2FCEA

Solution structure of c-lobe myosin light chain from saccharomices cerevisiae
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
KAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin light chain 1
publication title Structural basis for the interaction of the myosin light chain Mlc1p with the myosin V Myo2p IQ motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fceA00
4DIRA 3A4UB 1B4CA 3WHTB 1JFJA 1QX7A 4A4BA 2H2KA 2LUCA 3TS5C 1AVSA 1XVJA 3GK4X 1DF0B 1BR1B 3BYAA 3EKJA 2COLB 3ICBA 2HPSA 1DJXA 1OMVA 1YURA 4ZCVA 2BE6A 1KFUL 2KGBC 1SNLA 2BECA 3AKBA 4Q04A 3JTDB 4GFTA 1XFXO 1XA5A 2O60A 4HRHA 1M39A 2JRFA 1S1EA 4ZCUA 2M97A 1J1EA 3PATA 5ER4X 1XFYO 1Y1UA 3SG2A 3HX4A 4I5NB 3SG6A 4R1EA 2KDHA 4JWQA 2KI4C 1BF5A 1NX0A 3DVEA 5HKWA 1K9PA 1TN4A 1LVCD 2LCPA 3BUWB 3F45A 1JF0A 1K93D 1PSRA 4AOMA 1J7OA 1KCYA 5D7FA 2M8UA 2G9BA 3BOWA 1RECA 2Y5IA 5KU1A 1J7PA 2LHIA 1QV1A 4PHJA 1XFZO 1IRJA 3VRPA 1BG1A 1ZMZA 3TUYB 3ZWHA 1GQMA 1KK8C 1KQMB 3VROA 1B1GA 2EC6B 3KF9A 1GGZA 2OS8C 2RGIA 3CR5X 4BY4A 1KQVA 3DVJA 2L51A 2LHLA 1Q80A 1YX7A 4OCIA 3I5HC 1FPWA 1QS7A 2L4IA 2OTGC 2R2IA 1DF0A 1BJFA 2L5XB 4NDCA 1B9AA 2KHNA 1B47A 2HETA 2JT8A 2WC8A 1FF1A 2EHBA 3TDZA 4QJ4B 1JC2A 4MLWA 1CM4A 4YGCB 1GGWA 3FWCA 1NCYA 1LA0A 1XK4A 2B1UA 1A29A 2JC2A 5K89A 4YI8A 2KAXA 1SL7A 3VRNA 2LV7A 3SG7A 2LANA 1ZFSA 3EK4A 1EL4A 4GUKA 1DJYA 1S5GY 1QX2A 2JU0A 2JTZA 2KBIA 2L2EA 1Y0VH 1A2XA 1N0YA 3BUXB 2JQ6A 2CCMA 1SCVA 2F3YA 4I5LB 5BPJA 4HREE 2ISDA 1HQVA 5G08A 4UPGA 1PRWA 1CDNA 5TNCA 1CDMA 2K2AA 3DF0B 4WQ2A 1J7QA 1S6IA 4MRXA 1RWYA 1A4PA 1PVAA 3SG3A 1ZOTB 1L2OC 3BXKA 4OV2A 2H61C 1S5GZ 3I5IC 1DJIA 2Q4UA 2LC5A 5KTYA 2K8MB 1DVIA 1S6CA 1MHOA 3RLZA 4U8DA 4NDDA 2E6WA 4CFQA 2WOSA 3FWBA 3OB1B 4WQ3A 2SASA 3PM8A 1K8UA 1IJ6A 2LAPA 1PALA 1MWNA 1PULA 1M46A 2LVVA 2E30A 2JT0A 1TOPA 1CFFA 4PE0A 3KEVA 3KO0A 1IQ5A 4P5OE 3TZ1A 1IJ5A 4MVFA 1NUBA 2F33A 1OOJA 2BL0C 1OSAA 4YBHB 2L98A 1Y6WA 2LLTA 1JFKA 3PLFB 5DKQA 3NXAA 1XFUO 2LM5A 4GPLB 1JSAA 3SG4A 4YGDB 1C7WA 1W7IB 4YGBB 3LK1A 2BBNA 2ZFDA 3AAKA 1CKKA 3DF0A 2CBLA 1NX3A 2KI6D 3EVVA 4I5JA 2LMVA 4MN0A 2ZN9A 3VRQA 1DT7B 2K2FA 4P2YB 5AEQA 1FI5A 1H4BA 4CPVA 1SPYA 3WNXB 1CFPA 1LA3A 4MEWA 2MA2A 2LMTA 3I5GC 1YVHA 4CFRA 2GV5A 3CS1A 1K96A 3TS5B 3SIBA 1UHNA 2VRGA 4ORCB 2LUXA 3DD4A 2ZRSA 1ALVA 1WRZA 3LK0A 5J3XA 3JVTC 5I2OA 3CGAA 1H8BA 5CSNA 5I2QA 1F4QA 3SJSA 3O78A 1KSMA 3RM1A 3D10A 1OQPA 1Y1XA 1QIWA 2CTNA 3PSRA 3OB2B 1JF2A 5DKNA 2WCEA 4OR9B 1UHIA 1UHHA 1KWOC 2M0RA 1QIVA 1DGVA 3TDIA 4GGFC 1CM1A 4PHKA 1YX8A 1K95A 1R6PA 1GJYA 4N5XA 2L50A 1SBJA 2K7BA 5IBWA 4YGAA 1MR8A 1DJZA 1JWDA 1QLKA 4DS7A 1EH2A 4CIDA 2BCBA 1UWOA 1PSBA 3WXAA 2JWWA 1WDCC 3NSLA 1KK8B 1YR5A 1UUSA 2KYFA 1AHRA 3VRRA 2JZIA 2KBMA 1AUIB 2OS8B 2K0JA 4C0LA 1TNQA 2CXJA 1J7RA 1G4YR 2KFFA 1CB1A 2JXCA 5I8NA 2LP3A 2WORA 4JQ0D 3BUNB 1YUSA 2K61A 2KI6C 4WRIA 1N65A 5ER5A 1SW8A 1XO5A 1F8HA 1CMGA 4PE7A 1K2HA 2FCEA 1SR6C 2KSPA 1QV0A 3ZNIA 1CNPA 5CSJA 4PDZA 4ICBA 1C7VA 2WCBA 1SCMC 4M2QA 1S6JA 3KPXA 2AAOA 1NP8A 3K21A 1K90D 3NSIA 2BCXA 1YUTA 2NXQA 4GBAA 1IWQA 2LLUA 1YTZC 1M63B 2AMIA 1B8RA 1M45A 4IL1A 2ZKMX 2PASA 1MF8B 1SY9A 2F2OA 1MXEA 1V1GA 2KQ6A 3OX5A 2Q91A 2D8NA 1L2OB 1CLMA 3GOFA 2MRDA 1A75A 4JPZB 1SRAA 2PRUA 1MUXA 2NCOA 1YRUB 1DGUA 2PVBA 1K9UA 1KFXS 4MZLA 5DKRA 5B8IB 2NLNA 1TNXA 1CLBA 3I5FC 1LXFC 1BU3A 1AK8A 1B8LA 3LLEA 1G33A 4ETOA 4L9MA 2M7LA 4E68A 2K7OA 3CR4X 2JTTA 4YI9A 5JOLA 4M2PA 4PE4A 3CLNA 2FOTA 4MZKA 2HQWA 1B8CA 3EVUA 1S36A 1CFDA 2MAZA 1F55A 4XJKB 3LCPC 2NCPA 1TCFA 1BODA 1SMGA 1A03A 1OMDA 1KK7Y 2LNKA 2I2RE 2JULA 2KOTA 5AANA 4HRGA 1NYAA 1IGVA 1WRKA 5CSIA 2I94A 4FQOA 1JUOA 3IQOA 1NWDA 1QX5B 1SK6D 2Y1MA 1X02A 3PN7C 4DRWA 1DTLA 2F3ZA 2JXLA 2M3WA 2LE9B 3HCMA 2BCAA 2H61A 4OVNF 4MBEA 2PALA 1AP4A 5HLVA 5CSFA 3O4YA 2F8PA 1KK7Z 3GK1A 1KFUS 1UHKA 2OPOA 2HQ8A 1EXRA 2KGRA 3JVTB 1C07A 2P6BB 4C0JA 1NX1A 4NQGA 4PALA 2BBMA 2KAYA 5HKYA 1IH0A 2M9GA 3BUOB 4QJ3B 4DUQA 1NIWA 1NSHA 1JBAA 2M1UA 2WNDA 2KI4B 2CNPA 2BE4A 3M0WA 1XK4C 4XJKA 5AERA 1YVLA 3JTDC 1G8IA 5HYDA 1KWOB 2PMYA 1WLZA 3TDUA 2M7NA 5D69A 2AUCA 3H4SE 2JOJA 1M31A 2GGMA 2Y1NA 1SKTA 2MBXA 4TNCA 1CDLA 3CTNA 3DVMA 2MLEC 2ZNEA 4I5KA 1OMRA 3CZTX 3IQQA 4OKHA 3D0YB 1BR4B 4PE1A 3LL8B 1TCOB 2LVJA 4PHMA 1A75B 1RK9A 1QATA 1TNPA 1RJVA 2M29A 3QRXA 1WDCB 4AQJA 2KFGA 1QASA 3I5HB 1E8AA 2OTGB 2KNEA 3C1VA 3IF7A 1UURA 4MSPA 4N1GA 5HLOA 5AXIA 1KSOA 2LP2A 1XYDA 4HSZA 3TUYC 1DJGA 1PVBA 5CPVA 1KQMC 5AFPA 2TN4A 2V53A 2EC6C 2WCFA 3KHEA 1WLMA 1XFWO 1IG5A 1QLSA 2M49B 2BKIB 1NCXA 2A4JA 1AJ4A 1EG4A 5GQQC 1QVIY 1J1DA 1IKUA 2K7DA 3SG5A 1CMFA 1NX2A 1SYMA 3NSKA 3AAJA 1MQ1A 1BLQA 3PALA 1SR6B 1U5IB 1F70A 1DJHA 2L0PA 2K7CA 2PSRA 1ODBA 1S26D 1W7JB 2HF5A 1TIZA 2Y4QA 4N1FA 4USLA 2ZRTA 3SIAA 4C0KA 1FI6A 1EJ3A 1R2UA 3CR2A 1SCMB 4FTGA 2CT9A 3EKHA 5PALA 3O2PA 1WY9A 1ALWA 4GGFA 2JT3A 1F71A 1Y1AA 2EGDA 1TNWA 1D1OA 3FIAA 1BOCA 1RTP1 1CLLA 1QVIZ 4YRUA 1TTXA 1OZSA 1CDPA 1SL9A 2LVKA 1EG3A 1FW4A 3BUMB 3D0YA 4YGEB 5F6TA 1N2DA 2JNXA 3I5IB 5KSZA 3E3RA 1CTRA 1TRFA 1LKJA 2L4HA 5FYXA 1YRTB 2BKHB 1B7TY 1UP5A 1RFJA 3AKAA 3GK2A 1CFCA 4GGNA 4MZJA 4NDBA 1LINA 1SL8A 2MJWB 2FJUB 3FS7A 4GAOA 2I18A 3DVKA 2M1KB 3OX6A 2KQYA 2ZN8A 1ZUZA 3I5FB 1OZOA 3EK7A 2O5GA 3OP0A 4QJ5B 2I7AA 1MXLC 1XFVO 2GGZA 4PCWA 5I2LA 4D1EA 2DOQA 1HT9A 1K9KA 1NPQA 2LLSA 2LMUA 2ZNDA 2BL0B 2FCDA 1PK0D 2QACA 4MRYA 4XYNA 5JJGA 1U5IA 1QJTA 1NCZA 3MSEB 1B7TZ 4AQIA 2KFHA 3CWGA 3OHMB 1KFXL 3WHUB 2SCPA 1QXPA 2LVIA 4A4CA 4M2OA 1L7ZA 3A8RA 4PHNA 2KYCA 1OE9B 4ORAB 4BY5A 2MLFC 3PFVA 2JPTA 4DCKA 1FBVA 2MHHA 1VRKA 4CLNA 2QPTA 3VGOA 2JNFA 3EVRA 3O6BA 3NSOA 1DMOA 3PN7B 5HKZA 1BT6A 1WRLA 2G2BA 3I5GB 2NZ0A 1DJWA 1AJ5A 4ORBB 4F0ZB 1F4OA 1ZACA 3EK8A 1F54A 2KAVA 1YUUA 1S3PA 1UHJA 2F2PA 1QTXA 1J55A 3BOWB 4GNKB 2IS9A 1BMOA 1V1FA 1IQ3A 1RROA 3BQ3A 1K94A
