4JPZB

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
b'EPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor 13
molecule tags Transport protein
source organism Homo sapiens
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
total genus 43
structure length 142
sequence length 142
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jpzB01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jpzB02
5CSFA 2JC2A 1K90D 1K94A 5HLVA 2LVJA 1Q80A 4DCKA 1SKTA 2NZ0A 4FTGA 4OKHA 3I5IB 3NXAA 2BBNA 5J3XA 1C07A 1H8BA 5I2OA 1JFKA 1L7ZA 1F55A 1GGWA 2PRUA 2KYCA 1S6IA 1MR8A 1TCOB 3JTDC 2MAZA 1YTZC 1U5IA 1G33A 1MF8B 1QV1A 3BUXB 1CDMA 4MRXA 1RK9A 2O5GA 3FS7A 1JBAA 1K2HA 2KGBC 2CNPA 2LMVA 2BL0B 3O78A 3A4UB 3M0WA 1GQMA 1K9UA 3IQQA 1NWDA 1NX3A 2AUCA 2CXJA 2WCFA 3OX5A 4D1EA 2JNFA 1CNPA 4DUQA 2LUCA 2EHBA 2LM5A 1U5IB 4N1FA 4NDBA 2MJWB 3TUYC 2L0PA 1LVCD 2QPTA 4M2QA 2F3YA 3MSEB 2L2EA 3IF7A 3I5GC 1YURA 2B1UA 3BYAA 1TNXA 1L2OB 1FF1A 1DJZA 1WLMA 1RJVA 5TNCA 1WRKA 2M8UA 2M49B 2HETA 3I5HC 1SCVA 3OX6A 1DGVA 1SRAA 2JXCA 1R6PA 1JSAA 4N1GA 3BQ3A 1LA3A 1N65A 1FI6A 2M9GA 3VRRA 1BU3A 2I94A 3LCPC 2H2KA 3TS5B 2LHLA 2Q91A 1CFCA 2H61A 2WNDA 4BY4A 5IBWA 1V1FA 1YRUB 2EGDA 4C0LA 1CFFA 2Y4QA 1DT7B 3KHEA 1YR5A 5DKRA 4I5LB 3OB2B 1QV0A 1QJTA 2MLEC 2PVBA 4ICBA 4MVFA 1TTXA 2K7BA 4OVNF 5ER4X 3DVJA 2KBIA 2JT3A 4P2YB 2K8MB 2JU0A 2L51A 1AJ5A 4NDDA 1XK4C 1IKUA 4R1EA 3VGOA 1QASA 3CLNA 2LLUA 5AEQA 2BBMA 1MXLC 3CS1A 3QRXA 4GGNA 1RWYA 3GK4X 1MWNA 4ZCUA 5AERA 2BCAA 1EXRA 4M2PA 3OB1B 1K9PA 2OTGC 3PN7C 1AK8A 1JUOA 1KQMC 1NCYA 1KWOB 3BUWB 3RLZA 3E3RA 4AQJA 1EH2A 1DJXA 3PATA 1GJYA 2ISDA 1F71A 5JOLA 3CGAA 2CCMA 1EG3A 5AFPA 3EKHA 4HRHA 1KCYA 3SG4A 3BUOB 4CPVA 5CPVA 1IWQA 1ZFSA 1S6JA 1SW8A 3BOWA 4C0KA 2KI6C 4MZJA 4QJ5B 2MHHA 1QX5B 3BXKA 1S3PA 2L4IA 2L50A 2LNKA 1A03A 1SL7A 5I2LA 4PE0A 1RECA 1CLLA 2M3WA 2HQWA 3I5GB 3VRQA 1DJYA 1L2OC 2F3ZA 1KK8B 2CTNA 2SCPA 1B8LA 1UUSA 3OHMB 5HKWA 4ETOA 5KSZA 1XFYO 1OMDA 1CFPA 2K7CA 3VRPA 1XVJA 2M7LA 1UHJA 1JF2A 4GAOA 3K21A 3CR5X 1KFXS 2K7DA 3AAKA 4JWQA 4A4BA 1IH0A 1TIZA 1NYAA 5AANA 1B9AA 3GK2A 3EVUA 4M2OA 1CMGA 1ZMZA 1X02A 1NIWA 1CMFA 2VRGA 3EK4A 1DJHA 1AVSA 2M29A 