3KO0A

Structure of the tfp-ca2+-bound activated form of the s100a4 metastasis factor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phenothiazines inhibit S100A4 function by inducing protein oligomerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A4
total genus 34
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ko0A00
1G33A 3OHMB 1PSBA 3M0WA 2WOSA 1K2HA 3H4SE 3SG4A 2L4HA 3EKHA 2F2PA 1CDPA 5D69A 3SG2A 5I8NA 1CMGA 1LXFC 1NX1A 1OSAA 1S5GY 2KFGA 3SIBA 2WCBA 3SG3A 1F55A 4PE7A 4WQ3A 4WRIA 5CSIA 5F6TA 3PN7C 3VROA 1WLMA 2L98A 4YGCB 4YGEB 2JZIA 2K7OA 4ORBB 4I5LB 1RWYA 1SW8A 2KNEA 3KHEA 5HKWA 2PALA 1TCOB 1NX3A 2LVIA 3AKBA 1GJYA 1S6JA 1JBAA 1NPQA 2LNKA 1B9AA 1CFCA 2M0RA 2KI4C 3DVEA 2ZN9A 2ZRTA 3PM8A 2KOTA 2JWWA 1K9PA 2LHLA 2BL0B 1BG1A 1OMVA 2JXCA 3VGOA 2LMTA 4PDZA 1D1OA 1H8BA 1DGUA 1Y1UA 4WQ2A 2JNXA 1NCXA 4C0JA 1E8AA 3DF0A 4MBEA 2K7DA 2AUCA 1CDMA 1AVSA 1MQ1A 4PHKA 3O6BA 4MLWA 3CR5X 2RGIA 3OB2B 4NDDA 4DCKA 2H2KA 1F4QA 1FF1A 2JRFA 1YVLA 4OV2A 2L51A 3LLEA 1XK4A 2I18A 1N0YA 1N65A 3WHTB 1TNQA 1WY9A 1SKTA 3I5HB 5ER4X 3TUYC 2VRGA 4MEWA 1KQMC 3BUNB 4YI9A 2I94A 1S6CA 2K8MB 3O78A 1FI5A 2BECA 1EH2A 4GGFA 1ZOTB 2K0JA 1B8CA 2MA2A 3LK0A 2PASA 4MN0A 1DMOA 3PALA 2KQYA 1MF8B 4MZJA 2F3ZA 4A4CA 1UUSA 2JT0A 3D10A 1B7TY 2Q91A 3GK2A 3BOWA 2F2OA 3FWCA 1LVCD 1KWOC 4D1EA 1LA3A 1SCMC 2ZKMX 5J3XA 2CTNA 3SJSA 3VRPA 1F8HA 2BKHB 1PSRA 1SL7A 1DVIA 5AEQA 1TIZA 1F54A 1OZSA 1X02A 2JPTA 2KI4B 2M1KB 2R2IA 4HRGA 1JFKA 3D0YA 3WXAA 4IL1A 4PE4A 1Y1AA 1UHIA 1VRKA 4FQOA 5HLVA 1BR1B 1MXLC 1YRUB 2KDHA 2LHIA 2MRDA 4I5NB 4MRYA 1B47A 1CLMA 3LCPC 3O4YA 4OVNF 2F33A 4YGDB 1SY9A 3BUMB 3CS1A 1H4BA 2K7BA 1KK8B 1QXPA 1YX8A 1WRZA 4L9MA 4MZLA 3F45A 4XYNA 1YTZC 1CFPA 1EXRA 2EGDA 4N1GA 3CLNA 3FIAA 1AHRA 1B1GA 1XYDA 1IGVA 1AK8A 2QACA 3KF9A 1AJ5A 3LL8B 3MSEB 2JULA 2LP3A 2GGZA 5I2OA 3FWBA 1QASA 2LUXA 3OX6A 1NX2A 1NCZA 1KK7Z 1QV1A 2KI6D 4NDCA 1KQMB 5CSFA 1J1EA 1XFYO 1A29A 1EG3A 1QTXA 1SPYA 2LLUA 5ER5A 3TS5B 2LMVA 1J7PA 2JC2A 3DVJA 2L2EA 1BU3A 3DF0B 3EK4A 2Y1MA 4OKHA 2OTGB 1OMRA 3HX4A 4I5JA 4MRXA 1KFXS 3JVTB 1SR6B 1EL4A 4USLA 2KYFA 1YVHA 1C7VA 4ORAB 4QJ3B 1JSAA 1SCMB 2BKIB 3EK7A 3SG7A 3EK8A 1LINA 1K9UA 1SMGA 2HETA 2Y1NA 1DF0B 1SL9A 3I5GC 1SR6C 2K61A 1M46A 4YGBB 1DJYA 1U5IB 2K7CA 3CGAA 1MUXA 1EJ3A 2O60A 2LLSA 4QJ5B 4GBAA 5KTYA 3CZTX 3VRQA 2KGBC 3CWGA 1JC2A 2NZ0A 3EVUA 4P5OE 1YURA 2PSRA 3BQ3A 3GOFA 4DUQA 1YUUA 1B8RA 2NCOA 2ISDA 3JVTC 1GGZA 5HLOA 1C7WA 2I2RE 1RECA 2MHHA 1K90D 1K94A 3IQOA 1FW4A 1IJ5A 3JTDC 3AAKA 4CFRA 2FOTA 1KK7Y 1CM4A 2LCPA 1CFDA 3ZWHA 2JXLA 5BPJA 1R2UA 1OMDA 2BE4A 2ZNDA 2KFHA 2MJWB 1TTXA 4E68A 1UHNA 5I2QA 2BCBA 2CBLA 3BXKA 5B8IB 1N2DA 1K93D 1NP8A 1MR8A 1QVIY 2WORA 1ALWA 1JF0A 3EVVA 1TNXA 5AXIA 2M3WA 3I5HC 2M7LA 1Q80A 1L2OB 1TRFA 3TDIA 1LKJA 5IBWA 2M97A 1CFFA 3BUOB 4GPLB 1FPWA 1MWNA 1A4PA 1PULA 1YX7A 4A4BA 1ZUZA 4N5XA 4M2OA 1L7ZA 2OPOA 2KBMA 1CDNA 2L5XB 1S6IA 4M2PA 3D0YB 1PVBA 1JF2A 2V53A 4ZCUA 2KBIA 2Q4UA 1NUBA 1IJ6A 1WRLA 2B1UA 2LMUA 1WDCC 2BBMA 3DD4A 5HYDA 2GGMA 2ZRSA 1KSOA 4UPGA 1M63B 4N1FA 5D7FA 4TNCA 2HPSA 4OCIA 4MVFA 1DJGA 1DJHA 1KSMA 1QX7A 3A4UB 1BOCA 1CB1A 4R1EA 3BUXB 3PATA 4JPZB 1KK8C 3RM1A 3HCMA 2HF5A 2K2FA 2ZN8A 2K2AA 2JT8A 2AAOA 2KAYA 4CPVA 3C1VA 1K9KA 5CPVA 1DTLA 1XFVO 1Y1XA 5TNCA 1PK0D 1ZFSA 4CIDA 1PALA 3I5GB 2PVBA 1UURA 2LVKA 1M31A 4CFQA 2WC8A 1BJFA 1NIWA 2LC5A 4Q04A 2M8UA 1ZMZA 3PFVA 1BT6A 1QIVA 2M7NA 1W7JB 1F71A 2WCFA 5AERA 2WNDA 1V1GA 1LA0A 5JOLA 2LLTA 3KEVA 1OE9B 1IKUA 4OR9B 1BLQA 4YBHB 3EVRA 4GAOA 2CT9A 1TNPA 2M1UA 1RK9A 3GK1A 1B7TZ 5CSJA 3RLZA 2BL0C 1CTRA 2F3YA 3BYAA 2GV5A 2G9BA 2SCPA 4C0KA 4DIRA 2KAXA 1YUTA 1RJVA 1J7QA 1K95A 1IRJA 2KQ6A 4CLNA 3I5FC 3ZNIA 2JTTA 1S5GZ 5I2LA 2TN4A 4NQGA 1BODA 1EG4A 4BY4A 4HSZA 1S26D 1OQPA 2H61C 4YI8A 1BF5A 1AJ4A 1XO5A 5GQQC 1A75A 2PMYA 3DVKA 1XFWO 4YGAA 5K89A 1PRWA 2L0PA 1NWDA 2HQWA 1JUOA 3AAJA 2EC6B 4PALA 4MZKA 1GQMA 1KCYA 4YRUA 3I5IC 3NXAA 4ZCVA 1A75B 1WDCB 1W7IB 2QPTA 3NSLA 3OB1B 1CLBA 1L2OC 4P2YB 5FYXA 1QJTA 4XJKB 4PHMA 3IQQA 1UHJA 4NDBA 2Y4QA 5AANA 1MXEA 3VRNA 1FI6A 3PSRA 1F4OA 1IQ5A 2G2BA 1CMFA 2OS8C 2ZFDA 1IQ3A 5KU1A 2AMIA 2FCEA 2LVJA 4GNKB 1S1EA 1HQVA 2JOJA 1IWQA 3DVMA 1J7OA 1YUSA 1KWOB 2E30A 4BY5A 3JTDB 3CTNA 2M9GA 1UHKA 3CR4X 2MAZA 1GGWA 1CDLA 1G4YR 2BE6A 2M49B 5DKRA 2BCAA 2D8NA 2LUCA 1WRKA 1DGVA 2CNPA 2OTGC 5HKZA 1A03A 4MSPA 1J7RA 1XFXO 2LAPA 1HT9A 4GFTA 2HQ8A 2LVVA 3WNXB 1RTP1 4HREE 5CSNA 1QX2A 3OX5A 3WHUB 2COLB 2ZNEA 1Y0VH 1DJIA 2CXJA 4PE1A 3SG5A 1KQVA 1ODBA 3KPXA 2LV7A 2F8PA 3NSOA 1IH0A 1A2XA 1TOPA 1AUIB 4HRHA 1R6PA 3I5IB 1UP5A 4FTGA 2DOQA 1DJXA 1K8UA 2KFFA 2SASA 1XA5A 4GGNA 4ICBA 3TDUA 1QLSA 1NX0A 3BUWB 2MBXA 1RFJA 1SYMA 3E3RA 2FCDA 2JQ6A 4AQIA 1JWDA 1NYAA 1QVIZ 3IF7A 1YR5A 5HKYA 1SBJA 2PRUA 5JJGA 3QRXA 4AQJA 1UHHA 4U8DA 2BCXA 1DJZA 1QLKA 4PHJA 3K21A 1CNPA 2KAVA 3I5FB 1B4CA 2KYCA 3TUYB 4DS7A 1XFUO 1F70A 1BR4B 1KFXL 1OOJA 2LP2A 4C0LA 1WLZA 1XVJA 2P6BB 2JU0A 3EKJA 3FS7A 2LE9B 4F0ZB 5AFPA 1NSHA 1ALVA 2FJUB 4DRWA 1CLLA 2BBNA 1XK4C 3NSIA 3AKAA 3TZ1A 4M2QA 3A8RA 4ORCB 2LANA 3TDZA 1B8LA 2A4JA 1QX5B 2Y5IA 1PVAA 3GK4X 4JQ0D 3PLFB 2JT3A 1SCVA 5DKQA 2KI6C 2MLEC 4XJKA 1SRAA 4GUKA 5DKNA 1SL8A 3TS5C 1RROA 1QS7A 1UWOA 4I5KA 5PALA 1KFUL 2NXQA 2NCPA 1Y6WA 1ZACA 1MHOA 2CCMA 3BOWB 1BMOA 1S36A 3OP0A 1V1FA 1XFZO 2WCEA 3KO0A 3SIAA 1TNWA 4PHNA 1M39A 3NSKA 2L50A 1SNLA 2I7AA 3CR2A 1G8IA 3LK1A 1DT7B 1M45A 1IG5A 2NLNA 5KSZA 4GGFC 2JNFA 2OS8B 4QJ4B 1SK6D 3ICBA 2EC6C 1K96A 2MLFC 2JTZA 4PE0A 1DJWA 1NCYA 1QIWA 1J55A 2L4IA 3PN7B 1DF0A 3VRRA 4ETOA 4JWQA 1OZOA 2E6WA 1CKKA 2H61A 3O2PA 1JFJA 1U5IA 1C07A 1J1DA 1S3PA 1KFUS 1QATA 1TCFA 1QV0A 1CM1A 2LM5A 4AOMA 2O5GA 5G08A 2KHNA 4PCWA 1YRTB 1TN4A 1AP4A 1FBVA 3SG6A 2IS9A 2KSPA 2EHBA 2KGRA 2M29A
