;  1LA0 A;  1B4C A;  2DOQ A;  3ZWH A;  3SG7 A;  1IRJ A;  2L4I A;  1XFU O;  1KFU S;  2JT8 A;  3FWB A;  4XJK B;  1SPY A;  5CSF A;  1B7T Z;  1QIW A;  2AUC A;  1WRK A;  3FIA A;  1TCO B;  1UWO A;  3CTN A;  3OHM B;  4GPL B;  1IKU A;  3NSI A;  1SMG A;  2M0R A;  5DKQ A;  3GK4 X;  3I5H C;  3QRX A;  4M2P A;  1IJ5 A;  5I2O A;  4PE1 A;  4PHK A;  4GUK A;  1G33 A;  5DKR A;  1FPW A;  3CZT X;  4NDC A;  2KFH A;  4CID A;  1GGZ A;  4YI9 A;  1J1E A;  2LLS A;  4GAO A;  1DTL A;  2E6W A;  3SIA A;  3SG4 A;  1AK8 A;  1Y1X A;  4HRH A;  5JOL A;  3LLE A;  1SR6 B;  1UHH A;  3ICB A;  2H2K A;  1DJW A;  2LHI A;  2KBM A;  1A29 A;  1IH0 A;  3I5G B;  3SG2 A;  2JQ6 A;  5ER4 X;  2JUL A;  5KU1 A;  3CR4 X;  2F3Y A;  1TCF A;  3VRN A;  1B47 A;  4E68 A;  1REC A;  1BU3 A;  1YTZ C;  2LAN A;  5B8I B;  1DGV A;  2LVV A;  5AER A;  3HX4 A;  1ODB A;  2KYC A;  1K9K A;  3TS5 C;  1XK4 C;  1K9U A;  2LMU A;  1DJX A;  2KI6 C;  1NYA A;  2I7A A;  2KI4 C;  1OOJ A;  5AFP A;  4OV2 A;  2MLF C;  1S5G Y;  2K0J A;  1CDN A;  2I2R E;  2JTZ A;  1C7W A;  4GNK B;  3KEV A;  4JPZ B;  2CTN A;  2JNF A;  1SL9 A;  1F4O A;  1F8H A;  1CLL A;  1YRU B;  1BOD A;  2NZ0 A;  3KO0 A;  4ZCU A;  4C0J A;  2F2P A;  1ZMZ A;  2F8P A;  3EK7 A;  4MZK A;  3IQO A;  3D0Y A;  1SCM B;  1JFJ A;  3NSO A;  2WCE A;  1KFU L;  2RGI A;  3FWC A;  2G2B A;  4BY5 A;  3ZNI A;  3OP0 A;  1WDC C;  2LHL A;  1L7Z A;  3BYA A;  3BOW A;  4YGD B;  2F33 A;  5BPJ A;  2M97 A;  1Q80 A;  3F45 A;  1B7T Y;  4OKH A;  3LK1 A;  1S1E A;  3D0Y B;  1IQ3 A;  1RFJ A;  2KDH A;  3BUW B;  3IQQ A;  2KSP A;  1MUX A;  1NCY A;  1TRF A;  4MRY A;  3GK2 A;  2WND A;  3BOW B;  1LIN A;  2M49 B;  3RLZ A;  1XFV O;  2B1U A;  3O6B A;  1UP5 A;  1TN4 A;  2SCP A;  3PAT A;  1K96 A;  2R2I A;  1UHJ A;  4USL A;  3D10 A;  2JTT A;  2KFG A;  2KAX A;  4MVF A;  1YVL A;  1DF0 A;  2KAV A;  5ER5 A;  4CFR A;  3BUM B;  4I5J A;  1QS7 A;  1BF5 A;  1D1O A;  5K89 A;  1S36 A;  1E8A A;  1ZUZ A;  4HRE E;  4ICB A;  1M45 A;  2PVB A;  4NQG A;  1ZAC A;  2K8M B;  1S6C A;  2CXJ A;  4L9M A;  1QX7 A;  1S6I A;  1CKK A;  1DF0 B;  3A8R A;  2PMY A;  1IGV A;  2BCB A;  3HCM A;  2EHB A;  4P5O E;  3CGA A;  1BOC A;  1CLB A;  2LAP A;  4MBE A;  3NSL A;  3RM1 A;  1SR6 C;  1KCY A;  4PHN A;  3I5G C;  2KHN A;  3VGO A;  2ZNE A;  1KSM A;  1DMO A;  4ZCV A;  2K2A A;  2VRG A;  2NCP A;  1PVA A;  2ZRT A;  1XYD A;  2KQY A;  3PN7 B;  4HRG A;  4ORA B;  1UHK A;  1FW4 A;  2M9G A;  4U8D A;  1J7Q A;  2QPT A;  3I5I B;  3I5F C;  1H4B A;  3LL8 B;  1CMF A;  3AKA A;  2MJW B;  1CDP A;  3TDI A;  2CCM A;  3EKJ A;  1XFZ O;  1IQ5 A;  1AVS A;  2CNP A;  2E30 A;  2AAO A;  1JF0 A;  2WC8 A;  4PE0 A;  2JU0 A;  4PHM A;  1AP4 A;  3SG5 A;  1KQM B;  4DIR A;  1KWO B;  3CWG A;  4QJ3 B;  2BE4 A;  1F54 A;  1TTX A;  1RWY A;  1CLM A; 