1NSHA 2JWWA 2OS8B 1KFUL 2ZFDA 3C1VA 2I18A 3CTNA 1F4OA 5CSNA 1F70A 3JVTB 1OSAA 1DJIA 1S36A 4MBEA 2E6WA 5FYXA 1J1EA 4MEWA 1WLZA 4P5OE 1F8HA 2KFHA 4I5KA 1QX2A 1F54A 1OZSA 1RROA 3BOWB 1NP8A 1A75A 1NCZA 1QIVA 3I5IC 1AHRA 1MHOA 1JFJA 2O60A 3NSIA 1LA0A 2JXLA 1EJ3A 3EKJA 1S5GZ 3SJSA 1BMOA 2LMTA 4A4CA 1KSOA 1TNQA 2Y1NA 4BY5A 3DVKA 3I5FC 1PVAA 2BE6A 3GOFA 1XK4A 2HPSA 3FWBA 2KQYA 1IQ3A 2ZNDA 1YUUA 4U8DA 1MQ1A 1UHHA 3WHUB 1J1DA 3LLEA 1WRLA 1SPYA 4NQGA 2FJUB 4YGCB 4IL1A 5KU1A 3FWCA 1FPWA 2G2BA 2ZN9A 2A4JA 2TN4A 1PALA 1K95A 1AJ4A 1SNLA 2JTTA 2QACA 2Y5IA 1M45A 1BG1A 1N0YA 2LANA 4YRUA 4DS7A 1K9KA 4NDCA 2MBXA 4YGAA 1G4YR 2I7AA 1CTRA 4XJKB 3WHTB 1J7PA 1M39A 2KNEA 2HQ8A 1KK8C 1B47A 2LVIA 2ZRSA 1UURA 5K89A 1TN4A 4MZKA 1SY9A 4USLA 3AAJA 2LUXA 2JTZA 1QXPA 3TDIA 1IQ5A 4GPLB 2HF5A 3SG3A 2WORA 1PK0D 1CB1A 3SIBA 1UHKA 1PRWA 1Y0VH 1IG5A 2LMUA 1BOCA 1OOJA 4GFTA 1PULA 2E30A 2BCXA 1TOPA 2LP3A 1H4BA 4GGFA 4YGBB 2Y9ZA 2PALA 1AUIB 1QX7A 4GGFC 1YUSA 2ZNEA 1BF5A 3HCMA 1XFZO 4XYNA 2AMIA 1EL4A 1NPQA 2CT9A 3D0YB 2KYFA 2SASA 3TDUA 2L5XB 2BECA 5BPJA 1D1OA 1CLBA 1N2DA 2IS9A 3A8RA 1QTXA 1R2UA 2FCDA 2K2FA 1GGZA 1DF0A 1C7VA 2OTGB 1EG4A 3DVEA 2GGZA 4TNCA 1RTP1 5D69A 3DD4A 3CWGA 1QVIZ 1BR1B 4ORAB 3LL8B 5DKQA 3ZNIA 1JC2A 1ZOTB 2K2AA 3I5FB 2L4HA 1XFVO 3SG5A 1SR6C 1ZACA 5G08A 4DIRA 2JNXA 4CFQA 2KI6D 4MRYA 1FBVA 3ICBA 1B4CA 2KI4C 3CR4X 4WQ3A 1QIWA 1XFXO 1CDNA 1MXEA 4F0ZB 4QJ4B 1C7WA 1DJWA 1SYMA 3GK1A 4HREE 1LXFC 2L98A 2I2RE 2LCPA 2M0RA 3NSKA 1Y6WA 1J7OA 1UWOA 3AKAA 4PE4A 1YUTA 3OP0A 1A29A 1KFUS 4WQ2A 1SCMB 2LLTA 1KK7Y 2AAOA 3BUMB 1FI5A 2M7NA 5F6TA 4AOMA 2KAYA 1WY9A 1ODBA 1YX8A 1JF0A 3PLFB 5JJGA 5GQQC 2KDHA 1PSBA 2K61A 3RM1A 3LK0A 3DF0A 1OMVA 4GBAA 2KBMA 1Y1XA 1DF0B 1KK7Z 1QS7A 3ZWHA 2KGRA 1XYDA 2DOQA 1J55A 1S1EA 2OS8C 2V53A 1ALWA 3F45A 4JQ0D 4CLNA 1YVLA 4YGDB 4FQOA 1ZUZA 3DF0B 2JT8A 1W7IB 4GUKA 1LINA 1WDCB 1S5GY 2EC6B 1K93D 2JOJA 3O6BA 2NCOA 1DJGA 2RGIA 1IGVA 2K0JA 1UHNA 2JRFA 5CSIA 2Y1MA 1G8IA 2LLSA 1YVHA 3KPXA 1SL8A 4I5NB 1BJFA 3BUNB 1DVIA 3D0YA 4WRIA 1TNWA 4ORBB 1PVBA 2WC8A 4PHKA 1B7TY 3DVMA 1QATA 3CZTX 2PASA 5HLOA 2KFGA 3JTDB 5PALA 4UPGA 1J7QA 1NX2A 1TCFA 3WNXB 5D7FA 1IJ6A 2JQ6A 4OV2A 