chains in the Genus database with same CATH superfamily
1G33A 3OHMB 1PSBA 3M0WA 2WOSA 1K2HA 2K60A 3H4SE 3SG4A 2L4HA 3EKHA 2F2PA 1CDPA 5D69A 3EG5B 3SG2A 5I8NA 1LXFC 1NX1A 1CMGA 1OSAA 1S5GY 2KFGA 3SIBA 2WCBA 3SG3A 1F55A 4PE7A 4WQ3A 4WRIA 5CSIA 5F6TA 3PN7C 3VROA 1WLMA 2L98A 4YGCB 4YGEB 2JZIA 2K7OA 4ORBB 4I5LB 1RWYA 1SW8A 2KNEA 3QMEA 3KHEA 5HKWA 2PALA 1TCOB 1NX3A 2LVIA 3AKBA 3RZSA 2BNXA 3O4XA 1GJYA 1S6JA 1JBAA 1NPQA 2LNKA 1B9AA 1CFCA 2M0RA 2KI4C 3DVEA 2ZN9A 2ZRTA 3PM8A 2KOTA 2JWWA 1K9PA 2LHLA 2BL0B 1BG1A 1OMVA 2JXCA 3VGOA 2LMTA 4INXA 4PDZA 1D1OA 1H8BA 1DGUA 1Y1UA 2P70A 2JNXA 4WQ2A 1NCXA 3V2LA 1E8AA 3DF0A 4C0JA 5EL2A 4MBEA 2K7DA 2AUCA 1CDMA 1AVSA 1MQ1A 4PHKA 3O6BA 1XFRA 4MLWA 3CR5X 2RGIA 3OB2B 3S0EA 4NDDA 4DCKA 2H2KA 1F4QA 1FF1A 2JRFA 1YVLA 4OV2A 2L51A 3LLEA 1XK4A 2I18A 3R1OA 1N0YA 1N65A 3WHTB 1TNQA 1WY9A 1SKTA 3I5HB 5ER4X 3S0AA 3TUYC 2VRGA 4MEWA 1KQMC 3BUNB 4YI9A 2I94A 1S6CA 3FE9A 2K8MB 3O78A 1FI5A 2BECA 3B88A 1TUZA 5AXIA 1EH2A 4GGFA 1ZOTB 2K0JA 1B8CA 2MA2A 3LK0A 2PASA 4MN0A 1DMOA 3PALA 2KQYA 1MF8B 4MZJA 2F3ZA 4A4CA 1UUSA 2JT0A 3D10A 1B7TY 2Q91A 3GK2A 3BOWA 2F2OA 3FWCA 1LVCD 1KWOC 4D1EA 1LA3A 1SCMC 2ZKMX 5J3XA 2CTNA 3SJSA 3VRPA 1F8HA 2BKHB 1PSRA 1SL7A 1DVIA 2L2CA 5AEQA 1TIZA 1F54A 1OZSA 1X02A 2JPTA 2KI4B 2M1KB 2R2IA 4HRGA 1JFKA 3D0YA 1OOGA 4IL1A 3WXAA 4PE4A 1Y1AA 1UHIA 1VRKA 4FQOA 5HLVA 3SS3A 1BR1B 1MXLC 1YRUB 2KDHA 2LHIA 2MRDA 4I5NB 4MRYA 4OZDA 1B47A 1CLMA 3LCPC 3O4YA 4OVNF 2F33A 4YGDB 1SY9A 3BUMB 3DZTA 3CS1A 1H4BA 2K7BA 1KK8B 4JD9A 1QXPA 1YX8A 1WRZA 3CABA 4L9MA 4MZLA 3F45A 3D76A 4XYNA 1YTZC 1CFPA 1EXRA 2EGDA 2QDIA 4N1GA 3CLNA 3FIAA 1AHRA 1B1GA 1XYDA 1IGVA 1AK8A 2QACA 3KF9A 1AJ5A 3LL8B 3MSEB 2JULA 5FI6A 2LP3A 2GGZA 5I2OA 3FWBA 1QASA 2LUXA 3OX6A 1NX2A 1NCZA 1KK7Z 1QV1A 2KI6D 3DYEA 1KQMB 3BFAA 4NDCA 1J1EA 1XFYO 5CSFA 1A29A 1EG3A 1QTXA 1SPYA 2LLUA 5ER5A 3TS5B 2LMVA 1J7PA 1QWVA 1OW4A 2JC2A 3DVJA 2L2EA 1BU3A 2P71A 3DF0B 3EK4A 2Y1MA 3PJIA 3PM2A 2WCKA 4OKHA 2OTGB 1OMRA 3HX4A 4I5JA 4MRXA 1KFXS 3JVTB 1SR6B 1EL4A 4USLA 2KYFA 1YVHA 1C7VA 4ORAB 4QJ3B 3L4AA 1JSAA 1SCMB 2BKIB 3EK7A 3SG7A 3EK8A 1LINA 1K9UA 1SMGA 2HETA 2Y1NA 1DF0B 1ORGA 1SL9A 3I5GC 1IIOA 1SR6C 2K61A 1M46A 4YGBB 1DJYA 5D3OA 1U5IB 2K7CA 3CGAA 1MUXA 1EJ3A 1OOHA 2O60A 2LLSA 4QJ5B 4GBAA 5KTYA 3CZTX 3VRQA 2KGBC 3CWGA 1JC2A 2NZ0A 3EVUA 4P5OE 1YURA 3OBVA 2PSRA 3BQ3A 3GOFA 4DUQA 1YUUA 1B8RA 2NCOA 2ISDA 3JVTC 1GGZA 3NHTA 1C7WA 2I2RE 2QEVA 1RECA 2MHHA 5HLOA 1K90D 1K94A 3IQOA 1FW4A 1IJ5A 3JTDC 3B87A 3AAKA 4CFRA 2FOTA 1KK7Y 1CM4A 2LCPA 1CFDA 3ZWHA 2JXLA 5BPJA 1R2UA 1OMDA 2BE4A 2ZNDA 5FI2A 2KFHA 3B6XA 2MJWB 1TTXA 3N7HA 1UHNA 4E68A 5I2QA 1W9ZA 2BCBA 2CBLA 3BXKA 5B8IB 1N2DA 1K93D 1NP8A 1MR8A 1QVIY 2WC6A 2WORA 1ALWA 1JF0A 3EVVA 1TNXA 1OOIX 3DY9A 2M3WA 5DICA 2KLEA 3I5HC 1Q80A 1L2OB 3B7AA 1TRFA 2M7LA 3S0BA 3CZ0A 3TDIA 1LKJA 5IBWA 3D75A 3CZ2A 2M97A 1CFFA 1DQEA 3BUOB 4GPLB 1FPWA 1MWNA 1A4PA 1PULA 1YX7A 4A4BA 1TWOA 1ZUZA 4N5XA 4M2OA 1L7ZA 2OPOA 2KBMA 1CDNA 1DELA 2L5XB 1S6IA 4M2PA 3FE6A 3D0YB 1PVBA 1JF2A 4JKTA 2V53A 4ZCUA 2KBIA 2Q4UA 4INWA 1NUBA 1IJ6A 1WRLA 2B1UA 2LMUA 1WDCC 2BBMA 3DD4A 5HYDA 2GGMA 2ZRSA 1KSOA 4UPGA 1M63B 4N1FA 5D7FA 4TNCA 2HPSA 4OCIA 4MVFA 1DJGA 1DJHA 2BAPA 1KSMA 1QX7A 3A4UB 1BOCA 1CB1A 4R1EA 3BUXB 3PATA 4JPZB 1KK8C 3RM1A 3HCMA 2HF5A 3BFBA 2K2FA 2ZN8A 2K2AA 2QEOA 2JT8A 2AAOA 2KAYA 4CPVA 1T14A 3C1VA 1K9KA 2ERBA 5CPVA 1DTLA 1XFVO 1Y1XA 5TNCA 1PK0D 1ZFSA 4CIDA 1PALA 3I5GB 2PVBA 1UURA 2LVKA 1M31A 4CFQA 2WC8A 1BJFA 1NIWA 2LC5A 3Q8IA 2QEHA 1GM0A 4Q04A 2M8UA 1ZMZA 3PFVA 1BT6A 1QIVA 2M7NA 1W7JB 1F71A 2WCFA 5AERA 1TUJA 1V1GA 2WNDA 1LA0A 1LS8A 5JOLA 2LLTA 3KEVA 1OE9B 1IKUA 4OR9B 1BLQA 3NGVA 4YBHB 2WCJA 3EVRA 4GAOA 2CT9A 1TNPA 2M1UA 1RK9A 3GK1A 1B7TZ 5CSJA 3RLZA 2BL0C 1CTRA 2F3YA 3BYAA 2PYQA 2GV5A 1DC1A 2G9BA 2SCPA 4C0KA 4DIRA 2KAXA 1YUTA 1RJVA 1J7QA 1K95A 1IRJA 2KQ6A 4CLNA 3I5FC 3SS5A 3ZNIA 2JTTA 1S5GZ 5I2LA 2TN4A 4NQGA 1BODA 1EG4A 4BY4A 4HSZA 1S26D 1OQPA 2H61C 2WCHA 4YI8A 1BF5A 1AJ4A 3S0GA 1XO5A 5GQQC 1A75A 2PMYA 3DVKA 1XFWO 4YGAA 5K89A 1PRWA 2L0PA 1DEKA 1JUOA 1NWDA 2HQWA 3AAJA 3UO9A 2EC6B 4PALA 4MZKA 1GQMA 1KCYA 3K1EA 4YRUA 2WCLA 3I5IC 3NXAA 4ZCVA 1A75B 1WDCB 1W7IB 2QPTA 3NSLA 3OB1B 2QEBA 1CLBA 1L2OC 4P2YB 5FYXA 1QJTA 4XJKB 4PHMA 3CYZA 3IQQA 1UHJA 2KPHA 2WCMA 2Y4QA 4NDBA 1MXEA 5AANA 3VRNA 2JPOA 1FI6A 4IJ7A 3PSRA 1F4OA 1IQ5A 1C3YA 2G2BA 1CMFA 2OS8C 3R1PA 2WC5A 2ZFDA 1IQ3A 5KU1A 2AMIA 2FCEA 2LVJA 4GNKB 1S1EA 1HQVA 2JOJA 1IWQA 3DVMA 1J7OA 1YUSA 1KWOB 2E30A 3L4LA 4BY5A 3JTDB 3CTNA 2M9GA 3NHIA 1UHKA 3CR4X 2MAZA 1GGWA 1CDLA 1G4YR 2BE6A 2H8VA 2M49B 3S0DA 3UNWA 5DKRA 1P28A 2BCAA 2D8NA 2LUCA 1WRKA 1DGVA 2CNPA 2OTGC 5HKZA 1A03A 4MSPA 1J7RA 1XFXO 2LAPA 1HT9A 4GFTA 2HQ8A 2LVVA 3WNXB 1RTP1 5I94A 4HREE 5CSNA 1QX2A 3OX5A 3WHUB 2COLB 3L47A 2ZNEA 1Y0VH 1DJIA 2CXJA 4PE1A 3SG5A 1KQVA 1ODBA 3KPXA 2LV7A 2F8PA 3NSOA 1IH0A 1A2XA 1TOPA 2FJYA 3OGNA 1AUIB 4HRHA 1R6PA 3I5IB 1UP5A 4FTGA 2DOQA 3D77A 1DJXA 1K8UA 2KFFA 2SASA 1XA5A 4GGNA 4ICBA 3TDUA 3S0FA 1QLSA 1NX0A 3BUWB 1Z2CB 4KYNA 3D74A 1RFJA 1SYMA 