4JPZB

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
b'EPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor 13
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 43
structure length 142
sequence length 142
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jpzB01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jpzB02
4OKHA 4CIDA 3O78A 1LA0A 1IKUA 3CLNA 3CR4X 3I5FB 1L2OC 4M2QA 1UHJA 1SR6C 5GQQC 4D1EA 5IBWA 2CXJA 2BBNA 2G9BA 2KAVA 3A4UB 1MR8A 1QV0A 1NYAA 1GGWA 2I94A 2BE6A 1CLMA 1KFUS 3D0YA 4BY4A 4QJ4B 2KI6D 2F2OA 5HKZA 3TUYB 1K96A 2FCEA 1J55A 1DF0A 4NQGA 1KQMC 1YURA 1RJVA 4MRXA 1N0YA 3PM8A 1NX2A 1QASA 2AMIA 1ALVA 1GQMA 2PASA 4BY5A 1M31A 2KFHA 2M0RA 4N1GA 4OR9B 1IRJA 1CM4A 1EL4A 5F6TA 1NX1A 1GJYA 1NCYA 1TNQA 3SIBA 1WY9A 2LP3A 2SCPA 1KK8B 1A2XA 2M97A 2G2BA 1QX5B 2I2RE 2NLNA 2EGDA 3GOFA 5CSIA 2L0PA 1SL7A 2LVJA 4YGCB 1IH0A 1W7IB 1M46A 2LMUA 2MLFC 1WRKA 1F4OA 1XVJA 2FCDA 4HREE 4I5LB 4MVFA 3JTDB 4GNKB 1WDCC 1KSOA 1K9UA 1SL9A 2CT9A 2I7AA 4R1EA 1JSAA 1G4YR 1M63B 2FOTA 1S6CA 2MA2A 3KPXA 1CDPA 2COLB 2Q4UA 3NSIA 2KDHA 2K7CA 4PE0A 2MHHA 1OOJA 2K7OA 1TRFA 3WXAA 2KYFA 4WQ3A 3O2PA 1J7PA 1S5GY 3VGOA 3O4YA 2KI4C 4PALA 1WDCB 4YI8A 1AP4A 1LVCD 2OPOA 4YGDB 1K95A 1PULA 3PALA 3TS5B 1S6IA 2BCAA 3BUWB 4AOMA 2KQ6A 3EK4A 1AVSA 1A29A 2K7BA 2WCBA 3DD4A 1NX0A 4YI9A 2F33A 3DVMA 2ISDA 1NUBA 2KI4B 1WRLA 4N5XA 1HT9A 1ODBA 1QLSA 4FTGA 1WLZA 4PHKA 1S3PA 1UWOA 2MLEC 4YGBB 1N65A 1J7OA 1BT6A 1QX7A 1TOPA 3EKHA 1YTZC 1YVLA 1ZUZA 4PCWA 1YUTA 5ER4X 1QLKA 2JT3A 3AKBA 5B8IB 3NSKA 4A4CA 2LLSA 2KGRA 1OSAA 2E6WA 4E68A 1Q80A 1AJ5A 1TCOB 4U8DA 4YGAA 3CR5X 4DUQA 1RFJA 2QPTA 1NCXA 1S26D 4WRIA 3WHUB 1BR1B 3PN7B 4ORAB 2DOQA 1R2UA 4PDZA 2PRUA 3AAKA 2L51A 2HF5A 5I8NA 1K90D 4MZKA 2GGMA 5DKRA 2M1UA 1DJZA 1M39A 5G08A 5KTYA 2PALA 2JU0A 5CSFA 4GBAA 1BODA 2LV7A 1KWOC 1Y6WA 3NSLA 1B8CA 1XFYO 3NSOA 1RK9A 1R6PA 1IQ3A 2BL0C 4YRUA 1G8IA 4C0JA 1QJTA 2LMVA 1B7TY 5AFPA 2KAXA 3JVTB 1QATA 1YVHA 2KHNA 1KFXS 2HQ8A 2ZRSA 5PALA 3OB2B 2ZKMX 3CR2A 2Y1NA 3I5FC 2H2KA 1CMFA 1TTXA 3RLZA 2BE4A 1JUOA 2A4JA 1CKKA 3EKJA 4N1FA 1CM1A 2OS8B 1S1EA 4FQOA 3SG6A 3GK4X 2F8PA 5JOLA 2PSRA 1PALA 3SG2A 2HQWA 4HSZA 2I18A 4C0LA 3SG4A 3FWCA 2MJWB 3TUYC 1XA5A 2CNPA 5I2OA 1SKTA 2EC6B 3KHEA 1TIZA 1MQ1A 2MAZA 4PHNA 1YUSA 3EK8A 4HRHA 1SCMC 2KAYA 1G33A 4XJKB 1RROA 5AANA 1K93D 1UURA 2HPSA 1DGVA 4XYNA 2BECA 3CWGA 3F45A 1XFVO 1YR5A 4CLNA 3CZTX 1KK8C 2Q91A 3BUOB 1BMOA 3D10A 5DKQA 2NCPA 1DJXA 3KF9A 3EVVA 3KEVA 2LE9B 1SCVA 2BKHB 2M1KB 1SCMB 1XYDA 2LM5A 4JWQA 2JXLA 1YX8A 3JTDC 5JJGA 3ZWHA 1AHRA 1TNXA 1XK4C 2JT8A 1QV1A 2KFGA 3VRRA 1H4BA 1Y1XA 1RECA 2F2PA 1V1FA 1AJ4A 4M2OA 1WRZA 3FWBA 5CPVA 2M9GA 2LUXA 1J7RA 1FPWA 1OFCX 5AEQA 2LVKA 5TNCA 2KI6C 1CMGA 1DMOA 1QXPA 5AXIA 3NXAA 4GAOA 1SNLA 1EXRA 3A8RA 3BUNB 4ORCB 3SG3A 1YX7A 2KFFA 1EG3A 3TS5C 1B47A 3RM1A 4AQIA 3SG5A 1IWQA 1KFXL 1U5IA 3CTNA 1TNWA 3DVEA 1NIWA 4P2YB 3VRPA 1A75B 1OMRA 3IQQA 4MZLA 5D7FA 4A4BA 1BU3A 2ZNDA 1A03A 5HKYA 3FS7A 1JWDA 2KQYA 1JF0A 3I5GC 3LL8B 3GK1A 2H61A 1FW4A 1AK8A 4YGEB 3DVJA 4MLWA 4Q04A 2NCOA 2NXQA 2MBXA 1OE9B 2KBMA 2Y9ZA 4DIRA 2JC2A 1PVAA 1KK7Z 1FI6A 2WCFA 2ZN8A 1YUUA 3DF0B 3LK0A 4OCIA 1B4CA 1QTXA 1DVIA 1JF2A 2L4IA 3PN7C 1IQ5A 1PK0D 1QX2A 1S36A 3I5GB 4AQJA 5KSZA 3IF7A 1SPYA 1VRKA 5CSNA 2D8NA 1YRTB 4MBEA 1W7JB 1SY9A 1XFXO 2CTNA 3HX4A 1SRAA 1EJ3A 1C7VA 3BUXB 1K8UA 1XO5A 4USLA 1IJ5A 5HKWA 3PLFB 1NWDA 1GGZA 3D0YB 5J3XA 4MRYA 5CSJA 1QVIZ 3JVTC 1SW8A 4UPGA 2M49B 2JWWA 4GGFC 2K2FA 2QACA 1B1GA 1SK6D 4CPVA 4NDDA 1IG5A 1OQPA 3SIAA 3ZNIA 2LP2A 1PVBA 2SASA 3GK2A 2OS8C 4MN0A 2M7LA 1XK4A 1MWNA 2MRDA 2JRFA 2LMTA 2LVIA 2M29A 1MF8B 2M3WA 2H61C 3OHMB 1BR4B 2K7DA 3IQOA 1K94A 4F0ZB 2K0JA 1J1EA 2EC6C 2JTZA 1C07A 1A75A 4CFRA 3OX5A 1DGUA 3C1VA 1TCFA 2L4HA 1MXEA 1ZFSA 2FJUB 4ORBB 4IL1A 2B1UA 4OV2A 3I5IB 1X02A 1ZMZA 2M7NA 1BF5A 2WORA 1CDMA 4PE7A 2Y9YA 5I2LA 1EH2A 2LNKA 5FYXA 4OVNF 2BKIB 4YBHB 1KQVA 1MHOA 3CS1A 3I5HB 2WNDA 1J7QA 3BXKA 1IJ6A 4ETOA 2LUCA 2OTGB 4C0KA 1CLBA 1L7ZA 4GPLB 3VRNA 2O60A 5KU1A 1F70A 2BCXA 1KCYA 2LC5A 1IGVA 1WLMA 1PSRA 3E3RA 1LINA 2PVBA 5K89A 1JC2A 2ZFDA 2AAOA 1FI5A 1F4QA 3OX6A 1JBAA 2LHLA 3PATA 1UHKA 3BYAA 1J1DA 3WNXB 2VRGA 3OP0A 4ZCVA 4L9MA 1ZOTB 2L5XB 3AKAA 1CTRA 3MSEB 1AUIB 1BLQA 1DJWA 1UHHA 1YRUB 4MSPA 1K9KA 2PMYA 1DT7B 1CNPA 3PFVA 2EHBA 4I5NB 5AERA 1L2OB 1SR6B 4DRWA 2V53A 1NPQA 1JFJA 1F8HA 1TN4A 3K21A 3EVUA 4CFQA 2Y5IA 4TNCA 4ICBA 2LLTA 2JQ6A 1SBJA 1CDLA 1XFWO 3PSRA 3EVRA 1NSHA 3EK7A 2JXCA 1C7WA 2LVVA 2ZN9A 1UHNA 4GGFA 4M2PA 3O6BA 1KQMB 1OMVA 2F3YA 1CDNA 2TN4A 5DKNA 1RTP1 1ALWA 3CGAA 4MZJA 1OZSA 3HCMA 1DJHA 1QIWA 2KYCA 4GGNA 3M0WA 2L2EA 3VRQA 1Y1UA 3LK1A 4JPZB 1EG4A 3LLEA 2JPTA 2BCBA 1KK7Y 4PHJA 4WQ2A 2Y1MA 1D1OA 2IS9A 4JQ0D 2K61A 3WHTB 2KOTA 3SJSA 2NZ0A 2CBLA 2HETA 1LXFC 1OZOA 2AUCA 1MXLC 2JT0A 2ZNEA 4PE4A 2WOSA 1UHIA 2WCEA 1JFKA 3DVKA 2JOJA 2LCPA 2BBMA 3FIAA 1XFZO 3KO0A 2JZIA 1BJFA 1DJIA 1UP5A 2CCMA 4XJKA 1HQVA 3BOWB 1S6JA 1V1GA 3ICBA 3QRXA 1LA3A 2LAPA 1QIVA 2KBIA 2KGBC 1XFUO 1K2HA 2F3ZA 2WC8A 1KSMA 1S5GZ 1CFCA 1QVIY 1NP8A 2E30A 1SYMA 1B8LA 1OMDA 2KNEA 1NX3A 1B8RA 2JNXA 2GV5A 1PRWA 5I2QA 4NDCA 1PSBA 1CFFA 4PE1A 4HRGA 5D69A 1UUSA 2GGZA 2LHIA 1BOCA 1KFUL 5HYDA 2P6BB 2O5GA 3H4SE 4GFTA 5ER5A 1DF0B 2JTTA 2RGIA 1RWYA 5BPJA 1F71A 5HLOA 1BG1A 4GUKA 1Y0VH 1CLLA 1SMGA 4DS7A 2LANA 2L98A 1DJYA 3I5IC 4I5JA 1B9AA 2K8MB 4NDBA 2ZRTA 1DJGA 1FBVA 5HLVA 4ZCUA 2LLUA 1CB1A 3OB1B 4DCKA 1LKJA 3SG7A 3TDIA 2JNFA 4PHMA 3I5HC 1F54A 1MUXA 1K9PA 1QS7A 2K2AA 3TDZA 4P5OE 3BUMB 2OTGC 1N2DA 1E8AA 1ZACA 3TDUA 4QJ5B 1CFDA 3BQ3A 3TZ1A 3VROA 1A4PA 2M8UA 1CFPA 2JULA 2R2IA 1U5IB 2L50A 1DTLA 1TNPA 3AAJA 1KWOB 3DF0A 3LCPC 1F55A 4I5KA 1H8BA 1NCZA 1B7TZ 4QJ3B 1M45A 2BL0B 3BOWA 4MEWA 1SL8A 1FF1A 2KSPA 1Y1AA 2Y4QA
chains in the Genus database with same CATH superfamily
4DJGA 3O78A 2V7QJ 1LA0A 1L2OC 4M2QA 1UHJA 2OYHA 2CXJA 1RE4C 2BBNA 2G9BA 2Y0EA 3KZIE 3A4UB 1GGWA 4BY4A 3SWYA 2WPQA 4OGQC 4BXLA 3TUYB 4H13B 4NQGA 1M1JB 1DF0A 4PV1D 1YURA 4U3FE 1ALVA 2PASA 3L70G 1SQXG 4BY5A 1IRJA 1EL4A 5F6TA 2Q5UA 2KSJA 2SCPA 1KK8B 2G2BA 1NTMD 3L71D 1JY2N 2L0PA 1SL7A 1LTJB 3EFFK 1W7IB 3U1AA 4HREE 4IFFA 4N3YB 3Q5SA 1PGJA 3H1LD 1EXJA 1BDCA 1KILC 3M06A 4C7NA 1JSAA 1G4YR 1M63B 2WCKA 2KZJA 1NTMJ 4Y99B 2MHHA 1OOJA 4N78D 2YO2A 3L71J 2Z5IA 1TRFA 3WXAA 2WQYC 3O2PA 1JY2P 3AE7C 1NKNA 3VGOA 3H1LJ 2R3SA 4YGDB 3CZ1A 4INWA 3VMZA 4PV1B 3PALA 3O8ZA 1E5WA 1ZP0C 3RBXA 3EK4A 4UB8H 1A29A 3OBVA 2K7BA 3USSA 1NX0A 2ISDA 1NUBA 3BJHA 1QEXA 5GTIE 1KQFB 3S0GA 3H1KD 1W9ZA 4RO0A 1QLSA 4RJTA 4R4MA 4HJGH 1KYOE 2E75C 2MLEC 2NPSA 2WCLA 3MD0A 3CCEP 2FYUG 3EKHA 1YTZC 1YVLA 1ZUZA 4AYCA 1IFNA 3AKBA 3L4AA 1KQLA 3NSKA 4GT1A 1AJ5A 1NH4A 3CZ0A 4DUQA 5KLVG 3H1KJ 1NCXA 3PN7B 4PDZA 2DOQA 3FXDA 3RL0C 2PRUA 3AAKA 3RZSA 4MZKA 2E74D 3I55P 1JB0J 1RY3A 1M39A 5KTYA 2PALA 2JU0A 5CSFA 2HODB 4WY4D 4KT0J 1FZAA 3CX5H 3O6QB 1RF1A 1Y6WA 1B8CA 1XFYO 1KQGB 2A45H 1IQ3A 3BRVB 3FX0A 5I94A 3II6A 1NTKK 1BDDA 3WUUA 1SFCA 5KJ7A 1S1EA 4C46A 1FJKA 2PSRA 1MFZA 2N9BA 2I18A 4C0LA 2KUBA 3TUYC 4H13C 1M1JC 1SQBK 5H2FE 4IL6E 3H1HD 1SCMC 2E74B 3B6XA 2KAYA 1G33A 5AANA 1UURA 2HPSA 1FZCA 4WY4B 2XDJA 4U3FG 3GF3A 1XFVO 1N7SA 5GTHH 4CLNA 1KK8C 1BMOA 1NTKJ 4XE5B 3KF9A 1AJYA 1FBMA 2BKHB 1GK4A 1SQQD 1GU5A 1SQBD 3HTKA 4JWQA 1CSBA 1YX8A 5AVQB 1TNXA 3R72A 1XK4C 2JT8A 2BCCE 1LNQA 2KFGA 5KKZB 3HUSB 3SFEC 2IFNA 1AJ4A 1M1KQ 3JCUE 1RF0A 3RGUA 5CPVA 1SQBJ 1J7RA 2LVKA 2P71A 3CABA 3NXAA 2YXQB 1WT6A 1H8AA 3VOPA 4PV1C 1G2CB 3QWOC 3CCRP 3PH0A 3CX5I 4AQIA 3SG5A 1IWQA 1DC1A 3DVEA 1URQA 1YQ4C 3D74A 1A75B 1VQNP 2A45I 2B9BA 1OMRA 2AEMA 2IZ0A 1P84E 1BCCD 1BE3D 2KLVA 2ZNDA 3LL8B 2NRGA 1HBWA 3GK1A 3FGAD 3GHGA 3DVJA 4Q04A 2WZ7A 2NCOA 1LT1A 4CPGA 2QEXP 1JNMA 3OW2O 2JC2A 2ZN8A 1YUUA 1BE3J 1BCCJ 3DF0B 1B4CA 1DVIA 3PN7C 2KSEA 3MTUE 5AVUB 3I5GB 3IF7A 4DZOA 2D8NA 4D6TD 4IL6X 1SRAA 2OYHB 3BVHA 3BUXB 1XO5A 1IJ5A 5HKWA 1OZHA 1YJ9P 2J59M 2POHA 2L2CA 2IZ1A 1QVIZ 4PD4H 1OX3A 1C3ZA 4UPGA 1NWQA 1OMIA 4GGFC 2QACA 5CMZA 1B1GA 2E43A 4W7ZA 1L0LE 