1B8RA 4PALA 2D8NA 1UHIA 1XA5A 2BCBA 2ZRTA 4ORCB 2ZN8A 2JULA 4PHNA 2KHNA 3KO0A 5HYDA 2KI4B 1TNPA 3CR2A 3PFVA 5KTYA 1CKKA 1OZOA 2F8PA 2KOTA 3TUYB 4AQIA 3KEVA 1SL9A 5I2QA 1NCXA 1NX1A 2K7OA 2H61C 1JWDA 2COLB 3EVRA 1KSMA 4I5JA 3EVVA 1B8CA 3O4YA 2Y9YA 3I5HB 4MN0A 5HKZA 3O2PA 5I8NA 1OFCX 1XFUO 1OMRA 1OQPA 2LV7A 2FCEA 4C0JA 1DMOA 4YI9A 1CLMA 1RFJA 1M31A 1E8AA 3PSRA 3SIAA 1AP4A 1SK6D 2F2PA 1W7JB 1IJ5A 1XO5A 4PHJA 2LVVA 2MLFC 1CFDA 1PSRA 1QLKA 2F2OA 2KAXA 1KQVA 1B7TZ 2PMYA 4PHMA 2NLNA 3VROA 1K96A 3EK8A 4Q04A 2PSRA 3H4SE 4CIDA 4YGEB 1DTLA 5DKNA 4OCIA 1QVIY 4PE1A 1OE9B 1TRFA 2M97A 1FW4A 4HSZA 4JPZB 2NXQA 2KSPA 1HT9A 3AKBA 4YI8A 4DRWA 1QLSA 1K8UA 2WOSA 3PN7B 1SR6B 2LP2A 2LVKA 2BL0C 2KAVA 3FIAA 2M1KB 1KQMB 1Y1AA 1KWOC 2FOTA 3IQOA 1CM4A 1CDLA 2BKHB 1YX7A 3TZ1A 1B1GA 4CFRA 1F4QA 2MRDA 1LKJA 1WRZA 3PM8A 3D10A 4HRGA 5B8IB 1S26D 2JZIA 1J7RA 4PDZA 4E68A 1CDPA 4L9MA 1A75B 2GV5A 4MSPA 1ALVA 3SG6A 2P6BB 4PE7A 3KF9A 2WCBA 1NX0A 1VRKA 1A4PA 5HKYA 1HQVA 1SCMC 2CBLA 1M46A 2OPOA 3NSOA 4YBHB 2F33A 2ZKMX 2M1UA 4XJKA 1UP5A 1Y1UA 1A2XA 1S6CA 2WCEA 2NCPA 2LE9B 1DGUA 1BODA 1YRTB 3SG7A 3LK1A 2MA2A 3SG2A 4PCWA 2LHIA 3TS5C 2KQ6A 4GNKB 3PALA 2LC5A 4OR9B 1CM1A 3NSLA 1SMGA 1MUXA 1NUBA 1BR4B 2JT0A 2KFFA 4QJ3B 1XFWO 2R2IA 2G9BA 2BKIB 1BT6A 2BE4A 5ER5A 1SBJA 2LAPA 1IRJA 3EK7A 4ZCVA 1WDCC 2EC6C 3JVTC 5AXIA 2JPTA 3WXAA 2Q4UA 4MZLA 4N5XA 4MLWA 3TDZA 3VRNA 1BLQA 5CSJA 1V1GA 1KFXL 3HX4A 2GGMA 1M63B
chains in the Genus database with same CATH superfamily
1N86A 1K90D 1K94A 3FWNA 1Q80A 4OKHA 3NXAA 3BCCD 3PTZA 3S0DA 4N78E 1GGWA 5BU8B 3L74E 1TCOB 4UB6H 3S1KA 1YTZC 4U7JA 1T3JA 3B4SA 3BCCJ 5B66H 3H1KD 2ZYAA 1CDMA 1K2HA 1X9VA 2KIKA 2KGBC 2CNPA 3O78A 3FXDA 3M0WA 1GQMA 1M1JB 1NWDA 2YO3A 1GW4A 2JNFA 2LM5A 4N1FA 4NDBA 1YJWP 1HVVA 2L0PA 4EI2A 4WY4C 3W68A 2OYHA 3IF7A 3A0BH 1ZRTE 1TNXA 1T2KD 2CPSA 3S0AA 3II6A 1WLMA 1RJVA 1LWUB 1FZEA 2R32A 3I5HC 1RQUA 1DGVA 3AEBC 3H1LJ 1S5LX 4N1GA 3UNWA 5AVWB 1OVVA 4Z1MH 5AW9B 3UO9A 2H89C 2I94A 1JO5A 2R3CA 2H2KA 3TS5B 4XFJA 2P71A 2Y4QA 3KDPB 3I5CA 4K3AA 1FOSE 2YIUC 4ASVA 4ICBA 4MVFA 1TTXA 1EDIA 4OVNF 3BFHA 2JT3A 1IKUA 2JU0A 1AJ5A 4NDDA 5FI7A 4R1EA 3VGOA 3ITKA 2QJPC 5AEQA 