chains in the Genus database with same CATH superfamily
3B88A 4DIRA 3A4UB 1B4CA 3S0GA 3WHTB 1JFJA 1QX7A 4A4BA 2H2KA 2LUCA 3TS5C 1AVSA 1XVJA 3GK4X 1DF0B 1BR1B 2QEHA 3BYAA 3EKJA 2COLB 3DY9A 3ICBA 2HPSA 1DJXA 1OMVA 1YURA 4ZCVA 2BE6A 1KFUL 2KGBC 1SNLA 2BECA 3AKBA 4Q04A 3JTDB 3OBVA 1XFXO 4GFTA 1XA5A 2O60A 3OGNA 4HRHA 1M39A 2JRFA 2P71A 1S1EA 4ZCUA 2M97A 1J1EA 3PATA 5ER4X 1XFYO 1Y1UA 3SG2A 3HX4A 4I5NB 3SG6A 4R1EA 2KDHA 3DZTA 4JWQA 1LS8A 2KI4C 1BF5A 1NX0A 3CYZA 3DVEA 5HKWA 1K9PA 1TN4A 1LVCD 2LCPA 3BUWB 3F45A 1JF0A 1K93D 3PM2A 1PSRA 4AOMA 1J7OA 1KCYA 5D7FA 2M8UA 2G9BA 3BOWA 1RECA 3D75A 2Y5IA 3SS5A 5KU1A 2LHIA 1QV1A 3L4LA 1XFZO 1IRJA 4PHJA 1J7PA 3VRPA 3R1PA 1BG1A 1ZMZA 3TUYB 3ZWHA 1GQMA 1KK8C 1KQMB 3VROA 1B1GA 2EC6B 3KF9A 1GGZA 2OS8C 2KPHA 2RGIA 3CR5X 4BY4A 1KQVA 3DVJA 2L51A 2LHLA 2JPOA 1Q80A 1YX7A 2WCHA 4OCIA 3I5HC 2WCKA 1QS7A 2L4IA 2OTGC 2R2IA 1DF0A 1BJFA 2L5XB 4NDCA 1B9AA 2KHNA 1B47A 2HETA 2JT8A 1W9ZA 2QDIA 2WC8A 1FF1A 1ORGA 4OZDA 3V2LA 2EHBA 3TDZA 4QJ4B 1JC2A 4MLWA 1CM4A 4YGCB 1GGWA 3FWCA 1NCYA 1LA0A 1XK4A 2B1UA 1A29A 2JC2A 5K89A 4YI8A 3R1VA 2KAXA 1SL7A 3VRNA 2LV7A 3SG7A 2LANA 1ZFSA 3EK4A 3SS3A 1EL4A 4GUKA 1DJYA 1S5GY 1QX2A 2JU0A 2JTZA 2KBIA 2L2EA 1Y0VH 1A2XA 1N0YA 3BUXB 3R72A 2JQ6A 2CCMA 1SCVA 2F3YA 4I5LB 5BPJA 4HREE 2ISDA 1HQVA 5G08A 4UPGA 1PRWA 1CDNA 5TNCA 1CDMA 2K2AA 3DF0B 4WQ2A 1J7QA 1S6IA 3NHIA 4MRXA 1RWYA 1A4PA 1PVAA 3SG3A 1ZOTB 1L2OC 3BXKA 4OV2A 2H61C 1S5GZ 3I5IC 1DJIA 2Q4UA 2LC5A 3L47A 5KTYA 2K8MB 2L5YA 1DVIA 1S6CA 1FPWA 1MHOA 3RLZA 4U8DA 4NDDA 2E6WA 4CFQA 3S0DA 2WOSA 3FWBA 3OB1B 4WQ3A 2SASA 3IVTA 2WC6A 3PM8A 1K8UA 1IJ6A 1DELA 2LAPA 1PALA 1MWNA 1PULA 1M46A 2LVVA 2E30A 2JT0A 1TOPA 2WCJA 1CFFA 4PE0A 3KEVA 3KO0A 1IQ5A 4P5OE 3TZ1A 1IJ5A 4MVFA 1NUBA 2F33A 1OOJA 5HL1A 2BL0C 3NHTA 2BAPA 1OSAA 4YBHB 2L98A 1Y6WA 2LLTA 1JFKA 3PLFB 5DKQA 2PQLA 1Z4HA 3NXAA 1XFUO 2LM5A 4GPLB 1JSAA 3SG4A 4YGDB 1C7WA 1W7IB 4YGBB 3LK1A 2BBNA 2ZFDA 3CABA 3AAKA 1CKKA 3DF0A 3EG5B 2CBLA 1NX3A 4JKTA 2KI6D 3EVVA 4I5JA 2LMVA 4MN0A 2ZN9A 3VRQA 1DT7B 2K2FA 4P2YB 5AEQA 1FI5A 1H4BA 4CPVA 1SPYA 2QEBA 3B86A 3WNXB 1CFPA 1LA3A 4MEWA 2MA2A 2LMTA 3I5GC 1YVHA 3QMEA 4CFRA 2GV5A 3CS1A 1K96A 1DEKA 3TS5B 3SIBA 1UHNA 2VRGA 4ORCB 2LUXA 3DD4A 2ZRSA 1ALVA 1WRZA 3LK0A 5J3XA 2KLDA 3B6XA 3JVTC 3CGAA 5I2OA 1H8BA 5CSNA 5I2QA 1F4QA 3SJSA 3O78A 1KSMA 3RM1A 3D10A 1TWOA 1OQPA 2WCMA 1Y1XA 1QIWA 2CTNA 3PSRA 3OB2B 3B87A 1JF2A 5DKNA 2WCEA 4OR9B 1UHIA 3K1EA 1UHHA 1KWOC 2M0RA 1QIVA 1DGVA 3TDIA 4GGFC 1CM1A 4PHKA 1YX8A 1K95A 1R6PA 1GJYA 4N5XA 2L50A 1SBJA 2K7BA 5IBWA 4YGAA 1MR8A 1DJZA 1JWDA 1QLKA 4DS7A 1EH2A 3S0AA 4CIDA 2BCBA 1UWOA 1PSBA 3WXAA 2JWWA 1WDCC 3NSLA 1KK8B 1YR5A 1UUSA 2KYFA 1AHRA 3VRRA 4F7FA 2JZIA 2L2CA 2KBMA 1AUIB 4PT1A 2OS8B 2K0JA 4C0LA 1TNQA 3B7AA 2CXJA 1J7RA 2KLEA 4IJ7A 1G4YR 2KFFA 1CB1A 2JXCA 5I8NA 2LP3A 1OOFA 2PYQA 2WORA 4JQ0D 3BUNB 1YUSA 2K61A 2P70A 2KI6C 4WRIA 3SS4A 1N65A 5ER5A 1SW8A 1P28A 1OW4A 1XO5A 1F8HA 1IIOA 1CMGA 2WC5A 4PE7A 1K2HA 2FCEA 1SR6C 2KSPA 1QV0A 3ZNIA 1CNPA 5CSJA 4INWA 4PDZA 4ICBA 1C7VA 2WCBA 1SCMC 4M2QA 1S6JA 3FE8A 3KPXA 2AAOA 1NP8A 1TUZA 1K90D 3K21A 2BCXA 3NSIA 1YUTA 2NXQA 3L4AA 1IWQA 4GBAA 2LLUA 5I94A 1YTZC 1M63B 2AMIA 1B8RA 3CDNA 1M45A 3R1OA 4IL1A 1TUJA 2ZKMX 2PASA 1QWVA 1MF8B 1SY9A 5FI2A 2F2OA 1MXEA 1V1GA 2YGUA 2KQ6A 3OX5A 2Q91A 2D8NA 1L2OB 1CLMA 3GOFA 2MRDA 1A75A 4JPZB 1XFRA 1SRAA 2PRUA 1MUXA 2NCOA 1YRUB 1DGUA 2PVBA 1K9UA 5EL2A 1DC1A 1KFXS 4MZLA 5DKRA 5B8IB 2NLNA 1TNXA 1CLBA 3I5FC 1LXFC 1BU3A 1AK8A 1B8LA 3LLEA 1G33A 4ETOA 4L9MA 2M7LA 4E68A 2K7OA 3CR4X 2JTTA 4YI9A 3O4XA 5JOLA 4M2PA 3Q8IA 4PE4A 3CLNA 1T14A 2FOTA 4MZKA 2HQWA 1B8CA 3EVUA 3UO9A 3UNWA 3D73A 1S36A 1CFDA 2MAZA 1F55A 4XJKB 3LCPC 2NCPA 1TCFA 1BODA 1SMGA 1A03A 1OMDA 3PJIA 1KK7Y 2LNKA 3N7HA 2I2RE 2JULA 2KOTA 5AANA 4HRGA 1NYAA 1IGVA 1WRKA 5CSIA 2I94A 4FQOA 1JUOA 3IQOA 1NWDA 1QX5B 1SK6D 2Y1MA 1X02A 3PN7C 3NGVA 4DRWA 1DTLA 2F3ZA 2JXLA 2M3WA 2LE9B 3HCMA 2BCAA 2H61A 3D78A 4OVNF 4MBEA 2PALA 1AP4A 5HLVA 5CSFA 3O4YA 2F8PA 1KK7Z 3GK1A 1KFUS 4JD9A 1UHKA 2OPOA 2HQ8A 3FE6A 1EXRA 2KGRA 3VB1A 3JVTB 1C07A 2P6BB 4C0JA 2H8VA 1NX1A 4NQGA 2ERBA 4PALA 2BBMA 5FI7A 1OOGA 2KAYA 3CZ2A 5HKYA 1IH0A 2M9GA 3BUOB 4QJ3B 4DUQA 1NIWA 1NSHA 1JBAA 2M1UA 2WNDA 2KI4B 2CNPA 2BE4A 3M0WA 1XK4C 2K60A 4XJKA 1YVLA 3JTDC 1G8IA 5AERA 5HYDA 1KWOB 1SSEB 2PMYA 2WCLA 1WLZA 3BFAA 2M7NA 4KYNA 5D69A 2AUCA 3TDUA 3FE9A 5FI6A 3H4SE 2JOJA 1M31A 2GGMA 2Y1NA 1SKTA 2MBXA 3S0EA 4TNCA 1CDLA 3RZSA 3CTNA 3DVMA 2MLEC 2ZNEA 4I5KA 1OMRA 3CZTX 3IQQA 4OKHA 3D0YB 1BR4B 4PE1A 3LL8B 1TCOB 2LVJA 4PHMA 1A75B 1RK9A 1QATA 1TNPA 1RJVA 2M29A 3QRXA 1WDCB 4AQJA 2QEOA 3D74A 2KFGA 1C3ZA 1QASA 3I5HB 1E8AA 2OTGB 2KNEA 3C1VA 3IF7A 1UURA 4MSPA 4N1GA 5HLOA 5AXIA 1KSOA 2LP2A 1XYDA 4HSZA 3TUYC 1DJGA 1PVBA 5CPVA 1KQMC 3D76A 5AFPA 3S0FA 2TN4A 2V53A 2EC6C 2WCFA 2BNXA 1WLMA 1XFWO 3KHEA 1IG5A 1QLSA 2M49B 2BKIB 1NCXA 2A4JA 1AJ4A 1EG4A 1OOIX 5GQQC 1QVIY 1J1DA 1IKUA 2K7DA 3SG5A 1CMFA 1NX2A 1SYMA 3NSKA 3AAJA 1MQ1A 1BLQA 3PALA 1SR6B 1U5IB 1F70A 