1MUUA 1PVBA 2SASA 2K9JB 2O1KA 2M7LA 3O4XA 3L74E 3H6PA 1MWNA 2LXCB 2MKVA 2LVIA 2M3WA 1AQ5A 1LT9C 1BR4B 2K7DA 5CBNA 2NPSD 2B88A 3H1JD 4N6JA 3A2AA 1PP9D 1TCFA 1HGVA 3Q8IA 1KZUB 4ORBB 2B1UA 1JTHA 4WY4C 3S0EA 2JPOA 1BF5A 2W6JH 1CDMA 1JY3O 3H1JJ 1UIXA 3I5CA 3LW5H 2R5DA 2IBZI 1PP9J 4GOEA 3MUDA 1LP1B 2LUCA 2OTGB 1CLBA 1L7ZA 4ASVA 5B66H 2BCXA 3RK2D 3C8VA 3VB1A 5AVRB 1WLMA 3M9HA 2PVBA 3RL0g 2FBWC 3LIDA 2BCCG 2PP6A 5TJHA 1UHKA 1J1DA 2VRGA 4FQTA 1ZOTB 5KJ7D 1NTZK 2NPSB 3JC22 3OA7A 1JM0A 2PMYA 2GTEA 1AQTA 3AEFC 2K9YA 1AA0A 1SR6B 1Q2NA 4KJMA 1F8HA 3K21A 1J2JB 1OW6A 2M0BA 2JQ6A 1BGYJ 1CDLA 3MIWA 4PD4I 2LVVA 2IYPA 3M0DA 1VQ5P 1KQMB 3AE6C 3K5BA 3VP9A 2TN4A 3A7OA 3CGAA 3HCMA 1FJPA 1RF1B 4GGNA 1VQ4P 3VMAA 1DEKA 3D6YA 3LK1A 1EDJA 2G3AA 1EG4A 3LLEA 2JPTA 3RK2B 2FFDA 2IS9A 1DEBA 1QL1A 1NTZJ 3V6IA 2KOTA 4WWIA 2L91A 2NZ0A 2QJKB 2WCEA 3N7HA 2OYHC 3KO0A 2JZIA 2ZYDA 1NYHA 1DJIA 3DY9A 1S6JA 2LAPA 2OYIA 1M7LA 2WSFH 3TGUJ 1CFCA 5CCGA 1QVIY 1NP8A 1JO5A 2E30A 3DXLA 1NU1K 2KNEA 1NX3A 1B8RA 3D75A 2GV5A 1PRWA 1AVOA 1PSBA 4PE1A 3NGVA 3A0BE 1L0LG 1FZCB 4KYNA 4BRYA 3U1CA 5HYDA 2AXTH 3B88A 3L74G 4GFTA 3QMEA 4JYCA 1LS8A 2JTTA 1YTZI 2RGIA 4JYBA 1H0TA 2HLOA 3AEEC 1SSEB 4DOJA 3EG5B 1NU1D 5AW9B 3BCCD 3A0HE 2PGDA 1B9AA 2K8MB 3V2PA 2OTLP 4BWNA 2ZRTA 1DJGA 5HLVA 2HG5D 2LLUA 3E1RA 2YIUB 3D77A 3SS4A 3L72E 2K2AA 1QS7A 1NU1J 3TDZA 1KFNA 1L4AA 2OTGC 1E8AA 3L73E 3TZ1A 3VROA 4OGQD 2J5UA 2R2IA 4OH8B 1N73A 1DTLA 1B7TZ 4QJ3B 2BL0B 3BOWA 4MEWA 1U57A 2NPSC 2WPSA 3M9BA 4OKHA 3S0AA 3I5FB 1SR6C 4D1EA 3CC2P 1P84D 1NYAA 2BE6A 4ZKUA 1NHLA 3CWBE 1FZFA 2ZT9D 1K96A 4NPDA 4YXWH 1KQMC 3WUVA 2KZIA 4MRXA 2E76D 3PM8A 1X8YA 2FYNC 2AMIA 1RF1C 3SFDC 1GQMA 2RH0A 1FC2C 1M31A 4N1GA 3RK2C 3NHIA 1RE3A 4OGQB 3G3ZA 1VQLP 1DX7A 1KB9D 1QX5B 2I2RE 2NLNA 2QJKC 2LVJA 1IH0A 1M46A 5APUA 2MLFC 5KJ7C 1WRKA 1XVJA 4MVFA 3JTDB 3L35A 1IFDA 1WDCC 1KSOA 1SL9A 2CT9A 2A06E 1KFMA 3LW5J 1S6CA 2MA2A 4JKTA 2K7CA 1W2EA 1EZVD 5AW8B 1KMIZ 3SS5A 4WQ3A 5B5EH 5CJ0A 3AE9C 1NTKE 4PALA 1AP4A 1FDIA 2ZT9B 3P32A 1HWTC 3RL0D 1FZCC 2KXPB 1JTHB 2E76B 2PRRA 3P7KA 1LJ2A 1N7SC 2KQ6A 3DD4A 1U7MA 1GZLA 3CYZA 4H0LD 4N5XA 5KAIE 1IK7A 3B87A 4PHKA 1UWOA 2YMKA 1J7OA 3SS3A 2WTYA 1BT6A 5APWA 5B8IB 2E42A 1OSAA 2I8DA 1RF0C 2YIUC 3CXHD 3CR5X 2QPTA 4WRIA 1FOSF 4TT3H 2HF5A 3QH9A 1GDTA 2ITAA 2GGMA 2M1UA 1L0ND 3PHLA 3PP5A 2GM4A 3L72G 1VQ6P 1BODA 1M56D 3RL0B 2BL0C 1VL2A 2YKOA 5CCGD 1QJTA 1B7TY 1L0NJ 1OOHA 1VPCA 2KAXA 3GHGC 5PALA 3OB2B 1SLQA 4H0LB 3PJIA 3I5FC 3CR2A 1NGMB 3RLZA 4LGDE 1W2BO 2A4JA 1CKKA 5AW3B 4FQOA 3VYIA 2B87A 2F8PA 2GA1A 2FFDB 3SG2A 2HQWA 4HSZA 3FWCA 3L75J 1XA5A 3R1VA 3CCQP 3KHEA 1TIZA 3CWBG 3EK8A 2IDBA 5APSA 1NAFA 1KD1Q 4I2LC 3R1OA 1NTMK 2BECA 4RKUJ 4WB4A 2OYIB 3D10A 3H25A 2QEBA 1SCMB 1LTIC 4W7YA 1QLED 4OZDA 4IFMA 3JTDC 5JJGA 3CCVP 3B8EB 1QV1A 3D78A 5EL2A 4LC1A 1Y1XA 1V1FA 4BRYB 2Z4EA 4UB8E 2QA4P 2A06G 1WRZA 2LUXA 2RN0A 3IF4A 5AEQA 5TNCA 1H0TB 2L5YA 1SQVK 4EOTA 1U7JA 2ZT9C 3BUNB 1YX7A 1G1JA 2KFFA 1NTKG 2E76C 3L36A 3RM1A 2ZJSE 1KFXL 1U5IA 1J1EB 1ZR4A 1OOIX 1NIWA 4C7RA 4HH2A 3VTPC 3MUDC 3RK3E 1SQVD 1JF0A 2ZXEB 2H61A 1YJWP 2ZFCA 3CC4P 2NXQA 2MBXA 3CX5E 1Q7YQ 2YNYA 3VN0A 2N1TA 1NVOA 1YTZT 2M3BA 4DIRA 1ZRTE 1FI6A 2JR8A 3HE4A 5AW4B 1N73B 2H43A 3LK0A 3SWFA 1QTXA 1JF2A 1S3JA 1SQVJ 5KSZA 1J1DC 1H88A 1VRKA 5CSNA 5AW5B 1BGYE 3CCLP 2UWJE 3JSVC 2CTNA 1C7VA 3W68A 2PAJA 5CSJA 1Q86Q 3BFHA 4YTPC 1SW8A 1ORGA 2M49B 1SQPD 2JWWA 1H89A 3M0DC 4H0LC 1X0TA 2XZRA 1OQPA 1BSNA 1JY3N 1S9KD 3SIAA 3ZNIA 2LP2A 2KS1A 3GK2A 4MN0A 2WC6A 1EDLA 2KIKA 2JWDA 1SQXK 1Y47A 2FFDC 2M29A 1JMBA 2IPPA 3AEAC 5GTHE 1YJNP 3TF5A 1SQPJ 4PT1A 1OW7A 1FDOA 3CCSP 4F0ZB 5CJ4A 2JTZA 2R32A 1JY3P 1DGUA 1XFRA 2W6AA 5FI2A 3TGUE 1FDMA 3H32A 4O9BA 3V4QA 2FJUB 4OV2A 1X02A 1LT9B 3L70D 1SQXD 1SQQK 2Q6QA 2OYIC 1OW4A 5I2LA 3EFGA 1EH2A 1GD2E 1YITP 4OVNF 2BKIB 1KQVA 1E79H 5CCGC 1MHOA 2W83C 3CS1A 3V2QA 3BXKA 1S2EA 5BVZA 3VMXA 4C0KA 3VRNA 1F70A 3L70J 1SQXJ 5C39A 3S4RA 1Q81Q 3AE2C 1IGVA 3H1HJ 1LINA 1JC2A 2ZFDA 2OTJP 3CZ2A 1F4QA 2LHLA 3AE5C 2ZVOB 1Z2CB 3PATA 5APVA 2IBZE 5DJTB 3WNXB 2L5XB 3AKAA 1CTRA 2HPCB 3G4SP 3MSEB 3D76A 2DW3A 2FYUK 1DT7B 1CNPA 3PFVA 1SQQJ 2EHBA 2QE7H 1X9VA 1J1EC 4CFQA 2Y5IA 4TNCA 2LLTA 3HE5A 1IJDB 1NSHA 1PGOA 3P8CE 1L4AC 4ASWA 2JXCA 1PGQA 3O6BA 1OMVA 2FYUD 1S72P 1CDNA 1OW8A 1RTP1 1IO4A 1OZSA 5H2FH 1N73C 3SWKA 3VRQA 1NJIQ 1RQUA 1OOGA 1IZNB 2BCBA 2PYQA 4WQ2A 1D1OA 5KLVD 4RESB 3WHTB 2A45G 2WITA 1OOFA 2HETA 2FYUJ 1LXFC 1OZOA 2AUCA 2WOSA 3G6EP 3L37A 1JFKA 3DVKA 1PPJE 1VQ9P 1BGYG 3PRJA 1HQVA 1OXZA 2WSCH 3ICBA 2O1JA 2YMYA 3CMEP 1LA3A 2KGBC 1XFUO 2F3ZA 3IFMA 2V4HA 1KILE 2W90A 3FE9A 2R5BA 3FE8A 1OMDA 3V2NA 5I2QA 4D6TJ 1NTZG 3N7NA 1LTSC 2GGZA 5AVSB 1BOCA 1RE3C 3HRNA 1DF0B 5FI6A 1C3YA 3MHVA 3S9OA 4GUKA 1Y0VH 3OJAB 3CCJP 1SMGA 4DS7A 2WSSH 1ZMEC 2L98A 2N1TD 5D3OA 1P84H 4I5JA 4XFJA 5B66E 4NDBA 1FBVA 3TGUG 4U3FD 3CD6P 4I6MC 3TDIA 3SG7A 1HJ0A 4I7ZB 3TSIA 1MUXA 1K9PA 4P5OE 3BUMB 4C7NB 1ZACA 2PFXA 2OARA 2YKQA 4QJ5B 2JDIH 1CFDA 2KNCA 2M8UA 2QM7A 3F5HA 4L76A 1PZQA 1U5IB 1KB9H 3AAJA 1KWOB 3M91A 1A02J 2QJYC 1M45A 1FF1A 2Z5HA 1NO4A 1ZXGA 2Y4QA 5TISH 3IR9A 2P10A 2IBZG 4CIDA 3PLNA 1IKUA 3CR4X 4K35A 1NAYA 5GQQC 5IBWA 2N1TB 5APQA 1NU1G 2KAVA 3PM2A 1MR8A 1QV0A 1SFCD 1T2KD 3D0YA 1CLMA 2YKPA 4GIFA 1K8AQ 5CHXA 2F2OA 2KLEA 2GUVA 2FCEA 1J55A 4F7FA 1RJVA 2P58A 1N0YA 1W5CE 3IVTA 1NX2A 1QASA 1DD3A 1T8ZA 1ZR2A 1KYOD 2XKMA 5CBOA 2KFHA 2M0RA 2RKLA 3H1IE 1N2DC 1TNQA 1WY9A 2WCJA 2LP3A 1Q82Q 2WSEH 2JJLA 5AW0B 2M97A 1QVFO 2P70A 1VQ8P 3GOFA 1N7SD 4YGCB 2FYNB 2LMUA 1F4OA 4I5LB 2QVAA 2KS1B 1GL2A 1P84I 4WVZA 5KLIB 1HTLC 3CXHH 2CK3H 1Q90D 3CPWO 1JMMA 1JEKA 2AXTE 1CDPA 1PPJG 5BU5A 3NSIA 3KDPB 2KYFA 1SFCB 3PJSK 1YIJP 1IFIA 2LXBA 1FE6A 4A7PA 4YI8A 2KI4C 1WDCB 1LVCD 2Q3IA 3A3YB 2OPOA 4HYTB 2WC5A 5E79H 3Q5RA 1VF5D 4IOIH 1IFPA 1TWOA 4AOMA 2N9YB 1KB9I 2WCBA 3MP7B 3P8MC 5BU8B 4YI9A 2F33A 1WRLA 1RH5B 2FXPA 3IAOA 3AE1C 1JUNA 1DD4A 1URQD 2Q9IA 3EQ2A 1S3PA 5AVZB 1TOPA 1N7LA 5ER4X 1YUTA 4XA4A 5KAFE 1QLKA 1N7SB 2H88C 1EZVI 2H8PD 2KGRA 2E6WA 1NTME 3HTKB 4YGAA 3L71E 1RFJA 3WHUB 2HR3A 4I7ZC 4ORAB 4R4LA 1R2UA 3R2PA 2OYOA 2L51A 3H1LE 5I8NA 1K90D 4L75A 1DJZA 2WT7A 1AFOA 2AXCA 4GBAA 1MKMA 1LTJA 3OAKA 1XTGB 4N78E 1KWOC 2C9LY 4M3LA 3NSLA 1IC2A 1R6PA 2BCCD 3BCCJ 1VF5B 1G8IA 3Q3DA 4C0JA 4JBZA 1VQMP 5AFPA 2WPVB 2KB7P 1QATA 3WU2H 2KHNA 1EC5A 2ZRSA 2ZKMX 2Y1NA 2WSCJ 5APXA 4Z1MH 2H2KA 1URQB 2BE4A 2N1TC 3EKJA 3CXHI 4N1FA 1CM1A 2BCCJ 3KQGA 3H1KE 3FWLA 5APTA 5JOLA 1TU3F 3GHGB 3SG4A 2MJWB 3A0BH 2H89C 5AW2B 1SKTA 4PHNA 4HRHA 3TK1A 1FS0E 1YQ3C 1IK9A 1M8OB 3D71A 1RROA 5AW6B 1DGVA 3MGNA 4XYNA 3CWGA 3F45A 2P1JA 4PJ0E 4W80A 1YR5A 4IFDK 3CZTX 4UB6H 1T14A 3ABVC 3BUOB 5DKQA 3H1IG 5B5EE 1ZN5A 1XYDA 2JXLA 5KLIC 3ZWHA 2I1KA 3VRRA 3L75G 1HF9A 2LR2A 2QG4A 1RECA 1L0LK 4M2OA 2XNDH 3HD7A 3O6QA 1OFCX 1FPWA 1SFCC 1T2KC 1DMOA 3C1LA 1QXPA 5AXIA 4GAOA 1SNLA 1EXRA 2ZYAA 1QGKB 2CPSA 3NTNA 4EYYQ 3A8RA 2YGUA 2OGUA 1ZV8A 1B47A 1GK6A 1L0LD 3CTNA 1TNWA 1ZLLA 2E5TA 1R5LA 3L74D 4GKGA 3IQQA 4MZLA 1ZW0A 4A4BA 5AVXB 3FS7A 2ERBA 1VQ7P 1AK8A 4YGEB 2QDIA 2KNCB 1L0LJ 2Q1KA 3L74J 1OWAA 1PVAA 3GG2A 2WCFA 1DIPA 4OCIA 3S1KA 1SQBE 2L4IA 2FXOA 5CCHA 1L0NK 3R1PA 1IQ5A 4AQJA 4GDOA 1KTMA 1SPYA 1NTMG 4WBAA 3L71G 1YRTB 4NPFX 2WVRA 2QIWA 1W7JB 1SY9A 1XFXO 2Y0DA 3H1LG 1EJ3A 2WSEJ 4USLA 1J1DB 1VF5C 1NWDA 1GGZA 3D0YB 5J3XA 2BEZF 3HUSA 1IFMA 4H44D 1G1IA 2K2FA 3V2RA 1SK6D 4CPVA 1URQC 1IG5A 1S5LH 1GW3A 2HFED 3L47A 4YPCA 1SVFA 1BCCE 1BE3E 2LMTA 1MF8B 1G2CA 3IQOA 1UIIA 3NMDA 3H1KG 3I56P 3DYEA 3TDKA 1FAVA 4LLHA 1A75A 1QVGO 4ZMDA 3OX5A 1Z4HA 3CDNA 3C1VA 2L4HA 3L4FA 1MXEA 1ZFSA 5M1BA 4IL1A 1ZMZA 1FZBA 2RMZA 4PE7A 3MZWB 4INXA 4YBHB 2OQQA 3I5HB 2WNDA 2FJYA 4ETOA 4H44B 1LWUA 5KU1A 3AE8C 2K60A 1CI6A 1L4AD 1USEA 1KCYA 1S5LX 2LC5A 1PSRA 5K89A 3NXSA 3T97A 3OX6A 1JBAA 1TUJA 3BYAA 2QEHA 1SS1A 4ZCVA 4L9MA 2JKVA 2KP8A 1T6AA 1AUIB 1BLQA 1UHHA 2AEFA 1YRUB 1K9KA 2O3JA 3CCUP 1VDFA 4I5NB 1K9MQ 1K04A 3RBZA 4DRWA 1TN4A 2K9JA 3H1JE 3EVUA 2FKWB 4ICBA 2KI7B 1SBJA 1PP9E 2BASA 