4A7PA 2BASA 3QRXA 3CLQA 1LTGC 1HGVA 3KZIH 1K9PA 1JUOA 3K5BA 1NCYA 2IFNA 5APUA 1K05A 3JCUE 2YNYA 2L5YA 1DJXA 1LT9C 3HE4A 5JOLA 2CCMA 2Z5HA 1A02F 2GM4A 1IWQA 1S6JA 4C0KA 5TISH 2MHHA 1NTMK 1QX5B 1S3PA 4NPFX 1IK7A 1RECA 2BEZF 2M3WA 1EZVG 2M5AA 2C0WA 3V2QA 4ETOA 3L70G 3NMDA 3CWBE 1XVJA 1VL2A 1UHJA 3CX5H 3K21A 1OXZA 3AAKA 1TIZA 2R5DA 5AW6B 2KNCB 2E5TA 2WCHA 1JY3N 2HODB 2FYUG 5AVVB 1NIWA 4GIFA 1DJHA 1GL2A 1NYHA 1KFUL 3RK3B 3U1CA 1F4OA 3H1IG 1QVFO 1YQ3C 3BOWB 3SSUA 3AEEC 3U1AA 1SQQJ 1ZR2A 3L37A 1EJ3A 1A02J 3EKJA 1FBMA 1SQXD 3Q5SA 5CCGC 1KSOA 4AUWA 2W8ZA 1EDKA 4U3FJ 3VMXA 3MUDC 1NO4A 3BFBA 3WHUB 3LLEA 4NQGA 4H0LB 3W67A 5KU1A 1T3UA 1G2CA 1AA0A 3GF3A 4YRUA 1K9KA 4NDCA 2MBXA 1SQQE 3H32B 1Q86Q 2I7AA 1KILD 3H1LD 3FWLA 1J7PA 1YQ4C 2MKVA 2ZRSA 1K04A 1TN4A 4MZKA 3CXHH 3FXEA 4BRYA 1OOFA 1SY9A 4USLA 2H8PD 2JTZA 1QXPA 4INWA 1M57D 4GPLB 3ABVC 1RE4A 3RGUA 2HLOA 2QJYC 1DQEA 1HH0A 4ZKPA 1BOCA 3M91A 3KZIE 2KPHA 1H4BA 2LP3A 1DELA 2FYNC 4UB6E 4YGBB 1JB0J 3VN0A 1VQ6P 3CWBJ 1AUIB 3HCMA 1XFZO 1J1DC 2FKWB 2AMIA 3D0YB 1NPQA 4ZMDA 1J1EC 3O8ZA 1N2DA 2RMZA 1QTXA 3N4XA 3L72J 2FCDA 3IFMA 1AQ5A 1C7VA 2OTGB 1EG4A 4TNCA 5D69A 3P8MC 4ORAB 1NTZG 3M06A 3LL8B 1ZOTB 3VOPA 4I6MC 5AVSB 1SR6C 1ZACA 1MZ9A 4DIRA 1FBVA 3ICBA 5CMZA 2D2CD 5AVRB 2L91A 1B4CA 2W6AA 1ZN5A 1QIWA 1XFXO 2E74C 4HREE 2L98A 3BFAA 5CBOA 1NKNA 2ZT9C 1SQPG 1LWUA 4PE4A 3RK2B 2Q9IA 1ZW0A 4AOMA 5JJGA 2ITAA 1FAVA 5APWA 1LP1B 3S0EA 5GQQC 1PSBA 2K61A 1FS0E 1L0LJ 3BJHA 3DF0A 3RK3E 1YBKA 2KBMA 3L73J 2KXPB 1DF0B 1NTZE 2RH0A 1SFCA 4JQ0D 4FQOA 5B66E 1ZUZA 1SQBG 3DF0B 1OOIX 1P84E 3PRJA 3V6IA 3B86A 3WUTA 4GUKA 2XV5A 1FDOA 4H13C 1K93D 1NTMJ 1U7JA 2WCMA 1IGVA 2K0JA 1OIPA 2P7JA 5CCGD 2Y1MA 2NPSD 2I1KA 2M3BA 1SQPE 3D0YA 1IFMA 1TNWA 3D6ZA 4ORBB 3S0BA 2XKMA 1M1JA 1TCFA 3WNXB 2QEXP 2PYQA 2RN0A 2UWJE 2OYHC 3A0HE 1IJ6A 4OV2A 1B8RA 4PALA 1UHIA 1XA5A 2JULA 4PHNA 3KO0A 1TNPA 3CR2A 3SFDC 3M0DA 2F8PA 2XDJA 1QGKB 3TUYB 3CMEP 2IPPA 2Q3EA 1JWDA 2COLB 1S1CX 3H1KJ 5L8RJ 3EVRA 1KSMA 4I5JA 2WSFJ 2P10A 3S0GA 3T97A 2IBZE 5I8NA 1OQPA 2OTJP 3DY9A 3FGAD 1H88A 4YI9A 1JCCA 3GHGB 2PRRA 3USSA 1RFJA 4BXLA 2F2PA 2WTYA 1LGHB 4TLFA 2R44A 4IFMA 2F2OA 3RL0D 1YTZT 2AXTH 