1DJHA 2L0PA 2K7CA 2PSRA 1ODBA 1S26D 1W7JB 2HF5A 1TIZA 2Y4QA 4N1FA 4USLA 2ZRTA 3SIAA 4C0KA 1FI6A 1EJ3A 1R2UA 3CR2A 1SCMB 4FTGA 2CT9A 3EKHA 5PALA 3O2PA 1WY9A 1ALWA 4GGFA 2JT3A 1F71A 1Y1AA 2EGDA 1TNWA 1D1OA 3FIAA 1BOCA 1RTP1 1CLLA 1QVIZ 4YRUA 1TTXA 1OZSA 1CDPA 1SL9A 2LVKA 1EG3A 1FW4A 3BUMB 3D0YA 4INXA 4YGEB 5F6TA 3S0BA 1N2DA 2JNXA 3DYEA 3I5IB 3E3RA 5KSZA 1CTRA 1TRFA 1LKJA 2L4HA 5FYXA 1YRTB 2BKHB 1B7TY 1UP5A 1RFJA 3AKAA 3GK2A 1CFCA 4GGNA 4MZJA 3CZ0A 4NDBA 1LINA 1SL8A 2MJWB 2FJUB 3FS7A 4GAOA 2I18A 3DVKA 2M1KB 3OX6A 2KQYA 2ZN8A 1ZUZA 3I5FB 1OZOA 3EK7A 2O5GA 3OP0A 4QJ5B 2I7AA 1MXLC 1XFVO 2GGZA 1Z2CB 4PCWA 5I2LA 4D1EA 2DOQA 1HT9A 1K9KA 1NPQA 2LLSA 1DQEA 1GM0A 2LMUA 1C3YA 2ZNDA 2BL0B 2FCDA 1PK0D 2QACA 2GTEA 4MRYA 4XYNA 5JJGA 1U5IA 1OOHA 1QJTA 3BFHA 1NCZA 3MSEB 1B7TZ 4AQIA 2KFHA 2QEVA 3CWGA 3DXLA 3BJHA 1KFXL 3OHMB 3WHUB 2SCPA 1QXPA 2LVIA 4A4CA 4M2OA 1L7ZA 3A8RA 4PHNA 2KYCA 1OE9B 4ORAB 4BY5A 2MLFC 3PFVA 2JPTA 4DCKA 1FBVA 2MHHA 1VRKA 4CLNA 2QPTA 3VGOA 2JNFA 3EVRA 5D3OA 3O6BA 3NSOA 1DMOA 3PN7B 2FJYA 1BT6A 5HKZA 1WRLA 3BFBA 2G2BA 3I5GB 4FQTA 3D77A 2NZ0A 1DJWA 1AJ5A 4ORBB 4F0ZB 1F4OA 1ZACA 3EK8A 1F54A 5DICA 2KAVA 1YUUA 1S3PA 1UHJA 2F2PA 1QTXA 1J55A 3BOWB 4GNKB 2IS9A 1BMOA 1V1FA 1IQ3A 1RROA 3BQ3A 1K94A 3CZ1A
chains in the Genus database with same CATH topology
4DIRA 3A4UB 1B4CA 3WHTB 1JFJA 1QX7A 4A4BA 2H2KA 2LUCA 3TS5C 1AVSA 1XVJA 3GK4X 1DF0B 1BR1B 3BYAA 3EKJA 2COLB 3ICBA 2HPSA 1DJXA 1OMVA 1YURA 4ZCVA 2BE6A 1KFUL 2KGBC 1SNLA 2BECA 3AKBA 4Q04A 3JTDB 4GFTA 1XFXO 1XA5A 2O60A 4HRHA 1M39A 2JRFA 1S1EA 4ZCUA 2M97A 1J1EA 3PATA 5ER4X 1XFYO 1Y1UA 3SG2A 3HX4A 4I5NB 3SG6A 4R1EA 2KDHA 4JWQA 2KI4C 1BF5A 1NX0A 3DVEA 5HKWA 1K9PA 1TN4A 1LVCD 2LCPA 3BUWB 3F45A 1JF0A 1K93D 1PSRA 4AOMA 1J7OA 1KCYA 5D7FA 2M8UA 2G9BA 3BOWA 1RECA 2Y5IA 5KU1A 1J7PA 2LHIA 1QV1A 4PHJA 1XFZO 1IRJA 3VRPA 1BG1A 1ZMZA 3TUYB 3ZWHA 1GQMA 1KK8C 1KQMB 3VROA 1B1GA 2EC6B 3KF9A 1GGZA 2OS8C 2RGIA 3CR5X 4BY4A 1KQVA 3DVJA 2L51A 2LHLA 1Q80A 1YX7A 4OCIA 3I5HC 1FPWA 1QS7A 2L4IA 2OTGC 2R2IA 1DF0A 1BJFA 2L5XB 4NDCA 1B9AA 2KHNA 1B47A 2HETA 2JT8A 2WC8A 1FF1A 2EHBA 3TDZA 4QJ4B 1JC2A 4MLWA 1CM4A 4YGCB 1GGWA 3FWCA 1NCYA 1LA0A 1XK4A 2B1UA 1A29A 2JC2A 5K89A 4YI8A 2KAXA 1SL7A 3VRNA 2LV7A 3SG7A 2LANA 1ZFSA 3EK4A 1EL4A 4GUKA 1DJYA 1S5GY 1QX2A 2JU0A 2JTZA 2KBIA 2L2EA 1Y0VH 1A2XA 1N0YA 3BUXB 2JQ6A 2CCMA 1SCVA 2F3YA 4I5LB 5BPJA 4HREE 2ISDA 1HQVA 5G08A 4UPGA 1PRWA 1CDNA 5TNCA 1CDMA 2K2AA 3DF0B 4WQ2A 1J7QA 1S6IA 4MRXA 1RWYA 1A4PA 1PVAA 3SG3A 1ZOTB 1L2OC 3BXKA 4OV2A 2H61C 1S5GZ 3I5IC 1DJIA 2Q4UA 2LC5A 5KTYA 2K8MB 1DVIA 1S6CA 1MHOA 3RLZA 4U8DA 4NDDA 2E6WA 4CFQA 2WOSA 3FWBA 3OB1B 4WQ3A 2SASA 3PM8A 1K8UA 1IJ6A 2LAPA 1PALA 1MWNA 1PULA 1M46A 2LVVA 2E30A 2JT0A 1TOPA 1CFFA 4PE0A 3KEVA 3KO0A 1IQ5A 4P5OE 3TZ1A 1IJ5A 4MVFA 1NUBA 2F33A 1OOJA 2BL0C 1OSAA 4YBHB 2L98A 1Y6WA 2LLTA 1JFKA 3PLFB 5DKQA 3NXAA 1XFUO 2LM5A 4GPLB 1JSAA 3SG4A 4YGDB 1C7WA 1W7IB 4YGBB 3LK1A 2BBNA 2ZFDA 3AAKA 1CKKA 3DF0A 2CBLA 1NX3A 2KI6D 3EVVA 4I5JA 2LMVA 4MN0A 2ZN9A 3VRQA 1DT7B 2K2FA 4P2YB 5AEQA 1FI5A 1H4BA 4CPVA 1SPYA 3WNXB 1CFPA 1LA3A 4MEWA 2MA2A 2LMTA 3I5GC 1YVHA 4CFRA 2GV5A 3CS1A 1K96A 3TS5B 3SIBA 1UHNA 2VRGA 4ORCB 2LUXA 3DD4A 2ZRSA 1ALVA 1WRZA 3LK0A 5J3XA 3JVTC 5I2OA 3CGAA 1H8BA 5CSNA 5I2QA 1F4QA 3SJSA 3O78A 1KSMA 3RM1A 3D10A 1OQPA 1Y1XA 1QIWA 2CTNA 3PSRA 3OB2B 1JF2A 5DKNA 2WCEA 4OR9B 1UHIA 1UHHA 1KWOC 2M0RA 1QIVA 1DGVA 3TDIA 4GGFC 1CM1A 4PHKA 1YX8A 1K95A 1R6PA 1GJYA 4N5XA 2L50A 1SBJA 2K7BA 5IBWA 4YGAA 1MR8A 1DJZA 1JWDA 1QLKA 4DS7A 1EH2A 4CIDA 2BCBA 1UWOA 1PSBA 3WXAA 2JWWA 1WDCC 3NSLA 1KK8B 1YR5A 1UUSA 2KYFA 1AHRA 3VRRA 2JZIA 2KBMA 1AUIB 2OS8B 2K0JA 4C0LA 1TNQA 2CXJA 1J7RA 1G4YR 2KFFA 1CB1A 2JXCA 5I8NA 2LP3A 2WORA 4JQ0D 3BUNB 1YUSA 2K61A 2KI6C 4WRIA 1N65A 5ER5A 1SW8A 1XO5A 1F8HA 1CMGA 4PE7A 1K2HA 2FCEA 1SR6C 2KSPA 1QV0A 3ZNIA 1CNPA 5CSJA 4PDZA 4ICBA 1C7VA 2WCBA 1SCMC 4M2QA 1S6JA 3KPXA 2AAOA 1NP8A 3K21A 1K90D 3NSIA 2BCXA 1YUTA 2NXQA 4GBAA 1IWQA 2LLUA 1YTZC 1M63B 2AMIA 1B8RA 1M45A 4IL1A 2ZKMX 2PASA 1MF8B 1SY9A 2F2OA 1MXEA 1V1GA 2KQ6A 3OX5A 2Q91A 2D8NA 1L2OB 1CLMA 3GOFA 2MRDA 1A75A 4JPZB 1SRAA 2PRUA 1MUXA 2NCOA 1YRUB 1DGUA 2PVBA 1K9UA 1KFXS 4MZLA 5DKRA 5B8IB 2NLNA 1TNXA 1CLBA 3I5FC 1LXFC 1BU3A 1AK8A 1B8LA 3LLEA 1G33A 4ETOA 4L9MA 2M7LA 4E68A 2K7OA 3CR4X 2JTTA 4YI9A 5JOLA 4M2PA 4PE4A 3CLNA 2FOTA 4MZKA 2HQWA 1B8CA 3EVUA 1S36A 1CFDA 2MAZA 1F55A 4XJKB 3LCPC 2NCPA 1TCFA 1BODA 1SMGA 1A03A 1OMDA 1KK7Y 2LNKA 2I2RE 2JULA 2KOTA 5AANA 4HRGA 1NYAA 1IGVA 1WRKA 5CSIA 2I94A 4FQOA 1JUOA 3IQOA 1NWDA 1QX5B 1SK6D 2Y1MA 1X02A 3PN7C 4DRWA 1DTLA 2F3ZA 2JXLA 2M3WA 2LE9B 3HCMA 2BCAA 2H61A 4OVNF 4MBEA 2PALA 1AP4A 5HLVA 5CSFA 3O4YA 2F8PA 1KK7Z 3GK1A 1KFUS 1UHKA 2OPOA 2HQ8A 1EXRA 2KGRA 3JVTB 1C07A 2P6BB 4C0JA 1NX1A 4NQGA 4PALA 2BBMA 2KAYA 5HKYA 1IH0A 2M9GA 3BUOB 4QJ3B 4DUQA 1NIWA 1NSHA 1JBAA 2M1UA 2WNDA 2KI4B 2CNPA 2BE4A 3M0WA 1XK4C 4XJKA 5AERA 1YVLA 3JTDC 1G8IA 5HYDA 1KWOB 2PMYA 1WLZA 3TDUA 2M7NA 5D69A 2AUCA 3H4SE 2JOJA 1M31A 2GGMA 2Y1NA 1SKTA 2MBXA 4TNCA 1CDLA 3CTNA 3DVMA 2MLEC 2ZNEA 4I5KA 1OMRA 3CZTX 3IQQA 4OKHA 3D0YB 1BR4B 4PE1A 3LL8B 1TCOB 2LVJA 4PHMA 1A75B 1RK9A 1QATA 1TNPA 1RJVA 2M29A 3QRXA 1WDCB 4AQJA 2KFGA 1QASA 3I5HB 1E8AA 2OTGB 2KNEA 3C1VA 3IF7A 1UURA 4MSPA 4N1GA 5HLOA 5AXIA 1KSOA 2LP2A 1XYDA 4HSZA 3TUYC 1DJGA 1PVBA 5CPVA 1KQMC 5AFPA 2TN4A 2V53A 2EC6C 2WCFA 3KHEA 1WLMA 1XFWO 