2KLDA 3E3RA 2FCDA 2JQ6A 2MBXA 4AQIA 1NYAA 1JWDA 1QVIZ 3IF7A 1YR5A 5HKYA 1SBJA 2PRUA 3CZ1A 5JJGA 3QRXA 4AQJA 1UHHA 4U8DA 2BCXA 1DJZA 1QLKA 4PHJA 3K21A 1CNPA 2KAVA 3I5FB 1B4CA 2KYCA 3TUYB 4DS7A 1XFUO 1F70A 1BR4B 1KFXL 1OOJA 2LP2A 4C0LA 1WLZA 1XVJA 2P6BB 2JU0A 3EKJA 3FS7A 2LE9B 4F0ZB 5AFPA 1NSHA 1ALVA 2FJUB 4DRWA 1CLLA 2BBNA 1XK4C 3NSIA 4PT1A 3AKAA 3TZ1A 4M2QA 3A8RA 3B86A 2LANA 3IVTA 1B8LA 4ORCB 5FI7A 3TDZA 2A4JA 1QX5B 2Y5IA 1PVAA 3GK4X 4JQ0D 3PLFB 2JT3A 1SCVA 5DKQA 2KI6C 2MLEC 2YGUA 4XJKA 1SRAA 4F7FA 4GUKA 5DKNA 1SL8A 3TS5C 1RROA 1QS7A 1UWOA 4I5KA 5PALA 1KFUL 2NXQA 2NCPA 1Y6WA 1ZACA 1MHOA 2CCMA 3BOWB 3D73A 1SSEB 1BMOA 1S36A 3OP0A 1V1FA 3SS4A 1XFZO 3FE8A 2WCEA 3KO0A 3SIAA 1TNWA 4PHNA 1M39A 3NSKA 2L50A 1SNLA 2I7AA 3CR2A 1G8IA 3LK1A 1DT7B 1M45A 1IG5A 2PQLA 2L5YA 2NLNA 5KSZA 4GGFC 2JNFA 2OS8B 3CDNA 4QJ4B 1SK6D 3D78A 3ICBA 2EC6C 1K96A 1OOFA 3R1VA 2MLFC 2JTZA 5HL1A 4PE0A 1DJWA 1NCYA 1QIWA 1J55A 2L4IA 3PN7B 4FQTA 1DF0A 3VRRA 4ETOA 1Z4HA 4JWQA 1OZOA 2E6WA 1CKKA 2H61A 3O2PA 3BFHA 1JFJA 1U5IA 1C07A 1J1DA 1S3PA 1KFUS 3DXLA 1QATA 1TCFA 1QV0A 2GTEA 1CM1A 2LM5A 3R72A 4AOMA 1C3ZA 2O5GA 5G08A 3BJHA 2KHNA 4PCWA 1YRTB 1TN4A 1AP4A 1FBVA 3SG6A 2IS9A 2KSPA 2EHBA 2KGRA 3VB1A 2M29A
chains in the Genus database with same CATH topology
1G33A 3OHMB 1PSBA 3M0WA 2WOSA 1K2HA 3H4SE 3SG4A 2L4HA 3EKHA 2F2PA 1CDPA 5D69A 3SG2A 5I8NA 1CMGA 1LXFC 1NX1A 1OSAA 1S5GY 2KFGA 3SIBA 2WCBA 3SG3A 1F55A 4PE7A 4WQ3A 4WRIA 5CSIA 5F6TA 3PN7C 3VROA 1WLMA 2L98A 4YGCB 4YGEB 2JZIA 2K7OA 4ORBB 4I5LB 1RWYA 1SW8A 2KNEA 3KHEA 5HKWA 2PALA 1TCOB 1NX3A 2LVIA 3AKBA 1GJYA 1S6JA 1JBAA 1NPQA 2LNKA 1B9AA 1CFCA 2M0RA 2KI4C 3DVEA 2ZN9A 2ZRTA 3PM8A 2KOTA 2JWWA 1K9PA 2LHLA 2BL0B 1BG1A 1OMVA 2JXCA 3VGOA 2LMTA 4PDZA 1D1OA 1H8BA 1DGUA 1Y1UA 4WQ2A 2JNXA 1NCXA 4C0JA 1E8AA 3DF0A 4MBEA 2K7DA 2AUCA 1CDMA 1AVSA 1MQ1A 4PHKA 3O6BA 4MLWA 3CR5X 2RGIA 3OB2B 4NDDA 4DCKA 2H2KA 1F4QA 1FF1A 2JRFA 1YVLA 4OV2A 2L51A 3LLEA 1XK4A 2I18A 1N0YA 1N65A 3WHTB 1TNQA 1WY9A 1SKTA 3I5HB 5ER4X 3TUYC 2VRGA 4MEWA 1KQMC 3BUNB 4YI9A 2I94A 1S6CA 2K8MB 3O78A 1FI5A 2BECA 1EH2A 4GGFA 1ZOTB 2K0JA 1B8CA 2MA2A 3LK0A 2PASA 4MN0A 1DMOA 3PALA 2KQYA 1MF8B 4MZJA 2F3ZA 4A4CA 1UUSA 2JT0A 3D10A 1B7TY 2Q91A 3GK2A 3BOWA 2F2OA 3FWCA 1LVCD 1KWOC 4D1EA 1LA3A 1SCMC 2ZKMX 5J3XA 2CTNA 3SJSA 3VRPA 1F8HA 2BKHB 1PSRA 1SL7A 1DVIA 5AEQA 1TIZA 1F54A 1OZSA 1X02A 2JPTA 2KI4B 2M1KB 2R2IA 4HRGA 1JFKA 3D0YA 3WXAA 4IL1A 4PE4A 1Y1AA 1UHIA 1VRKA 4FQOA 5HLVA 1BR1B 1MXLC 1YRUB 2KDHA 2LHIA 2MRDA 4I5NB 4MRYA 1B47A 1CLMA 3LCPC 3O4YA 4OVNF 2F33A 4YGDB 1SY9A 3BUMB 3CS1A 1H4BA 2K7BA 1KK8B 1QXPA 1YX8A 1WRZA 4L9MA 4MZLA 3F45A 4XYNA 1YTZC 1CFPA 1EXRA 2EGDA 4N1GA 3CLNA 3FIAA 1AHRA 1B1GA 1XYDA 1IGVA 1AK8A 2QACA 3KF9A 1AJ5A 3LL8B 3MSEB 2JULA 2LP3A 2GGZA 5I2OA 3FWBA 1QASA 2LUXA 3OX6A 1NX2A 1NCZA 1KK7Z 1QV1A 2KI6D 4NDCA 1KQMB 5CSFA 1J1EA 1XFYO 1A29A 1EG3A 1QTXA 1SPYA 2LLUA 5ER5A 3TS5B 2LMVA 1J7PA 2JC2A 3DVJA 2L2EA 1BU3A 3DF0B 3EK4A 2Y1MA 4OKHA 2OTGB 1OMRA 3HX4A 4I5JA 4MRXA 1KFXS 3JVTB 1SR6B 1EL4A 4USLA 2KYFA 1YVHA 1C7VA 4ORAB 4QJ3B 1JSAA 1SCMB 2BKIB 3EK7A 3SG7A 3EK8A 1LINA 1K9UA 1SMGA 2HETA 2Y1NA 1DF0B 1SL9A 3I5GC 1SR6C 2K61A 1M46A 4YGBB 1DJYA 1U5IB 2K7CA 3CGAA 1MUXA 1EJ3A 2O60A 2LLSA 4QJ5B 4GBAA 5KTYA 3CZTX 3VRQA 2KGBC 3CWGA 1JC2A 2NZ0A 3EVUA 4P5OE 1YURA 2PSRA 3BQ3A 3GOFA 4DUQA 1YUUA 1B8RA 2NCOA 2ISDA 3JVTC 1GGZA 5HLOA 1C7WA 2I2RE 1RECA 2MHHA 1K90D 1K94A 3IQOA 1FW4A 1IJ5A 3JTDC 3AAKA 4CFRA 2FOTA 1KK7Y 1CM4A 2LCPA 1CFDA 3ZWHA 2JXLA 5BPJA 1R2UA 1OMDA 2BE4A 2ZNDA 2KFHA 2MJWB 1TTXA 4E68A 1UHNA 5I2QA 2BCBA 2CBLA 3BXKA 5B8IB 1N2DA 1K93D 1NP8A 1MR8A 1QVIY 2WORA 1ALWA 1JF0A 3EVVA 1TNXA 5AXIA 2M3WA 3I5HC 2M7LA 1Q80A 1L2OB 1TRFA 3TDIA 1LKJA 5IBWA 2M97A 1CFFA 3BUOB 4GPLB 1FPWA 1MWNA 1A4PA 1PULA 1YX7A 4A4BA 1ZUZA 4N5XA 4M2OA 1L7ZA 2OPOA 2KBMA 1CDNA 2L5XB 1S6IA 4M2PA 3D0YB 1PVBA 1JF2A 2V53A 4ZCUA 2KBIA 2Q4UA 1NUBA 1IJ6A 1WRLA 2B1UA 2LMUA 1WDCC 2BBMA 3DD4A 5HYDA 2GGMA 2ZRSA 1KSOA 4UPGA 1M63B 4N1FA 5D7FA 4TNCA 2HPSA 4OCIA 4MVFA 1DJGA 1DJHA 1KSMA 1QX7A 3A4UB 1BOCA 1CB1A 4R1EA 3BUXB 3PATA 4JPZB 1KK8C 3RM1A 3HCMA 2HF5A 2K2FA 2ZN8A 2K2AA 2JT8A 2AAOA 2KAYA 4CPVA 3C1VA 1K9KA 5CPVA 1DTLA 1XFVO 1Y1XA 5TNCA 1PK0D 1ZFSA 4CIDA 1PALA 3I5GB 2PVBA 1UURA 2LVKA 1M31A 4CFQA 2WC8A 1BJFA 1NIWA 2LC5A 4Q04A 2M8UA 1ZMZA 3PFVA 1BT6A 1QIVA 2M7NA 1W7JB 1F71A 2WCFA 5AERA 2WNDA 1V1GA 1LA0A 5JOLA 2LLTA 3KEVA 1OE9B 1IKUA 4OR9B 1BLQA 4YBHB 3EVRA 4GAOA 2CT9A 1TNPA 2M1UA 1RK9A 3GK1A 1B7TZ 5CSJA 3RLZA 2BL0C 1CTRA 2F3YA 3BYAA 2GV5A 2G9BA 2SCPA 4C0KA 4DIRA 2KAXA 1YUTA 1RJVA 1J7QA 1K95A 1IRJA 2KQ6A 4CLNA 3I5FC 3ZNIA 2JTTA 1S5GZ 5I2LA 2TN4A 4NQGA 1BODA 1EG4A 4BY4A 4HSZA 1S26D 1OQPA 2H61C 4YI8A 1BF5A 1AJ4A 1XO5A 5GQQC 1A75A 2PMYA 3DVKA 1XFWO 4YGAA 5K89A 1PRWA 2L0PA 1NWDA 2HQWA 1JUOA 3AAJA 2EC6B 4PALA 4MZKA 1GQMA 1KCYA 4YRUA 3I5IC 3NXAA 4ZCVA 1A75B 1WDCB 1W7IB 2QPTA 3NSLA 3OB1B 1CLBA 1L2OC 4P2YB 5FYXA 1QJTA 4XJKB 4PHMA 3IQQA 1UHJA 4NDBA 2Y4QA 5AANA 1MXEA 3VRNA 1FI6A 3PSRA 1F4OA 1IQ5A 2G2BA 1CMFA 2OS8C 2ZFDA 1IQ3A 5KU1A 2AMIA 2FCEA 2LVJA 4GNKB 1S1EA 1HQVA 2JOJA 1IWQA 3DVMA 1J7OA 1YUSA 1KWOB 2E30A 4BY5A 3JTDB 3CTNA 2M9GA 1UHKA 3CR4X 2MAZA 1GGWA 1CDLA 1G4YR 2BE6A 2M49B 5DKRA 2BCAA 2D8NA 2LUCA 1WRKA 1DGVA 2CNPA 2OTGC 5HKZA 1A03A 4MSPA 1J7RA 1XFXO 2LAPA 1HT9A 4GFTA 2HQ8A 2LVVA 3WNXB 1RTP1 4HREE 5CSNA 1QX2A 3OX5A 3WHUB 2COLB 2ZNEA 1Y0VH 