3L71G 1JY2N 4IJ7A 2YKPA 1AJYA 1MFTA 1SQBJ 4YGEB 1DTLA 2Y0CA 1L4AA 2N1TC 1N73A 1OE9B 1TRFA 5BVZA 3HE4B 4JKTA 4IFDK 4HSZA 3VTPC 1EZVE 2NXQA 1HT9A 3AKBA 1ZRTD 2E75D 1KILC 1KTMA 2BL0C 1NTKD 5APXA 2FOTA 1CM4A 2YKOA 1NAYA 3R1OA 2E74D 2NZ2A 3MD0A 3D73A 1B1GA 1X79B 2XZRA 1F4QA 1G1JA 4PV1D 1SVFA 4O9BA 3CL3D 3D10A 5B8IB 1BSNA 2JZIA 5KLVG 3R72A 1SP4A 4L9MA 3SS4A 1VQKP 3PHLA 2OQQA 4PE7A 4W7YA 2CBLA 1M46A 2F33A 4INXA 4XJKA 5CCHA 3O4XA 1A2XA 2WCEA 2NCPA 2Q7CA 2LE9B 3HUSC 1BODA 2LHIA 2GUSA 3PALA 3CZ1A 1MUXA 2WSCH 2KFFA 4QJ3B 1PV3A 3Q1MA 1MKMA 1BT6A 2JEEA 2V7QH 3EWKA 3CMAP 3EK7A 2L5GB 4ZCVA 1WDCC 3H25A 2EC6C 3AEDC 3WXAA 3L75E 5KAFH 4N5XA 5FI6A 1SSEB 3V2PA 1QWVA 2JC2A 1KB9I 1RQVA 5APVA 5KLVK 3I5IB 2N1TB 1JFKA 2PRUA 1LTBC 4AQRD 1MR8A 3JTDC 2MAZA 3GMAA 5M1BA 1QV1A 2WCJA 3BRVB 1BE3E 4MRXA 1RK9A 3FS7A 1USDA 4W80A 2BL0B 3A4UB 1K9UA 1NX3A 2OARA 2B89A 2FXMA 2LUCA 1U5IB 3CXHE 3AE8C 5CJ4A 2F3YA 3MSEB 3I5GC 2B1UA 1L0NJ 2WPRA 3L74G 3L70J 3D71A 1L2OB 1FZCA 3M9QA 2HYNA 1NGMB 1WRKA 2HETA 3B71A 2VRSA 1SRAA 3IF4A 1R6PA 2NPSC 1H0TB 3QWOC 1JMMA 1LA3A 3DYEA 1FI6A 2Y0EA 1FZGA 4QMAA 2M9GA 1EC5A 3KQGA 5KKZB 1NU1E 2WNDA 3RL0C 4DJGA 1Z2CB 3CX5I 3L4LA 1PGJA 1SQVJ 2WITA 3S4RA 2C9NY 1FC2C 3OB2B 1QV0A 3V5BA 5KJ7A 3N7NA 2K7BA 3H32A 3DVJA 2KBIA 4P2YB 1KD1Q 3IN6A 1BDDA 1XK4C 2YXRB 2FYUJ 1QASA 2LLUA 5H2FE 2BBMA 1FZFA 3GK4X 2BCAA 3PN7C 1AK8A 3RLZA 5I94A 2XNXA 1RF1B 1F71A 1KYOH 1SLQA 3E7KA 3EKHA 1IFNA 1VF5B 4JD9A 5CPVA 1SQBK 1N73C 2BNXA 1SW8A 2KI6C 4MZJA 2JO1A 3L75G 1RE4C 2H88C 2L4IA 1A03A 1SL7A 5I2LA 3TNUA 1LP1A 3VRQA 2ZYDA 1L2OC 1G1IA 2K9YA 2CTNA 1FZCC 3OHMB 3OBVA 4D6TE 1XFYO 1OMDA 3U59A 3TDKA 2M7LA 1RHZB 1YYCA 4JWQA 1IH0A 3SFEC 1PP9J 1B9AA 3B5NC 1UIXA 3GK2A 1NTKE 2O01N 4I7ZC 1CMFA 1NSHA 1JNMA 3CTNA 3C1VA 2B87A 1F70A 4Y99C 3JVTB 1RH5B 1DJIA 4PD4E 1EQ7A 3MUDA 1J1EA 4MEWA 1WLZA 1BE3G 4PV1C 1NP8A 3AE1C 1GDTA 4IL6H 4L76A 1NCZA 2W6JH 2O1KA 5AW5B 3LIEA 1QIVA 2ZXEB 3B8EB 3L71J 1AHRA 2IYOA 1LA0A 2JXLA 1AVOA 3SJSA 3M9BA 2LMTA 3B6XA 1TNQA 4TT3H 1P84H 3I5FC 1PVAA 2BE6A 1EZVI 1M1JC 3MHVA 1NTMD 1OMIA 1YUUA 2ZYGA 3K1EA 1UHHA 4KJMA 2KYVA 2LKMA 1SPYA 5DJTB 1X22A 5AW0B 3IAOA 4YGCB 1SQVD 1TUJA 1FPWA 1HGZA 