1IG5A 1QLSA 2M49B 2BKIB 1NCXA 2A4JA 1AJ4A 1EG4A 5GQQC 1QVIY 1J1DA 1IKUA 2K7DA 3SG5A 1CMFA 1NX2A 1SYMA 3NSKA 3AAJA 1MQ1A 1BLQA 3PALA 1SR6B 1U5IB 1F70A 1DJHA 2L0PA 2K7CA 2PSRA 1ODBA 1S26D 1W7JB 2HF5A 1TIZA 2Y4QA 4N1FA 4USLA 2ZRTA 3SIAA 4C0KA 1FI6A 1EJ3A 1R2UA 3CR2A 1SCMB 4FTGA 2CT9A 3EKHA 5PALA 3O2PA 1WY9A 1ALWA 4GGFA 2JT3A 1F71A 1Y1AA 2EGDA 1TNWA 1D1OA 3FIAA 1BOCA 1RTP1 1CLLA 1QVIZ 4YRUA 1TTXA 1OZSA 1CDPA 1SL9A 2LVKA 1EG3A 1FW4A 3BUMB 3D0YA 4YGEB 5F6TA 1N2DA 2JNXA 3I5IB 5KSZA 3E3RA 1CTRA 1TRFA 1LKJA 2L4HA 5FYXA 1YRTB 2BKHB 1B7TY 1UP5A 1RFJA 3AKAA 3GK2A 1CFCA 4GGNA 4MZJA 4NDBA 1LINA 1SL8A 2MJWB 2FJUB 3FS7A 4GAOA 2I18A 3DVKA 2M1KB 3OX6A 2KQYA 2ZN8A 1ZUZA 3I5FB 1OZOA 3EK7A 2O5GA 3OP0A 4QJ5B 2I7AA 1MXLC 1XFVO 2GGZA 4PCWA 5I2LA 4D1EA 2DOQA 1HT9A 1K9KA 1NPQA 2LLSA 2LMUA 2ZNDA 2BL0B 2FCDA 1PK0D 2QACA 4MRYA 4XYNA 5JJGA 1U5IA 1QJTA 1NCZA 3MSEB 1B7TZ 4AQIA 2KFHA 3CWGA 3OHMB 1KFXL 3WHUB 2SCPA 1QXPA 2LVIA 4A4CA 4M2OA 1L7ZA 3A8RA 4PHNA 2KYCA 1OE9B 4ORAB 4BY5A 2MLFC 3PFVA 2JPTA 4DCKA 1FBVA 2MHHA 1VRKA 4CLNA 2QPTA 3VGOA 2JNFA 3EVRA 3O6BA 3NSOA 1DMOA 3PN7B 5HKZA 1BT6A 1WRLA 2G2BA 3I5GB 2NZ0A 1DJWA 1AJ5A 4ORBB 4F0ZB 1F4OA 1ZACA 3EK8A 1F54A 2KAVA 1YUUA 1S3PA 1UHJA 2F2PA 1QTXA 1J55A 3BOWB 4GNKB 2IS9A 1BMOA 1V1FA 1IQ3A 1RROA 3BQ3A 1K94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIR A;  3A4U B;  1B4C A;  3WHT B;  1JFJ A;  1QX7 A;  4A4B A;  2H2K A;  2LUC A;  3TS5 C;  1AVS A;  1XVJ A;  3GK4 X;  1DF0 B;  1BR1 B;  3BYA A;  3EKJ A;  2COL B;  3ICB A;  2HPS A;  1DJX A;  1OMV A;  1YUR A;  4ZCV A;  2BE6 A;  1KFU L;  2KGB C;  1SNL A;  2BEC A;  3AKB A;  4Q04 A;  3JTD B;  4GFT A;  1XFX O;  1XA5 A;  2O60 A;  4HRH A;  1M39 A;  2JRF A;  1S1E A;  4ZCU A;  2M97 A;  1J1E A;  3PAT A;  5ER4 X;  1XFY O;  1Y1U A;  3SG2 A;  3HX4 A;  4I5N B;  3SG6 A;  4R1E A;  2KDH A;  4JWQ A;  2KI4 C;  1BF5 A;  1NX0 A;  3DVE A;  5HKW A;  1K9P A;  1TN4 A;  1LVC D;  2LCP A;  3BUW B;  3F45 A;  1JF0 A;  1K93 D;  1PSR A;  4AOM A;  1J7O A;  1KCY A;  5D7F A;  2M8U A;  2G9B A;  3BOW A;  1REC A;  2Y5I A;  5KU1 A;  1J7P A;  2LHI A;  1QV1 A;  4PHJ A;  1XFZ O;  1IRJ A;  3VRP A;  1BG1 A;  1ZMZ A;  3TUY B;  3ZWH A;  1GQM A;  1KK8 C;  1KQM B;  3VRO A;  1B1G A;  2EC6 B;  3KF9 A;  1GGZ A;  2OS8 C;  2RGI A;  3CR5 X;  4BY4 A;  1KQV A;  3DVJ A;  2L51 A;  2LHL A;  1Q80 A;  1YX7 A;  4OCI A;  3I5H C;  1FPW A;  1QS7 A;  2L4I A;  2OTG C;  2R2I A;  1DF0 A;  1BJF A;  2L5X B;  4NDC A;  1B9A A;  2KHN A;  1B47 A;  2HET A;  2JT8 A;  2WC8 A;  1FF1 A;  2EHB A;  3TDZ A;  4QJ4 B;  1JC2 A;  4MLW A;  1CM4 A;  4YGC B;  1GGW A;  3FWC A;  1NCY A;  1LA0 A;  1XK4 A;  2B1U A;  1A29 A;  2JC2 A;  5K89 A;  4YI8 A;  2KAX A;  1SL7 A;  3VRN A;  2LV7 A;  3SG7 A;  2LAN A;  1ZFS A;  3EK4 A;  1EL4 A;  4GUK A;  1DJY A;  1S5G Y;  1QX2 A;  2JU0 A;  2JTZ A;  2KBI A;  2L2E A;  1Y0V H;  1A2X A;  1N0Y A;  3BUX B;  2JQ6 A;  2CCM A;  1SCV A;  2F3Y A;  4I5L B;  5BPJ A;  4HRE E;  2ISD A;  1HQV A;  5G08 A;  4UPG A;  1PRW A;  1CDN A;  5TNC A;  1CDM A;  2K2A A;  3DF0 B;  4WQ2 A;  1J7Q A;  1S6I A;  4MRX A;  1RWY A;  1A4P A;  1PVA A;  3SG3 A;  1ZOT B;  1L2O C;  3BXK A;  4OV2 A;  2H61 C;  1S5G Z;  3I5I C;  1DJI A;  2Q4U A;  2LC5 A;  5KTY A;  2K8M B;  1DVI A;  1S6C A;  1MHO A;  3RLZ A;  4U8D A;  4NDD A;  2E6W A;  4CFQ A;  2WOS A;  3FWB A;  3OB1 B;  4WQ3 A;  2SAS A;  3PM8 A;  1K8U A;  1IJ6 A;  2LAP A;  1PAL A;  1MWN A;  1PUL A;  1M46 A;  2LVV A;  2E30 A;  2JT0 A;  1TOP A;  1CFF A;  4PE0 A;  3KEV A;  3KO0 A;  1IQ5 A;  4P5O E;  3TZ1 A;  1IJ5 A;  4MVF A;  1NUB A;  2F33 A;  1OOJ A;  2BL0 C;  1OSA A;  4YBH B;  2L98 A;  1Y6W A;  2LLT A;  1JFK A;  3PLF B;  5DKQ A;  3NXA A;  1XFU O;  2LM5 A;  4GPL B;  1JSA A;  3SG4 A;  4YGD B;  1C7W A;  1W7I B;  4YGB B;  3LK1 A;  2BBN A;  2ZFD A;  3AAK A;  1CKK A;  3DF0 A;  2CBL A;  1NX3 A;  2KI6 D;  3EVV A;  4I5J A;  2LMV A;  4MN0 A;  2ZN9 A;  3VRQ A;  1DT7 B;  2K2F A;  4P2Y B;  5AEQ A;  1FI5 A;  1H4B A;  4CPV A;  1SPY A;  3WNX B;  1CFP A;  1LA3 A;  4MEW A;  2MA2 A;  2LMT A;  3I5G C;  1YVH A;  4CFR A;  2GV5 A;  3CS1 A;  1K96 A;  3TS5 B;  3SIB A;  1UHN A;  2VRG A;  4ORC B;  2LUX A;  3DD4 A;  2ZRS A;  1ALV A;  1WRZ A;  3LK0 A;  5J3X A;  3JVT C;  5I2O A;  3CGA A;  1H8B A;  5CSN A;  5I2Q A;  1F4Q A;  3SJS A;  3O78 A;  1KSM A;  3RM1 A;  3D10 A;  1OQP A;  1Y1X A;  1QIW A;  2CTN A;  3PSR A;  3OB2 B;  1JF2 A;  5DKN A;  2WCE A;  4OR9 B;  1UHI A;  1UHH A;  1KWO C;  2M0R A;  1QIV A;  1DGV A;  3TDI A;  4GGF C;  1CM1 A;  4PHK A;  1YX8 A;  1K95 A;  1R6P A;  1GJY A;  4N5X A;  2L50 A;  1SBJ A;  2K7B A;  5IBW A;  4YGA A;  1MR8 A;  1DJZ A;  1JWD A;  1QLK A;  4DS7 A;  1EH2 A;  4CID A;  2BCB A;  1UWO A;  1PSB A;  3WXA A;  2JWW A;  1WDC C;  3NSL A;  1KK8 B;  1YR5 A;  1UUS A;  2KYF A;  1AHR A;  3VRR A;  2JZI A;  2KBM A;  1AUI B;  2OS8 B;  2K0J A;  4C0L A;  1TNQ A;  2CXJ A;  1J7R A;  1G4Y R;  2KFF A;  1CB1 A;  2JXC A;  5I8N A;  2LP3 A;  2WOR A;  4JQ0 D;  3BUN B;  1YUS A;  2K61 A;  2KI6 C;  4WRI A;  1N65 A;  5ER5 A;  1SW8 A;  1XO5 A;  1F8H A;  1CMG A;  4PE7 A;  1K2H A;  2FCE A;  1SR6 C;  2KSP A;  1QV0 A;  3ZNI A;  1CNP A;  5CSJ A;  4PDZ A;  4ICB A;  1C7V A;  2WCB A;  1SCM C;  4M2Q A;  1S6J A;  3KPX A;  2AAO A;  1NP8 A;  3K21 A;  1K90 D;  3NSI A;  2BCX A;  1YUT A;  2NXQ A;  4GBA A;  1IWQ A;  2LLU A;  1YTZ C;  1M63 B;  2AMI A;  1B8R A;  1M45 A;  