#chains in the Genus database with same CATH topology
 5D69 A;  2MRD A;  2KGR A;  3BUN B;  3OGN A;  1FI5 A;  1F55 A;  4P2Y B;  4Q04 A;  3JVT C;  1MF8 B;  1SCM C;  3EKH A;  1XFW O;  2KAY A;  1XA5 A;  4WQ2 A;  4I5N B;  1JWD A;  3CAB A;  3DF0 A;  1K90 D;  5CSN A;  5PAL A;  3NHT A;  3PFV A;  2QAC A;  1BMO A;  3BXK A;  4QJ4 B;  4I5L B;  1C3Z A;  1QX2 A;  3NHI A;  4N1F A;  3PSR A;  4OR9 B;  2ZN8 A;  3I5F B;  1PVB A;  3IF7 A;  3IVT A;  5AEQ A;  2O60 A;  3O4Y A;  3OX6 A;  1H8B A;  1M46 A;  1R6P A;  2MA2 A;  3DF0 B;  4YGE B;  3D73 A;  4GFT A;  3WXA A;  1QVI Z;  1YX8 A;  4PT1 A;  1X02 A;  2F2O A;  4WRI A;  2ISD A;  3H4S E;  2M3W A;  1GQM A;  3JTD B;  1LXF C;  1NUB A;  4D1E A;  1M63 B;  1YUT A;  2L50 A;  2PSR A;  4HSZ A;  2M1K B;  2JXL A;  1DJG A;  1TIZ A;  3GOF A;  1G8I A;  3TZ1 A;  1NWD A;  2FJU B;  4YGA A;  2HET A;  4NDD A;  3AAK A;  1L2O B;  2BCX A;  1DJI A;  2BL0 B;  4DCK A;  3LK0 A;  1Y0V H;  2QEH A;  1MWN A;  1SY9 A;  2ZKM X;  3SG3 A;  3KHE A;  4F0Z B;  3D76 A;  1BLQ A;  1ALW A;  3JVT B;  4PHJ A;  2O5G A;  2I94 A;  3WHU B;  1B8L A;  1XO5 A;  5FI6 A;  2M1U A;  5HLV A;  2M7N A;  1Y1A A;  3S0D A;  2LVI A;  2EGD A;  2GGM A;  2NCO A;  3VRQ A;  1A75 A;  5CSJ A;  1CNP A;  2KQ6 A;  1RK9 A;  1QTX A;  1RJV A;  1K8U A;  2MBX A;  2ZN9 A;  2MHH A;  1KK7 Z;  3Q8I A;  1MXE A;  1QAS A;  2P71 A;  1QX5 B;  3CR5 X;  5D3O A;  1XFY O;  1FI6 A;  2EC6 C;  2JNX A;  3D75 A;  1QV0 A;  3S0A A;  4N5X A;  1EXR A;  3KF9 A;  3OB1 B;  3R1P A;  3DY9 A;  4ORB B;  4KYN A;  2JC2 A;  5J3X A;  4PE7 A;  1A75 B;  2TN4 A;  2WCH A;  1WRL A;  1NSH A;  3PN7 C;  1GM0 A;  3BUX B;  4PCW A;  2ZND A;  3I5I C;  1SL8 A;  1M39 A;  1ORG A;  1IG5 A;  4JQ0 D;  2BBN A;  2NXQ A;  4MZJ A;  2K7C A;  3TDZ A;  1BR1 B;  4C0L A;  1KQV A;  1N65 A;  2Y5I A;  4BY4 A;  2HF5 A;  2KI6 D;  1NPQ A;  1BT6 A;  1OSA A;  3BFH A;  2IS9 A;  4FTG A;  3SG6 A;  1KQM C;  4AOM A;  3VRP A;  1KWO C;  1YRT B;  2COL B;  4FQO A;  1NCZ A;  1MR8 A;  1P28 A;  2K7O A;  2Q4U A;  3L4L A;  3SS4 A;  3B88 A;  3CLN A;  1JBA A;  1OZO A;  1KSO A;  2HQ8 A;  3KPX A;  3EVR A;  4CFQ A;  1T14 A;  3CZ0 A;  1RRO A;  3C1V A;  3D78 A;  4AQJ A;  1ALV A;  1VRK A;  3PAL A;  4UPG A;  4MZL A;  2K2F A;  4N1G A;  1UUR A;  1WY9 A;  1N2D A;  3PLF B;  2JPT A;  1QVI