1QX8A 1PALA 2ZJSE 1K95A 1SNLA 2JTTA 1M45A 1BG1A 5C39A 4LGDE 4PJ0H 1G4YR 1CTRA 3NHTA 1KFNA 2QEHA 1SFCC 4WB4A 1B47A 1PP9E 2IX7C 1VQPP 3PP5A 2I1JA 2AEJA 4IFFA 5KAFE 1QL2A 4EOTA 2LUXA 4N78D 1IQ5A 2WORA 4ZKUA 3SIBA 3E1RA 1K73Q 2YIUB 1OOJA 3OA7A 1MUUA 2E30A 2BCXA 4GGFA 2PALA 4GGFC 1YUSA 1T14A 2CT9A 3TDUA 2L5XB 1CLBA 1NU1D 4IL6X 1VQNP 3A8RA 2ZVOB 3A5TA 1R8EA 3AE5C 2GGZA 3TGUJ 1BR1B 3FE6A 2L4HA 4B86A 2FJYA 2KI6D 2K3RA 1KQSO 4JYCA 2IFMA 1FJPA 2KI4C 2E5YA 3VYIA 4WBAA 5AVQB 1MXEA 3BVHA 1C7WA 1SYMA 1JTHA 4H44D 2LCPA 2IYPA 1FOSF 1YIJP 3V2RA 1UWOA 3AKAA 2KOGA 3OP0A 5KLIB 4WQ2A 2KK7A 3BUMB 1FI5A 2M7NA 3OAKA 2KAYA 5D3OA 3B5ND 2QJKB 1ODBA 1YX8A 3A3YB 1XFRA 1KMIZ 1GL2D 3M0DC 4GBAA 1N7LA 4GODA 1KK7Z 3PM2A 1XYDA 4KT0J 1J55A 1S1EA 2IBZG 1LTJC 1ALWA 3F45A 3CXHD 3KHUA 2K9JA 3RK3C 1YVLA 4OGQC 3H1JD 3TGUG 1PFIA 5GTIE 2JT8A 3FE8A 1DD4A 3VMZA 1ZLLA 5CJ0A 2JOJA 1DJGA 2E76D 1J1DB 1JTHB 2ZFCA 2IZ1A 1K8AQ 1LTSC 1SL8A 4RO0A 4HJGH 3BUNB 4WRIA 1B7TY 3DVMA 2PASA 1LJ2A 4LLHA 1J7QA 2WSCJ 1T6AA 5D7FA 3L36A 1GD2E 2E76B 2D8NA 4ORCB 4YXWH 3PFVA 1CKKA 3CCMP 1S9KD 2A06D 2P2UA 3KEVA 3CX5D 2JWDA 1NCXA 1NX1A 2K7OA 1E79H 2H61C 2A06E 2IDBA 4H0LD 3EVVA 1L4AC 1B8CA 2O3JA 1NTZK 4UB8E 3I5HB 5KAIE 5KLVD 1OFCX 3GG2A 2LV7A 3V2NA 4C7RA 2QJKC 2LXBA 3V2LA 1DMOA 1M31A 2QJYB 3SIAA 1AP4A 4BRYB 2KNCA 1W7JB 2QRXA 1IJ5A 4PHJA 4N6JA 3RZSA 2LVVA 2OTLP 1LTJB 2MLFC 1CFDA 2KAXA 3H1KE 4PHMA 3VROA 4NPEA 1U7MA 2K9JB 3G3ZA 1SQQG 4XE5B 1J1EB 2NRGA 2O01H 5DKNA 4OZDA 1LT1A 4BWNA 1ZR4A 1GZLA 5AVUB 2D2CB 2H7HA 3AE6C 2Y0DA 3CCVP 3G4SP 3LW5J 3CC2P 5APSA 1SR6B 3AEAC 1OVRA 2KLVA 1SFCD 3FIAA 1KQMB 1Y1AA 1IJDB 3HE5B 1GL2B 1PP9G 1MV8A 1LT9B 1YX7A 2OYHB 2Q3IA 2J5UA 2PQLA 4PJ0E 5AVYB 1KFMA 4D6TD 1WRZA 1SQBE 3BRTB 1J7RA 1KB9H 3PH0A 4E68A 1IFDA 1SQXE 1E5WA 5KJ7D 1NTKJ 3KF9A 2WCBA 2ERBA 1A4PA 2OPOA 1SCMC 3Q3DA 2ZKMX 4PD4H 3WU2E 1RY3A 3CCUP 1OWAA 3IR9A 4L74A 2WT7B 1S6CA 3Q5PA 1URQC 1EDLA 3S0FA 5TJHA 1KB9D 1YRTB 3LK1A 2MA2A 3SG2A 4PCWA 3L71D 1BCCJ 1T2KC 2LC5A 1SQBD 1CM1A 3GLMA 1SMGA 1ZMEC 1NUBA 5ER5A 3P32A 2FYZA 1OW7A 3UIAA 2QSIA 5AXIA 2Q4UA 3TDZA 1V1GA 5HKYA 1GK4A 5CSFA 2JKVA 5HLVA 2R5BA 4XA4A 4DCKA 1SKTA 2H8VA 2NZ0A 4FTGA 5J3XA 