4IL1 A;  2ZKM X;  2PAS A;  1MF8 B;  1SY9 A;  2F2O A;  1MXE A;  1V1G A;  2KQ6 A;  3OX5 A;  2Q91 A;  2D8N A;  1L2O B;  1CLM A;  3GOF A;  2MRD A;  1A75 A;  4JPZ B;  1SRA A;  2PRU A;  1MUX A;  2NCO A;  1YRU B;  1DGU A;  2PVB A;  1K9U A;  1KFX S;  4MZL A;  5DKR A;  5B8I B;  2NLN A;  1TNX A;  1CLB A;  3I5F C;  1LXF C;  1BU3 A;  1AK8 A;  1B8L A;  3LLE A;  1G33 A;  4ETO A;  4L9M A;  2M7L A;  4E68 A;  2K7O A;  3CR4 X;  2JTT A;  4YI9 A;  5JOL A;  4M2P A;  4PE4 A;  3CLN A;  2FOT A;  4MZK A;  2HQW A;  1B8C A;  3EVU A;  1S36 A;  1CFD A;  2MAZ A;  1F55 A;  4XJK B;  3LCP C;  2NCP A;  1TCF A;  1BOD A;  1SMG A;  1A03 A;  1OMD A;  1KK7 Y;  2LNK A;  2I2R E;  2JUL A;  2KOT A;  5AAN A;  4HRG A;  1NYA A;  1IGV A;  1WRK A;  5CSI A;  2I94 A;  4FQO A;  1JUO A;  3IQO A;  1NWD A;  1QX5 B;  1SK6 D;  2Y1M A;  1X02 A;  3PN7 C;  4DRW A;  1DTL A;  2F3Z A;  2JXL A;  2M3W A;  2LE9 B;  3HCM A;  2BCA A;  2H61 A;  4OVN F;  4MBE A;  2PAL A;  1AP4 A;  5HLV A;  5CSF A;  3O4Y A;  2F8P A;  1KK7 Z;  3GK1 A;  1KFU S;  1UHK A;  2OPO A;  2HQ8 A;  1EXR A;  2KGR A;  3JVT B;  1C07 A;  2P6B B;  4C0J A;  1NX1 A;  4NQG A;  4PAL A;  2BBM A;  2KAY A;  5HKY A;  1IH0 A;  2M9G A;  3BUO B;  4QJ3 B;  4DUQ A;  1NIW A;  1NSH A;  1JBA A;  2M1U A;  2WND A;  2KI4 B;  2CNP A;  2BE4 A;  3M0W A;  1XK4 C;  4XJK A;  5AER A;  1YVL A;  3JTD C;  1G8I A;  5HYD A;  1KWO B;  2PMY A;  1WLZ A;  3TDU A;  2M7N A;  5D69 A;  2AUC A;  3H4S E;  2JOJ A;  1M31 A;  2GGM A;  2Y1N A;  1SKT A;  2MBX A;  4TNC A;  1CDL A;  3CTN A;  3DVM A;  2MLE C;  2ZNE A;  4I5K A;  1OMR A;  3CZT X;  3IQQ A;  4OKH A;  3D0Y B;  1BR4 B;  4PE1 A;  3LL8 B;  1TCO B;  2LVJ A;  4PHM A;  1A75 B;  1RK9 A;  1QAT A;  1TNP A;  1RJV A;  2M29 A;  3QRX A;  1WDC B;  4AQJ A;  2KFG A;  1QAS A;  3I5H B;  1E8A A;  2OTG B;  2KNE A;  3C1V A;  3IF7 A;  1UUR A;  4MSP A;  4N1G A;  5HLO A;  5AXI A;  1KSO A;  2LP2 A;  1XYD A;  4HSZ A;  3TUY C;  1DJG A;  1PVB A;  5CPV A;  1KQM C;  5AFP A;  2TN4 A;  2V53 A;  2EC6 C;  2WCF A;  3KHE A;  1WLM A;  1XFW O;  1IG5 A;  1QLS A;  2M49 B;  2BKI B;  1NCX A;  2A4J A;  1AJ4 A;  1EG4 A;  5GQQ C;  1QVI Y;  1J1D A;  1IKU A;  2K7D A;  3SG5 A;  1CMF A;  1NX2 A;  1SYM A;  3NSK A;  3AAJ A;  1MQ1 A;  1BLQ A;  3PAL A;  1SR6 B;  1U5I B;  1F70 A;  1DJH A;  2L0P A;  2K7C A;  2PSR A;  1ODB A;  1S26 D;  1W7J B;  2HF5 A;  1TIZ A;  2Y4Q A;  4N1F A;  4USL A;  2ZRT A;  3SIA A;  4C0K A;  1FI6 A;  1EJ3 A;  1R2U A;  3CR2 A;  1SCM B;  4FTG A;  2CT9 A;  3EKH A;  5PAL A;  3O2P A;  1WY9 A;  1ALW A;  4GGF A;  2JT3 A;  1F71 A;  1Y1A A;  2EGD A;  1TNW A;  1D1O A;  3FIA A;  1BOC A;  1RTP 1;  1CLL A;  1QVI Z;  4YRU A;  1TTX A;  1OZS A;  1CDP A;  1SL9 A;  2LVK A;  1EG3 A;  1FW4 A;  3BUM B;  3D0Y A;  4YGE B;  5F6T A;  1N2D A;  2JNX A;  3I5I B;  5KSZ A;  3E3R A;  1CTR A;  1TRF A;  1LKJ A;  2L4H A;  5FYX A;  1YRT B;  2BKH B;  1B7T Y;  1UP5 A;  1RFJ A;  3AKA A;  3GK2 A;  1CFC A;  4GGN A;  4MZJ A;  4NDB A;  1LIN A;  1SL8 A;  2MJW B;  2FJU B;  3FS7 A;  4GAO A;  2I18 A;  3DVK A;  2M1K B;  3OX6 A;  2KQY A;  2ZN8 A;  1ZUZ A;  3I5F B;  1OZO A;  3EK7 A;  2O5G A;  3OP0 A;  4QJ5 B;  2I7A A;  1MXL C;  1XFV O;  2GGZ A;  4PCW A;  5I2L A;  4D1E A;  2DOQ A;  1HT9 A;  1K9K A;  1NPQ A;  2LLS A;  2LMU A;  2ZND A;  2BL0 B;  2FCD A;  1PK0 D;  2QAC A;  4MRY A;  4XYN A;  5JJG A;  1U5I A;  1QJT A;  1NCZ A;  3MSE B;  1B7T Z;  4AQI A;  2KFH A;  3CWG A;  3OHM B;  1KFX L;  3WHU B;  2SCP A;  1QXP A;  2LVI A;  4A4C A;  4M2O A;  1L7Z A;  3A8R A;  4PHN A;  2KYC A;  1OE9 B;  4ORA B;  4BY5 A;  2MLF C;  3PFV A;  2JPT A;  4DCK A;  1FBV A;  2MHH A;  1VRK A;  4CLN A;  2QPT A;  3VGO A;  2JNF A;  3EVR A;  3O6B A;  3NSO A;  1DMO A;  3PN7 B;  5HKZ A;  1BT6 A;  1WRL A;  2G2B A;  3I5G B;  2NZ0 A;  1DJW A;  1AJ5 A;  4ORB B;  4F0Z B;  1F4O A;  1ZAC A;  3EK8 A;  1F54 A;  2KAV A;  1YUU A;  1S3P A;  1UHJ A;  2F2P A;  1QTX A;  1J55 A;  3BOW B;  4GNK B;  2IS9 A;  1BMO A;  1V1F A;  1IQ3 A;  1RRO A;  3BQ3 A;  1K94 A; 
#chains in the Genus database with same CATH topology
 3B88 A;  4DIR A;  3A4U B;  1B4C A;  3S0G A;  3WHT B;  1JFJ A;  1QX7 A;  4A4B A;  2H2K A;  2LUC A;  3TS5 C;  1AVS A;  1XVJ A;  3GK4 X;  1DF0 B;  1BR1 B;  2QEH A;  3BYA A;  3EKJ A;  2COL B;  3DY9 A;  3ICB A;  2HPS A;  1DJX A;  1OMV A;  1YUR A;  4ZCV A;  2BE6 A;  1KFU L;  2KGB C;  1SNL A;  2BEC A;  3AKB A;  4Q04 A;  3JTD B;  3OBV A;  1XFX O;  4GFT A;  1XA5 A;  2O60 A;  3OGN A;  4HRH A;  1M39 A;  2JRF A;  2P71 A;  1S1E A;  4ZCU A;  2M97 A;  1J1E A;  3PAT A;  5ER4 X;  1XFY O;  1Y1U A;  3SG2 A;  3HX4 A;  4I5N B;  3SG6 A;  4R1E A;  2KDH A;  3DZT A;  4JWQ A;  1LS8 A;  2KI4 C;  1BF5 A;  1NX0 A;  3CYZ A;  3DVE A;  5HKW A;  1K9P A;  1TN4 A;  1LVC D;  2LCP A;  3BUW B;  3F45 A;  1JF0 A;  1K93 D;  3PM2 A;  1PSR A;  4AOM A;  1J7O A;  1KCY A;  5D7F A;  2M8U A;  2G9B A;  3BOW A;  1REC A;  3D75 A;  2Y5I A;  3SS5 A;  5KU1 A;  2LHI A;  1QV1 A;  3L4L A;  1XFZ O;  1IRJ A;  4PHJ A;  1J7P A;  3VRP A;  3R1P A;  1BG1 A;  1ZMZ A;  3TUY B;  3ZWH A;  1GQM A;  1KK8 C;  1KQM B;  3VRO A;  1B1G A;  2EC6 B;  3KF9 A;  1GGZ A;  2OS8 C;  2KPH A;  2RGI A;  3CR5 X;  4BY4 A;  1KQV A;  3DVJ A;  2L51 A;  2LHL A;  2JPO A;  1Q80 A;  1YX7 A;  2WCH A;  4OCI A;  3I5H C;  2WCK A;  1QS7 A;  2L4I A;  2OTG C;  2R2I A;  1DF0 A;  1BJF A;  2L5X B;  4NDC A;  1B9A A;  2KHN A;  1B47 A;  2HET A;  