Y;  1LA3 A;  1FBV A;  4YGC B;  2LV7 A;  1TWO A;  2BE6 A;  4C0K A;  1JFK A;  1XVJ A;  2EC6 B;  2LP2 A;  2OTG B;  1DGU A;  2WOR A;  2V53 A;  3M0W A;  1FF1 A;  2M8U A;  3DD4 A;  3NSK A;  2ZRS A;  1MHO A;  3CZ2 A;  3NXA A;  1CM4 A;  2KLE A;  1KK8 C;  3AAJ A;  3CR2 A;  4OZD A;  1DJZ A;  1WRZ A;  2WCF A;  2P6B B;  1K9P A;  1QIV A;  1UHI A;  1OOI X;  1YVH A;  5JJG A;  1WLM A;  1IWQ A;  1EL4 A;  2OS8 B;  3A4U B;  2JWW A;  1JF2 A;  1B8C A;  1MXL C;  1Z4H A;  4A4B A;  3JTD C;  3CDN A;  4MN0 A;  1RTP 1;  1PK0 D;  2KYF A;  1F4Q A;  3EK8 A;  3FE8 A;  3DVM A;  5HKZ A;  1F71 A;  1PSR A;  3B7A A;  2L0P A;  3E3R A;  1QAT A;  1W7J B;  1HQV A;  3BQ3 A;  2H61 A;  2K60 A;  3SS3 A;  3DVE A;  3TDU A;  1NX1 A;  1KFX S;  3PM8 A;  3SJS A;  1A2X A;  1EG3 A;  4PAL A;  1NP8 A;  1KK7 Y;  1L2O C;  2BL0 C;  5IBW A;  3TUY B;  1NX3 A;  1QJT A;  2M7L A;  3DXL A;  3WHT B;  1Y6W A;  2K7D A;  2JXC A;  2BEC A;  5DKN A;  1DVI A;  5HL1 A;  2PQL A;  1ZFS A;  3RZS A;  3FE6 A;  4IJ7 A;  1S6J A;  1BJF A;  2FOT A;  1JUO A;  4JWQ A;  2BKI B;  1CB1 A;  1GJY A;  1SCV A;  3OX5 A;  4TNC A;  3FS7 A;  4ETO A;  2LVJ A;  1EJ3 A;  1C7V A;  5G08 A;  1MQ1 A;  1YUU A;  2PAL A;  4NDB A;  5DIC A;  5FYX A;  2M29 A;  1SL7 A;  1J7R A;  3BJH A;  1DEL A;  3S0B A;  4CLN A;  3O2P A;  1B9A A;  1U5I A;  4M2O A;  1SKT A;  5GQQ C;  4AQI A;  2CT9 A;  2G9B A;  2KGB C;  5I94 A;  2LVK A;  1EG4 A;  1SYM A;  5AXI A;  2LMT A;  3CYZ A;  1W7I B;  2KBI A;  4MSP A;  1KK8 B;  3WNX B;  1CMG A;  2BKH B;  5D7F A;  1CFP A;  3BUO B;  1OE9 B;  2KFF A;  4XYN A;  1BR4 B;  2ZFD A;  4GGF A;  1OOH A;  2HQW A;  5KTY A;  1ZOT B;  1U5I B;  1NX2 A;  1OMV A;  2LUC A;  1R2U A;  1DJY A;  1NX0 A;  2Y1M A;  3DVK A;  3D77 A;  3PJI A;  4MLW A;  1DC1 A;  3EK4 A;  2HPS A;  2YGU A;  1JC2 A;  1AJ5 A;  1OMR A;  2P70 A;  5KSZ A;  2F3Z A;  2LLU A;  1N0Y A;  4OVN F;  4IL1 A;  2JT3 A;  3K21 A;  5HLO A;  3VRO A;  1F70 A;  2L98 A;  1TNP A;  2LM5 A;  1CDL A;  1A03 A;  3DVJ A;  3DZT A;  2LMV A;  1PRW A;  4GGN A;  2LP3 A;  2WC6 A;  2WOS A;  1QLS A;  2PRU A;  1GGW A;  2GGZ A;  1K95 A;  1TNQ A;  5HKW A;  2WCB A;  3O78 A;  4ORC B;  4CPV A;  2MLE C;  5I8N A;  1HT9 A;  1TNX A;  5I2L A;  2GTE A;  2I18 A;  1QV1 A;  1V1G A;  1NCX A;  1K93 D;  3B86 A;  3EVV A;  3I5H B;  2L51 A;  4DS7 A;  3EG5 B;  3V2L A;  1CFC A;  2Y4Q A;  1DJH A;  1XFX O;  1KFX L;  4R1E A;  1S3P A;  1YUR A;  2OTG C;  2L2C A;  2JT0 A;  5AAN A;  1C07 A;  2FCD A;  2K61 A;  1CTR A;  2JRF A;  4DRW A;  4YBH B;  3R72 A;  4MRX A;  4M2Q