1H8BA 2KZIA 2BBNA 2BAPA 2KYCA 1S6IA 1S4XA 1U5IA 1G33A 1JBAA 4K35A 3PJIA 3V4WA 2DW3A 3OX5A 2AUCA 1JM0A 2CXJA 1GL2C 1DD3A 1QLED 4D1EA 3H1LG 3SWFA 2EHBA 3Q5RA 2LXCB 2XU6A 2MJWB 3MZWB 3TUYC 2J59M 1Q81Q 3B7AA 4H0LC 2QPTA 3HTKB 3KPEA 3BYAA 3HD7C 2BCCG 4N3YB 3N7HA 1N7SC 1FF1A 1VQ5P 2Z4EA 1SCVA 3TK1A 5AVZB 1OOGA 3BQ3A 1VF5D 1YHQP 3GHGC 3P7KA 3CX5E 3VRRA 2HPCB 1BU3A 1M90Q 3LCPC 3D70A 2Q91A 1CFCA 2H61A 4BY4A 2OYIC 2GTEA 5EL2A 1CFFA 4C0LA 4D6TJ 1DT7B 2K60A 4I5LB 1KN7A 2MLEC 1QJTA 3BCCE 2PVBA 1EXIA 2E42A 2FYNB 2OGUA 2W83C 5ER4X 1JY2P 1AV1A 3OJAB 1P28A 2K8MB 3JC22 3I55P 3AE4C 3EFGA 4U3FD 1RWYA 1MWNA 5AERA 1EXRA 1NU1G 3OB1B 2OTGC 3BUWB 1KWOB 3AE3C 3E3RA 1FDMA 4AQJA 3H1HD 1EH2A 3C9IA 3PATA 1SQQD 2KB7P 3CGAA 1S72P 1EG3A 1KCYA 3SG4A 3BUOB 1L2PA 2WCKA 4L75A 2YXQB 1ZFSA 3NFQA 3BOWA 4QJ5B 3TYYA 2E75C 5TISE 1IIOA 2V4HA 2LNKA 4KHXA 2RKLA 1CLLA 3I5GB 3A7OA 3E1IA 2ZT9B 4L73A 2F3ZA 2PP6A 1KK8B 5KLVJ 1B8LA 5HKWA 3VRPA 5B5EH 3C1LA 2FFDB 1JF2A 2QIWA 1VQ4P 3CR5X 1KFXS 4A4BA 1NYAA 5AANA 4M2OA 1CMGA 1ZMZA 1X02A 5E79E 3EK4A 1NWQA 1AVSA 5CBNA 2OS8B 2ZFDA 2OYIB 2QM8A 5CSNA 3CXHI 1S36A 3HUSA 2E6WA 5FYXA 1Y9BA 4PT1A 3G9RA 3S9OA 1R5LA 4P5OE 2KFHA 4I5KA 2H43A 1RROA 4AYCA 2JP3A 3GF7A 1BE3J 3I5IC 1MHOA 1JFJA 2O60A 3B5NA 5AW8B 3AECC 5GTHE 5KJ7C 1DH3A 1ZV8A 3DVKA 4HB1A 1VQLP 3GOFA 2HPSA 3FWBA 2KQYA 1IQ3A 3LW5H 1URQD 1MQ1A 3EG5B 2PFXA 4U3FE 3TSIA 3WU2H 1KILA 1LT9A 3F5HA 4WY4B 2O01J 2FFDA 4IL1A 2G2BA 2A4JA 2TN4A 3H1KG 3NHIA 5HL1A 1AJ4A 1N0YA 2KI7B 3RL0g 4YGAA 4GOEA 4XJKB 1OOHA 1JOCA 5K89A 2HQ8A 2LVIA 1OW6A 1UURA 1IFJA 3WUVA 3AAJA 1BE3D 5KKZC 1CI6B 3TDIA 3A0HH 1BCCE 3JCUH 3SG3A 1VPCA 1CB1A 1PK0D 2V7QJ 4IOIH 1JEKA 2POHA 1BGYD 1Y0VH 1IG5A 5CCHD 4GFTA 3EQ2A 1PULA 1TOPA 1NHLA 1NTME 1QEXA 1LTAC 2Y9ZA 1DX7A 4RESB 1OVUA 4XYNA 2W27A 2KYFA 1W2EA 1EXJA 3AE2C 2BECA 3HTKA 3FE9A 1PPJG 1ZP0C 1R2UA 3TGUD 2K2FA 1DF0A 3DVEA 1RTP1 3R1PA 2NPSA 1QVIZ 4H44B 4H13D 5DKQA 2QEBA 3CZ2A 1JC2A 3I5FB 3SG5A 5G08A 2JNXA 1W5CE 1VF5C 2KS1B 1DIPA 3L75D 4JBZA 5APQA 3AE9C 1CDNA 2AEFA 2C0XA 3L4AA 4F0ZB 1SQQK 1LNQA 4QJ4B 2GA1A 3D74A 1OZHA 3GK1A 1S5LH 2Z5IA 3NTNA 2I2RE 2M0RA 1L0NG 3L74J 3NSKA 1Y6WA 1J7OA 1WT6A 2WQYC 1YUTA 