2JT8 A;  1W9Z A;  2QDI A;  2WC8 A;  1FF1 A;  1ORG A;  4OZD A;  3V2L A;  2EHB A;  3TDZ A;  4QJ4 B;  1JC2 A;  4MLW A;  1CM4 A;  4YGC B;  1GGW A;  3FWC A;  1NCY A;  1LA0 A;  1XK4 A;  2B1U A;  1A29 A;  2JC2 A;  5K89 A;  4YI8 A;  3R1V A;  2KAX A;  1SL7 A;  3VRN A;  2LV7 A;  3SG7 A;  2LAN A;  1ZFS A;  3EK4 A;  3SS3 A;  1EL4 A;  4GUK A;  1DJY A;  1S5G Y;  1QX2 A;  2JU0 A;  2JTZ A;  2KBI A;  2L2E A;  1Y0V H;  1A2X A;  1N0Y A;  3BUX B;  3R72 A;  2JQ6 A;  2CCM A;  1SCV A;  2F3Y A;  4I5L B;  5BPJ A;  4HRE E;  2ISD A;  1HQV A;  5G08 A;  4UPG A;  1PRW A;  1CDN A;  5TNC A;  1CDM A;  2K2A A;  3DF0 B;  4WQ2 A;  1J7Q A;  1S6I A;  3NHI A;  4MRX A;  1RWY A;  1A4P A;  1PVA A;  3SG3 A;  1ZOT B;  1L2O C;  3BXK A;  4OV2 A;  2H61 C;  1S5G Z;  3I5I C;  1DJI A;  2Q4U A;  2LC5 A;  3L47 A;  5KTY A;  2K8M B;  2L5Y A;  1DVI A;  1S6C A;  1FPW A;  1MHO A;  3RLZ A;  4U8D A;  4NDD A;  2E6W A;  4CFQ A;  3S0D A;  2WOS A;  3FWB A;  3OB1 B;  4WQ3 A;  2SAS A;  3IVT A;  2WC6 A;  3PM8 A;  1K8U A;  1IJ6 A;  1DEL A;  2LAP A;  1PAL A;  1MWN A;  1PUL A;  1M46 A;  2LVV A;  2E30 A;  2JT0 A;  1TOP A;  2WCJ A;  1CFF A;  4PE0 A;  3KEV A;  3KO0 A;  1IQ5 A;  4P5O E;  3TZ1 A;  1IJ5 A;  4MVF A;  1NUB A;  2F33 A;  1OOJ A;  5HL1 A;  2BL0 C;  3NHT A;  2BAP A;  1OSA A;  4YBH B;  2L98 A;  1Y6W A;  2LLT A;  1JFK A;  3PLF B;  5DKQ A;  2PQL A;  1Z4H A;  3NXA A;  1XFU O;  2LM5 A;  4GPL B;  1JSA A;  3SG4 A;  4YGD B;  1C7W A;  1W7I B;  4YGB B;  3LK1 A;  2BBN A;  2ZFD A;  3CAB A;  3AAK A;  1CKK A;  3DF0 A;  3EG5 B;  2CBL A;  1NX3 A;  4JKT A;  2KI6 D;  3EVV A;  4I5J A;  2LMV A;  4MN0 A;  2ZN9 A;  3VRQ A;  1DT7 B;  2K2F A;  4P2Y B;  5AEQ A;  1FI5 A;  1H4B A;  4CPV A;  1SPY A;  2QEB A;  3B86 A;  3WNX B;  1CFP A;  1LA3 A;  4MEW A;  2MA2 A;  2LMT A;  3I5G C;  1YVH A;  3QME A;  4CFR A;  2GV5 A;  3CS1 A;  1K96 A;  1DEK A;  3TS5 B;  3SIB A;  1UHN A;  2VRG A;  4ORC B;  2LUX A;  3DD4 A;  2ZRS A;  1ALV A;  1WRZ A;  3LK0 A;  5J3X A;  2KLD A;  3B6X A;  3JVT C;  3CGA A;  5I2O A;  1H8B A;  5CSN A;  5I2Q A;  1F4Q A;  3SJS A;  3O78 A;  1KSM A;  3RM1 A;  3D10 A;  1TWO A;  1OQP A;  2WCM A;  1Y1X A;  1QIW A;  2CTN A;  3PSR A;  3OB2 B;  3B87 A;  1JF2 A;  5DKN A;  2WCE A;  4OR9 B;  1UHI A;  3K1E A;  1UHH A;  1KWO C;  2M0R A;  1QIV A;  1DGV A;  3TDI A;  4GGF C;  1CM1 A;  4PHK A;  1YX8 A;  1K95 A;  1R6P A;  1GJY A;  4N5X A;  2L50 A;  1SBJ A;  2K7B A;  5IBW A;  4YGA A;  1MR8 A;  1DJZ A;  1JWD A;  1QLK A;  4DS7 A;  1EH2 A;  3S0A A;  4CID A;  2BCB A;  1UWO A;  1PSB A;  3WXA A;  2JWW A;  1WDC C;  3NSL A;  1KK8 B;  1YR5 A;  1UUS A;  2KYF A;  1AHR A;  3VRR A;  4F7F A;  2JZI A;  2L2C A;  2KBM A;  1AUI B;  4PT1 A;  2OS8 B;  2K0J A;  4C0L A;  1TNQ A;  3B7A A;  2CXJ A;  1J7R A;  2KLE A;  4IJ7 A;  1G4Y R;  2KFF A;  1CB1 A;  2JXC A;  5I8N A;  2LP3 A;  1OOF A;  2PYQ A;  2WOR A;  4JQ0 D;  3BUN B;  1YUS A;  2K61 A;  2P70 A;  2KI6 C;  4WRI A;  3SS4 A;  1N65 A;  5ER5 A;  1SW8 A;  1P28 A;  1OW4 A;  1XO5 A;  1F8H A;  1IIO A;  1CMG A;  2WC5 A;  4PE7 A;  1K2H A;  2FCE A;  1SR6 C;  2KSP A;  1QV0 A;  3ZNI A;  1CNP A;  5CSJ A;  4INW A;  4PDZ A;  4ICB A;  1C7V A;  2WCB A;  1SCM C;  4M2Q A;  1S6J A;  3FE8 A;  3KPX A;  2AAO A;  1NP8 A;  1TUZ A;  1K90 D;  3K21 A;  2BCX A;  3NSI A;  1YUT A;  2NXQ A;  3L4A A;  1IWQ A;  4GBA A;  2LLU A;  5I94 A;  1YTZ C;  1M63 B;  2AMI A;  1B8R A;  3CDN A;  1M45 A;  3R1O A;  4IL1 A;  1TUJ A;  2ZKM X;  2PAS A;  1QWV A;  1MF8 B;  1SY9 A;  5FI2 A;  2F2O A;  1MXE A;  1V1G A;  2YGU A;  2KQ6 A;  3OX5 A;  2Q91 A;  2D8N A;  1L2O B;  1CLM A;  3GOF A;  2MRD A;  1A75 A;  4JPZ B;  1XFR A;  1SRA A;  2PRU A;  1MUX A;  2NCO A;  1YRU B;  1DGU A;  2PVB A;  1K9U A;  5EL2 A;  1DC1 A;  1KFX S;  4MZL A;  5DKR A;  5B8I B;  2NLN A;  1TNX A;  1CLB A;  3I5F C;  1LXF C;  1BU3 A;  1AK8 A;  1B8L A;  3LLE A;  1G33 A;  4ETO A;  4L9M A;  2M7L A;  4E68 A;  2K7O A;  3CR4 X;  2JTT A;  4YI9 A;  3O4X A;  5JOL A;  4M2P A;  3Q8I A;  4PE4 A;  3CLN A;  1T14 A;  2FOT A;  4MZK A;  2HQW A;  1B8C A;  3EVU A;  3UO9 A;  3UNW A;  3D73 A;  1S36 A;  1CFD A;  2MAZ A;  1F55 A;  4XJK B;  3LCP C;  2NCP A;  1TCF A;  1BOD A;  1SMG A;  1A03 A;  1OMD A;  3PJI A;  1KK7 Y;  2LNK A;  3N7H A;  2I2R E;  2JUL A;  2KOT A;  5AAN A;  4HRG A;  1NYA A;  1IGV A;  1WRK A;  5CSI A;  2I94 A;  4FQO A;  1JUO A;  3IQO A;  1NWD A;  1QX5 B;  1SK6 D;  2Y1M A;  1X02 A;  3PN7 C;  3NGV A;  4DRW A;  1DTL A;  2F3Z A;  2JXL A;  2M3W A;  2LE9 B;  3HCM A;  2BCA A;  2H61 A;  3D78 A;  4OVN F;  4MBE A;  2PAL A;  1AP4 A;  5HLV A;  5CSF A;  3O4Y A;  2F8P A;  1KK7 Z;  3GK1 A;  1KFU S;  4JD9 A;  1UHK A;  2OPO A;  2HQ8 A;  3FE6 A;  1EXR A;  2KGR A;  3VB1 A;  3JVT B;  1C07 A;  2P6B B;  4C0J A;  2H8V A;  1NX1 A;  4NQG A;  2ERB A;  4PAL A;  2BBM A;  5FI7 A;  1OOG A;  2KAY A;  3CZ2 A;  5HKY A;  1IH0 A;  2M9G A;  3BUO B;  4QJ3 B;  4DUQ A;  1NIW A;  1NSH A;  1JBA A;  2M1U A;  2WND A;  2KI4 B;  2CNP A;  2BE4 A;  3M0W A;  1XK4 C;  2K60 A;  4XJK A;  1YVL A;  3JTD C;  1G8I A;  5AER A;  5HYD A;  1KWO B;  1SSE B;  2PMY A;  2WCL A;  1WLZ A;  3BFA A;  2M7N A;  4KYN A;  5D69 A;  2AUC A;  3TDU A;  3FE9 A;  5FI6 A;  3H4S E;  2JOJ A;  1M31 A;  2GGM A;  2Y1N A;  1SKT A;  2MBX A;  3S0E A;  4TNC A;  1CDL A;  3RZS A;  3CTN A;  3DVM A;  2MLE C;  2ZNE A;  4I5K A;  1OMR A;  3CZT X;  3IQQ A;  4OKH A;  3D0Y B;  1BR4 B;  4PE1 A;  