5AVWB 1FOSE 1YI2P 3PSRA 3EVRA 3EK7A 3AEGC 1C7WA 2ZN9A 1UHNA 3H1HG 2WT7B 4M2PA 3CC7P 1DJHA 3B86A 2KYCA 2QM8A 3N4XA 5KTBA 2L2EA 3KZIH 4PHJA 1L4AB 2Y1MA 2JWAA 1SQQG 1SQBG 3SJSA 2CBLA 2JT0A 4PE4A 2ZNEA 1UHIA 5DICA 3L72D 3FIAA 1DH3A 4XJKA 1UP5A 1LP1A 3AEDC 3BOWB 3HD7D 3L73D 3M9QA 1SQPK 4HKZH 1QIVA 2KBIA 2WMMA 1K2HA 1S5GZ 1OVRA 1R5SA 3L72J 3E7KA 4K3AA 1SYMA 1B8LA 2FY8A 2JNXA 3KYQA 3L73J 4NDCA 1GMJA 4HRGA 5AVTB 2K3RA 3Q1MA 5D69A 5AVYB 2HYNA 2M5AA 1S1CX 4GODA 3H4SE 2O5GA 5ER5A 1NTZE 3GLMA 1BCCG 1BE3G 5L8RJ 2SPZA 1BG1A 3D73A 4L74A 3D6ZA 1GTWA 2IYOA 2WPRA 1GL2C 3F89A 2B89A 3CWBD 1N8RQ 2QJPC 1LTTC 5CCHD 3HD7B 4DCKA 1LKJA 1SP4A 2FXMA 2JNFA 1F54A 3I5HC 4D6TG 5GTIH 3PTZA 3CWBJ 1M57D 1KYOH 4H44C 2W27A 2K37A 1HJBA 1A4PA 3AECC 1CFPA 1F55A 1H8BA 3LCPC 2A06D 1NKZB 1SL8A 3TNUA 2KSPA 3B4SA 3S0DA 3B5NA 3W67A 3CLNA 3Q5PA 1NTKD 2QJYB 3GF7A 1FZEA 2I94A 1KFUS 1KQSO 4QJ4B 3AE3C 2KI6D 3CI9A 1NU1E 1YBKA 2IFMA 3H1JG 3BCCE 5HKZA 2JEEA 1PP9G 1CW5A 3BASA 2YO3A 1LTJC 5KLVK 4OR9B 2JO1A 2ZYGA 1CM4A 3NHTA 1NX1A 1GJYA 1NCYA 3SIBA 1CZQA 4U7JA 1A2XA 1XTCC 4Y99C 2EGDA 5CSIA 4IL6H 1YYCA 2FCDA 3BFBA 4GNKB 1R8EA 1K9UA 2D2CD 2I7AA 4R1EA 4PD4E 3TYYA 2FOTA 3KPXA 2COLB 2Q4UA 1BSHA 2KDHA 2C0WA 4PE0A 3B71A 2G8YA 1DQEA 2K7OA 2W6BA 5K5GB 3NFQA 1J7PA 1S5GY 3O4YA 3EWKA 1GU4A 1KYOI 3AEBC 5KLVJ 4MN4C 2B87B 1S4XA 1K95A 1PULA 1JY2O 2C0XA 3TS5B 1MFTA 1S6IA 2BCAA 3BUWB 3B7AA 3JCUH 1AVSA 3DVMA 2KI4B 1HT9A 1ODBA 4FTGA 1WLZA 4YGBB 1N65A 1PGPA 1QX7A 4PCWA 1LWUB 2JT3A 2OTKE 4A4CA 1CI6B 2LLSA 2Y0CA 4E68A 1RE4A 1Q80A 1KB9E 1TCOB 3HD7C 2Q7CA 4U8DA 3T97B 2D2CB 1FU1A 4OWFA 1S26D 1BR1B 3SSUA 1LGHB 3CMAP 3KHUA 5DKRA 5TISE 1IIOA 5G08A 2LV7A 1EZVE 1PV3A 3V4WA 2JP3A 2W8ZA 3NSOA 1RK9A 1GM0A 4YRUA 1EXIA 2LMVA 3UIAA 1Z56A 1QWVA 3JVTB 1YVHA 4U3FJ 1KFXS 2HQ8A 4EDFA 2KK7A 1CMFA 1TTXA 1JUOA 2OS8B 1JCCA 2ZXXA 1KILA 4IJ7A 3SG6A 2E74C 3GK4X 5CCHC 1EDIA 1PALA 2K88A 2E5YA 2CNPA 1TUZA 5I2OA 2EC6B 1AVYA 1Y8AA 1MQ1A 2MAZA 1YUSA 3HE4B 3BCCG 3CCMP 3RK3D 3CXHE 4XJKB 1MZ9A 4B86A 1K93D 3CX5D 5KKZC 1L0NE 3HUSC 2Q91A 2WCMA 2NCPA 1DJXA 1ZRTD 3EVVA 1X22A 3KEVA 2LE9B 1SCVA 3VMYA 2M1KB 2AEJA 2LM5A 3A5TA 1YHQP 2CPBA 2L5GB 1AHRA 2GUSA 5E79E 1BGYD 1H4BA 1X79B 1M90Q 2F2PA 2M5AB 3CLQA 3B5ND 3FWBA 2M9GA 1K05A 3L75E 1JCDA 1ZOYC 3AE4C 2KI6C 1CMGA 4EIJA 1PFIA 4ORCB 3SG3A 1EG3A 3TS5C 3G9RA 2C9NY 1NTZD 1DELA 2O01H 3BRTB 4L73A 3RK3B 3FWNA 2ZAEB 4AUWA 4P2YB 3VRPA 1WMKA 5D7FA 3H32B 1BU3A 3K1EA 1A03A 5HKYA 1JWDA 3CL3D 3IN6A 2KQYA 3I5GC 3M0AA 3VP8A 2WWWA 1LWUC 3WMM0 3ZDMA 1FW4A 4I1LA 4MLWA 1OE9B 2KBMA 1JOCA 2Y9ZA 3G71P 3TGUD 1KK7Z 2D2CC 3ITKA 1PK0D 1S36A 1QX2A 4JF7A 3TNUB 1Y9BA 3B5NB 1M1JA 4KHXA 3WU2E 4MBEA 2I1JA 5FI7A 3V5BA 3HX4A 2KOGA 2V7QH 1VQKP 1K8UA 2LKMA 3PLFB 1QL2A 1EZVG 2XU6A 4MRYA 3GW6A 3OGNA 3JVTC 3C9IA 3U59A 4NDDA 2IBZD 2OS8C 1XK4A 1P28A 3HE5B 2MRDA 2JRFA 3UO9A 1SQVE 3L4LA 2H61C 3OHMB 4UB6E 4TLFA 1K94A 1HUCA 2K0JA 1J1EA 2QSIA 2EC6C 4AQRD 1C07A 1USDA 4CFRA 5AW7B 1VQPP 3P8CD 1RQVA 3I5IB 2M7NA 2WORA 2Y9YA 5KAFH 1DEEG 2LNKA 3KPEA 5FYXA 1OIPA 2ZVNB 1L0NG 1J7QA 1IJ6A 4EI2A 3Q2YA 4PD4D 4GPLB 2O60A 3A0HH 4GOFA 2P2UA 1N86A 1FI5A 3E3RA 1PPJD 1SQPE 2AAOA 2P7JA 3S0FA 2WCHA 2BEQD 1S9KE 3OP0A 2YXRB 1PIXA 2XV5A 1DJWA 1KILD 2HODA 4MSPA 2VRSA 5AERA 1OVUA 1L2OB 3E1IA 3RK3C 2MJZA 2V53A 1NPQA 1PL5A 1JFJA 4ZNCA 2H8VA 1XFWO 4HB1A 1KORA 3LIEA 2QEVA 4GGFA 3L70E 1SQXE 1LTAC 2KYVA 2F3YA 3UNWA 1FZGA 5DKNA 2FYZA 1ALWA 4MZJA 3H1HE 1QIWA 1T3UA 2BNXA 3D70A 3M0WA 2K1AA 1Y1UA 4JPZB 2KLUA 2KLDA 1KK7Y 4DT0A 5AW1B 4JQ0D 1LT9A 4YXDC 2K61A 3B5NC 2E75D 5AVVB 2O01N 4PJ0H 1MXLC 2BAPA 1S5LE 1MV8A 2JOJA 2LCPA 2BBMA 1SQQE 1XFZO 1HGZA 1IFJA 5DJUB 1BJFA 2CCMA 1GW4A 1HH0A 2IX7C 1V1GA 1KILB 4WY4A 3QRXA 2PQLA 1GL2D 1LTBC 2R44A 2WC8A 1WRGA 1KSMA 2M3EA 2R3CA 2J58A 3KXDA 1A02F 2QRXA 1CFFA 2HPCA 1QX8A 1UUSA 2LHIA 1NOHA 1KFUL 1KC8Q 1LTGC 1T3JA 1K73Q 2P6BB 1AV1A 5EFWB 1RWYA 5BPJA 3S0BA 1F71A 5HLOA 2FYUE 5APYA 1SQVG 4Y28J 2KPHA 2H7HA 1CLLA 1OVVA 3V2LA 3DZTA 1EDKA 2LANA 1L2PA 2E75B 2O01J 1DJYA 3I5IC 5KLVE 2NZ2A 3WUTA 4ZCUA 3BATA 2M8RA 1CB1A 1KV4A 3OB1B 1D7MA 4H13D 3L73G 4PHMA 1GL2B 3H1ID 5KAIH 2QJPB 1N2DA 4JD9A 3FXEA 3TDUA 4QMAA 4ZKPA 4D6TE 1HVVA 3BQ3A 2QEOA 2Q3EA 3L75D 2JULA 1KN7A 2XNXA 2L50A 3DF0A 1TNPA 3BFAA 1VQOP 4I5KA 4NPEA 1NCZA 3H1IJ 2P67A 1RHZB 3GMAA 3R4YA 5HL1A 1SQPG 1EQ7A 1Y1AA 3FE6A 2WSFJ
chains in the Genus database with same CATH topology
4OKHA 4CIDA 3O78A 1LA0A 1IKUA 3CLNA 3CR4X 3I5FB 1L2OC 4M2QA 1UHJA 1SR6C 5GQQC 4D1EA 5IBWA 2CXJA 2BBNA 2G9BA 2KAVA 3A4UB 1MR8A 1QV0A 1NYAA 1GGWA 2I94A 2BE6A 1CLMA 1KFUS 3D0YA 4BY4A 4QJ4B 2KI6D 2F2OA 5HKZA 3TUYB 1K96A 2FCEA 1J55A 1DF0A 4NQGA 1KQMC 1YURA 1RJVA 4MRXA 1N0YA 3PM8A 1NX2A 1QASA 2AMIA 1ALVA 1GQMA 2PASA 4BY5A 1M31A 2KFHA 2M0RA 4N1GA 4OR9B 1IRJA 1CM4A 1EL4A 5F6TA 1NX1A 1GJYA 1NCYA 1TNQA 3SIBA 1WY9A 2LP3A 2SCPA 1KK8B 1A2XA 2M97A 2G2BA 1QX5B 2I2RE 2NLNA 2EGDA 3GOFA 5CSIA 2L0PA 1SL7A 2LVJA 4YGCB 1IH0A 1W7IB 1M46A 2LMUA 2MLFC 1WRKA 1F4OA 1XVJA 2FCDA 4HREE 4I5LB 4MVFA 3JTDB 4GNKB 1WDCC 1KSOA 1K9UA 1SL9A 2CT9A 2I7AA 4R1EA 1JSAA 1G4YR 1M63B 2FOTA 1S6CA 2MA2A 3KPXA 1CDPA 2COLB 2Q4UA 3NSIA 2KDHA 2K7CA 4PE0A 2MHHA 1OOJA 2K7OA 1TRFA 3WXAA 2KYFA 4WQ3A 3O2PA 1J7PA 1S5GY 3VGOA 3O4YA 2KI4C 4PALA 1WDCB 4YI8A 1AP4A 1LVCD 2OPOA 4YGDB 1K95A 1PULA 3PALA 3TS5B 1S6IA 2BCAA 3BUWB 4AOMA 2KQ6A 3EK4A 1AVSA 1A29A 2K7BA 2WCBA 3DD4A 1NX0A 4YI9A 2F33A 3DVMA 2ISDA 1NUBA 2KI4B 1WRLA 4N5XA 1HT9A 1ODBA 1QLSA 4FTGA 1WLZA 4PHKA 1S3PA 1UWOA 2MLEC 4YGBB 1N65A 1J7OA 1BT6A 1QX7A 1TOPA 3EKHA 1YTZC 1YVLA 1ZUZA 4PCWA 1YUTA 5ER4X 1QLKA 2JT3A 3AKBA 5B8IB 3NSKA 4A4CA 2LLSA 2KGRA 1OSAA 2E6WA 4E68A 1Q80A 1AJ5A 1TCOB 4U8DA 4YGAA 3CR5X 4DUQA 1RFJA 2QPTA 1NCXA 1S26D 4WRIA 3WHUB 1BR1B 3PN7B 4ORAB 2DOQA 1R2UA 4PDZA 2PRUA 3AAKA 2L51A 2HF5A 5I8NA 1K90D 4MZKA 2GGMA 5DKRA 2M1UA 1DJZA 1M39A 5G08A 5KTYA 2PALA 2JU0A 5CSFA 4GBAA 1BODA 2LV7A 1KWOC 1Y6WA 3NSLA 1B8CA 1XFYO 3NSOA 1RK9A 1R6PA 1IQ3A 2BL0C 4YRUA 1G8IA 4C0JA 1QJTA 2LMVA 1B7TY 5AFPA 2KAXA 3JVTB 1QATA 1YVHA 2KHNA 1KFXS 2HQ8A 2ZRSA 5PALA 3OB2B 2ZKMX 3CR2A 2Y1NA 3I5FC 2H2KA 1CMFA 1TTXA 3RLZA 2BE4A 1JUOA 2A4JA 1CKKA 3EKJA 4N1FA 1CM1A 2OS8B 1S1EA 4FQOA 3SG6A 3GK4X 2F8PA 5JOLA 2PSRA 1PALA 3SG2A 2HQWA 4HSZA 2I18A 4C0LA 3SG4A 3FWCA 2MJWB 3TUYC 1XA5A 2CNPA 5I2OA 1SKTA 2EC6B 3KHEA 1TIZA 1MQ1A 2MAZA 4PHNA 1YUSA 3EK8A 4HRHA 1SCMC 2KAYA 1G33A 4XJKB 1RROA 5AANA 1K93D 1UURA 2HPSA 1DGVA 4XYNA 2BECA 3CWGA 3F45A 1XFVO 1YR5A 4CLNA 3CZTX 1KK8C 2Q91A 3BUOB 1BMOA 3D10A 5DKQA 2NCPA 1DJXA 3KF9A 3EVVA 3KEVA 2LE9B 1SCVA 2BKHB 2M1KB 1SCMB 1XYDA 2LM5A 4JWQA 2JXLA 1YX8A 3JTDC 5JJGA 3ZWHA 1AHRA 1TNXA 1XK4C 2JT8A 1QV1A 2KFGA 3VRRA 1H4BA 1Y1XA 1RECA 2F2PA 1V1FA 1AJ4A 4M2OA 1WRZA 3FWBA 5CPVA 2M9GA 2LUXA 1J7RA 1FPWA 1OFCX 5AEQA 2LVKA 5TNCA 2KI6C 1CMGA 1DMOA 1QXPA 5AXIA 3NXAA 4GAOA 1SNLA 1EXRA 3A8RA 3BUNB 4ORCB 3SG3A 1YX7A 2KFFA 1EG3A 3TS5C 1B47A 3RM1A 4AQIA 3SG5A 1IWQA 1KFXL 1U5IA 3CTNA 1TNWA 3DVEA 1NIWA 4P2YB 3VRPA 1A75B 1OMRA 3IQQA 4MZLA 5D7FA 4A4BA 1BU3A 2ZNDA 1A03A 5HKYA 3FS7A 1JWDA 2KQYA 1JF0A 3I5GC 3LL8B 3GK1A 2H61A 1FW4A 1AK8A 4YGEB 3DVJA 4MLWA 4Q04A 2NCOA 2NXQA 2MBXA 1OE9B 2KBMA 2Y9ZA 4DIRA 2JC2A 1PVAA 1KK7Z 1FI6A 2WCFA 2ZN8A 1YUUA 3DF0B 3LK0A 4OCIA 1B4CA 1QTXA 1DVIA 1JF2A 2L4IA 3PN7C 1IQ5A 1PK0D 1QX2A 1S36A 3I5GB 4AQJA 5KSZA 3IF7A 1SPYA 1VRKA 5CSNA 2D8NA 1YRTB 4MBEA 1W7JB 1SY9A 1XFXO 2CTNA 3HX4A 1SRAA 1EJ3A 1C7VA 3BUXB 1K8UA 1XO5A 4USLA 1IJ5A 5HKWA 3PLFB 1NWDA 1GGZA 3D0YB 5J3XA 4MRYA 5CSJA 1QVIZ 3JVTC 1SW8A 4UPGA 2M49B 2JWWA 4GGFC 2K2FA 2QACA 1B1GA 1SK6D 4CPVA 4NDDA 1IG5A 1OQPA 3SIAA 3ZNIA 2LP2A 1PVBA 2SASA 3GK2A 2OS8C 4MN0A 2M7LA 1XK4A 1MWNA 2MRDA 2JRFA 2LMTA 2LVIA 2M29A 1MF8B 2M3WA 2H61C 3OHMB 1BR4B 2K7DA 3IQOA 1K94A 4F0ZB 2K0JA 1J1EA 2EC6C 2JTZA 1C07A 1A75A 4CFRA 3OX5A 1DGUA 3C1VA 1TCFA 2L4HA 1MXEA 1ZFSA 2FJUB 4ORBB 4IL1A 2B1UA 4OV2A 3I5IB 1X02A 1ZMZA 2M7NA 1BF5A 2WORA 1CDMA 4PE7A 2Y9YA 5I2LA 1EH2A 2LNKA 5FYXA 4OVNF 2BKIB 4YBHB 1KQVA 1MHOA 3CS1A 3I5HB 2WNDA 1J7QA 