1DJIA 2CXJA 4PE1A 3SG5A 1KQVA 1ODBA 3KPXA 2LV7A 2F8PA 3NSOA 1IH0A 1A2XA 1TOPA 1AUIB 4HRHA 1R6PA 3I5IB 1UP5A 4FTGA 2DOQA 1DJXA 1K8UA 2KFFA 2SASA 1XA5A 4GGNA 4ICBA 3TDUA 1QLSA 1NX0A 3BUWB 2MBXA 1RFJA 1SYMA 3E3RA 2FCDA 2JQ6A 4AQIA 1JWDA 1NYAA 1QVIZ 3IF7A 1YR5A 5HKYA 1SBJA 2PRUA 5JJGA 3QRXA 4AQJA 1UHHA 4U8DA 2BCXA 1DJZA 1QLKA 4PHJA 3K21A 1CNPA 2KAVA 3I5FB 1B4CA 2KYCA 3TUYB 4DS7A 1XFUO 1F70A 1BR4B 1KFXL 1OOJA 2LP2A 4C0LA 1WLZA 1XVJA 2P6BB 2JU0A 3EKJA 3FS7A 2LE9B 4F0ZB 5AFPA 1NSHA 1ALVA 2FJUB 4DRWA 1CLLA 2BBNA 1XK4C 3NSIA 3AKAA 3TZ1A 4M2QA 3A8RA 4ORCB 2LANA 3TDZA 1B8LA 2A4JA 1QX5B 2Y5IA 1PVAA 3GK4X 4JQ0D 3PLFB 2JT3A 1SCVA 5DKQA 2KI6C 2MLEC 4XJKA 1SRAA 4GUKA 5DKNA 1SL8A 3TS5C 1RROA 1QS7A 1UWOA 4I5KA 5PALA 1KFUL 2NXQA 2NCPA 1Y6WA 1ZACA 1MHOA 2CCMA 3BOWB 1BMOA 1S36A 3OP0A 1V1FA 1XFZO 2WCEA 3KO0A 3SIAA 1TNWA 4PHNA 1M39A 3NSKA 2L50A 1SNLA 2I7AA 3CR2A 1G8IA 3LK1A 1DT7B 1M45A 1IG5A 2NLNA 5KSZA 4GGFC 2JNFA 2OS8B 4QJ4B 1SK6D 3ICBA 2EC6C 1K96A 2MLFC 2JTZA 4PE0A 1DJWA 1NCYA 1QIWA 1J55A 2L4IA 3PN7B 1DF0A 3VRRA 4ETOA 4JWQA 1OZOA 2E6WA 1CKKA 2H61A 3O2PA 1JFJA 1U5IA 1C07A 1J1DA 1S3PA 1KFUS 1QATA 1TCFA 1QV0A 1CM1A 2LM5A 4AOMA 2O5GA 5G08A 2KHNA 4PCWA 1YRTB 1TN4A 1AP4A 1FBVA 3SG6A 2IS9A 2KSPA 2EHBA 2KGRA 2M29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G33 A;  3OHM B;  1PSB A;  3M0W A;  2WOS A;  1K2H A;  3H4S E;  3SG4 A;  2L4H A;  3EKH A;  2F2P A;  1CDP A;  5D69 A;  3SG2 A;  5I8N A;  1CMG A;  1LXF C;  1NX1 A;  1OSA A;  1S5G Y;  2KFG A;  3SIB A;  2WCB A;  3SG3 A;  1F55 A;  4PE7 A;  4WQ3 A;  4WRI A;  5CSI A;  5F6T A;  3PN7 C;  3VRO A;  1WLM A;  2L98 A;  4YGC B;  4YGE B;  2JZI A;  2K7O A;  4ORB B;  4I5L B;  1RWY A;  1SW8 A;  2KNE A;  3KHE A;  5HKW A;  2PAL A;  1TCO B;  1NX3 A;  2LVI A;  3AKB A;  1GJY A;  1S6J A;  1JBA A;  1NPQ A;  2LNK A;  1B9A A;  1CFC A;  2M0R A;  2KI4 C;  3DVE A;  2ZN9 A;  2ZRT A;  3PM8 A;  2KOT A;  2JWW A;  1K9P A;  2LHL A;  2BL0 B;  1BG1 A;  1OMV A;  2JXC A;  3VGO A;  2LMT A;  4PDZ A;  1D1O A;  1H8B A;  1DGU A;  1Y1U A;  4WQ2 A;  2JNX A;  1NCX A;  4C0J A;  1E8A A;  3DF0 A;  4MBE A;  2K7D A;  2AUC A;  1CDM A;  1AVS A;  1MQ1 A;  4PHK A;  3O6B A;  4MLW A;  3CR5 X;  2RGI A;  3OB2 B;  4NDD A;  4DCK A;  2H2K A;  1F4Q A;  1FF1 A;  2JRF A;  1YVL A;  4OV2 A;  2L51 A;  3LLE A;  1XK4 A;  2I18 A;  1N0Y A;  1N65 A;  3WHT B;  1TNQ A;  1WY9 A;  1SKT A;  3I5H B;  5ER4 X;  3TUY C;  2VRG A;  4MEW A;  1KQM C;  3BUN B;  4YI9 A;  2I94 A;  1S6C A;  2K8M B;  3O78 A;  1FI5 A;  2BEC A;  1EH2 A;  4GGF A;  1ZOT B;  2K0J A;  1B8C A;  2MA2 A;  3LK0 A;  2PAS A;  4MN0 A;  1DMO A;  3PAL A;  2KQY A;  1MF8 B;  4MZJ A;  2F3Z A;  4A4C A;  1UUS A;  2JT0 A;  3D10 A;  1B7T Y;  2Q91 A;  3GK2 A;  3BOW A;  2F2O A;  3FWC A;  1LVC D;  1KWO C;  4D1E A;  1LA3 A;  1SCM C;  2ZKM X;  5J3X A;  2CTN A;  3SJS A;  3VRP A;  1F8H A;  2BKH B;  1PSR A;  1SL7 A;  1DVI A;  5AEQ A;  1TIZ A;  1F54 A;  1OZS A;  1X02 A;  2JPT A;  2KI4 B;  2M1K B;  2R2I A;  4HRG A;  1JFK A;  3D0Y A;  3WXA A;  4IL1 A;  4PE4 A;  1Y1A A;  1UHI A;  1VRK A;  4FQO A;  5HLV A;  1BR1 B;  1MXL C;  1YRU B;  2KDH A;  2LHI A;  2MRD A;  4I5N B;  4MRY A;  1B47 A;  1CLM A;  3LCP C;  3O4Y A;  4OVN F;  2F33 A;  4YGD B;  1SY9 A;  3BUM B;  3CS1 A;  1H4B A;  2K7B A;  1KK8 B;  1QXP A;  1YX8 A;  1WRZ A;  4L9M A;  4MZL A;  3F45 A;  4XYN A;  1YTZ C;  1CFP A;  1EXR A;  2EGD A;  4N1G A;  3CLN A;  3FIA A;  1AHR A;  1B1G A;  1XYD A;  1IGV A;  1AK8 A;  2QAC A;  3KF9 A;  1AJ5 A;  3LL8 B;  3MSE B;  2JUL A;  2LP3 A;  2GGZ A;  5I2O A;  3FWB A;  1QAS A;  2LUX A;  3OX6 A;  1NX2 A;  1NCZ A;  1KK7 Z;  1QV1 A;  2KI6 D;  4NDC A;  1KQM B;  5CSF A;  1J1E A;  1XFY O;  1A29 A;  1EG3 A;  1QTX A;  1SPY A;  2LLU A;  5ER5 A;  3TS5 B;  2LMV A;  1J7P A;  2JC2 A;  3DVJ A;  2L2E A;  1BU3 A;  3DF0 B;  3EK4 A;  2Y1M A;  4OKH A;  2OTG B;  1OMR A;  3HX4 A;  4I5J A;  4MRX A;  1KFX S;  3JVT B;  1SR6 B;  1EL4 A;  4USL A;  2KYF A;  1YVH A;  1C7V A;  4ORA B;  4QJ3 B;  1JSA A;  1SCM B;  2BKI B;  3EK7 A;  3SG7 A;  3EK8 A;  1LIN A;  1K9U A;  1SMG A;  2HET A;  2Y1N A;  1DF0 B;  1SL9 A;  3I5G C;  1SR6 C;  2K61 A;  1M46 A;  4YGB B;  1DJY A;  1U5I B;  2K7C A;  3CGA A;  1MUX A;  1EJ3 A;  2O60 A;  2LLS A;  4QJ5 B;  4GBA A;  5KTY A;  3CZT X;  3VRQ A;  2KGB C;  3CWG A;  1JC2 A;  2NZ0 A;  3EVU A;  4P5O E;  1YUR A;  2PSR A;  3BQ3 A;  3GOF A;  4DUQ A;  1YUU A;  1B8R A;  2NCO A;  2ISD A;  3JVT C;  1GGZ A;  5HLO A;  1C7W A;  2I2R E;  1REC A;  2MHH A;  1K90 D;  1K94 A;  3IQO A;  1FW4 A;  1IJ5 A;  3JTD C;  3AAK A;  4CFR A;  2FOT A;  1KK7 Y;  1CM4 A;  2LCP A;  1CFD A;  3ZWH A;  2JXL A;  5BPJ A;  1R2U A;  1OMD A;  2BE4 A;  2ZND A;  2KFH A;  2MJW B;  1TTX A;  4E68 A;  1UHN A;  5I2Q A;  2BCB A;  2CBL A;  3BXK A;  5B8I B;  1N2D A;  1K93 D;  1NP8 A;  1MR8 A;  1QVI Y;  2WOR A;  1ALW A;  1JF0 A;  3EVV A;  1TNX A;  5AXI A;  2M3W A;  3I5H C;  2M7L A;  1Q80 A;  1L2O B;  1TRF A;  3TDI A;  1LKJ A;  5IBW A;  2M97 A;  1CFF A;  3BUO B;  4GPL B;  1FPW A;  1MWN A;  1A4P A;  1PUL A;  1YX7 A;  4A4B A;  1ZUZ A;  4N5X A;  4M2O A;  1L7Z A;  2OPO A;  2KBM A;  1CDN A;  2L5X B;  1S6I A;  4M2P A;  3D0Y B;  1PVB A;  1JF2 A;  2V53 A;  4ZCU A;  2KBI A;  2Q4U A;  1NUB A;  1IJ6 A;  1WRL A;  2B1U A;  2LMU A;  1WDC C;  2BBM A;  3DD4 A;  5HYD A;  2GGM A;  2ZRS A;  1KSO A;  4UPG A;  1M63 B;  4N1F A;  5D7F