A;  2D8N A;  2FJY A;  4INX A;  1WLZ A;  3UO9 A;  1IJ6 A;  2BCA A;  2NLN A;  4A4C A;  2LLT A;  4MEW A;  1SK6 D;  2OS8 C;  2L4H A;  1BG1 A;  1CM1 A;  1XK4 A;  2QEO A;  2KNE A;  2LNK A;  3SIB A;  2Y1N A;  4GBA A;  3VRR A;  1S26 D;  4I5K A;  3CZ1 A;  1TOP A;  1K2H A;  3AKB A;  1SRA A;  1G4Y R;  2H8V A;  3EVU A;  4YGB B;  3MSE B;  5TNC A;  2JZI A;  1OMD A;  3FE9 A;  3TS5 B;  3TUY C;  1B1G A;  4WQ3 A;  1PUL A;  1YUS A;  2LUX A;  2WCK A;  5CSI A;  3OB2 B;  2KI4 B;  1UUS A;  1K94 A;  1AHR A;  1OZS A;  1YX7 A;  2JPO A;  2H61 C;  1IIO A;  2PAS A;  1EH2 A;  4YI8 A;  1A4P A;  2A4J A;  1PSB A;  2CBL A;  3NGV A;  5I2Q A;  1QXP A;  4DUQ A;  2BBM A;  1DT7 B;  2JOJ A;  2L5X B;  1OQP A;  1LVC D;  5HKY A;  1CFF A;  2AMI A;  2SAS A;  1CFD A;  1Z2C B;  1NIW A;  2GV5 A;  2L2E A;  2MAZ A;  2QEV A;  1J55 A;  3CS1 A;  1J1D A;  1SBJ A;  1Y1U A;  1V1F A;  4PDZ A;  5CPV A;  1M31 A;  1AJ4 A;  1PAL A;  1S5G Z;  3GK1 A;  1CDM A;  5HYD A;  1WDC B;  4QJ5 B;  1JSA A;  2K7B A;  1B8R A;  3LCP C;  1DQE A;  2LCP A;  1TNW A;  2L5Y A;  2QEB A;  4OCI A;  2Q91 A;  1AUI B;  4YRU A;  3R1O A;  1J7P A;  4PE4 A;  5F6T A;  2FCE A;  2LC5 A;  2LE9 B;  2KOT A;  4XJK A;  2OPO A;  1C3Y A;  1J7O A;  2WCL A;  1SNL A;  4GGF C;  3S0G A;  1UHN A;  1SW8 A;  1YR5 A;  1QLK A;  1LKJ A;  1LA0 A;  1B4C A;  2DOQ A;  3ZWH A;  3SG7 A;  1IRJ A;  2L4I A;  1XFU O;  1KFU S;  2JT8 A;  3FWB A;  4XJK B;  3L4A A;  1SPY A;  5CSF A;  1B7T Z;  1QIW A;  2AUC A;  1WRK A;  3FIA A;  1TCO B;  1UWO A;  1OW4 A;  3CTN A;  3OHM B;  4GPL B;  1IKU A;  2ERB A;  3NSI A;  1SMG A;  2M0R A;  5EL2 A;  5DKQ A;  3GK4 X;  3I5H C;  3QRX A;  4M2P A;  1IJ5 A;  5I2O A;  4PE1 A;  4PHK A;  4GUK A;  2WCM A;  1G33 A;  5DKR A;  1FPW A;  3CZT X;  4NDC A;  3D74 A;  2KFH A;  4CID A;  1GGZ A;  2QDI A;  4YI9 A;  1J1E A;  2LLS A;  4GAO A;  1DTL A;  2E6W A;  3SIA A;  3SG4 A;  1AK8 A;  1Y1X A;  4HRH A;  5JOL A;  1DEK A;  3LLE A;  1SR6 B;  1UHH A;  3ICB A;  2H2K A;  1DJW A;  2LHI A;  2KBM A;  1A29 A;  1LS8 A;  4JD9 A;  3I5G B;  3N7H A;  4JKT A;  3SG2 A;  2JQ6 A;  5ER4 X;  1IH0 A;  2JUL A;  5KU1 A;  3CR4 X;  2F3Y A;  1TCF A;  3PM2 A;  1B47 A;  3VRN A;  4E68 A;  2KPH A;  1REC A;  1BU3 A;  1YTZ C;  1TUJ A;  2LAN A;  3VB1 A;  5B8I B;  1DGV A;  3B6X A;  2LVV A;  5AER A;  3HX4 A;  1OOF A;  1ODB A;  2KYC A;  1K9K A;  3TS5 C;  1XK4 C;  1K9U A;  2LMU A;  1DJX A;  2KI6 C;  3DYE A;  1NYA A;  2I7A A;  2KI4 C;  1OOJ A;  5AFP A;  4OV2 A;  1W9Z A;  1S5G Y;  2K0J A;  2MLF C;  1CDN A;  2I2R E;  2JTZ A;  