3BXKA 1IJ6A 4ETOA 2LUCA 2OTGB 4C0KA 1CLBA 1L7ZA 4GPLB 3VRNA 2O60A 5KU1A 1F70A 2BCXA 1KCYA 2LC5A 1IGVA 1WLMA 1PSRA 3E3RA 1LINA 2PVBA 5K89A 1JC2A 2ZFDA 2AAOA 1FI5A 1F4QA 3OX6A 1JBAA 2LHLA 3PATA 1UHKA 3BYAA 1J1DA 3WNXB 2VRGA 3OP0A 4ZCVA 4L9MA 1ZOTB 2L5XB 3AKAA 1CTRA 3MSEB 1AUIB 1BLQA 1DJWA 1UHHA 1YRUB 4MSPA 1K9KA 2PMYA 1DT7B 1CNPA 3PFVA 2EHBA 4I5NB 5AERA 1L2OB 1SR6B 4DRWA 2V53A 1NPQA 1JFJA 1F8HA 1TN4A 3K21A 3EVUA 4CFQA 2Y5IA 4TNCA 4ICBA 2LLTA 2JQ6A 1SBJA 1CDLA 1XFWO 3PSRA 3EVRA 1NSHA 3EK7A 2JXCA 1C7WA 2LVVA 2ZN9A 1UHNA 4GGFA 4M2PA 3O6BA 1KQMB 1OMVA 2F3YA 1CDNA 2TN4A 5DKNA 1RTP1 1ALWA 3CGAA 4MZJA 1OZSA 3HCMA 1DJHA 1QIWA 2KYCA 4GGNA 3M0WA 2L2EA 3VRQA 1Y1UA 3LK1A 4JPZB 1EG4A 3LLEA 2JPTA 2BCBA 1KK7Y 4PHJA 4WQ2A 2Y1MA 1D1OA 2IS9A 4JQ0D 2K61A 3WHTB 2KOTA 3SJSA 2NZ0A 2CBLA 2HETA 1LXFC 1OZOA 2AUCA 1MXLC 2JT0A 2ZNEA 4PE4A 2WOSA 1UHIA 2WCEA 1JFKA 3DVKA 2JOJA 2LCPA 2BBMA 3FIAA 1XFZO 3KO0A 2JZIA 1BJFA 1DJIA 1UP5A 2CCMA 4XJKA 1HQVA 3BOWB 1S6JA 1V1GA 3ICBA 3QRXA 1LA3A 2LAPA 1QIVA 2KBIA 2KGBC 1XFUO 1K2HA 2F3ZA 2WC8A 1KSMA 1S5GZ 1CFCA 1QVIY 1NP8A 2E30A 1SYMA 1B8LA 1OMDA 2KNEA 1NX3A 1B8RA 2JNXA 2GV5A 1PRWA 5I2QA 4NDCA 1PSBA 1CFFA 4PE1A 4HRGA 5D69A 1UUSA 2GGZA 2LHIA 1BOCA 1KFUL 5HYDA 2P6BB 2O5GA 3H4SE 4GFTA 5ER5A 1DF0B 2JTTA 2RGIA 1RWYA 5BPJA 1F71A 5HLOA 1BG1A 4GUKA 1Y0VH 1CLLA 1SMGA 4DS7A 2LANA 2L98A 1DJYA 3I5IC 4I5JA 1B9AA 2K8MB 4NDBA 2ZRTA 1DJGA 1FBVA 5HLVA 4ZCUA 2LLUA 1CB1A 3OB1B 4DCKA 1LKJA 3SG7A 3TDIA 2JNFA 4PHMA 3I5HC 1F54A 1MUXA 1K9PA 1QS7A 2K2AA 3TDZA 4P5OE 3BUMB 2OTGC 1N2DA 1E8AA 1ZACA 3TDUA 4QJ5B 1CFDA 3BQ3A 3TZ1A 3VROA 1A4PA 2M8UA 1CFPA 2JULA 2R2IA 1U5IB 2L50A 1DTLA 1TNPA 3AAJA 1KWOB 3DF0A 3LCPC 1F55A 4I5KA 1H8BA 1NCZA 1B7TZ 4QJ3B 1M45A 2BL0B 3BOWA 4MEWA 1SL8A 1FF1A 2KSPA 1Y1AA 2Y4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKH A;  4CID A;  3O78 A;  1LA0 A;  1IKU A;  3CLN A;  3CR4 X;  3I5F B;  1L2O C;  4M2Q A;  1UHJ A;  1SR6 C;  5GQQ C;  4D1E A;  5IBW A;  2CXJ A;  2BBN A;  2G9B A;  2KAV A;  3A4U B;  1MR8 A;  1QV0 A;  1NYA A;  1GGW A;  2I94 A;  2BE6 A;  1CLM A;  1KFU S;  3D0Y A;  4BY4 A;  4QJ4 B;  2KI6 D;  2F2O A;  5HKZ A;  3TUY B;  1K96 A;  2FCE A;  1J55 A;  1DF0 A;  4NQG A;  1KQM C;  1YUR A;  1RJV A;  4MRX A;  1N0Y A;  3PM8 A;  1NX2 A;  1QAS A;  2AMI A;  1ALV A;  1GQM A;  2PAS A;  4BY5 A;  1M31 A;  2KFH A;  2M0R A;  4N1G A;  4OR9 B;  1IRJ A;  1CM4 A;  1EL4 A;  5F6T A;  1NX1 A;  1GJY A;  1NCY A;  1TNQ A;  3SIB A;  1WY9 A;  2LP3 A;  2SCP A;  1KK8 B;  1A2X A;  2M97 A;  2G2B A;  1QX5 B;  2I2R E;  2NLN A;  2EGD A;  3GOF A;  5CSI A;  2L0P A;  1SL7 A;  2LVJ A;  4YGC B;  1IH0 A;  1W7I B;  1M46 A;  2LMU A;  2MLF C;  1WRK A;  1F4O A;  1XVJ A;  2FCD A;  4HRE E;  4I5L B;  4MVF A;  3JTD B;  4GNK B;  1WDC C;  1KSO A;  1K9U A;  1SL9 A;  2CT9 A;  2I7A A;  4R1E A;  1JSA A;  1G4Y R;  1M63 B;  2FOT A;  1S6C A;  2MA2 A;  3KPX A;  1CDP A;  2COL B;  2Q4U A;  3NSI A;  2KDH A;  2K7C A;  4PE0 A;  2MHH A;  1OOJ A;  2K7O A;  1TRF A;  3WXA A;  2KYF A;  4WQ3 A;  3O2P A;  1J7P A;  1S5G Y;  3VGO A;  3O4Y A;  2KI4 C;  4PAL A;  1WDC B;  4YI8 A;  1AP4 A;  1LVC D;  2OPO A;  4YGD B;  1K95 A;  1PUL A;  3PAL A;  3TS5 B;  1S6I A;  2BCA A;  3BUW B;  4AOM A;  2KQ6 A;  3EK4 A;  1AVS A;  1A29 A;  2K7B A;  2WCB A;  3DD4 A;  1NX0 A;  4YI9 A;  2F33 A;  3DVM A;  2ISD A;  1NUB A;  2KI4 B;  1WRL A;  4N5X A;  1HT9 A;  1ODB A;  1QLS A;  4FTG A;  1WLZ A;  4PHK A;  1S3P A;  1UWO A;  2MLE C;  4YGB B;  1N65 A;  1J7O A;  1BT6 A;  1QX7 A;  1TOP A;  3EKH A;  1YTZ C;  1YVL A;  1ZUZ A;  4PCW A;  1YUT A;  5ER4 X;  1QLK A;  2JT3 A;  3AKB A;  5B8I B;  3NSK A;  4A4C A;  2LLS A;  2KGR A;  1OSA A;  2E6W A;  4E68 A;  1Q80 A;  1AJ5 A;  1TCO B;  4U8D A;  4YGA A;  3CR5 X;  4DUQ A;  1RFJ A;  2QPT A;  1NCX A;  1S26 D;  4WRI A;  3WHU B;  1BR1 B;  3PN7 B;  4ORA B;  2DOQ A;  1R2U A;  4PDZ A;  2PRU A;  3AAK A;  2L51 A;  2HF5 A;  5I8N A;  1K90 D;  4MZK A;  2GGM A;  5DKR A;  2M1U A;  1DJZ A;  1M39 A;  5G08 A;  5KTY A;  2PAL A;  2JU0 A;  5CSF A;  4GBA A;  1BOD A;  2LV7 A;  1KWO C;  1Y6W A;  3NSL A;  1B8C A;  1XFY O;  3NSO A;  1RK9 A;  1R6P A;  1IQ3 A;  2BL0 C;  4YRU A;  1G8I A;  4C0J A;  1QJT A;  2LMV A;  1B7T Y;  5AFP A;  2KAX A;  3JVT B;  1QAT A;  1YVH A;  2KHN A;  1KFX S;  2HQ8 A;  2ZRS A;  5PAL A;  3OB2 B;  2ZKM X;  3CR2 A;  2Y1N A;  3I5F C;  2H2K A;  1CMF A;  1TTX A;  3RLZ A;  2BE4 A;  1JUO A;  2A4J A;  1CKK A;  3EKJ A;  4N1F A;  1CM1 A;  2OS8 B;  1S1E A;  4FQO A;  3SG6 A;  3GK4 X;  2F8P A;  5JOL A;  2PSR A;  1PAL A;  3SG2 A;  2HQW A;  4HSZ A;  2I18 A;  4C0L A;  3SG4 A;  3FWC A;  2MJW B;  3TUY C;  1XA5 A;  2CNP A;  5I2O A;  1SKT A;  2EC6 B;  3KHE A;  1TIZ A;  1MQ1 A;  2MAZ A;  4PHN A;  1YUS A;  3EK8 A;  4HRH A;  1SCM C;  2KAY A;  1G33 A;  4XJK B;  1RRO A;  5AAN A;  1K93 D;  1UUR A;  2HPS A;  1DGV A;  4XYN A;  2BEC A;  3CWG A;  3F45 A;  1XFV O;  1YR5 A;  4CLN A;  3CZT X;  1KK8 C;  2Q91 A;  3BUO B;  1BMO A;  3D10 A;  5DKQ A;  2NCP A;  1DJX A;  3KF9 A;  3EVV A;  3KEV A;  2LE9 B;  1SCV A;  2BKH B;  2M1K B;  1SCM B;  1XYD A;  2LM5 A;  4JWQ A;  2JXL A;  1YX8 A;  3JTD C;  5JJG A;  3ZWH A;  1AHR A;  1TNX A;  1XK4 C;  2JT8 A;  1QV1 A;  2KFG A;  3VRR A;  1H4B A;  1Y1X A;  1REC A;  2F2P A;  1V1F A;  1AJ4 A;  4M2O A;  1WRZ A;  3FWB A;  5CPV A;  2M9G A;  2LUX A;  1J7R A;  1FPW A;  1OFC X;  5AEQ A;  2LVK A;  5TNC A;  2KI6 C;  1CMG A;  1DMO A;  1QXP A;  5AXI A;  3NXA A;  4GAO A;  1SNL A;  1EXR A;  3A8R A;  3BUN B;  4ORC B;  3SG3 A;  1YX7 A;  2KFF A;  1EG3 A;  3TS5 C;  1B47 A;  3RM1 A;  4AQI A;  3SG5 A;  1IWQ A;  1KFX L;  1U5I A;  3CTN A;  1TNW A;  3DVE A;  1NIW A;  4P2Y B;  3VRP A;  1A75 B;  1OMR A;  3IQQ A;  4MZL A;  5D7F A;  4A4B A;  1BU3 A;  2ZND A;  1A03 A;  5HKY A;  3FS7 A;  1JWD A;  2KQY A;  1JF0 A;  3I5G C;  3LL8 B;  3GK1 A;  2H61 A;  1FW4 A;  1AK8 A;  4YGE B;  3DVJ A;  4MLW A;  4Q04 A;  2NCO A;  2NXQ A;  2MBX A;  1OE9 B;  2KBM A;  2Y9Z A;  4DIR A;  2JC2 A;  1PVA A;  1KK7 Z;  1FI6 A;  2WCF A;  2ZN8 A;  1YUU A;  3DF0 B;  3LK0 A;  4OCI A;  1B4C A;  1QTX A;  1DVI A;  1JF2 A;  2L4I A;  3PN7 C;  1IQ5 A;  1PK0 D;  1QX2 A;  1S36 A;  3I5G B;  4AQJ A;  5KSZ A;  3IF7 A;  1SPY A;  1VRK A;  5CSN A;  2D8N A;  1YRT B;  4MBE A;  1W7J B;  1SY9 A;  1XFX O;  2CTN A;  3HX4 A;  1SRA A;  1EJ3 A;  1C7V A;  3BUX B;  1K8U A;  1XO5 A;  4USL A;  1IJ5 A;  5HKW A;  3PLF B;  1NWD A;  1GGZ A;  3D0Y B;  5J3X A;  4MRY A;  5CSJ A;  1QVI Z;  3JVT C;  1SW8 A;  4UPG A;  2M49 B;  2JWW A;  4GGF C;  2K2F A;  2QAC A;  1B1G A;  1SK6 D;  4CPV A;  4NDD A;  1IG5 A;  1OQP A;  3SIA A;  3ZNI A;  2LP2 A;  1PVB A;  2SAS A;  3GK2 A;  2OS8 C;  4MN0 A;  2M7L A;  1XK4 A;  1MWN A;  2MRD A;  2JRF A;  2LMT A;  2LVI A;  2M29 A;  1MF8 B;  2M3W A;  2H61 C;  3OHM B;  1BR4 B;  2K7D A;  3IQO A;  1K94 A;  4F0Z B;  2K0J A;  1J1E A;  2EC6 C;  2JTZ A;  1C07 A;  1A75 A;  4CFR A;  3OX5 A;  1DGU A;  3C1V A;  1TCF A;  2L4H A;  1MXE A;  1ZFS A;  2FJU B;  4ORB B;  4IL1 A;  2B1U A;  4OV2 A;  3I5I B;  1X02 A;  1ZMZ A;  2M7N A;  1BF5 A;  2WOR A;  1CDM A;  4PE7 A;  2Y9Y A;  5I2L A;  1EH2 A;  2LNK A;  5FYX A;  4OVN F;  2BKI B;  4YBH B;  1KQV A;  1MHO A;  3CS1 A;  3I5H B;  2WND A;  1J7Q A;  3BXK A;  1IJ6 A;  4ETO A;  2LUC A;  2OTG B;  4C0K A;  1CLB A;  1L7Z A;  4GPL B;  3VRN A;  2O60 A;  5KU1 A;  1F70 A;  2BCX A;  1KCY A;  2LC5 A;  1IGV A;  1WLM A;  1PSR A;  3E3R A;  1LIN A;  2PVB A;  5K89 A;  1JC2 A;  2ZFD A;  2AAO A;  1FI5 A;  1F4Q A;  3OX6 A;  1JBA A;  2LHL A;  3PAT A;  1UHK A;  3BYA A;  1J1D A;  3WNX B;  2VRG A;  3OP0 A;  4ZCV A;  4L9M A;  1ZOT B;  2L5X B;  3AKA A;  1CTR A;  3MSE B;  1AUI B;  1BLQ A;  1DJW A;  1UHH A;  1YRU B;  4MSP A;  1K9K A;  2PMY A;  1DT7 B;  1CNP A;  3PFV A;  2EHB A;  4I5N B;  5AER A;  1L2O B;  1SR6 B;  4DRW A;  2V53 A;  1NPQ A;  1JFJ A;  1F8H A;  1TN4 A;  3K21 A;  3EVU A;  4CFQ A;  2Y5I A;  4TNC A;  4ICB A;  2LLT A;  2JQ6 A;  1SBJ A;  1CDL A;  1XFW O;  3PSR A;  3EVR