A;  4TNC A;  2HPS A;  4OCI A;  4MVF A;  1DJG A;  1DJH A;  1KSM A;  1QX7 A;  3A4U B;  1BOC A;  1CB1 A;  4R1E A;  3BUX B;  3PAT A;  4JPZ B;  1KK8 C;  3RM1 A;  3HCM A;  2HF5 A;  2K2F A;  2ZN8 A;  2K2A A;  2JT8 A;  2AAO A;  2KAY A;  4CPV A;  3C1V A;  1K9K A;  5CPV A;  1DTL A;  1XFV O;  1Y1X A;  5TNC A;  1PK0 D;  1ZFS A;  4CID A;  1PAL A;  3I5G B;  2PVB A;  1UUR A;  2LVK A;  1M31 A;  4CFQ A;  2WC8 A;  1BJF A;  1NIW A;  2LC5 A;  4Q04 A;  2M8U A;  1ZMZ A;  3PFV A;  1BT6 A;  1QIV A;  2M7N A;  1W7J B;  1F71 A;  2WCF A;  5AER A;  2WND A;  1V1G A;  1LA0 A;  5JOL A;  2LLT A;  3KEV A;  1OE9 B;  1IKU A;  4OR9 B;  1BLQ A;  4YBH B;  3EVR A;  4GAO A;  2CT9 A;  1TNP A;  2M1U A;  1RK9 A;  3GK1 A;  1B7T Z;  5CSJ A;  3RLZ A;  2BL0 C;  1CTR A;  2F3Y A;  3BYA A;  2GV5 A;  2G9B A;  2SCP A;  4C0K A;  4DIR A;  2KAX A;  1YUT A;  1RJV A;  1J7Q A;  1K95 A;  1IRJ A;  2KQ6 A;  4CLN A;  3I5F C;  3ZNI A;  2JTT A;  1S5G Z;  5I2L A;  2TN4 A;  4NQG A;  1BOD A;  1EG4 A;  4BY4 A;  4HSZ A;  1S26 D;  1OQP A;  2H61 C;  4YI8 A;  1BF5 A;  1AJ4 A;  1XO5 A;  5GQQ C;  1A75 A;  2PMY A;  3DVK A;  1XFW O;  4YGA A;  5K89 A;  1PRW A;  2L0P A;  1NWD A;  2HQW A;  1JUO A;  3AAJ A;  2EC6 B;  4PAL A;  4MZK A;  1GQM A;  1KCY A;  4YRU A;  3I5I C;  3NXA A;  4ZCV A;  1A75 B;  1WDC B;  1W7I B;  2QPT A;  3NSL A;  3OB1 B;  1CLB A;  1L2O C;  4P2Y B;  5FYX A;  1QJT A;  4XJK B;  4PHM A;  3IQQ A;  1UHJ A;  4NDB A;  2Y4Q A;  5AAN A;  1MXE A;  3VRN A;  1FI6 A;  3PSR A;  1F4O A;  1IQ5 A;  2G2B A;  1CMF A;  2OS8 C;  2ZFD A;  1IQ3 A;  5KU1 A;  2AMI A;  2FCE A;  2LVJ A;  4GNK B;  1S1E A;  1HQV A;  2JOJ A;  1IWQ A;  3DVM A;  1J7O A;  1YUS A;  1KWO B;  2E30 A;  4BY5 A;  3JTD B;  3CTN A;  2M9G A;  1UHK A;  3CR4 X;  2MAZ A;  1GGW A;  1CDL A;  1G4Y R;  2BE6 A;  2M49 B;  5DKR A;  2BCA A;  2D8N A;  2LUC A;  1WRK A;  1DGV A;  2CNP A;  2OTG C;  5HKZ A;  1A03 A;  4MSP A;  1J7R A;  1XFX O;  2LAP A;  1HT9 A;  4GFT A;  2HQ8 A;  2LVV A;  3WNX B;  1RTP 1;  4HRE E;  5CSN A;  1QX2 A;  3OX5 A;  3WHU B;  2COL B;  2ZNE A;  1Y0V H;  1DJI A;  2CXJ A;  4PE1 A;  3SG5 A;  1KQV A;  1ODB A;  3KPX A;  2LV7 A;  2F8P A;  3NSO A;  1IH0 A;  1A2X A;  1TOP A;  1AUI B;  4HRH A;  1R6P A;  3I5I B;  1UP5 A;  4FTG A;  2DOQ A;  1DJX A;  1K8U A;  2KFF A;  2SAS A;  1XA5 A;  4GGN A;  4ICB A;  3TDU A;  1QLS A;  1NX0 A;  3BUW B;  2MBX A;  1RFJ A;  1SYM A;  3E3R A;  2FCD A;  2JQ6 A;  4AQI A;  1JWD A;  1NYA A;  1QVI Z;  3IF7 A;  1YR5 A;  5HKY A;  1SBJ A;  2PRU A;  5JJG A;  3QRX A;  4AQJ A;  1UHH A;  4U8D A;  2BCX A;  1DJZ A;  1QLK A;  4PHJ A;  3K21 A;  1CNP A;  2KAV A;  3I5F B;  1B4C A;  2KYC A;  3TUY B;  4DS7 A;  1XFU O;  1F70 A;  1BR4 B;  1KFX L;  1OOJ A;  2LP2 A;  4C0L A;  1WLZ A;  1XVJ A;  2P6B B;  2JU0 A;  3EKJ A;  3FS7 A;  2LE9 B;  4F0Z B;  5AFP A;  1NSH A;  1ALV A;  2FJU B;  4DRW A;  1CLL A;  2BBN A;  1XK4 C;  3NSI A;  3AKA A;  3TZ1 A;  4M2Q A;  3A8R A;  4ORC B;  2LAN A;  3TDZ A;  1B8L A;  2A4J A;  1QX5 B;  2Y5I A;  1PVA A;  3GK4 X;  4JQ0 D;  3PLF B;  2JT3 A;  1SCV A;  5DKQ A;  2KI6 C;  2MLE C;  4XJK A;  1SRA A;  4GUK A;  5DKN A;  1SL8 A;  3TS5 C;  1RRO A;  1QS7 A;  1UWO A;  4I5K A;  5PAL A;  1KFU L;  2NXQ A;  2NCP A;  1Y6W A;  1ZAC A;  1MHO A;  2CCM A;  3BOW B;  1BMO A;  1S36 A;  3OP0 A;  1V1F A;  1XFZ O;  2WCE A;  3KO0 A;  3SIA A;  1TNW A;  4PHN A;  1M39 A;  3NSK A;  2L50 A;  1SNL A;  2I7A A;  3CR2 A;  1G8I A;  3LK1 A;  1DT7 B;  1M45 A;  1IG5 A;  2NLN A;  5KSZ A;  4GGF C;  2JNF A;  2OS8 B;  4QJ4 B;  1SK6 D;  3ICB A;  2EC6 C;  1K96 A;  2MLF C;  2JTZ A;  4PE0 A;  1DJW A;  1NCY A;  1QIW A;  1J55 A;  2L4I A;  3PN7 B;  1DF0 A;  3VRR A;  4ETO A;  4JWQ A;  1OZO A;  2E6W A;  1CKK A;  2H61 A;  3O2P A;  1JFJ A;  1U5I A;  1C07 A;  1J1D A;  1S3P A;  1KFU S;  1QAT A;  1TCF A;  1QV0 A;  1CM1 A;  2LM5 A;  4AOM A;  2O5G A;  5G08 A;  2KHN A;  4PCW A;  1YRT B;  1TN4 A;  1AP4 A;  1FBV A;  3SG6 A;  2IS9 A;  2KSP A;  2EHB A;  2KGR A;  2M29 A; 
#chains in the Genus database with same CATH topology
 1G33 A;  3OHM B;  1PSB A;  3M0W A;  2WOS A;  1K2H A;  2K60 A;  3H4S E;  3SG4 A;  2L4H A;  3EKH A;  2F2P A;  1CDP A;  5D69 A;  3EG5 B;  3SG2 A;  5I8N A;  1LXF C;  1NX1 A;  1CMG A;  1OSA A;  1S5G Y;  2KFG A;  3SIB A;  2WCB A;  3SG3 A;  1F55 A;  4PE7 A;  4WQ3 A;  4WRI A;  5CSI A;  5F6T A;  3PN7 C;  3VRO A;  1WLM A;  2L98 A;  4YGC B;  4YGE B;  2JZI A;  2K7O A;  4ORB B;  4I5L B;  1RWY A;  1SW8 A;  2KNE A;  3QME A;  3KHE A;  5HKW A;  2PAL A;  1TCO B;  1NX3 A;  2LVI A;  3AKB A;  3RZS A;  2BNX A;  3O4X A;  1GJY A;  1S6J A;  1JBA A;  1NPQ A;  2LNK A;  1B9A A;  1CFC A;  2M0R A;  2KI4 C;  3DVE A;  2ZN9 A;  2ZRT A;  3PM8 A;  2KOT A;  2JWW A;  1K9P A;  2LHL A;  2BL0 B;  1BG1 A;  1OMV A;  2JXC A;  3VGO A;  2LMT A;  4INX A;  4PDZ A;  1D1O A;  1H8B A;  1DGU A;  1Y1U A;  2P70 A;  2JNX A;  4WQ2 A;  1NCX A;  3V2L A;  1E8A A;  3DF0 A;  4C0J A;  5EL2 A;  4MBE A;  2K7D A;  2AUC A;  1CDM A;  1AVS A;  1MQ1 A;  4PHK A;  3O6B A;  1XFR A;  4MLW A;  3CR5 X;  2RGI A;  3OB2 B;  3S0E A;  4NDD A;  4DCK A;  2H2K A;  1F4Q A;  1FF1 A;  2JRF A;  1YVL A;  4OV2 A;  2L51 A;  3LLE A;  1XK4 A;  2I18 A;  3R1O A;  1N0Y A;  1N65 A;  3WHT B;  1TNQ A;  1WY9 A;  1SKT A;  3I5H B;  5ER4 X;  3S0A A;  3TUY C;  2VRG A;  4MEW A;  1KQM C;  3BUN B;  4YI9 A;  2I94 A;  1S6C A;  3FE9 A;  2K8M B;  3O78 A;  1FI5 A;  