3LL8 B;  1TCO B;  2LVJ A;  4PHM A;  1A75 B;  1RK9 A;  1QAT A;  1TNP A;  1RJV A;  2M29 A;  3QRX A;  1WDC B;  4AQJ A;  2QEO A;  3D74 A;  2KFG A;  1C3Z A;  1QAS A;  3I5H B;  1E8A A;  2OTG B;  2KNE A;  3C1V A;  3IF7 A;  1UUR A;  4MSP A;  4N1G A;  5HLO A;  5AXI A;  1KSO A;  2LP2 A;  1XYD A;  4HSZ A;  3TUY C;  1DJG A;  1PVB A;  5CPV A;  1KQM C;  3D76 A;  5AFP A;  3S0F A;  2TN4 A;  2V53 A;  2EC6 C;  2WCF A;  2BNX A;  1WLM A;  1XFW O;  3KHE A;  1IG5 A;  1QLS A;  2M49 B;  2BKI B;  1NCX A;  2A4J A;  1AJ4 A;  1EG4 A;  1OOI X;  5GQQ C;  1QVI Y;  1J1D A;  1IKU A;  2K7D A;  3SG5 A;  1CMF A;  1NX2 A;  1SYM A;  3NSK A;  3AAJ A;  1MQ1 A;  1BLQ A;  3PAL A;  1SR6 B;  1U5I B;  1F70 A;  1DJH A;  2L0P A;  2K7C A;  2PSR A;  1ODB A;  1S26 D;  1W7J B;  2HF5 A;  1TIZ A;  2Y4Q A;  4N1F A;  4USL A;  2ZRT A;  3SIA A;  4C0K A;  1FI6 A;  1EJ3 A;  1R2U A;  3CR2 A;  1SCM B;  4FTG A;  2CT9 A;  3EKH A;  5PAL A;  3O2P A;  1WY9 A;  1ALW A;  4GGF A;  2JT3 A;  1F71 A;  1Y1A A;  2EGD A;  1TNW A;  1D1O A;  3FIA A;  1BOC A;  1RTP 1;  1CLL A;  1QVI Z;  4YRU A;  1TTX A;  1OZS A;  1CDP A;  1SL9 A;  2LVK A;  1EG3 A;  1FW4 A;  3BUM B;  3D0Y A;  4INX A;  4YGE B;  5F6T A;  3S0B A;  1N2D A;  2JNX A;  3DYE A;  3I5I B;  3E3R A;  5KSZ A;  1CTR A;  1TRF A;  1LKJ A;  2L4H A;  5FYX A;  1YRT B;  2BKH B;  1B7T Y;  1UP5 A;  1RFJ A;  3AKA A;  3GK2 A;  1CFC A;  4GGN A;  4MZJ A;  3CZ0 A;  4NDB A;  1LIN A;  1SL8 A;  2MJW B;  2FJU B;  3FS7 A;  4GAO A;  2I18 A;  3DVK A;  2M1K B;  3OX6 A;  2KQY A;  2ZN8 A;  1ZUZ A;  3I5F B;  1OZO A;  3EK7 A;  2O5G A;  3OP0 A;  4QJ5 B;  2I7A A;  1MXL C;  1XFV O;  2GGZ A;  1Z2C B;  4PCW A;  5I2L A;  4D1E A;  2DOQ A;  1HT9 A;  1K9K A;  1NPQ A;  2LLS A;  1DQE A;  1GM0 A;  2LMU A;  1C3Y A;  2ZND A;  2BL0 B;  2FCD A;  1PK0 D;  2QAC A;  2GTE A;  4MRY A;  4XYN A;  5JJG A;  1U5I A;  1OOH A;  1QJT A;  3BFH A;  1NCZ A;  3MSE B;  1B7T Z;  4AQI A;  2KFH A;  2QEV A;  3CWG A;  3DXL A;  3BJH A;  1KFX L;  3OHM B;  3WHU B;  2SCP A;  1QXP A;  2LVI A;  4A4C A;  4M2O A;  1L7Z A;  3A8R A;  4PHN A;  2KYC A;  1OE9 B;  4ORA B;  4BY5 A;  2MLF C;  3PFV A;  2JPT A;  4DCK A;  1FBV A;  2MHH A;  1VRK A;  4CLN A;  2QPT A;  3VGO A;  2JNF A;  3EVR A;  5D3O A;  3O6B A;  3NSO A;  1DMO A;  3PN7 B;  2FJY A;  1BT6 A;  5HKZ A;  1WRL A;  3BFB A;  2G2B A;  3I5G B;  4FQT A;  3D77 A;  2NZ0 A;  1DJW A;  1AJ5 A;  4ORB B;  4F0Z B;  1F4O A;  1ZAC A;  3EK8 A;  1F54 A;  5DIC A;  2KAV A;  1YUU A;  1S3P A;  1UHJ A;  2F2P A;  1QTX A;  1J55 A;  3BOW B;  4GNK B;  2IS9 A;  1BMO A;  1V1F A;  1IQ3 A;  1RRO A;  3BQ3 A;  1K94 A;  3CZ1 A; 
#chains in the Genus database with same CATH homology
 4DIR A;  3A4U B;  1B4C A;  3WHT B;  1JFJ A;  1QX7 A;  4A4B A;  2H2K A;  2LUC A;  3TS5 C;  1AVS A;  1XVJ A;  3GK4 X;  1DF0 B;  1BR1 B;  3BYA A;  3EKJ A;  2COL B;  3ICB A;  2HPS A;  1DJX A;  1OMV A;  1YUR A;  4ZCV A;  2BE6 A;  1KFU L;  2KGB C;  1SNL A;  2BEC A;  3AKB A;  4Q04 A;  3JTD B;  4GFT A;  1XFX O;  1XA5 A;  2O60 A;  4HRH A;  1M39 A;  2JRF A;  1S1E A;  4ZCU A;  2M97 A;  1J1E A;  3PAT A;  5ER4 X;  1XFY O;  1Y1U A;  3SG2 A;  3HX4 A;  4I5N B;  3SG6 A;  4R1E A;  2KDH A;  4JWQ A;  2KI4 C;  1BF5 A;  1NX0 A;  3DVE A;  5HKW A;  1K9P A;  1TN4 A;  1LVC D;  2LCP A;  3BUW B;  3F45 A;  1JF0 A;  1K93 D;  1PSR A;  4AOM A;  1J7O A;  1KCY A;  5D7F A;  2M8U A;  2G9B A;  3BOW A;  1REC A;  2Y5I A;  5KU1 A;  1J7P A;  2LHI A;  1QV1 A;  4PHJ A;  1XFZ O;  1IRJ A;  3VRP A;  1BG1 A;  1ZMZ A;  3TUY B;  3ZWH A;  1GQM A;  1KK8 C;  1KQM B;  3VRO A;  1B1G A;  2EC6 B;  3KF9 A;  1GGZ A;  2OS8 C;  2RGI A;  3CR5 X;  4BY4 A;  1KQV A;  3DVJ A;  2L51 A;  2LHL A;  1Q80 A;  1YX7 A;  4OCI A;  3I5H C;  1FPW A;  1QS7 A;  2L4I A;  2OTG C;  2R2I A;  1DF0 A;  1BJF A;  2L5X B;  4NDC A;  1B9A A;  2KHN A;  1B47 A;  2HET A;  2JT8 A;  2WC8 A;  1FF1 A;  2EHB A;  3TDZ A;  4QJ4 B;  1JC2 A;  4MLW A;  1CM4 A;  4YGC B;  1GGW A;  3FWC A;  1NCY A;  1LA0 A;  1XK4 A;  2B1U A;  1A29 A;  2JC2 A;  5K89 A;  4YI8 A;  2KAX A;  1SL7 A;  3VRN A;  2LV7 A;  3SG7 A;  2LAN A;  1ZFS A;  3EK4 A;  1EL4 A;  4GUK A;  1DJY A;  1S5G Y;  1QX2 A;  2JU0 A;  2JTZ A;  2KBI A;  2L2E A;  1Y0V H;  1A2X A;  1N0Y A;  3BUX B;  2JQ6 A;  2CCM A;  1SCV A;  2F3Y A;  4I5L B;  5BPJ A;  4HRE E;  2ISD A;  1HQV A;  5G08 A;  4UPG A;  1PRW A;  1CDN A;  5TNC A;  1CDM A;  2K2A A;  3DF0 B;  4WQ2 A;  1J7Q A;  1S6I A;  4MRX A;  1RWY A;  1A4P A;  1PVA A;  3SG3 A;  1ZOT B;  1L2O C;  3BXK A;  4OV2 A;  2H61 C;  1S5G Z;  3I5I C;  1DJI A;  2Q4U A;  2LC5 A;  5KTY A;  2K8M B;  1DVI A;  1S6C A;  1MHO A;  3RLZ A;  4U8D A;  4NDD A;  2E6W A;  4CFQ A;  2WOS A;  3FWB A;  3OB1 B;  4WQ3 A;  2SAS A;  3PM8 A;  1K8U A;  1IJ6 A;  2LAP A;  1PAL A;  1MWN A;  1PUL A;  1M46 A;  2LVV A;  2E30 A;  2JT0 A;  1TOP A;  1CFF A;  4PE0 A;  3KEV A;  3KO0 A;  1IQ5 A;  4P5O E;  3TZ1 A;  1IJ5 A;  4MVF A;  1NUB A;  2F33 A;  1OOJ A;  2BL0 C;  1OSA A;  4YBH B;  2L98 A;  1Y6W A;  2LLT A;  1JFK A;  3PLF B;  5DKQ A;  3NXA A;  1XFU O;  2LM5 A;  4GPL B;  1JSA A;  3SG4 A;  4YGD B;  1C7W A;  1W7I B;  4YGB B;  3LK1 A;  2BBN A;  2ZFD A;  3AAK A;  1CKK A;  3DF0 A;  2CBL A;  1NX3 A;  2KI6 D;  3EVV A;  4I5J A;  2LMV A;  4MN0 A;  2ZN9 A;  3VRQ A;  1DT7 B;  2K2F A;  4P2Y B;  5AEQ A;  1FI5 A;  1H4B A;  4CPV A;  1SPY A;  3WNX B;  1CFP A;  1LA3 A;  4MEW A;  2MA2 A;  2LMT A;  3I5G