A;  1NSH A;  3EK7 A;  2JXC A;  1C7W A;  2LVV A;  2ZN9 A;  1UHN A;  4GGF A;  4M2P A;  3O6B A;  1KQM B;  1OMV A;  2F3Y A;  1CDN A;  2TN4 A;  5DKN A;  1RTP 1;  1ALW A;  3CGA A;  4MZJ A;  1OZS A;  3HCM A;  1DJH A;  1QIW A;  2KYC A;  4GGN A;  3M0W A;  2L2E A;  3VRQ A;  1Y1U A;  3LK1 A;  4JPZ B;  1EG4 A;  3LLE A;  2JPT A;  2BCB A;  1KK7 Y;  4PHJ A;  4WQ2 A;  2Y1M A;  1D1O A;  2IS9 A;  4JQ0 D;  2K61 A;  3WHT B;  2KOT A;  3SJS A;  2NZ0 A;  2CBL A;  2HET A;  1LXF C;  1OZO A;  2AUC A;  1MXL C;  2JT0 A;  2ZNE A;  4PE4 A;  2WOS A;  1UHI A;  2WCE A;  1JFK A;  3DVK A;  2JOJ A;  2LCP A;  2BBM A;  3FIA A;  1XFZ O;  3KO0 A;  2JZI A;  1BJF A;  1DJI A;  1UP5 A;  2CCM A;  4XJK A;  1HQV A;  3BOW B;  1S6J A;  1V1G A;  3ICB A;  3QRX A;  1LA3 A;  2LAP A;  1QIV A;  2KBI A;  2KGB C;  1XFU O;  1K2H A;  2F3Z A;  2WC8 A;  1KSM A;  1S5G Z;  1CFC A;  1QVI Y;  1NP8 A;  2E30 A;  1SYM A;  1B8L A;  1OMD A;  2KNE A;  1NX3 A;  1B8R A;  2JNX A;  2GV5 A;  1PRW A;  5I2Q A;  4NDC A;  1PSB A;  1CFF A;  4PE1 A;  4HRG A;  5D69 A;  1UUS A;  2GGZ A;  2LHI A;  1BOC A;  1KFU L;  5HYD A;  2P6B B;  2O5G A;  3H4S E;  4GFT A;  5ER5 A;  1DF0 B;  2JTT A;  2RGI A;  1RWY A;  5BPJ A;  1F71 A;  5HLO A;  1BG1 A;  4GUK A;  1Y0V H;  1CLL A;  1SMG A;  4DS7 A;  2LAN A;  2L98 A;  1DJY A;  3I5I C;  4I5J A;  1B9A A;  2K8M B;  4NDB A;  2ZRT A;  1DJG A;  1FBV A;  5HLV A;  4ZCU A;  2LLU A;  1CB1 A;  3OB1 B;  4DCK A;  1LKJ A;  3SG7 A;  3TDI A;  2JNF A;  4PHM A;  3I5H C;  1F54 A;  1MUX A;  1K9P A;  1QS7 A;  2K2A A;  3TDZ A;  4P5O E;  3BUM B;  2OTG C;  1N2D A;  1E8A A;  1ZAC A;  3TDU A;  4QJ5 B;  1CFD A;  3BQ3 A;  3TZ1 A;  3VRO A;  1A4P A;  2M8U A;  1CFP A;  2JUL A;  2R2I A;  1U5I B;  2L50 A;  1DTL A;  1TNP A;  3AAJ A;  1KWO B;  3DF0 A;  3LCP C;  1F55 A;  4I5K A;  1H8B A;  1NCZ A;  1B7T Z;  4QJ3 B;  1M45 A;  2BL0 B;  3BOW A;  4MEW A;  1SL8 A;  1FF1 A;  2KSP A;  1Y1A A;  2Y4Q A; 
#chains in the Genus database with same CATH topology
 4DJG A;  3O78 A;  2V7Q J;  1LA0 A;  1L2O C;  4M2Q A;  1UHJ A;  2OYH A;  2CXJ A;  1RE4 C;  2BBN A;  2G9B A;  2Y0E A;  3KZI E;  3A4U B;  1GGW A;  4BY4 A;  3SWY A;  2WPQ A;  4OGQ C;  4BXL A;  3TUY B;  4H13 B;  4NQG A;  1M1J B;  1DF0 A;  4PV1 D;  1YUR A;  4U3F E;  1ALV A;  2PAS A;  3L70 G;  1SQX G;  4BY5 A;  1IRJ A;  1EL4 A;  5F6T A;  2Q5U A;  2KSJ A;  2SCP A;  1KK8 B;  2G2B A;  1NTM D;  3L71 D;  1JY2 N;  2L0P A;  1SL7 A;  1LTJ B;  3EFF K;  1W7I B;  3U1A A;  4HRE E;  4IFF A;  4N3Y B;  3Q5S A;  1PGJ A;  3H1L D;  1EXJ A;  1BDC A;  1KIL C;  3M06 A;  4C7N A;  1JSA A;  1G4Y R;  1M63 B;  2WCK A;  2KZJ A;  1NTM J;  4Y99 B;  2MHH A;  1OOJ A;  4N78 D;  2YO2 A;  3L71 J;  2Z5I A;  1TRF A;  3WXA A;  2WQY C;  3O2P A;  1JY2 P;  3AE7 C;  1NKN A;  3VGO A;  3H1L J;  2R3S A;  4YGD B;  3CZ1 A;  4INW A;  3VMZ A;  4PV1 B;  3PAL A;  3O8Z A;  1E5W A;  1ZP0 C;  3RBX A;  3EK4 A;  4UB8 H;  1A29 A;  3OBV A;  2K7B A;  3USS A;  1NX0 A;  2ISD A;  1NUB A;  3BJH A;  1QEX A;  5GTI E;  1KQF B;  3S0G A;  3H1K D;  1W9Z A;  4RO0 A;  1QLS A;  4RJT A;  4R4M A;  4HJG H;  1KYO E;  2E75 C;  2MLE C;  2NPS A;  2WCL A;  3MD0 A;  3CCE P;  2FYU G;  3EKH A;  1YTZ C;  1YVL A;  1ZUZ A;  4AYC A;  1IFN A;  3AKB A;  3L4A A;  1KQL A;  3NSK A;  4GT1 A;  1AJ5 A;  1NH4 A;  3CZ0 A;  4DUQ A;  5KLV G;  3H1K J;  1NCX A;  3PN7 B;  4PDZ A;  2DOQ A;  3FXD A;  3RL0 C;  2PRU A;  3AAK A;  3RZS A;  4MZK A;  2E74 D;  3I55 P;  1JB0 J;  1RY3 A;  1M39 A;  5KTY A;  2PAL A;  2JU0 A;  5CSF A;  2HOD B;  4WY4 D;  4KT0 J;  1FZA A;  3CX5 H;  3O6Q B;  1RF1 A;  1Y6W A;  1B8C A;  1XFY O;  1KQG B;  2A45 H;  1IQ3 A;  3BRV B;  3FX0 A;  5I94 A;  3II6 A;  1NTK K;  1BDD A;  3WUU A;  1SFC A;  5KJ7 A;  1S1E A;  4C46 A;  1FJK A;  2PSR A;  1MFZ A;  2N9B A;  2I18 A;  4C0L A;  2KUB A;  3TUY C;  4H13 C;  1M1J C;  1SQB K;  5H2F E;  4IL6 E;  3H1H D;  1SCM C;  2E74 B;  3B6X A;  2KAY A;  1G33 A;  5AAN A;  1UUR A;  2HPS A;  1FZC A;  4WY4 B;  2XDJ A;  4U3F G;  3GF3 A;  1XFV O;  1N7S A;  5GTH H;  4CLN A;  1KK8 C;  1BMO A;  1NTK J;  4XE5 B;  3KF9 A;  1AJY A;  1FBM A;  2BKH B;  1GK4 A;  1SQQ D;  1GU5 A;  1SQB D;  3HTK A;  4JWQ A;  1CSB A;  1YX8 A;  5AVQ B;  1TNX A;  3R72 A;  1XK4 C;  2JT8 A;  2BCC E;  1LNQ A;  2KFG A;  5KKZ B;  3HUS B;  3SFE C;  2IFN A;  1AJ4 A;  1M1K Q;  3JCU E;  1RF0 A;  3RGU A;  5CPV A;  1SQB J;  1J7R A;  2LVK A;  2P71 A;  3CAB A;  3NXA A;  2YXQ B;  1WT6 A;  1H8A A;  3VOP A;  4PV1 C;  1G2C B;  3QWO C;  3CCR P;  3PH0 A;  3CX5 I;  4AQI A;  3SG5 A;  1IWQ A;  1DC1 A;  3DVE A;  1URQ A;  1YQ4 C;  3D74 A;  1A75 B;  1VQN P;  2A45 I;  2B9B A;  1OMR A;  2AEM A;  2IZ0 A;  1P84 E;  1BCC D;  1BE3 D;  2KLV A;  2ZND A;  3LL8 B;  2NRG A;  1HBW A;  3GK1 A;  3FGA D;  3GHG A;  3DVJ A;  4Q04 A;  2WZ7 A;  2NCO A;  1LT1 A;  4CPG A;  2QEX P;  1JNM A;  3OW2 O;  2JC2 A;  2ZN8 A;  1YUU A;  1BE3 J;  1BCC J;  3DF0 B;  1B4C A;  1DVI A;  3PN7 C;  2KSE A;  3MTU E;  5AVU B;  3I5G B;  3IF7 A;  4DZO A;  2D8N A;  4D6T D;  4IL6 X;  1SRA A;  2OYH B;  3BVH A;  3BUX B;  1XO5 A;  1IJ5 A;  5HKW A;  1OZH A;  1YJ9 P;  2J59 M;  2POH A;  2L2C A;  2IZ1 A;  1QVI Z;  4PD4 H;  1OX3 A;  1C3Z A;  4UPG A;  1NWQ A;  1OMI A;  4GGF C;  2QAC A;  5CMZ A;  1B1G A;  2E43 A;  4W7Z A;  1L0L E;  1MUU A;  1PVB A;  2SAS A;  2K9J B;  2O1K A;  2M7L A;  3O4X A;  3L74 E;  3H6P A;  1MWN A;  2LXC B;  2MKV A;  2LVI A;  2M3W A;  1AQ5 A;  1LT9 C;  1BR4 B;  2K7D A;  5CBN A;  2NPS D;  2B88 A;  3H1J D;  4N6J A;  3A2A A;  1PP9 D;  1TCF A;  1HGV A;  3Q8I A;  1KZU B;  4ORB B;  2B1U A;  1JTH A;  4WY4 C;  3S0E A;  2JPO A;  1BF5 A;  2W6J H;  1CDM A;  1JY3 O;  3H1J J;  1UIX A;  3I5C A;  3LW5 H;  2R5D A;  2IBZ I;  1PP9 J;  4GOE A;  3MUD A;  1LP1 B;  2LUC A;  2OTG B;  1CLB A;  1L7Z A;  4ASV A;  5B66 H;  2BCX A;  3RK2 D;  3C8V A;  3VB1 A;  5AVR B;  1WLM A;  3M9H A;  2PVB A;  3RL0 g;  2FBW C;  3LID A;  2BCC G;  2PP6 A;  5TJH A;  1UHK A;  1J1D A;  2VRG A;  4FQT A;  1ZOT B;  5KJ7 D;  1NTZ K;  2NPS B;  3JC2 2;  3OA7 A;  1JM0 A;  2PMY A;  2GTE A;  1AQT A;  3AEF C;  2K9Y A;  1AA0 A;  1SR6 B;  1Q2N A;  4KJM A;  1F8H A;  3K21 A;  1J2J B;  1OW6 A;  2M0B A;  2JQ6 A;  1BGY J;  1CDL A;  3MIW A;  4PD4 I;  2LVV A;  2IYP A;  3M0D A;  1VQ5 P;  1KQM B;  3AE6 C;  3K5B A;  3VP9 A;  2TN4 A;  3A7O A;  3CGA A;  3HCM A;  1FJP A;  1RF1 B;  4GGN A;  1VQ4 P;  3VMA A;  1DEK A;  3D6Y A;  3LK1 A;  1EDJ A;  2G3A A;  1EG4 A;  3LLE A;  2JPT A;  3RK2 B;  2FFD A;  2IS9 A;  1DEB A;  1QL1 A;  1NTZ J;  3V6I A;  2KOT A;  4WWI A;  2L91 A;  2NZ0 A;  2QJK B;  2WCE A;  3N7H A;  2OYH C;  3KO0 A;  2JZI A;  2ZYD A;  1NYH A;  1DJI A;  3DY9 A;  1S6J A;  2LAP A;  2OYI A;  1M7L A;  2WSF H;  3TGU J;  1CFC A;  5CCG A;  1QVI Y;  1NP8 A;  1JO5 A;  2E30 A;  3DXL A;  1NU1 K;  2KNE A;  1NX3 A;  1B8R A;  3D75 A;  2GV5 A;  1PRW A;  1AVO A;  1PSB A;  4PE1 A;  3NGV A;  3A0B E;  1L0L G;  1FZC B;  4KYN A;  4BRY A;  3U1C A;  5HYD A;  2AXT H;  3B88 A;  3L74 G;  4GFT A;  3QME A;  4JYC A;  1LS8 A;  2JTT A;  1YTZ I;  2RGI A;  4JYB A;  1H0T A;  2HLO A;  3AEE C;  1SSE B;  4DOJ A;  3EG5 B;  1NU1 D;  5AW9 B;  3BCC D;  3A0H E;  2PGD A;  1B9A A;  2K8M B;  3V2P A;  2OTL P;  4BWN A;  2ZRT A;  1DJG A;  5HLV A;  2HG5 D;  2LLU A;  3E1R A;  2YIU B;  3D77 A;  3SS4 A;  3L72 E;  2K2A A;  1QS7 A;  1NU1 J;  3TDZ A;  1KFN A;  1L4A A;  2OTG C;  1E8A A;  3L73 E;  3TZ1 A;  3VRO A;  4OGQ D;  2J5U A;  2R2I A;  4OH8 B;  1N73 A;  1DTL A;  1B7T Z;  4QJ3 B;  2BL0 B;  3BOW A;  4MEW A;  1U57 A;  2NPS C;  2WPS A;  3M9B A;  4OKH A;  3S0A A;  3I5F B;  1SR6 C;  4D1E A;  3CC2 P;  1P84 D;  1NYA A;  2BE6 A;  4ZKU A;  1NHL A;  3CWB E;  1FZF A;  2ZT9 D;  1K96 A;  4NPD A;  4YXW H;  1KQM C;  3WUV A;  2KZI A;  4MRX A;  2E76 D;  3PM8 A;  1X8Y A;  2FYN C;  2AMI A;  1RF1 C;  3SFD C;  1GQM A;  2RH0 A;  1FC2 C;  1M31 A;  4N1G A;  3RK2 C;  3NHI A;  1RE3 A;  4OGQ B;  3G3Z A;  1VQL P;  1DX7 A;  1KB9 D;  1QX5 B;  2I2R E;  2NLN A;  2QJK C;  2LVJ A;  1IH0 A;  1M46 A;  