2BAP A;  2BNX A;  1C7W A;  4GNK B;  3KEV A;  4JPZ B;  2CTN A;  2JNF A;  1SL9 A;  1F4O A;  1F8H A;  1CLL A;  1YRU B;  1BOD A;  2NZ0 A;  3KO0 A;  4ZCU A;  4C0J A;  2F2P A;  5FI2 A;  1ZMZ A;  2F8P A;  3EK7 A;  4MZK A;  3IQO A;  3D0Y A;  1SCM B;  1JFJ A;  3NSO A;  2WCE A;  1KFU L;  2RGI A;  3FWC A;  1OOG A;  2G2B A;  4BY5 A;  3ZNI A;  3OP0 A;  1WDC C;  2LHL A;  1L7Z A;  3BYA A;  3BOW A;  4YGD B;  2F33 A;  1QWV A;  5BPJ A;  2M97 A;  1Q80 A;  3F45 A;  1B7T Y;  4OKH A;  3LK1 A;  1S1E A;  3D0Y B;  1IQ3 A;  1RFJ A;  2KDH A;  3BUW B;  3IQQ A;  2KSP A;  1MUX A;  1NCY A;  1TRF A;  4MRY A;  3GK2 A;  2WND A;  3BOW B;  1LIN A;  1SSE B;  2M49 B;  3OBV A;  4INW A;  3RLZ A;  1XFR A;  1XFV O;  2B1U A;  3O6B A;  1UP5 A;  1TN4 A;  2SCP A;  3BFB A;  3PAT A;  1K96 A;  2R2I A;  1UHJ A;  4USL A;  3O4X A;  1TUZ A;  3D10 A;  2JTT A;  2WCJ A;  2KFG A;  2KAX A;  4MVF A;  1YVL A;  1DF0 A;  2KAV A;  5ER5 A;  4CFR A;  3BUM B;  4I5J A;  1QS7 A;  1BF5 A;  1D1O A;  5K89 A;  1S36 A;  1E8A A;  1ZUZ A;  4HRE E;  4ICB A;  1M45 A;  3S0F A;  2PVB A;  4NQG A;  1ZAC A;  2K8M B;  1S6C A;  2CXJ A;  4L9M A;  1QX7 A;  1S6I A;  3K1E A;  1CKK A;  1DF0 B;  3A8R A;  2PMY A;  1IGV A;  2BCB A;  3HCM A;  2EHB A;  4FQT A;  3CGA A;  4P5O E;  1BOC A;  1CLB A;  2LAP A;  4MBE A;  3NSL A;  3RM1 A;  1SR6 C;  1KCY A;  4PHN A;  3S0E A;  3I5G C;  3B87 A;  2KHN A;  2PYQ A;  2ZNE A;  1KSM A;  3VGO A;  1DMO A;  3R1V A;  4ZCV A;  2K2A A;  2VRG A;  2NCP A;  1PVA A;  2ZRT A;  1XYD A;  2KQY A;  3PN7 B;  4HRG A;  2KLD A;  4ORA B;  1UHK A;  1FW4 A;  2M9G A;  4U8D A;  1J7Q A;  2QPT A;  3I5I B;  3I5F C;  1H4B A;  3LL8 B;  1CMF A;  3AKA A;  2MJW B;  1CDP A;  3TDI A;  2CCM A;  3EKJ A;  1XFZ O;  1IQ5 A;  1AVS A;  3SS5 A;  2CNP A;  2E30 A;  2AAO A;  3UNW A;  3BFA A;  1JF0 A;  2WC8 A;  4PE0 A;  2JU0 A;  3L47 A;  4PHM A;  1AP4 A;  3SG5 A;  1KQM B;  2WC5 A;  4DIR A;  1KWO B;  3CWG A;  4QJ3 B;  4F7F A;  2BE4 A;  1F54 A;  1TTX A;  3QME A;  5FI7 A;  1RWY A;  1CLM A; 
#chains in the Genus database with same CATH homology
 5D69 A;  2MRD A;  2KGR A;  3BUN B;  1FI5 A;  1F55 A;  4P2Y B;  4Q04 A;  3JVT C;  1MF8 B;  1SCM C;  3EKH A;  1XFW O;  2KAY A;  1XA5 A;  4WQ2 A;  4I5N B;  1JWD A;  3DF0 A;  1K90 D;  5CSN A;  5PAL A;  3PFV A;  2QAC A;  1BMO A;  3BXK A;  4QJ4 B;  4I5L B;  1QX2 A;  4N1F A;  3PSR A;  4OR9 B;  2ZN8 A;  3I5F B;  1PVB A;  3IF7 A;  5AEQ A;  2O60 A;  3O4Y A;  3OX6 A;  1H8B A;  1M46 A;  1R6P A;  2MA2 A;  3DF0 B;  4YGE B;  4GFT A;  3WXA A;  1QVI Z;  1YX8 