2BEC A;  3B88 A;  1TUZ A;  5AXI A;  1EH2 A;  4GGF A;  1ZOT B;  2K0J A;  1B8C A;  2MA2 A;  3LK0 A;  2PAS A;  4MN0 A;  1DMO A;  3PAL A;  2KQY A;  1MF8 B;  4MZJ A;  2F3Z A;  4A4C A;  1UUS A;  2JT0 A;  3D10 A;  1B7T Y;  2Q91 A;  3GK2 A;  3BOW A;  2F2O A;  3FWC A;  1LVC D;  1KWO C;  4D1E A;  1LA3 A;  1SCM C;  2ZKM X;  5J3X A;  2CTN A;  3SJS A;  3VRP A;  1F8H A;  2BKH B;  1PSR A;  1SL7 A;  1DVI A;  2L2C A;  5AEQ A;  1TIZ A;  1F54 A;  1OZS A;  1X02 A;  2JPT A;  2KI4 B;  2M1K B;  2R2I A;  4HRG A;  1JFK A;  3D0Y A;  1OOG A;  4IL1 A;  3WXA A;  4PE4 A;  1Y1A A;  1UHI A;  1VRK A;  4FQO A;  5HLV A;  3SS3 A;  1BR1 B;  1MXL C;  1YRU B;  2KDH A;  2LHI A;  2MRD A;  4I5N B;  4MRY A;  4OZD A;  1B47 A;  1CLM A;  3LCP C;  3O4Y A;  4OVN F;  2F33 A;  4YGD B;  1SY9 A;  3BUM B;  3DZT A;  3CS1 A;  1H4B A;  2K7B A;  1KK8 B;  4JD9 A;  1QXP A;  1YX8 A;  1WRZ A;  3CAB A;  4L9M A;  4MZL A;  3F45 A;  3D76 A;  4XYN A;  1YTZ C;  1CFP A;  1EXR A;  2EGD A;  2QDI A;  4N1G A;  3CLN A;  3FIA A;  1AHR A;  1B1G A;  1XYD A;  1IGV A;  1AK8 A;  2QAC A;  3KF9 A;  1AJ5 A;  3LL8 B;  3MSE B;  2JUL A;  5FI6 A;  2LP3 A;  2GGZ A;  5I2O A;  3FWB A;  1QAS A;  2LUX A;  3OX6 A;  1NX2 A;  1NCZ A;  1KK7 Z;  1QV1 A;  2KI6 D;  3DYE A;  1KQM B;  3BFA A;  4NDC A;  1J1E A;  1XFY O;  5CSF A;  1A29 A;  1EG3 A;  1QTX A;  1SPY A;  2LLU A;  5ER5 A;  3TS5 B;  2LMV A;  1J7P A;  1QWV A;  1OW4 A;  2JC2 A;  3DVJ A;  2L2E A;  1BU3 A;  2P71 A;  3DF0 B;  3EK4 A;  2Y1M A;  3PJI A;  3PM2 A;  2WCK A;  4OKH A;  2OTG B;  1OMR A;  3HX4 A;  4I5J A;  4MRX A;  1KFX S;  3JVT B;  1SR6 B;  1EL4 A;  4USL A;  2KYF A;  1YVH A;  1C7V A;  4ORA B;  4QJ3 B;  3L4A A;  1JSA A;  1SCM B;  2BKI B;  3EK7 A;  3SG7 A;  3EK8 A;  1LIN A;  1K9U A;  1SMG A;  2HET A;  2Y1N A;  1DF0 B;  1ORG A;  1SL9 A;  3I5G C;  1IIO A;  1SR6 C;  2K61 A;  1M46 A;  4YGB B;  1DJY A;  5D3O A;  1U5I B;  2K7C A;  3CGA A;  1MUX A;  1EJ3 A;  1OOH A;  2O60 A;  2LLS A;  4QJ5 B;  4GBA A;  5KTY A;  3CZT X;  3VRQ A;  2KGB C;  3CWG A;  1JC2 A;  2NZ0 A;  3EVU A;  4P5O E;  1YUR A;  3OBV A;  2PSR A;  3BQ3 A;  3GOF A;  4DUQ A;  1YUU A;  1B8R A;  2NCO A;  2ISD A;  3JVT C;  1GGZ A;  3NHT A;  1C7W A;  2I2R E;  2QEV A;  1REC A;  2MHH A;  5HLO A;  1K90 D;  1K94 A;  3IQO A;  1FW4 A;  1IJ5 A;  3JTD C;  3B87 A;  3AAK A;  4CFR A;  2FOT A;  1KK7 Y;  1CM4 A;  2LCP A;  1CFD A;  3ZWH A;  2JXL A;  5BPJ A;  1R2U A;  1OMD A;  2BE4 A;  2ZND A;  5FI2 A;  2KFH A;  3B6X A;  2MJW B;  1TTX A;  3N7H A;  1UHN A;  4E68 A;  5I2Q A;  1W9Z A;  2BCB A;  2CBL A;  3BXK A;  5B8I B;  1N2D A;  1K93 D;  1NP8 A;  1MR8 A;  1QVI Y;  2WC6 A;  2WOR A;  1ALW A;  1JF0 A;  3EVV A;  1TNX A;  1OOI X;  3DY9 A;  2M3W A;  5DIC A;  2KLE A;  3I5H C;  1Q80 A;  1L2O B;  3B7A A;  1TRF A;  2M7L A;  3S0B A;  3CZ0 A;  3TDI A;  1LKJ A;  5IBW A;  3D75 A;  3CZ2 A;  2M97 A;  1CFF A;  1DQE A;  3BUO B;  4GPL B;  1FPW A;  1MWN A;  1A4P A;  1PUL A;  1YX7 A;  4A4B A;  1TWO A;  1ZUZ A;  4N5X A;  4M2O A;  1L7Z A;  2OPO A;  2KBM A;  1CDN A;  1DEL A;  2L5X B;  1S6I A;  4M2P A;  3FE6 A;  3D0Y B;  1PVB A;  1JF2 A;  4JKT A;  2V53 A;  4ZCU A;  2KBI A;  2Q4U A;  4INW A;  1NUB A;  1IJ6 A;  1WRL A;  2B1U A;  2LMU A;  1WDC C;  2BBM A;  3DD4 A;  5HYD A;  2GGM A;  2ZRS A;  1KSO A;  4UPG A;  1M63 B;  4N1F A;  5D7F A;  4TNC A;  2HPS A;  4OCI A;  4MVF A;  1DJG A;  1DJH A;  2BAP A;  1KSM A;  1QX7 A;  3A4U B;  1BOC A;  1CB1 A;  4R1E A;  3BUX B;  3PAT A;  4JPZ B;  1KK8 C;  3RM1 A;  3HCM A;  2HF5 A;  3BFB A;  2K2F A;  2ZN8 A;  2K2A A;  2QEO A;  2JT8 A;  2AAO A;  2KAY A;  4CPV A;  1T14 A;  3C1V A;  1K9K A;  2ERB A;  5CPV A;  1DTL A;  1XFV O;  1Y1X A;  5TNC A;  1PK0 D;  1ZFS A;  4CID A;  1PAL A;  3I5G B;  2PVB A;  1UUR A;  2LVK A;  1M31 A;  4CFQ A;  2WC8 A;  1BJF A;  1NIW A;  2LC5 A;  3Q8I A;  2QEH A;  1GM0 A;  4Q04 A;  2M8U A;  1ZMZ A;  3PFV A;  1BT6 A;  1QIV A;  2M7N A;  1W7J B;  1F71 A;  2WCF A;  5AER A;  1TUJ A;  1V1G A;  2WND A;  1LA0 A;  1LS8 A;  5JOL A;  2LLT A;  3KEV A;  1OE9 B;  1IKU A;  4OR9 B;  1BLQ A;  3NGV A;  4YBH B;  2WCJ A;  3EVR A;  4GAO A;  2CT9 A;  1TNP A;  2M1U A;  1RK9 A;  3GK1 A;  1B7T Z;  5CSJ A;  3RLZ A;  2BL0 C;  1CTR A;  2F3Y A;  3BYA A;  2PYQ A;  2GV5 A;  1DC1 A;  2G9B A;  2SCP A;  4C0K A;  4DIR A;  2KAX A;  1YUT A;  1RJV A;  1J7Q A;  1K95 A;  1IRJ A;  2KQ6 A;  4CLN A;  3I5F C;  3SS5 A;  3ZNI A;  2JTT A;  1S5G Z;  5I2L A;  2TN4 A;  4NQG A;  1BOD A;  1EG4 A;  4BY4 A;  4HSZ A;  1S26 D;  1OQP A;  2H61 C;  2WCH A;  4YI8 A;  1BF5 A;  1AJ4 A;  3S0G A;  1XO5 A;  5GQQ C;  1A75 A;  2PMY A;  3DVK A;  1XFW O;  4YGA A;  5K89 A;  1PRW A;  2L0P A;  1DEK A;  1JUO A;  1NWD A;  2HQW A;  3AAJ A;  3UO9 A;  2EC6 B;  4PAL A;  4MZK A;  1GQM A;  1KCY A;  3K1E A;  4YRU A;  2WCL A;  3I5I C;  3NXA A;  4ZCV A;  1A75 B;  1WDC B;  1W7I B;  2QPT A;  3NSL A;  3OB1 B;  2QEB A;  1CLB A;  1L2O C;  4P2Y B;  5FYX A;  1QJT A;  4XJK B;  4PHM A;  3CYZ A;  3IQQ A;  1UHJ A;  2KPH A;  2WCM A;  2Y4Q A;  4NDB A;  1MXE A;  5AAN A;  3VRN A;  2JPO A;  1FI6 A;  4IJ7 A;  3PSR A;  1F4O A;  1IQ5 A;  1C3Y A;  2G2B A;  1CMF A;  2OS8 C;  3R1P A;  2WC5 A;  2ZFD A;  1IQ3 A;  5KU1 A;  2AMI A;  2FCE A;  2LVJ A;  4GNK B;  1S1E A;  1HQV A;  2JOJ A;  1IWQ A;  3DVM A;  1J7O A;  1YUS A;  1KWO B;  2E30 A;  3L4L A;  4BY5 A;  3JTD B;  3CTN A;  2M9G A;  3NHI A;  1UHK A;  3CR4 X;  