5APU A;  2MLF C;  5KJ7 C;  1WRK A;  1XVJ A;  4MVF A;  3JTD B;  3L35 A;  1IFD A;  1WDC C;  1KSO A;  1SL9 A;  2CT9 A;  2A06 E;  1KFM A;  3LW5 J;  1S6C A;  2MA2 A;  4JKT A;  2K7C A;  1W2E A;  1EZV D;  5AW8 B;  1KMI Z;  3SS5 A;  4WQ3 A;  5B5E H;  5CJ0 A;  3AE9 C;  1NTK E;  4PAL A;  1AP4 A;  1FDI A;  2ZT9 B;  3P32 A;  1HWT C;  3RL0 D;  1FZC C;  2KXP B;  1JTH B;  2E76 B;  2PRR A;  3P7K A;  1LJ2 A;  1N7S C;  2KQ6 A;  3DD4 A;  1U7M A;  1GZL A;  3CYZ A;  4H0L D;  4N5X A;  5KAI E;  1IK7 A;  3B87 A;  4PHK A;  1UWO A;  2YMK A;  1J7O A;  3SS3 A;  2WTY A;  1BT6 A;  5APW A;  5B8I B;  2E42 A;  1OSA A;  2I8D A;  1RF0 C;  2YIU C;  3CXH D;  3CR5 X;  2QPT A;  4WRI A;  1FOS F;  4TT3 H;  2HF5 A;  3QH9 A;  1GDT A;  2ITA A;  2GGM A;  2M1U A;  1L0N D;  3PHL A;  3PP5 A;  2GM4 A;  3L72 G;  1VQ6 P;  1BOD A;  1M56 D;  3RL0 B;  2BL0 C;  1VL2 A;  2YKO A;  5CCG D;  1QJT A;  1B7T Y;  1L0N J;  1OOH A;  1VPC A;  2KAX A;  3GHG C;  5PAL A;  3OB2 B;  1SLQ A;  4H0L B;  3PJI A;  3I5F C;  3CR2 A;  1NGM B;  3RLZ A;  4LGD E;  1W2B O;  2A4J A;  1CKK A;  5AW3 B;  4FQO A;  3VYI A;  2B87 A;  2F8P A;  2GA1 A;  2FFD B;  3SG2 A;  2HQW A;  4HSZ A;  3FWC A;  3L75 J;  1XA5 A;  3R1V A;  3CCQ P;  3KHE A;  1TIZ A;  3CWB G;  3EK8 A;  2IDB A;  5APS A;  1NAF A;  1KD1 Q;  4I2L C;  3R1O A;  1NTM K;  2BEC A;  4RKU J;  4WB4 A;  2OYI B;  3D10 A;  3H25 A;  2QEB A;  1SCM B;  1LTI C;  4W7Y A;  1QLE D;  4OZD A;  4IFM A;  3JTD C;  5JJG A;  3CCV P;  3B8E B;  1QV1 A;  3D78 A;  5EL2 A;  4LC1 A;  1Y1X A;  1V1F A;  4BRY B;  2Z4E A;  4UB8 E;  2QA4 P;  2A06 G;  1WRZ A;  2LUX A;  2RN0 A;  3IF4 A;  5AEQ A;  5TNC A;  1H0T B;  2L5Y A;  1SQV K;  4EOT A;  1U7J A;  2ZT9 C;  3BUN B;  1YX7 A;  1G1J A;  2KFF A;  1NTK G;  2E76 C;  3L36 A;  3RM1 A;  2ZJS E;  1KFX L;  1U5I A;  1J1E B;  1ZR4 A;  1OOI X;  1NIW A;  4C7R A;  4HH2 A;  3VTP C;  3MUD C;  3RK3 E;  1SQV D;  1JF0 A;  2ZXE B;  2H61 A;  1YJW P;  2ZFC A;  3CC4 P;  2NXQ A;  2MBX A;  3CX5 E;  1Q7Y Q;  2YNY A;  3VN0 A;  2N1T A;  1NVO A;  1YTZ T;  2M3B A;  4DIR A;  1ZRT E;  1FI6 A;  2JR8 A;  3HE4 A;  5AW4 B;  1N73 B;  2H43 A;  3LK0 A;  3SWF A;  1QTX A;  1JF2 A;  1S3J A;  1SQV J;  5KSZ A;  1J1D C;  1H88 A;  1VRK A;  5CSN A;  5AW5 B;  1BGY E;  3CCL P;  2UWJ E;  3JSV C;  2CTN A;  1C7V A;  3W68 A;  2PAJ A;  5CSJ A;  1Q86 Q;  3BFH A;  4YTP C;  1SW8 A;  1ORG A;  2M49 B;  1SQP D;  2JWW A;  1H89 A;  3M0D C;  4H0L C;  1X0T A;  2XZR A;  1OQP A;  1BSN A;  1JY3 N;  1S9K D;  3SIA A;  3ZNI A;  2LP2 A;  2KS1 A;  3GK2 A;  4MN0 A;  2WC6 A;  1EDL A;  2KIK A;  2JWD A;  1SQX K;  1Y47 A;  2FFD C;  2M29 A;  1JMB A;  2IPP A;  3AEA C;  5GTH E;  1YJN P;  3TF5 A;  1SQP J;  4PT1 A;  1OW7 A;  1FDO A;  3CCS P;  4F0Z B;  5CJ4 A;  2JTZ A;  2R32 A;  1JY3 P;  1DGU A;  1XFR A;  2W6A A;  5FI2 A;  3TGU E;  1FDM A;  3H32 A;  4O9B A;  3V4Q A;  2FJU B;  4OV2 A;  1X02 A;  1LT9 B;  3L70 D;  1SQX D;  1SQQ K;  2Q6Q A;  2OYI C;  1OW4 A;  5I2L A;  3EFG A;  1EH2 A;  1GD2 E;  1YIT P;  4OVN F;  2BKI B;  1KQV A;  1E79 H;  5CCG C;  1MHO A;  2W83 C;  3CS1 A;  3V2Q A;  3BXK A;  1S2E A;  5BVZ A;  3VMX A;  4C0K A;  3VRN A;  1F70 A;  3L70 J;  1SQX J;  5C39 A;  3S4R A;  1Q81 Q;  3AE2 C;  1IGV A;  3H1H J;  1LIN A;  1JC2 A;  2ZFD A;  2OTJ P;  3CZ2 A;  1F4Q A;  2LHL A;  3AE5 C;  2ZVO B;  1Z2C B;  3PAT A;  5APV A;  2IBZ E;  5DJT B;  3WNX B;  2L5X B;  3AKA A;  1CTR A;  2HPC B;  3G4S P;  3MSE B;  3D76 A;  2DW3 A;  2FYU K;  1DT7 B;  1CNP A;  3PFV A;  1SQQ J;  2EHB A;  2QE7 H;  1X9V A;  1J1E C;  4CFQ A;  2Y5I A;  4TNC A;  2LLT A;  3HE5 A;  1IJD B;  1NSH A;  1PGO A;  3P8C E;  1L4A C;  4ASW A;  2JXC A;  1PGQ A;  3O6B A;  1OMV A;  2FYU D;  1S72 P;  1CDN A;  1OW8 A;  1RTP 1;  1IO4 A;  1OZS A;  5H2F H;  1N73 C;  3SWK A;  3VRQ A;  1NJI Q;  1RQU A;  1OOG A;  1IZN B;  2BCB A;  2PYQ A;  4WQ2 A;  1D1O A;  5KLV D;  4RES B;  3WHT B;  2A45 G;  2WIT A;  1OOF A;  2HET A;  2FYU J;  1LXF C;  1OZO A;  2AUC A;  2WOS A;  3G6E P;  3L37 A;  1JFK A;  3DVK A;  1PPJ E;  1VQ9 P;  1BGY G;  3PRJ A;  1HQV A;  1OXZ A;  2WSC H;  3ICB A;  2O1J A;  2YMY A;  3CME P;  1LA3 A;  2KGB C;  1XFU O;  2F3Z A;  3IFM A;  2V4H A;  1KIL E;  2W90 A;  3FE9 A;  2R5B A;  3FE8 A;  1OMD A;  3V2N A;  5I2Q A;  4D6T J;  1NTZ G;  3N7N A;  1LTS C;  2GGZ A;  5AVS B;  1BOC A;  1RE3 C;  3HRN A;  1DF0 B;  5FI6 A;  1C3Y A;  3MHV A;  3S9O A;  4GUK A;  1Y0V H;  3OJA B;  3CCJ P;  1SMG A;  4DS7 A;  2WSS H;  1ZME C;  2L98 A;  2N1T D;  5D3O A;  1P84 H;  4I5J A;  4XFJ A;  5B66 E;  4NDB A;  1FBV A;  3TGU G;  4U3F D;  3CD6 P;  4I6M C;  3TDI A;  3SG7 A;  1HJ0 A;  4I7Z B;  3TSI A;  1MUX A;  1K9P A;  4P5O E;  3BUM B;  4C7N B;  1ZAC A;  2PFX A;  2OAR A;  2YKQ A;  4QJ5 B;  2JDI H;  1CFD A;  2KNC A;  2M8U A;  2QM7 A;  3F5H A;  4L76 A;  1PZQ A;  1U5I B;  1KB9 H;  3AAJ A;  1KWO B;  3M91 A;  1A02 J;  2QJY C;  1M45 A;  1FF1 A;  2Z5H A;  1NO4 A;  1ZXG A;  2Y4Q A;  5TIS H;  3IR9 A;  2P10 A;  2IBZ G;  4CID A;  3PLN A;  1IKU A;  3CR4 X;  4K35 A;  1NAY A;  5GQQ C;  5IBW A;  2N1T B;  5APQ A;  1NU1 G;  2KAV A;  3PM2 A;  1MR8 A;  1QV0 A;  1SFC D;  1T2K D;  3D0Y A;  1CLM A;  2YKP A;  4GIF A;  1K8A Q;  5CHX A;  2F2O A;  2KLE A;  2GUV A;  2FCE A;  1J55 A;  4F7F A;  1RJV A;  2P58 A;  1N0Y A;  1W5C E;  3IVT A;  1NX2 A;  1QAS A;  1DD3 A;  1T8Z A;  1ZR2 A;  1KYO D;  2XKM A;  5CBO A;  2KFH A;  2M0R A;  2RKL A;  3H1I E;  1N2D C;  1TNQ A;  1WY9 A;  2WCJ A;  2LP3 A;  1Q82 Q;  2WSE H;  2JJL A;  5AW0 B;  2M97 A;  1QVF O;  2P70 A;  1VQ8 P;  3GOF A;  1N7S D;  4YGC B;  2FYN B;  2LMU A;  1F4O A;  4I5L B;  2QVA A;  2KS1 B;  1GL2 A;  1P84 I;  4WVZ A;  5KLI B;  1HTL C;  3CXH H;  2CK3 H;  1Q90 D;  3CPW O;  1JMM A;  1JEK A;  2AXT E;  1CDP A;  1PPJ G;  5BU5 A;  3NSI A;  3KDP B;  2KYF A;  1SFC B;  3PJS K;  1YIJ P;  1IFI A;  2LXB A;  1FE6 A;  4A7P A;  4YI8 A;  2KI4 C;  1WDC B;  1LVC D;  2Q3I A;  3A3Y B;  2OPO A;  4HYT B;  2WC5 A;  5E79 H;  3Q5R A;  1VF5 D;  4IOI H;  1IFP A;  1TWO A;  4AOM A;  2N9Y B;  1KB9 I;  2WCB A;  3MP7 B;  3P8M C;  5BU8 B;  4YI9 A;  2F33 A;  1WRL A;  1RH5 B;  2FXP A;  3IAO A;  3AE1 C;  1JUN A;  1DD4 A;  1URQ D;  2Q9I A;  3EQ2 A;  1S3P A;  5AVZ B;  1TOP A;  1N7L A;  5ER4 X;  1YUT A;  4XA4 A;  5KAF E;  1QLK A;  1N7S B;  2H88 C;  1EZV I;  2H8P D;  2KGR A;  2E6W A;  1NTM E;  3HTK B;  4YGA A;  3L71 E;  1RFJ A;  3WHU B;  2HR3 A;  4I7Z C;  4ORA B;  4R4L A;  1R2U A;  3R2P A;  2OYO A;  2L51 A;  3H1L E;  5I8N A;  1K90 D;  4L75 A;  1DJZ A;  2WT7 A;  1AFO A;  2AXC A;  4GBA A;  1MKM A;  1LTJ A;  3OAK A;  1XTG B;  4N78 E;  1KWO C;  2C9L Y;  4M3L A;  3NSL A;  1IC2 A;  1R6P A;  2BCC D;  3BCC J;  1VF5 B;  1G8I A;  3Q3D A;  4C0J A;  4JBZ A;  1VQM P;  5AFP A;  2WPV B;  2KB7 P;  1QAT A;  3WU2 H;  2KHN A;  1EC5 A;  2ZRS A;  2ZKM X;  2Y1N A;  2WSC J;  5APX A;  4Z1M H;  2H2K A;  1URQ B;  2BE4 A;  2N1T C;  3EKJ A;  3CXH I;  4N1F A;  1CM1 A;  2BCC J;  3KQG A;  3H1K E;  3FWL A;  5APT A;  5JOL A;  1TU3 F;  3GHG B;  3SG4 A;  2MJW B;  3A0B H;  2H89 C;  5AW2 B;  1SKT A;  4PHN A;  4HRH A;  3TK1 A;  1FS0 E;  1YQ3 C;  1IK9 A;  1M8O B;  3D71 A;  1RRO A;  5AW6 B;  1DGV A;  3MGN A;  4XYN A;  3CWG A;  3F45 A;  2P1J A;  4PJ0 E;  4W80 A;  1YR5 A;  4IFD K;  3CZT X;  4UB6 H;  1T14 A;  3ABV C;  3BUO B;  5DKQ A;  3H1I G;  5B5E E;  1ZN5 A;  1XYD A;  2JXL A;  5KLI C;  3ZWH A;  2I1K A;  3VRR A;  3L75 G;  1HF9 A;  2LR2 A;  2QG4 A;  1REC A;  1L0L K;  4M2O A;  2XND H;  3HD7 A;  3O6Q A;  1OFC X;  1FPW A;  1SFC C;  1T2K C;  1DMO A;  3C1L A;  1QXP A;  5AXI A;  4GAO A;  1SNL A;  1EXR A;  2ZYA A;  1QGK B;  2CPS A;  3NTN A;  4EYY Q;  3A8R A;  2YGU A;  2OGU A;  1ZV8 A;  1B47 A;  1GK6 A;  1L0L D;  3CTN A;  1TNW A;  1ZLL A;  2E5T A;  1R5L A;  3L74 D;  4GKG A;  3IQQ A;  4MZL A;  1ZW0 A;  4A4B A;  5AVX B;  3FS7 A;  2ERB A;  1VQ7 P;  1AK8 A;  4YGE B;  2QDI A;  2KNC B;  1L0L J;  2Q1K A;  3L74 J;  1OWA A;  1PVA A;  3GG2 A;  2WCF A;  1DIP A;  4OCI A;  3S1K A;  1SQB E;  2L4I A;  2FXO A;  