A;  1X02 A;  2F2O A;  4WRI A;  2ISD A;  3H4S E;  2M3W A;  1GQM A;  3JTD B;  1LXF C;  1NUB A;  4D1E A;  1M63 B;  1YUT A;  2L50 A;  2PSR A;  4HSZ A;  2M1K B;  2JXL A;  1DJG A;  1TIZ A;  3GOF A;  1G8I A;  3TZ1 A;  1NWD A;  2FJU B;  4YGA A;  2HET A;  4NDD A;  3AAK A;  1L2O B;  2BCX A;  1DJI A;  2BL0 B;  4DCK A;  3LK0 A;  1Y0V H;  1MWN A;  1SY9 A;  2ZKM X;  3SG3 A;  3KHE A;  4F0Z B;  1BLQ A;  1ALW A;  3JVT B;  4PHJ A;  2O5G A;  2I94 A;  3WHU B;  1B8L A;  1XO5 A;  2M1U A;  5HLV A;  2M7N A;  1Y1A A;  3VRQ A;  2LVI A;  2EGD A;  2GGM A;  2NCO A;  1A75 A;  5CSJ A;  1CNP A;  2KQ6 A;  1RK9 A;  1QTX A;  1RJV A;  1K8U A;  2MBX A;  2ZN9 A;  2MHH A;  1KK7 Z;  1MXE A;  1QAS A;  1QX5 B;  3CR5 X;  1FI6 A;  1XFY O;  2EC6 C;  2JNX A;  1QV0 A;  4N5X A;  1EXR A;  3KF9 A;  3OB1 B;  4ORB B;  2JC2 A;  5J3X A;  4PE7 A;  1A75 B;  2TN4 A;  1WRL A;  1NSH A;  3PN7 C;  3BUX B;  4PCW A;  2ZND A;  3I5I C;  1SL8 A;  1M39 A;  1IG5 A;  4JQ0 D;  2BBN A;  2NXQ A;  4MZJ A;  2K7C A;  3TDZ A;  1BR1 B;  4C0L A;  1KQV A;  1N65 A;  2Y5I A;  4BY4 A;  2HF5 A;  2KI6 D;  1NPQ A;  1BT6 A;  1OSA A;  2IS9 A;  4FTG A;  3SG6 A;  1KQM C;  4AOM A;  3VRP A;  1KWO C;  1YRT B;  2COL B;  4FQO A;  1NCZ A;  1MR8 A;  2K7O A;  2Q4U A;  3CLN A;  1JBA A;  1OZO A;  1KSO A;  2HQ8 A;  3KPX A;  3EVR A;  4CFQ A;  1RRO A;  3C1V A;  4AQJ A;  1ALV A;  1VRK A;  3PAL A;  4UPG A;  4MZL A;  2K2F A;  4N1G A;  1UUR A;  1WY9 A;  1N2D A;  3PLF B;  2JPT A;  1QVI Y;  1LA3 A;  1FBV A;  4YGC B;  2LV7 A;  2BE6 A;  4C0K A;  1JFK A;  1XVJ A;  2EC6 B;  2LP2 A;  2OTG B;  1DGU A;  2WOR A;  2V53 A;  3M0W A;  1FF1 A;  2M8U A;  3DD4 A;  3NSK A;  2ZRS A;  1MHO A;  3NXA A;  1CM4 A;  1KK8 C;  3AAJ A;  3CR2 A;  1DJZ A;  1WRZ A;  2WCF A;  2P6B B;  1K9P A;  1QIV A;  1UHI A;  1YVH A;  5JJG A;  1WLM A;  1IWQ A;  1EL4 A;  2OS8 B;  3A4U B;  2JWW A;  1JF2 A;  1B8C A;  1MXL C;  4A4B A;  3JTD C;  4MN0 A;  1RTP 1;  1PK0 D;  2KYF A;  1F4Q A;  3EK8 A;  5HKZ A;  3DVM A;  1F71 A;  1PSR A;  2L0P A;  3E3R A;  1QAT A;  1W7J B;  1HQV A;  3BQ3 A;  2H61 A;  3DVE A;  3TDU A;  1NX1 A;  1KFX S;  3PM8 A;  3SJS A;  1A2X A;  1EG3 A;  4PAL A;  1NP8 A;  1KK7 Y;  1L2O C;  2BL0 C;  5IBW A;  3TUY B;  1NX3 A;  1QJT A;  2M7L A;  3WHT B;  1Y6W A;  2K7D A;  2JXC A;  2BEC A;  5DKN A;  1DVI A;  1ZFS A;  1S6J A;  1BJF A;  2FOT A;  1JUO A;  4JWQ A;  2BKI B;  1CB1 A;  1GJY A;  1SCV A;  3OX5 A;  4TNC A;  3FS7 A;  4ETO A;  2LVJ A;  1EJ3 A;  1C7V A;  5G08 A;  1MQ1 A;  1YUU A;  2PAL A;  4NDB A;  5FYX A;  2M29 