2MAZ A;  1GGW A;  1CDL A;  1G4Y R;  2BE6 A;  2H8V A;  2M49 B;  3S0D A;  3UNW A;  5DKR A;  1P28 A;  2BCA A;  2D8N A;  2LUC A;  1WRK A;  1DGV A;  2CNP A;  2OTG C;  5HKZ A;  1A03 A;  4MSP A;  1J7R A;  1XFX O;  2LAP A;  1HT9 A;  4GFT A;  2HQ8 A;  2LVV A;  3WNX B;  1RTP 1;  5I94 A;  4HRE E;  5CSN A;  1QX2 A;  3OX5 A;  3WHU B;  2COL B;  3L47 A;  2ZNE A;  1Y0V H;  1DJI A;  2CXJ A;  4PE1 A;  3SG5 A;  1KQV A;  1ODB A;  3KPX A;  2LV7 A;  2F8P A;  3NSO A;  1IH0 A;  1A2X A;  1TOP A;  2FJY A;  3OGN A;  1AUI B;  4HRH A;  1R6P A;  3I5I B;  1UP5 A;  4FTG A;  2DOQ A;  3D77 A;  1DJX A;  1K8U A;  2KFF A;  2SAS A;  1XA5 A;  4GGN A;  4ICB A;  3TDU A;  3S0F A;  1QLS A;  1NX0 A;  3BUW B;  1Z2C B;  4KYN A;  3D74 A;  1RFJ A;  1SYM A;  2KLD A;  3E3R A;  2FCD A;  2JQ6 A;  2MBX A;  4AQI A;  1NYA A;  1JWD A;  1QVI Z;  3IF7 A;  1YR5 A;  5HKY A;  1SBJ A;  2PRU A;  3CZ1 A;  5JJG A;  3QRX A;  4AQJ A;  1UHH A;  4U8D A;  2BCX A;  1DJZ A;  1QLK A;  4PHJ A;  3K21 A;  1CNP A;  2KAV A;  3I5F B;  1B4C A;  2KYC A;  3TUY B;  4DS7 A;  1XFU O;  1F70 A;  1BR4 B;  1KFX L;  1OOJ A;  2LP2 A;  4C0L A;  1WLZ A;  1XVJ A;  2P6B B;  2JU0 A;  3EKJ A;  3FS7 A;  2LE9 B;  4F0Z B;  5AFP A;  1NSH A;  1ALV A;  2FJU B;  4DRW A;  1CLL A;  2BBN A;  1XK4 C;  3NSI A;  4PT1 A;  3AKA A;  3TZ1 A;  4M2Q A;  3A8R A;  3B86 A;  2LAN A;  3IVT A;  1B8L A;  4ORC B;  5FI7 A;  3TDZ A;  2A4J A;  1QX5 B;  2Y5I A;  1PVA A;  3GK4 X;  4JQ0 D;  3PLF B;  2JT3 A;  1SCV A;  5DKQ A;  2KI6 C;  2MLE C;  2YGU A;  4XJK A;  1SRA A;  4F7F A;  4GUK A;  5DKN A;  1SL8 A;  3TS5 C;  1RRO A;  1QS7 A;  1UWO A;  4I5K A;  5PAL A;  1KFU L;  2NXQ A;  2NCP A;  1Y6W A;  1ZAC A;  1MHO A;  2CCM A;  3BOW B;  3D73 A;  1SSE B;  1BMO A;  1S36 A;  3OP0 A;  1V1F A;  3SS4 A;  1XFZ O;  3FE8 A;  2WCE A;  3KO0 A;  3SIA A;  1TNW A;  4PHN A;  1M39 A;  3NSK A;  2L50 A;  1SNL A;  2I7A A;  3CR2 A;  1G8I A;  3LK1 A;  1DT7 B;  1M45 A;  1IG5 A;  2PQL A;  2L5Y A;  2NLN A;  5KSZ A;  4GGF C;  2JNF A;  2OS8 B;  3CDN A;  4QJ4 B;  1SK6 D;  3D78 A;  3ICB A;  2EC6 C;  1K96 A;  1OOF A;  3R1V A;  2MLF C;  2JTZ A;  5HL1 A;  4PE0 A;  1DJW A;  1NCY A;  1QIW A;  1J55 A;  2L4I A;  3PN7 B;  4FQT A;  1DF0 A;  3VRR A;  4ETO A;  1Z4H A;  4JWQ A;  1OZO A;  2E6W A;  1CKK A;  2H61 A;  3O2P A;  3BFH A;  1JFJ A;  1U5I A;  1C07 A;  1J1D A;  1S3P A;  1KFU S;  3DXL A;  1QAT A;  1TCF A;  1QV0 A;  2GTE A;  1CM1 A;  2LM5 A;  3R72 A;  4AOM A;  1C3Z A;  2O5G A;  5G08 A;  3BJH A;  2KHN A;  4PCW A;  1YRT B;  1TN4 A;  1AP4 A;  1FBV A;  3SG6 A;  2IS9 A;  2KSP A;  2EHB A;  2KGR A;  3VB1 A;  2M29 A; 
#chains in the Genus database with same CATH homology
 1G33 A;  3OHM B;  1PSB A;  3M0W A;  2WOS A;  1K2H A;  3H4S E;  3SG4 A;  2L4H A;  3EKH A;  2F2P A;  1CDP A;  5D69 A;  3SG2 A;  5I8N A;  1CMG A;  1LXF C;  1NX1 A;  1OSA A;  1S5G Y;  2KFG A;  3SIB A;  2WCB A;  3SG3 A;  1F55 A;  4PE7 A;  4WQ3 A;  4WRI A;  5CSI A;  5F6T A;  3PN7 C;  3VRO A;  1WLM A;  2L98 A;  4YGC B;  4YGE B;  2JZI A;  2K7O A;  4ORB B;  4I5L B;  1RWY A;  1SW8 A;  2KNE A;  3KHE A;  5HKW A;  2PAL A;  1TCO B;  1NX3 A;  2LVI A;  3AKB A;  1GJY A;  1S6J A;  1JBA A;  1NPQ A;  2LNK A;  1B9A A;  1CFC A;  2M0R A;  2KI4 C;  3DVE A;  2ZN9 A;  2ZRT A;  3PM8 A;  2KOT A;  2JWW A;  1K9P A;  2LHL A;  2BL0 B;  1BG1 A;  1OMV A;  2JXC A;  3VGO A;  2LMT A;  4PDZ A;  1D1O A;  1H8B A;  1DGU A;  1Y1U A;  4WQ2 A;  2JNX A;  1NCX A;  4C0J A;  1E8A A;  3DF0 A;  4MBE A;  2K7D A;  2AUC A;  1CDM A;  1AVS A;  1MQ1 A;  4PHK A;  3O6B A;  4MLW A;  3CR5 X;  2RGI A;  3OB2 B;  4NDD A;  4DCK A;  2H2K A;  1F4Q A;  1FF1 A;  2JRF A;  1YVL A;  4OV2 A;  2L51 A;  3LLE A;  1XK4 A;  2I18 A;  1N0Y A;  1N65 A;  3WHT B;  1TNQ A;  1WY9 A;  1SKT A;  3I5H B;  5ER4 X;  3TUY C;  2VRG A;  4MEW A;  1KQM C;  3BUN B;  4YI9 A;  2I94 A;  1S6C A;  2K8M B;  3O78 A;  1FI5 A;  2BEC A;  1EH2 A;  4GGF A;  1ZOT B;  2K0J A;  1B8C A;  2MA2 A;  3LK0 A;  2PAS A;  4MN0 A;  1DMO A;  3PAL A;  2KQY A;  1MF8 B;  4MZJ A;  2F3Z A;  4A4C A;  1UUS A;  2JT0 A;  3D10 A;  1B7T Y;  2Q91 A;  3GK2 A;  3BOW A;  2F2O A;  3FWC A;  1LVC D;  1KWO C;  4D1E A;  1LA3 A;  1SCM C;  2ZKM X;  5J3X A;  2CTN A;  3SJS A;  3VRP A;  1F8H A;  2BKH B;  1PSR A;  1SL7 A;  1DVI A;  5AEQ A;  1TIZ A;  1F54 A;  1OZS A;  1X02 A;  2JPT A;  2KI4 B;  2M1K B;  2R2I A;  4HRG A;  1JFK A;  3D0Y A;  3WXA A;  4IL1 A;  4PE4 A;  1Y1A A;  1UHI A;  1VRK A;  4FQO A;  5HLV A;  1BR1 B;  1MXL C;  1YRU B;  2KDH A;  2LHI A;  2MRD A;  4I5N B;  4MRY A;  1B47 A;  1CLM A;  3LCP C;  3O4Y A;  4OVN F;  2F33 A;  4YGD B;  1SY9 A;  3BUM B;  3CS1 A;  1H4B A;  2K7B A;  1KK8 B;  1QXP A;  1YX8 A;  1WRZ A;  4L9M A;  4MZL A;  3F45 A;  4XYN A;  1YTZ C;  1CFP A;  1EXR A;  2EGD A;  4N1G A;  3CLN A;  3FIA A;  1AHR A;  1B1G A;  1XYD A;  1IGV A;  1AK8 A;  2QAC A;  3KF9 A;  1AJ5 A;  3LL8 B;  3MSE B;  2JUL A;  2LP3 A;  2GGZ A;  5I2O A;  3FWB A;  1QAS A;  2LUX A;  3OX6 A;  1NX2 A;  1NCZ A;  1KK7 Z;  1QV1 A;  2KI6 D;  4NDC A;  1KQM B;  5CSF A;  1J1E A;  1XFY O;  1A29 A;  1EG3 A;  1QTX A;  1SPY A;  2LLU A;  5ER5 A;  3TS5 B;  2LMV A;  1J7P A;  2JC2 A;  3DVJ A;  2L2E A;  1BU3 A;  3DF0 B;  3EK4 A;  2Y1M A;  4OKH A;  2OTG B;  1OMR A;  3HX4 A;  4I5J A;  4MRX A;  1KFX S;  3JVT B;  1SR6 B;  1EL4 A;  4USL A;  2KYF A;  1YVH A;  1C7V A;  4ORA B;  4QJ3 B;  1JSA A;  1SCM B;  2BKI B;  3EK7 