5CCH A;  1L0N K;  3R1P A;  1IQ5 A;  4AQJ A;  4GDO A;  1KTM A;  1SPY A;  1NTM G;  4WBA A;  3L71 G;  1YRT B;  4NPF X;  2WVR A;  2QIW A;  1W7J B;  1SY9 A;  1XFX O;  2Y0D A;  3H1L G;  1EJ3 A;  2WSE J;  4USL A;  1J1D B;  1VF5 C;  1NWD A;  1GGZ A;  3D0Y B;  5J3X A;  2BEZ F;  3HUS A;  1IFM A;  4H44 D;  1G1I A;  2K2F A;  3V2R A;  1SK6 D;  4CPV A;  1URQ C;  1IG5 A;  1S5L H;  1GW3 A;  2HFE D;  3L47 A;  4YPC A;  1SVF A;  1BCC E;  1BE3 E;  2LMT A;  1MF8 B;  1G2C A;  3IQO A;  1UII A;  3NMD A;  3H1K G;  3I56 P;  3DYE A;  3TDK A;  1FAV A;  4LLH A;  1A75 A;  1QVG O;  4ZMD A;  3OX5 A;  1Z4H A;  3CDN A;  3C1V A;  2L4H A;  3L4F A;  1MXE A;  1ZFS A;  5M1B A;  4IL1 A;  1ZMZ A;  1FZB A;  2RMZ A;  4PE7 A;  3MZW B;  4INX A;  4YBH B;  2OQQ A;  3I5H B;  2WND A;  2FJY A;  4ETO A;  4H44 B;  1LWU A;  5KU1 A;  3AE8 C;  2K60 A;  1CI6 A;  1L4A D;  1USE A;  1KCY A;  1S5L X;  2LC5 A;  1PSR A;  5K89 A;  3NXS A;  3T97 A;  3OX6 A;  1JBA A;  1TUJ A;  3BYA A;  2QEH A;  1SS1 A;  4ZCV A;  4L9M A;  2JKV A;  2KP8 A;  1T6A A;  1AUI B;  1BLQ A;  1UHH A;  2AEF A;  1YRU B;  1K9K A;  2O3J A;  3CCU P;  1VDF A;  4I5N B;  1K9M Q;  1K04 A;  3RBZ A;  4DRW A;  1TN4 A;  2K9J A;  3H1J E;  3EVU A;  2FKW B;  4ICB A;  2KI7 B;  1SBJ A;  1PP9 E;  2BAS A;  5AVW B;  1FOS E;  1YI2 P;  3PSR A;  3EVR A;  3EK7 A;  3AEG C;  1C7W A;  2ZN9 A;  1UHN A;  3H1H G;  2WT7 B;  4M2P A;  3CC7 P;  1DJH A;  3B86 A;  2KYC A;  2QM8 A;  3N4X A;  5KTB A;  2L2E A;  3KZI H;  4PHJ A;  1L4A B;  2Y1M A;  2JWA A;  1SQQ G;  1SQB G;  3SJS A;  2CBL A;  2JT0 A;  4PE4 A;  2ZNE A;  1UHI A;  5DIC A;  3L72 D;  3FIA A;  1DH3 A;  4XJK A;  1UP5 A;  1LP1 A;  3AED C;  3BOW B;  3HD7 D;  3L73 D;  3M9Q A;  1SQP K;  4HKZ H;  1QIV A;  2KBI A;  2WMM A;  1K2H A;  1S5G Z;  1OVR A;  1R5S A;  3L72 J;  3E7K A;  4K3A A;  1SYM A;  1B8L A;  2FY8 A;  2JNX A;  3KYQ A;  3L73 J;  4NDC A;  1GMJ A;  4HRG A;  5AVT B;  2K3R A;  3Q1M A;  5D69 A;  5AVY B;  2HYN A;  2M5A A;  1S1C X;  4GOD A;  3H4S E;  2O5G A;  5ER5 A;  1NTZ E;  3GLM A;  1BCC G;  1BE3 G;  5L8R J;  2SPZ A;  1BG1 A;  3D73 A;  4L74 A;  3D6Z A;  1GTW A;  2IYO A;  2WPR A;  1GL2 C;  3F89 A;  2B89 A;  3CWB D;  1N8R Q;  2QJP C;  1LTT C;  5CCH D;  3HD7 B;  4DCK A;  1LKJ A;  1SP4 A;  2FXM A;  2JNF A;  1F54 A;  3I5H C;  4D6T G;  5GTI H;  3PTZ A;  3CWB J;  1M57 D;  1KYO H;  4H44 C;  2W27 A;  2K37 A;  1HJB A;  1A4P A;  3AEC C;  1CFP A;  1F55 A;  1H8B A;  3LCP C;  2A06 D;  1NKZ B;  1SL8 A;  3TNU A;  2KSP A;  3B4S A;  3S0D A;  3B5N A;  3W67 A;  3CLN A;  3Q5P A;  1NTK D;  2QJY B;  3GF7 A;  1FZE A;  2I94 A;  1KFU S;  1KQS O;  4QJ4 B;  3AE3 C;  2KI6 D;  3CI9 A;  1NU1 E;  1YBK A;  2IFM A;  3H1J G;  3BCC E;  5HKZ A;  2JEE A;  1PP9 G;  1CW5 A;  3BAS A;  2YO3 A;  1LTJ C;  5KLV K;  4OR9 B;  2JO1 A;  2ZYG A;  1CM4 A;  3NHT A;  1NX1 A;  1GJY A;  1NCY A;  3SIB A;  1CZQ A;  4U7J A;  1A2X A;  1XTC C;  4Y99 C;  2EGD A;  5CSI A;  4IL6 H;  1YYC A;  2FCD A;  3BFB A;  4GNK B;  1R8E A;  1K9U A;  2D2C D;  2I7A A;  4R1E A;  4PD4 E;  3TYY A;  2FOT A;  3KPX A;  2COL B;  2Q4U A;  1BSH A;  2KDH A;  2C0W A;  4PE0 A;  3B71 A;  2G8Y A;  1DQE A;  2K7O A;  2W6B A;  5K5G B;  3NFQ A;  1J7P A;  1S5G Y;  3O4Y A;  3EWK A;  1GU4 A;  1KYO I;  3AEB C;  5KLV J;  4MN4 C;  2B87 B;  1S4X A;  1K95 A;  1PUL A;  1JY2 O;  2C0X A;  3TS5 B;  1MFT A;  1S6I A;  2BCA A;  3BUW B;  3B7A A;  3JCU H;  1AVS A;  3DVM A;  2KI4 B;  1HT9 A;  1ODB A;  4FTG A;  1WLZ A;  4YGB B;  1N65 A;  1PGP A;  1QX7 A;  4PCW A;  1LWU B;  2JT3 A;  2OTK E;  4A4C A;  1CI6 B;  2LLS A;  2Y0C A;  4E68 A;  1RE4 A;  1Q80 A;  1KB9 E;  1TCO B;  3HD7 C;  2Q7C A;  4U8D A;  3T97 B;  2D2C B;  1FU1 A;  4OWF A;  1S26 D;  1BR1 B;  3SSU A;  1LGH B;  3CMA P;  3KHU A;  5DKR A;  5TIS E;  1IIO A;  5G08 A;  2LV7 A;  1EZV E;  1PV3 A;  3V4W A;  2JP3 A;  2W8Z A;  3NSO A;  1RK9 A;  1GM0 A;  4YRU A;  1EXI A;  2LMV A;  3UIA A;  1Z56 A;  1QWV A;  3JVT B;  1YVH A;  4U3F J;  1KFX S;  2HQ8 A;  4EDF A;  2KK7 A;  1CMF A;  1TTX A;  1JUO A;  2OS8 B;  1JCC A;  2ZXX A;  1KIL A;  4IJ7 A;  3SG6 A;  2E74 C;  3GK4 X;  5CCH C;  1EDI A;  1PAL A;  2K88 A;  2E5Y A;  2CNP A;  1TUZ A;  5I2O A;  2EC6 B;  1AVY A;  1Y8A A;  1MQ1 A;  2MAZ A;  1YUS A;  3HE4 B;  3BCC G;  3CCM P;  3RK3 D;  3CXH E;  4XJK B;  1MZ9 A;  4B86 A;  1K93 D;  3CX5 D;  5KKZ C;  1L0N E;  3HUS C;  2Q91 A;  2WCM A;  2NCP A;  1DJX A;  1ZRT D;  3EVV A;  1X22 A;  3KEV A;  2LE9 B;  1SCV A;  3VMY A;  2M1K B;  2AEJ A;  2LM5 A;  3A5T A;  1YHQ P;  2CPB A;  2L5G B;  1AHR A;  2GUS A;  5E79 E;  1BGY D;  1H4B A;  1X79 B;  1M90 Q;  2F2P A;  2M5A B;  3CLQ A;  3B5N D;  3FWB A;  2M9G A;  1K05 A;  3L75 E;  1JCD A;  1ZOY C;  3AE4 C;  2KI6 C;  1CMG A;  4EIJ A;  1PFI A;  4ORC B;  3SG3 A;  1EG3 A;  3TS5 C;  3G9R A;  2C9N Y;  1NTZ D;  1DEL A;  2O01 H;  3BRT B;  4L73 A;  3RK3 B;  3FWN A;  2ZAE B;  4AUW A;  4P2Y B;  3VRP A;  1WMK A;  5D7F A;  3H32 B;  1BU3 A;  3K1E A;  1A03 A;  5HKY A;  1JWD A;  3CL3 D;  3IN6 A;  2KQY A;  3I5G C;  3M0A A;  3VP8 A;  2WWW A;  1LWU C;  3WMM 0;  3ZDM A;  1FW4 A;  4I1L A;  4MLW A;  1OE9 B;  2KBM A;  1JOC A;  2Y9Z A;  3G71 P;  3TGU D;  1KK7 Z;  2D2C C;  3ITK A;  1PK0 D;  1S36 A;  1QX2 A;  4JF7 A;  3TNU B;  1Y9B A;  3B5N B;  1M1J A;  4KHX A;  3WU2 E;  4MBE A;  2I1J A;  5FI7 A;  3V5B A;  3HX4 A;  2KOG A;  2V7Q H;  1VQK P;  1K8U A;  2LKM A;  3PLF B;  1QL2 A;  1EZV G;  2XU6 A;  4MRY A;  3GW6 A;  3OGN A;  3JVT C;  3C9I A;  3U59 A;  4NDD A;  2IBZ D;  2OS8 C;  1XK4 A;  1P28 A;  3HE5 B;  2MRD A;  2JRF A;  3UO9 A;  1SQV E;  3L4L A;  2H61 C;  3OHM B;  4UB6 E;  4TLF A;  1K94 A;  1HUC A;  2K0J A;  1J1E A;  2QSI A;  2EC6 C;  4AQR D;  1C07 A;  1USD A;  4CFR A;  5AW7 B;  1VQP P;  3P8C D;  1RQV A;  3I5I B;  2M7N A;  2WOR A;  2Y9Y A;  5KAF H;  1DEE G;  2LNK A;  3KPE A;  5FYX A;  1OIP A;  2ZVN B;  1L0N G;  1J7Q A;  1IJ6 A;  4EI2 A;  3Q2Y A;  4PD4 D;  4GPL B;  2O60 A;  3A0H H;  4GOF A;  2P2U A;  1N86 A;  1FI5 A;  3E3R A;  1PPJ D;  1SQP E;  2AAO A;  2P7J A;  3S0F A;  2WCH A;  2BEQ D;  1S9K E;  3OP0 A;  2YXR B;  1PIX A;  2XV5 A;  1DJW A;  1KIL D;  2HOD A;  4MSP A;  2VRS A;  5AER A;  1OVU A;  1L2O B;  3E1I A;  3RK3 C;  2MJZ A;  2V53 A;  1NPQ A;  1PL5 A;  1JFJ A;  4ZNC A;  2H8V A;  1XFW O;  4HB1 A;  1KOR A;  3LIE A;  2QEV A;  4GGF A;  3L70 E;  1SQX E;  1LTA C;  2KYV A;  2F3Y A;  3UNW A;  1FZG A;  5DKN A;  2FYZ A;  1ALW A;  4MZJ A;  3H1H E;  1QIW A;  1T3U A;  2BNX A;  3D70 A;  3M0W A;  2K1A A;  1Y1U A;  4JPZ B;  2KLU A;  2KLD A;  1KK7 Y;  4DT0 A;  5AW1 B;  4JQ0 D;  1LT9 A;  4YXD C;  2K61 A;  3B5N C;  2E75 D;  5AVV B;  2O01 N;  4PJ0 H;  1MXL C;  2BAP A;  1S5L E;  1MV8 A;  2JOJ A;  2LCP A;  2BBM A;  1SQQ E;  1XFZ O;  1HGZ A;  1IFJ A;  5DJU B;  1BJF A;  2CCM A;  1GW4 A;  1HH0 A;  2IX7 C;  1V1G A;  1KIL B;  4WY4 A;  3QRX A;  2PQL A;  1GL2 D;  1LTB C;  2R44 A;  2WC8 A;  1WRG A;  1KSM A;  2M3E A;  2R3C A;  2J58 A;  3KXD A;  1A02 F;  2QRX A;  1CFF A;  2HPC A;  1QX8 A;  1UUS A;  2LHI A;  1NOH A;  1KFU L;  1KC8 Q;  1LTG C;  1T3J A;  1K73 Q;  2P6B B;  1AV1 A;  5EFW B;  1RWY A;  5BPJ A;  3S0B A;  1F71 A;  5HLO A;  2FYU E;  5APY A;  1SQV G;  4Y28 J;  2KPH A;  2H7H A;  1CLL A;  1OVV A;  3V2L A;  3DZT A;  1EDK A;  2LAN A;  1L2P A;  2E75 B;  2O01 J;  1DJY A;  3I5I C;  5KLV E;  2NZ2 A;  3WUT A;  4ZCU A;  3BAT A;  2M8R A;  1CB1 A;  1KV4 A;  3OB1 B;  1D7M A;  4H13 D;  3L73 G;  4PHM A;  1GL2 B;  3H1I D;  5KAI H;  2QJP B;  1N2D A;  4JD9 A;  3FXE A;  3TDU A;  4QMA A;  4ZKP A;  4D6T E;  1HVV A;  3BQ3 A;  2QEO A;  2Q3E A;  3L75 D;  2JUL A;  1KN7 A;  2XNX A;  2L50 A;  3DF0 A;  1TNP A;  3BFA A;  1VQO P;  4I5K A;  4NPE A;  1NCZ A;  3H1I J;  2P67 A;  1RHZ B;  3GMA A;  3R4Y A;  5HL1 A;  1SQP G;  1EQ7 A;  1Y1A A;  3FE6 A;  2WSF J; 
#chains in the Genus database with same CATH homology