C;  1YVH A;  4CFR A;  2GV5 A;  3CS1 A;  1K96 A;  3TS5 B;  3SIB A;  1UHN A;  2VRG A;  4ORC B;  2LUX A;  3DD4 A;  2ZRS A;  1ALV A;  1WRZ A;  3LK0 A;  5J3X A;  3JVT C;  5I2O A;  3CGA A;  1H8B A;  5CSN A;  5I2Q A;  1F4Q A;  3SJS A;  3O78 A;  1KSM A;  3RM1 A;  3D10 A;  1OQP A;  1Y1X A;  1QIW A;  2CTN A;  3PSR A;  3OB2 B;  1JF2 A;  5DKN A;  2WCE A;  4OR9 B;  1UHI A;  1UHH A;  1KWO C;  2M0R A;  1QIV A;  1DGV A;  3TDI A;  4GGF C;  1CM1 A;  4PHK A;  1YX8 A;  1K95 A;  1R6P A;  1GJY A;  4N5X A;  2L50 A;  1SBJ A;  2K7B A;  5IBW A;  4YGA A;  1MR8 A;  1DJZ A;  1JWD A;  1QLK A;  4DS7 A;  1EH2 A;  4CID A;  2BCB A;  1UWO A;  1PSB A;  3WXA A;  2JWW A;  1WDC C;  3NSL A;  1KK8 B;  1YR5 A;  1UUS A;  2KYF A;  1AHR A;  3VRR A;  2JZI A;  2KBM A;  1AUI B;  2OS8 B;  2K0J A;  4C0L A;  1TNQ A;  2CXJ A;  1J7R A;  1G4Y R;  2KFF A;  1CB1 A;  2JXC A;  5I8N A;  2LP3 A;  2WOR A;  4JQ0 D;  3BUN B;  1YUS A;  2K61 A;  2KI6 C;  4WRI A;  1N65 A;  5ER5 A;  1SW8 A;  1XO5 A;  1F8H A;  1CMG A;  4PE7 A;  1K2H A;  2FCE A;  1SR6 C;  2KSP A;  1QV0 A;  3ZNI A;  1CNP A;  5CSJ A;  4PDZ A;  4ICB A;  1C7V A;  2WCB A;  1SCM C;  4M2Q A;  1S6J A;  3KPX A;  2AAO A;  1NP8 A;  3K21 A;  1K90 D;  3NSI A;  2BCX A;  1YUT A;  2NXQ A;  4GBA A;  1IWQ A;  2LLU A;  1YTZ C;  1M63 B;  2AMI A;  1B8R A;  1M45 A;  4IL1 A;  2ZKM X;  2PAS A;  1MF8 B;  1SY9 A;  2F2O A;  1MXE A;  1V1G A;  2KQ6 A;  3OX5 A;  2Q91 A;  2D8N A;  1L2O B;  1CLM A;  3GOF A;  2MRD A;  1A75 A;  4JPZ B;  1SRA A;  2PRU A;  1MUX A;  2NCO A;  1YRU B;  1DGU A;  2PVB A;  1K9U A;  1KFX S;  4MZL A;  5DKR A;  5B8I B;  2NLN A;  1TNX A;  1CLB A;  3I5F C;  1LXF C;  1BU3 A;  1AK8 A;  1B8L A;  3LLE A;  1G33 A;  4ETO A;  4L9M A;  2M7L A;  4E68 A;  2K7O A;  3CR4 X;  2JTT A;  4YI9 A;  5JOL A;  4M2P A;  4PE4 A;  3CLN A;  2FOT A;  4MZK A;  2HQW A;  1B8C A;  3EVU A;  1S36 A;  1CFD A;  2MAZ A;  1F55 A;  4XJK B;  3LCP C;  2NCP A;  1TCF A;  1BOD A;  1SMG A;  1A03 A;  1OMD A;  1KK7 Y;  2LNK A;  2I2R E;  2JUL A;  2KOT A;  5AAN A;  4HRG A;  1NYA A;  1IGV A;  1WRK A;  5CSI A;  2I94 A;  4FQO A;  1JUO A;  3IQO A;  1NWD A;  1QX5 B;  1SK6 D;  2Y1M A;  1X02 A;  3PN7 C;  4DRW A;  1DTL A;  2F3Z A;  2JXL A;  2M3W A;  2LE9 B;  3HCM A;  2BCA A;  2H61 A;  4OVN F;  4MBE A;  2PAL A;  1AP4 A;  5HLV A;  5CSF A;  3O4Y A;  2F8P A;  1KK7 Z;  3GK1 A;  1KFU S;  1UHK A;  2OPO A;  2HQ8 A;  1EXR A;  2KGR A;  3JVT B;  1C07 A;  2P6B B;  4C0J A;  1NX1 A;  4NQG A;  4PAL A;  2BBM A;  2KAY A;  5HKY A;  1IH0 A;  2M9G A;  3BUO B;  4QJ3 B;  4DUQ A;  1NIW A;  1NSH A;  1JBA A;  2M1U A;  2WND A;  2KI4 B;  2CNP A;  2BE4 A;  3M0W A;  1XK4 C;  4XJK A;  5AER A;  1YVL A;  3JTD C;  1G8I A;  5HYD A;  1KWO B;  2PMY A;  1WLZ A;  3TDU A;  2M7N A;  5D69 A;  2AUC A;  3H4S E;  2JOJ A;  1M31 A;  2GGM A;  2Y1N A;  1SKT A;  2MBX A;  4TNC A;  1CDL A;  3CTN A;  3DVM A;  2MLE C;  2ZNE A;  4I5K A;  1OMR A;  3CZT X;  3IQQ A;  4OKH A;  3D0Y B;  1BR4 B;  4PE1 A;  3LL8 B;  1TCO B;  2LVJ A;  4PHM A;  1A75 B;  1RK9 A;  1QAT A;  1TNP A;  1RJV A;  2M29 A;  3QRX A;  1WDC B;  4AQJ A;  2KFG A;  1QAS A;  3I5H B;  1E8A A;  2OTG B;  2KNE A;  3C1V A;  3IF7 A;  1UUR A;  4MSP A;  4N1G A;  5HLO A;  5AXI A;  1KSO A;  2LP2 A;  1XYD A;  4HSZ A;  3TUY C;  1DJG A;  1PVB A;  5CPV A;  1KQM C;  5AFP A;  2TN4 A;  2V53 A;  2EC6 C;  2WCF A;  3KHE A;  1WLM A;  1XFW O;  1IG5 A;  1QLS A;  2M49 B;  2BKI B;  1NCX A;  2A4J A;  1AJ4 A;  1EG4 A;  5GQQ C;  1QVI Y;  1J1D A;  1IKU A;  2K7D A;  3SG5 A;  1CMF A;  1NX2 A;  1SYM A;  3NSK A;  3AAJ A;  1MQ1 A;  1BLQ A;  3PAL A;  1SR6 B;  1U5I B;  1F70 A;  1DJH A;  2L0P A;  2K7C A;  2PSR A;  1ODB A;  1S26 D;  1W7J B;  2HF5 A;  1TIZ A;  2Y4Q A;  4N1F A;  4USL A;  2ZRT A;  3SIA A;  4C0K A;  1FI6 A;  1EJ3 A;  1R2U A;  3CR2 A;  1SCM B;  4FTG A;  2CT9 A;  3EKH A;  5PAL A;  3O2P A;  1WY9 A;  1ALW A;  4GGF A;  2JT3 A;  1F71 A;  1Y1A A;  2EGD A;  1TNW A;  1D1O A;  3FIA A;  1BOC A;  1RTP 1;  1CLL A;  1QVI Z;  4YRU A;  1TTX A;  1OZS A;  1CDP A;  1SL9 A;  2LVK A;  1EG3 A;  1FW4 A;  3BUM B;  3D0Y A;  4YGE B;  5F6T A;  1N2D A;  2JNX A;  3I5I B;  5KSZ A;  3E3R A;  1CTR A;  1TRF A;  1LKJ A;  2L4H A;  5FYX A;  1YRT B;  2BKH B;  1B7T Y;  1UP5 A;  1RFJ A;  3AKA A;  3GK2 A;  1CFC A;  4GGN A;  4MZJ A;  4NDB A;  1LIN A;  1SL8 A;  2MJW B;  2FJU B;  3FS7 A;  4GAO A;  2I18 A;  3DVK A;  2M1K B;  3OX6 A;  2KQY A;  2ZN8 A;  1ZUZ A;  3I5F B;  1OZO A;  3EK7 A;  2O5G A;  3OP0 A;  4QJ5 B;  2I7A A;  1MXL C;  1XFV O;  2GGZ A;  4PCW A;  5I2L A;  4D1E A;  2DOQ A;  1HT9 A;  1K9K A;  1NPQ A;  2LLS A;  2LMU A;  2ZND A;  2BL0 B;  2FCD A;  1PK0 D;  2QAC A;  4MRY A;  4XYN A;  5JJG A;  1U5I A;  1QJT A;  1NCZ A;  3MSE B;  1B7T Z;  4AQI A;  2KFH A;  3CWG A;  3OHM B;  1KFX L;  3WHU B;  2SCP A;  1QXP A;  2LVI A;  4A4C A;  4M2O A;  1L7Z A;  3A8R A;  4PHN A;  2KYC A;  1OE9 B;  4ORA B;  4BY5 A;  2MLF C;  3PFV A;  2JPT A;  4DCK A;  1FBV A;  2MHH A;  1VRK A;  4CLN A;  2QPT A;  3VGO A;  2JNF A;  3EVR A;  3O6B A;  3NSO A;  1DMO A;  3PN7 B;  5HKZ A;  1BT6 A;  1WRL A;  2G2B A;  3I5G B;  2NZ0 A;  1DJW A;  1AJ5 A;  4ORB B;  4F0Z B;  1F4O A;  1ZAC A;  3EK8 A;  1F54 A;  2KAV A;  1YUU A;  1S3P A;  1UHJ A;  2F2P A;  1QTX A;  1J55 A;  3BOW B;  4GNK B;  2IS9 A;  1BMO A;  1V1F A;  1IQ3 A;  1RRO A;  3BQ3 A;  1K94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...