A;  1SL7 A;  1J7R A;  4CLN A;  3O2P A;  1B9A A;  1U5I A;  4M2O A;  1SKT A;  5GQQ C;  4AQI A;  2CT9 A;  2G9B A;  2KGB C;  2LVK A;  1EG4 A;  1SYM A;  5AXI A;  2LMT A;  1W7I B;  2KBI A;  4MSP A;  1KK8 B;  3WNX B;  1CMG A;  2BKH B;  5D7F A;  1CFP A;  3BUO B;  1OE9 B;  2KFF A;  4XYN A;  1BR4 B;  2ZFD A;  4GGF A;  2HQW A;  5KTY A;  1ZOT B;  1U5I B;  1NX2 A;  1OMV A;  2LUC A;  1R2U A;  1DJY A;  1NX0 A;  2Y1M A;  3DVK A;  4MLW A;  3EK4 A;  2HPS A;  1JC2 A;  1AJ5 A;  1OMR A;  5KSZ A;  2F3Z A;  2LLU A;  1N0Y A;  4OVN F;  4IL1 A;  2JT3 A;  3K21 A;  5HLO A;  3VRO A;  1F70 A;  2L98 A;  1TNP A;  2LM5 A;  1CDL A;  1A03 A;  3DVJ A;  2LMV A;  1PRW A;  4GGN A;  2LP3 A;  2WOS A;  1QLS A;  2PRU A;  1GGW A;  2GGZ A;  1K95 A;  1TNQ A;  5HKW A;  2WCB A;  3O78 A;  4ORC B;  4CPV A;  2MLE C;  5I8N A;  1HT9 A;  1TNX A;  5I2L A;  2I18 A;  1QV1 A;  1V1G A;  1NCX A;  1K93 D;  3EVV A;  3I5H B;  4DS7 A;  2L51 A;  1CFC A;  2Y4Q A;  1DJH A;  1XFX O;  1KFX L;  4R1E A;  1S3P A;  1YUR A;  2OTG C;  2JT0 A;  5AAN A;  1C07 A;  2FCD A;  2K61 A;  1CTR A;  2JRF A;  4DRW A;  4YBH B;  4MRX A;  4M2Q A;  2D8N A;  1WLZ A;  1IJ6 A;  2BCA A;  2NLN A;  4A4C A;  2LLT A;  4MEW A;  1SK6 D;  2OS8 C;  2L4H A;  1BG1 A;  1CM1 A;  1XK4 A;  2KNE A;  2LNK A;  3SIB A;  2Y1N A;  4GBA A;  3VRR A;  1S26 D;  4I5K A;  1TOP A;  1K2H A;  3AKB A;  1SRA A;  1G4Y R;  3EVU A;  4YGB B;  3MSE B;  5TNC A;  2JZI A;  1OMD A;  3TUY C;  3TS5 B;  1B1G A;  4WQ3 A;  1PUL A;  1YUS A;  2LUX A;  5CSI A;  3OB2 B;  2KI4 B;  1UUS A;  1K94 A;  1AHR A;  1OZS A;  1YX7 A;  2H61 C;  2PAS A;  1EH2 A;  4YI8 A;  1A4P A;  2A4J A;  1PSB A;  2CBL A;  5I2Q A;  1QXP A;  4DUQ A;  2BBM A;  1DT7 B;  2JOJ A;  2L5X B;  1OQP A;  1LVC D;  5HKY A;  1CFF A;  2AMI A;  2SAS A;  1CFD A;  1NIW A;  2GV5 A;  2L2E A;  2MAZ A;  3CS1 A;  1J55 A;  1J1D A;  1SBJ A;  1Y1U A;  1V1F A;  4PDZ A;  5CPV A;  1M31 A;  1AJ4 A;  1PAL A;  1S5G Z;  3GK1 A;  1CDM A;  5HYD A;  1WDC B;  4QJ5 B;  1JSA A;  2K7B A;  1B8R A;  3LCP C;  2LCP A;  1TNW A;  4YRU A;  4OCI A;  2Q91 A;  1AUI B;  1J7P A;  4PE4 A;  5F6T A;  2FCE A;  2LC5 A;  2LE9 B;  2KOT A;  4XJK A;  2OPO A;  1J7O A;  4GGF C;  1SNL A;  1UHN A;  1SW8 A;  1YR5 A;  1QLK A;  1LKJ A;  1LA0 A;  1B4C A;  2DOQ A;  3ZWH A;  3SG7 A;  1IRJ A;  2L4I A;  1XFU O;  1KFU S;  2JT8 A;  3FWB A;  4XJK B;  1SPY A;  5CSF A;  1B7T Z;  1QIW A;  2AUC A;  1WRK A;  3FIA A;  1TCO B;  1UWO A;  3CTN A;  3OHM B;  4GPL B;  1IKU A;  3NSI A;  1SMG A;  2M0R A;  5DKQ A;  3GK4 X;  3I5H C;  