 4OKH A;  4CID A;  3O78 A;  1LA0 A;  1IKU A;  3CLN A;  3CR4 X;  3I5F B;  1L2O C;  4M2Q A;  1UHJ A;  1SR6 C;  5GQQ C;  4D1E A;  5IBW A;  2CXJ A;  2BBN A;  2G9B A;  2KAV A;  3A4U B;  1MR8 A;  1QV0 A;  1NYA A;  1GGW A;  2I94 A;  2BE6 A;  1CLM A;  1KFU S;  3D0Y A;  4BY4 A;  4QJ4 B;  2KI6 D;  2F2O A;  5HKZ A;  3TUY B;  1K96 A;  2FCE A;  1J55 A;  1DF0 A;  4NQG A;  1KQM C;  1YUR A;  1RJV A;  4MRX A;  1N0Y A;  3PM8 A;  1NX2 A;  1QAS A;  2AMI A;  1ALV A;  1GQM A;  2PAS A;  4BY5 A;  1M31 A;  2KFH A;  2M0R A;  4N1G A;  4OR9 B;  1IRJ A;  1CM4 A;  1EL4 A;  5F6T A;  1NX1 A;  1GJY A;  1NCY A;  1TNQ A;  3SIB A;  1WY9 A;  2LP3 A;  2SCP A;  1KK8 B;  1A2X A;  2M97 A;  2G2B A;  1QX5 B;  2I2R E;  2NLN A;  2EGD A;  3GOF A;  5CSI A;  2L0P A;  1SL7 A;  2LVJ A;  4YGC B;  1IH0 A;  1W7I B;  1M46 A;  2LMU A;  2MLF C;  1WRK A;  1F4O A;  1XVJ A;  2FCD A;  4HRE E;  4I5L B;  4MVF A;  3JTD B;  4GNK B;  1WDC C;  1KSO A;  1K9U A;  1SL9 A;  2CT9 A;  2I7A A;  4R1E A;  1JSA A;  1G4Y R;  1M63 B;  2FOT A;  1S6C A;  2MA2 A;  3KPX A;  1CDP A;  2COL B;  2Q4U A;  3NSI A;  2KDH A;  2K7C A;  4PE0 A;  2MHH A;  1OOJ A;  2K7O A;  1TRF A;  3WXA A;  2KYF A;  4WQ3 A;  3O2P A;  1J7P A;  1S5G Y;  3VGO A;  3O4Y A;  2KI4 C;  4PAL A;  1WDC B;  4YI8 A;  1AP4 A;  1LVC D;  2OPO A;  4YGD B;  1K95 A;  1PUL A;  3PAL A;  3TS5 B;  1S6I A;  2BCA A;  3BUW B;  4AOM A;  2KQ6 A;  3EK4 A;  1AVS A;  1A29 A;  2K7B A;  2WCB A;  3DD4 A;  1NX0 A;  4YI9 A;  2F33 A;  3DVM A;  2ISD A;  1NUB A;  2KI4 B;  1WRL A;  4N5X A;  1HT9 A;  1ODB A;  1QLS A;  4FTG A;  1WLZ A;  4PHK A;  1S3P A;  1UWO A;  2MLE C;  4YGB B;  1N65 A;  1J7O A;  1BT6 A;  1QX7 A;  1TOP A;  3EKH A;  1YTZ C;  1YVL A;  1ZUZ A;  4PCW A;  1YUT A;  5ER4 X;  1QLK A;  2JT3 A;  3AKB A;  5B8I B;  3NSK A;  4A4C A;  2LLS A;  2KGR A;  1OSA A;  2E6W A;  4E68 A;  1Q80 A;  1AJ5 A;  1TCO B;  4U8D A;  4YGA A;  3CR5 X;  4DUQ A;  1RFJ A;  2QPT A;  1NCX A;  1S26 D;  4WRI A;  3WHU B;  1BR1 B;  3PN7 B;  4ORA B;  2DOQ A;  1R2U A;  4PDZ A;  2PRU A;  3AAK A;  2L51 A;  2HF5 A;  5I8N A;  1K90 D;  4MZK A;  2GGM A;  5DKR A;  2M1U A;  1DJZ A;  1M39 A;  5G08 A;  5KTY A;  2PAL A;  2JU0 A;  5CSF A;  4GBA A;  1BOD A;  2LV7 A;  1KWO C;  1Y6W A;  3NSL A;  1B8C A;  1XFY O;  3NSO A;  1RK9 A;  1R6P A;  1IQ3 A;  2BL0 C;  4YRU A;  1G8I A;  4C0J A;  1QJT A;  2LMV A;  1B7T Y;  5AFP A;  2KAX A;  3JVT B;  1QAT A;  1YVH A;  2KHN A;  1KFX S;  2HQ8 A;  2ZRS A;  5PAL A;  3OB2 B;  2ZKM X;  3CR2 A;  2Y1N A;  3I5F C;  2H2K A;  1CMF A;  1TTX A;  3RLZ A;  2BE4 A;  1JUO A;  2A4J A;  1CKK A;  3EKJ A;  4N1F A;  1CM1 A;  2OS8 B;  1S1E A;  4FQO A;  3SG6 A;  3GK4 X;  2F8P A;  5JOL A;  2PSR A;  1PAL A;  3SG2 A;  2HQW A;  4HSZ A;  2I18 A;  4C0L A;  3SG4 A;  3FWC A;  2MJW B;  3TUY C;  1XA5 A;  2CNP A;  5I2O A;  1SKT A;  2EC6 B;  3KHE A;  1TIZ A;  1MQ1 A;  2MAZ A;  4PHN A;  1YUS A;  3EK8 A;  4HRH A;  1SCM C;  2KAY A;  1G33 A;  4XJK B;  1RRO A;  5AAN A;  1K93 D;  1UUR A;  2HPS A;  1DGV A;  4XYN A;  2BEC A;  3CWG A;  3F45 A;  1XFV O;  1YR5 A;  4CLN A;  3CZT X;  1KK8 C;  2Q91 A;  3BUO B;  1BMO A;  3D10 A;  5DKQ A;  2NCP A;  1DJX A;  3KF9 A;  3EVV A;  3KEV A;  2LE9 B;  1SCV A;  2BKH B;  2M1K B;  1SCM B;  1XYD A;  2LM5 A;  4JWQ A;  2JXL A;  1YX8 A;  3JTD C;  5JJG A;  3ZWH A;  1AHR A;  1TNX A;  1XK4 C;  2JT8 A;  1QV1 A;  2KFG A;  3VRR A;  1H4B A;  1Y1X A;  1REC A;  2F2P A;  1V1F A;  1AJ4 A;  4M2O A;  1WRZ A;  3FWB A;  5CPV A;  2M9G A;  2LUX A;  1J7R A;  1FPW A;  1OFC X;  5AEQ A;  2LVK A;  5TNC A;  2KI6 C;  1CMG A;  1DMO A;  1QXP A;  5AXI A;  3NXA A;  4GAO A;  1SNL A;  1EXR A;  3A8R A;  3BUN B;  4ORC B;  3SG3 A;  1YX7 A;  2KFF A;  1EG3 A;  3TS5 C;  1B47 A;  3RM1 A;  4AQI A;  3SG5 A;  1IWQ A;  1KFX L;  1U5I A;  3CTN A;  1TNW A;  3DVE A;  1NIW A;  4P2Y B;  3VRP A;  1A75 B;  1OMR A;  3IQQ A;  4MZL A;  5D7F A;  4A4B A;  1BU3 A;  2ZND A;  1A03 A;  5HKY A;  3FS7 A;  1JWD A;  2KQY A;  1JF0 A;  3I5G C;  3LL8 B;  3GK1 A;  2H61 A;  1FW4 A;  1AK8 A;  4YGE B;  3DVJ A;  4MLW A;  4Q04 A;  2NCO A;  2NXQ A;  2MBX A;  1OE9 B;  2KBM A;  2Y9Z A;  4DIR A;  2JC2 A;  1PVA A;  1KK7 Z;  1FI6 A;  2WCF A;  2ZN8 A;  1YUU A;  3DF0 B;  3LK0 A;  4OCI A;  1B4C A;  1QTX A;  1DVI A;  1JF2 A;  2L4I A;  3PN7 C;  1IQ5 A;  1PK0 D;  1QX2 A;  1S36 A;  3I5G B;  4AQJ A;  5KSZ A;  3IF7 A;  1SPY A;  1VRK A;  5CSN A;  2D8N A;  1YRT B;  4MBE A;  1W7J B;  1SY9 A;  1XFX O;  2CTN A;  3HX4 A;  1SRA A;  1EJ3 A;  1C7V A;  3BUX B;  1K8U A;  1XO5 A;  4USL A;  1IJ5 A;  5HKW A;  3PLF B;  1NWD A;  1GGZ A;  3D0Y B;  5J3X A;  4MRY A;  5CSJ A;  1QVI Z;  3JVT C;  1SW8 A;  4UPG A;  2M49 B;  2JWW A;  4GGF C;  2K2F A;  2QAC A;  1B1G A;  1SK6 D;  4CPV A;  4NDD A;  1IG5 A;  1OQP A;  3SIA A;  3ZNI A;  2LP2 A;  1PVB A;  2SAS A;  3GK2 A;  2OS8 C;  4MN0 A;  2M7L A;  1XK4 A;  1MWN A;  2MRD A;  2JRF A;  2LMT A;  2LVI A;  2M29 A;  1MF8 B;  2M3W A;  2H61 C;  3OHM B;  1BR4 B;  2K7D A;  3IQO A;  1K94 A;  4F0Z B;  2K0J A;  1J1E A;  2EC6 C;  2JTZ A;  1C07 A;  1A75 A;  4CFR A;  3OX5 A;  1DGU A;  3C1V A;  1TCF A;  2L4H A;  1MXE A;  1ZFS A;  2FJU B;  4ORB B;  4IL1 A;  2B1U A;  4OV2 A;  3I5I B;  1X02 A;  1ZMZ A;  2M7N A;  1BF5 A;  2WOR A;  1CDM A;  4PE7 A;  2Y9Y A;  5I2L A;  1EH2 A;  2LNK A;  5FYX A;  4OVN F;  2BKI B;  4YBH B;  1KQV A;  1MHO A;  3CS1 A;  3I5H B;  2WND A;  1J7Q A;  3BXK A;  1IJ6 A;  4ETO A;  2LUC A;  2OTG B;  4C0K A;  1CLB A;  1L7Z A;  4GPL B;  3VRN A;  2O60 A;  5KU1 A;  1F70 A;  2BCX A;  1KCY A;  2LC5 A;  1IGV A;  1WLM A;  1PSR A;  3E3R A;  1LIN A;  2PVB A;  5K89 A;  1JC2 A;  2ZFD A;  2AAO A;  1FI5 A;  1F4Q A;  3OX6 A;  1JBA A;  2LHL A;  3PAT A;  1UHK A;  3BYA A;  1J1D A;  3WNX B;  2VRG A;  3OP0 A;  4ZCV A;  4L9M A;  1ZOT B;  2L5X B;  3AKA A;  1CTR A;  3MSE B;  1AUI B;  1BLQ A;  1DJW A;  1UHH A;  1YRU B;  4MSP A;  1K9K A;  2PMY A;  1DT7 B;  1CNP A;  3PFV A;  2EHB A;  4I5N B;  5AER A;  1L2O B;  1SR6 B;  4DRW A;  2V53 A;  1NPQ A;  1JFJ A;  1F8H A;  1TN4 A;  3K21 A;  3EVU A;  4CFQ A;  2Y5I A;  4TNC A;  4ICB A;  2LLT A;  2JQ6 A;  1SBJ A;  1CDL A;  1XFW O;  3PSR A;  3EVR A;  1NSH A;  3EK7 A;  2JXC A;  1C7W A;  2LVV A;  2ZN9 A;  1UHN A;  4GGF A;  4M2P A;  3O6B A;  1KQM B;  1OMV A;  2F3Y A;  1CDN A;  2TN4 A;  5DKN A;  1RTP 1;  1ALW A;  3CGA A;  4MZJ A;  1OZS A;  3HCM A;  1DJH A;  1QIW A;  2KYC A;  4GGN A;  3M0W A;  2L2E A;  3VRQ A;  1Y1U A;  3LK1 A;  4JPZ B;  1EG4 A;  3LLE A;  2JPT A;  2BCB A;  1KK7 Y;  4PHJ A;  4WQ2 A;  2Y1M A;  1D1O A;  2IS9 A;  4JQ0 D;  2K61 A;  3WHT B;  2KOT A;  3SJS A;  2NZ0 A;  2CBL A;  2HET A;  1LXF C;  1OZO A;  2AUC A;  1MXL C;  2JT0 A;  2ZNE A;  4PE4 A;  2WOS A;  1UHI A;  2WCE A;  1JFK A;  3DVK A;  2JOJ A;  2LCP A;  2BBM A;  3FIA A;  1XFZ O;  3KO0 A;  2JZI A;  1BJF A;  1DJI A;  1UP5 A;  2CCM A;  4XJK A;  1HQV A;  3BOW B;  1S6J A;  1V1G A;  3ICB A;  3QRX A;  1LA3 A;  2LAP A;  1QIV A;  2KBI A;  2KGB C;  1XFU O;  1K2H A;  2F3Z A;  2WC8 A;  1KSM A;  1S5G Z;  1CFC A;  1QVI Y;  1NP8 A;  2E30 A;  1SYM A;  1B8L A;  1OMD A;  2KNE A;  1NX3 A;  1B8R A;  2JNX A;  2GV5 A;  1PRW A;  5I2Q A;  4NDC A;  1PSB A;  1CFF A;  4PE1 A;  4HRG A;  5D69 A;  1UUS A;  2GGZ A;  2LHI A;  1BOC A;  1KFU L;  5HYD A;  2P6B B;  2O5G A;  3H4S E;  4GFT A;  5ER5 A;  1DF0 B;  2JTT A;  2RGI A;  1RWY A;  5BPJ A;  1F71 A;  5HLO A;  1BG1 A;  4GUK A;  1Y0V H;  1CLL A;  1SMG A;  4DS7 A;  2LAN A;  2L98 A;  1DJY A;  3I5I C;  4I5J A;  1B9A A;  2K8M B;  4NDB A;  2ZRT A;  1DJG A;  1FBV A;  5HLV A;  4ZCU A;  2LLU A;  1CB1 A;  3OB1 B;  4DCK A;  1LKJ A;  3SG7 A;  3TDI A;  2JNF A;  4PHM A;  3I5H C;  1F54 A;  1MUX A;  1K9P A;  1QS7 A;  2K2A A;  3TDZ A;  4P5O E;  3BUM B;  2OTG C;  1N2D A;  1E8A A;  1ZAC A;  3TDU A;  4QJ5 B;  1CFD A;  3BQ3 A;  3TZ1 A;  3VRO A;  1A4P A;  2M8U A;  1CFP A;  2JUL A;  2R2I A;  1U5I B;  2L50 A;  1DTL A;  1TNP A;  3AAJ A;  1KWO B;  3DF0 A;  3LCP C;  1F55 A;  4I5K A;  1H8B A;  1NCZ A;  1B7T Z;  4QJ3 B;  1M45 A;  2BL0 B;  3BOW A;  4MEW A;  1SL8 A;  1FF1 A;  2KSP A;  1Y1A A;  2Y4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...