A;  3SG7 A;  3EK8 A;  1LIN A;  1K9U A;  1SMG A;  2HET A;  2Y1N A;  1DF0 B;  1SL9 A;  3I5G C;  1SR6 C;  2K61 A;  1M46 A;  4YGB B;  1DJY A;  1U5I B;  2K7C A;  3CGA A;  1MUX A;  1EJ3 A;  2O60 A;  2LLS A;  4QJ5 B;  4GBA A;  5KTY A;  3CZT X;  3VRQ A;  2KGB C;  3CWG A;  1JC2 A;  2NZ0 A;  3EVU A;  4P5O E;  1YUR A;  2PSR A;  3BQ3 A;  3GOF A;  4DUQ A;  1YUU A;  1B8R A;  2NCO A;  2ISD A;  3JVT C;  1GGZ A;  5HLO A;  1C7W A;  2I2R E;  1REC A;  2MHH A;  1K90 D;  1K94 A;  3IQO A;  1FW4 A;  1IJ5 A;  3JTD C;  3AAK A;  4CFR A;  2FOT A;  1KK7 Y;  1CM4 A;  2LCP A;  1CFD A;  3ZWH A;  2JXL A;  5BPJ A;  1R2U A;  1OMD A;  2BE4 A;  2ZND A;  2KFH A;  2MJW B;  1TTX A;  4E68 A;  1UHN A;  5I2Q A;  2BCB A;  2CBL A;  3BXK A;  5B8I B;  1N2D A;  1K93 D;  1NP8 A;  1MR8 A;  1QVI Y;  2WOR A;  1ALW A;  1JF0 A;  3EVV A;  1TNX A;  5AXI A;  2M3W A;  3I5H C;  2M7L A;  1Q80 A;  1L2O B;  1TRF A;  3TDI A;  1LKJ A;  5IBW A;  2M97 A;  1CFF A;  3BUO B;  4GPL B;  1FPW A;  1MWN A;  1A4P A;  1PUL A;  1YX7 A;  4A4B A;  1ZUZ A;  4N5X A;  4M2O A;  1L7Z A;  2OPO A;  2KBM A;  1CDN A;  2L5X B;  1S6I A;  4M2P A;  3D0Y B;  1PVB A;  1JF2 A;  2V53 A;  4ZCU A;  2KBI A;  2Q4U A;  1NUB A;  1IJ6 A;  1WRL A;  2B1U A;  2LMU A;  1WDC C;  2BBM A;  3DD4 A;  5HYD A;  2GGM A;  2ZRS A;  1KSO A;  4UPG A;  1M63 B;  4N1F A;  5D7F A;  4TNC A;  2HPS A;  4OCI A;  4MVF A;  1DJG A;  1DJH A;  1KSM A;  1QX7 A;  3A4U B;  1BOC A;  1CB1 A;  4R1E A;  3BUX B;  3PAT A;  4JPZ B;  1KK8 C;  3RM1 A;  3HCM A;  2HF5 A;  2K2F A;  2ZN8 A;  2K2A A;  2JT8 A;  2AAO A;  2KAY A;  4CPV A;  3C1V A;  1K9K A;  5CPV A;  1DTL A;  1XFV O;  1Y1X A;  5TNC A;  1PK0 D;  1ZFS A;  4CID A;  1PAL A;  3I5G B;  2PVB A;  1UUR A;  2LVK A;  1M31 A;  4CFQ A;  2WC8 A;  1BJF A;  1NIW A;  2LC5 A;  4Q04 A;  2M8U A;  1ZMZ A;  3PFV A;  1BT6 A;  1QIV A;  2M7N A;  1W7J B;  1F71 A;  2WCF A;  5AER A;  2WND A;  1V1G A;  1LA0 A;  5JOL A;  2LLT A;  3KEV A;  1OE9 B;  1IKU A;  4OR9 B;  1BLQ A;  4YBH B;  3EVR A;  4GAO A;  2CT9 A;  1TNP A;  2M1U A;  1RK9 A;  3GK1 A;  1B7T Z;  5CSJ A;  3RLZ A;  2BL0 C;  1CTR A;  2F3Y A;  3BYA A;  2GV5 A;  2G9B A;  2SCP A;  4C0K A;  4DIR A;  2KAX A;  1YUT A;  1RJV A;  1J7Q A;  1K95 A;  1IRJ A;  2KQ6 A;  4CLN A;  3I5F C;  3ZNI A;  2JTT A;  1S5G Z;  5I2L A;  2TN4 A;  4NQG A;  1BOD A;  1EG4 A;  4BY4 A;  4HSZ A;  1S26 D;  1OQP A;  2H61 C;  4YI8 A;  1BF5 A;  1AJ4 A;  1XO5 A;  5GQQ C;  1A75 A;  2PMY A;  3DVK A;  1XFW O;  4YGA A;  5K89 A;  1PRW A;  2L0P A;  1NWD A;  2HQW A;  1JUO A;  3AAJ A;  2EC6 B;  4PAL A;  4MZK A;  1GQM A;  1KCY A;  4YRU A;  3I5I C;  3NXA A;  4ZCV A;  1A75 B;  1WDC B;  1W7I B;  2QPT A;  3NSL A;  3OB1 B;  1CLB A;  1L2O C;  4P2Y B;  5FYX A;  1QJT A;  4XJK B;  4PHM A;  3IQQ A;  1UHJ A;  4NDB A;  2Y4Q A;  5AAN A;  1MXE A;  3VRN A;  1FI6 A;  3PSR A;  1F4O A;  1IQ5 A;  2G2B A;  1CMF A;  2OS8 C;  2ZFD A;  1IQ3 A;  5KU1 A;  2AMI A;  2FCE A;  2LVJ A;  4GNK B;  1S1E A;  1HQV A;  2JOJ A;  1IWQ A;  3DVM A;  1J7O A;  1YUS A;  1KWO B;  2E30 A;  4BY5 A;  3JTD B;  3CTN A;  2M9G A;  1UHK A;  3CR4 X;  2MAZ A;  1GGW A;  1CDL A;  1G4Y R;  2BE6 A;  2M49 B;  5DKR A;  2BCA A;  2D8N A;  2LUC A;  1WRK A;  1DGV A;  2CNP A;  2OTG C;  5HKZ A;  1A03 A;  4MSP A;  1J7R A;  1XFX O;  2LAP A;  1HT9 A;  4GFT A;  2HQ8 A;  2LVV A;  3WNX B;  1RTP 1;  4HRE E;  5CSN A;  1QX2 A;  3OX5 A;  3WHU B;  2COL B;  2ZNE A;  1Y0V H;  1DJI A;  2CXJ A;  4PE1 A;  3SG5 A;  1KQV A;  1ODB A;  3KPX A;  2LV7 A;  2F8P A;  3NSO A;  1IH0 A;  1A2X A;  1TOP A;  1AUI B;  4HRH A;  1R6P A;  3I5I B;  1UP5 A;  4FTG A;  2DOQ A;  1DJX A;  1K8U A;  2KFF A;  2SAS A;  1XA5 A;  4GGN A;  4ICB A;  3TDU A;  1QLS A;  1NX0 A;  3BUW B;  2MBX A;  1RFJ A;  1SYM A;  3E3R A;  2FCD A;  2JQ6 A;  4AQI A;  1JWD A;  1NYA A;  1QVI Z;  3IF7 A;  1YR5 A;  5HKY A;  1SBJ A;  2PRU A;  5JJG A;  3QRX A;  4AQJ A;  1UHH A;  4U8D A;  2BCX A;  1DJZ A;  1QLK A;  4PHJ A;  3K21 A;  1CNP A;  2KAV A;  3I5F B;  1B4C A;  2KYC A;  3TUY B;  4DS7 A;  1XFU O;  1F70 A;  1BR4 B;  1KFX L;  1OOJ A;  2LP2 A;  4C0L A;  1WLZ A;  1XVJ A;  2P6B B;  2JU0 A;  3EKJ A;  3FS7 A;  2LE9 B;  4F0Z B;  5AFP A;  1NSH A;  1ALV A;  2FJU B;  4DRW A;  1CLL A;  2BBN A;  1XK4 C;  3NSI A;  3AKA A;  3TZ1 A;  4M2Q A;  3A8R A;  4ORC B;  2LAN A;  3TDZ A;  1B8L A;  2A4J A;  1QX5 B;  2Y5I A;  1PVA A;  3GK4 X;  4JQ0 D;  3PLF B;  2JT3 A;  1SCV A;  5DKQ A;  2KI6 C;  2MLE C;  4XJK A;  1SRA A;  4GUK A;  5DKN A;  1SL8 A;  3TS5 C;  1RRO A;  1QS7 A;  1UWO A;  4I5K A;  5PAL A;  1KFU L;  2NXQ A;  2NCP A;  1Y6W A;  1ZAC A;  1MHO A;  2CCM A;  3BOW B;  1BMO A;  1S36 A;  3OP0 A;  1V1F A;  1XFZ O;  2WCE A;  3KO0 A;  3SIA A;  1TNW A;  4PHN A;  1M39 A;  3NSK A;  2L50 A;  1SNL A;  2I7A A;  3CR2 A;  1G8I A;  3LK1 A;  1DT7 B;  1M45 A;  1IG5 A;  2NLN A;  5KSZ A;  4GGF C;  2JNF A;  2OS8 B;  4QJ4 B;  1SK6 D;  3ICB A;  2EC6 C;  1K96 A;  2MLF C;  2JTZ A;  4PE0 A;  1DJW A;  1NCY A;  1QIW A;  1J55 A;  2L4I A;  3PN7 B;  1DF0 A;  3VRR A;  4ETO A;  4JWQ A;  1OZO A;  2E6W A;  1CKK A;  2H61 A;  3O2P A;  1JFJ A;  1U5I A;  1C07 A;  1J1D A;  1S3P A;  1KFU S;  1QAT A;  1TCF A;  1QV0 A;  1CM1 A;  2LM5 A;  4AOM A;  2O5G A;  5G08 A;  2KHN A;  4PCW A;  1YRT B;  1TN4 A;  1AP4 A;  1FBV A;  3SG6 A;  2IS9 A;  2KSP A;  2EHB A;  2KGR A;  2M29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...