3QRX A;  4M2P A;  1IJ5 A;  5I2O A;  4PE1 A;  4PHK A;  4GUK A;  1G33 A;  5DKR A;  1FPW A;  3CZT X;  4NDC A;  2KFH A;  4CID A;  1GGZ A;  4YI9 A;  1J1E A;  2LLS A;  4GAO A;  1DTL A;  2E6W A;  3SIA A;  3SG4 A;  1AK8 A;  1Y1X A;  4HRH A;  5JOL A;  3LLE A;  1SR6 B;  1UHH A;  3ICB A;  2H2K A;  1DJW A;  2LHI A;  2KBM A;  1A29 A;  1IH0 A;  3I5G B;  3SG2 A;  2JQ6 A;  5ER4 X;  2JUL A;  5KU1 A;  3CR4 X;  2F3Y A;  1TCF A;  3VRN A;  1B47 A;  4E68 A;  1REC A;  1BU3 A;  1YTZ C;  2LAN A;  5B8I B;  1DGV A;  2LVV A;  5AER A;  3HX4 A;  1ODB A;  2KYC A;  1K9K A;  3TS5 C;  1XK4 C;  1K9U A;  2LMU A;  1DJX A;  2KI6 C;  1NYA A;  2I7A A;  2KI4 C;  1OOJ A;  5AFP A;  4OV2 A;  2MLF C;  1S5G Y;  2K0J A;  1CDN A;  2I2R E;  2JTZ A;  1C7W A;  4GNK B;  3KEV A;  4JPZ B;  2CTN A;  2JNF A;  1SL9 A;  1F4O A;  1F8H A;  1CLL A;  1YRU B;  1BOD A;  2NZ0 A;  3KO0 A;  4ZCU A;  4C0J A;  2F2P A;  1ZMZ A;  2F8P A;  3EK7 A;  4MZK A;  3IQO A;  3D0Y A;  1SCM B;  1JFJ A;  3NSO A;  2WCE A;  1KFU L;  2RGI A;  3FWC A;  2G2B A;  4BY5 A;  3ZNI A;  3OP0 A;  1WDC C;  2LHL A;  1L7Z A;  3BYA A;  3BOW A;  4YGD B;  2F33 A;  5BPJ A;  2M97 A;  1Q80 A;  3F45 A;  1B7T Y;  4OKH A;  3LK1 A;  1S1E A;  3D0Y B;  1IQ3 A;  1RFJ A;  2KDH A;  3BUW B;  3IQQ A;  2KSP A;  1MUX A;  1NCY A;  1TRF A;  4MRY A;  3GK2 A;  2WND A;  3BOW B;  1LIN A;  2M49 B;  3RLZ A;  1XFV O;  2B1U A;  3O6B A;  1UP5 A;  1TN4 A;  2SCP A;  3PAT A;  1K96 A;  2R2I A;  1UHJ A;  4USL A;  3D10 A;  2JTT A;  2KFG A;  2KAX A;  4MVF A;  1YVL A;  1DF0 A;  2KAV A;  5ER5 A;  4CFR A;  3BUM B;  4I5J A;  1QS7 A;  1BF5 A;  1D1O A;  5K89 A;  1S36 A;  1E8A A;  1ZUZ A;  4HRE E;  4ICB A;  1M45 A;  2PVB A;  4NQG A;  1ZAC A;  2K8M B;  1S6C A;  2CXJ A;  4L9M A;  1QX7 A;  1S6I A;  1CKK A;  1DF0 B;  3A8R A;  2PMY A;  1IGV A;  2BCB A;  3HCM A;  2EHB A;  4P5O E;  3CGA A;  1BOC A;  1CLB A;  2LAP A;  4MBE A;  3NSL A;  3RM1 A;  1SR6 C;  1KCY A;  4PHN A;  3I5G C;  2KHN A;  3VGO A;  2ZNE A;  1KSM A;  1DMO A;  4ZCV A;  2K2A A;  2VRG A;  2NCP A;  1PVA A;  2ZRT A;  1XYD A;  2KQY A;  3PN7 B;  4HRG A;  4ORA B;  1UHK A;  1FW4 A;  2M9G A;  4U8D A;  1J7Q A;  2QPT A;  3I5I B;  3I5F C;  1H4B A;  3LL8 B;  1CMF A;  3AKA A;  2MJW B;  1CDP A;  3TDI A;  2CCM A;  3EKJ A;  1XFZ O;  1IQ5 A;  1AVS A;  2CNP A;  2E30 A;  2AAO A;  1JF0 A;  2WC8 A;  4PE0 A;  2JU0 A;  4PHM A;  1AP4 A;  3SG5 A;  1KQM B;  4DIR A;  1KWO B;  3CWG A;  4QJ3 B;  2BE4 A;  1F54 A;  1TTX A;  1RWY A;  1CLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...