1LTTC 1A29A 2QG4A 2QA4P 1KK7Y 1HJBA 5F6TA 2A06G 1SFCB 3PLFB 3F89A 3BATA 3A0BE 2HPCA 3RM1A 3LK0A 4I7ZB 3CCJP 1Y1XA 2DOQA 1EZVD 2V53A 3Q2YA 4YGDB 2R3SA 2JDIH 3D6YA 1KORA 3NGVA 4PV1B 4WY4A 1LINA 1WDCB 1S9KE 2EC6B 3O6BA 3L73D 3NXSA 1QVGO 1GU5A 3GHGA 4I5NB 1M1KQ 1BJFA 1DVIA 2K37A 2JJLA 1PVBA 2WC8A 3IVTA 4WY4D 3OW2O 2KFGA 1N7SA 1GU4A 4UPGA 1NX2A 3H6PA 1RF0C 4W7ZA 3QH9A 2JQ6A 4EIJA 1SQVG 2ZVNB 2KLEA 2ZRTA 1WRGA 5HYDA 2KHNA 1UIIA 2KI4B 3I56P 1IO4A 2KOTA 3H1HE 3L75J 1IK9A 1SL9A 2B87B 2P1JA 2YMYA 4ZNCA 2A45H 2JR8A 1WMKA 1TWOA 2IBZD 3CD6P 1IC2A 1CSBA 2N9YB 3O4YA 3H1JG 1FJKA 2G3AA 2Y9YA 5KLIC 1ZXGA 4MN0A 5HKZA 4I1LA 1LTJA 1PL5A 2QM7A 5DJUB 1OMRA 4HH2A 2FCEA 4C0JA 4GDOA 3CCEP 1NAFA 1CLMA 5CHXA 1E8AA 3PSRA 1OW4A 5H2FH 4OWFA 3CWBD 3CCSP 3RL0B 1VQOP 1PSRA 1QLKA 3L71E 1KQVA 3CC7P 1DEBA 2Q6QA 2B9BA 3EK8A 4Q04A 2PSRA 4LC1A 3M0AA 4CIDA 4C7NB 4F7FA 1QVIY 3PLNA 1JMBA 5APYA 1HJ0A 1FW4A 4JYBA 1RF1A 4DZOA 1PGOA 4YI8A 4DRWA 1QLSA 2FYUD 3PN7B 2LVKA 3FX0A 2KAVA 2WSSH 1HUCA 3SS5A 2WZ7A 5FI2A 2M0BA 3D77A 3H1ID 2MJZA 3TZ1A 1NVOA 3CPWO 1P84D 2MRDA 5B5EE 1LKJA 3TNUB 2E74B 3H1JJ 3PM8A 1S26D 4C46A 1NTZD 1CDPA 1A75B 2GV5A 4MSPA 1YTZI 1AQTA 3RK2C 2B88A 1NX0A 1LWUC 1X0TA 1HQVA 2SPZA 3CI9A 4YBHB 2M1UA 3D75A 1VQ8P 1L4AB 2OTKE 2K88A 1JY3P 1H8AA 1AFOA 1DGUA 4IL6E 4JF7A 4PD4I 5AVTB 1BSHA 2GUVA 3L70D 3TS5C 2KQ6A 4GNKB 3D76A 3NSLA 3CDNA 2JT0A 4RKUJ 4OGQB 1JY2O 3T97B 1XFWO 2R2IA 1L0NK 2G9BA 2BKIB 5AW7B 2BE4A 3G6EP 1SBJA 1NTKK 1FE6A 2M5AB 1RF0A 3JVTC 1IFIA 4MZLA 4ASWA 4MLWA 2BCCE 5CSJA 1USEA 1KFXL 2PAJA 2GGMA 2W90A 1NTMG 3MIWA 1U57A 3WMM0 3RBXA 1BGYE 2QJPB 2LVJA 2Q5UA 4CPGA 1RE3A 4WVZA 2E43A 1C07A 1X8YA 5I2OA 1IFPA 1L7ZA 1NJIQ 1F55A 1M8OB 4R4LA 2ZAEB 1MF8B 1M7LA 3BUXB 3A2AA 3L35A 2O5GA 1KQFB 2KS1A 1L0LG 2N1TA 2LMVA 2E76C 1VQ9P 3IQQA 2WCFA 1CNPA 4DUQA 1NH4A 1ORGA 3R4YA 3QMEA 3KYQA 3WUUA 2JWAA 1LVCD 4M2QA 1SQPJ 2L2EA 2BEQD 1YURA 2FXOA 2AXCA 1DJZA 3OGNA 1JY3O 5TNCA 2M8UA 2M49B 2QDIA 3OX6A 1ZOYC 1FZAA 2JXCA 3H1LE 1JSAA 1URQB 1N65A 2WT7A 3P8CE 1N2DC 2QVAA 3L73E 2LHLA 1Q7YQ 1NTZJ 5IBWA 1V1FA 1YRUB 3BCCG 1L4AD 2EGDA 1W2BO 3KHEA 1YR5A 5DKRA 1PIXA 3L72G 5KTBA 2O1JA 2A45G 3VP9A 4NPDA 1S3JA 4KYNA 1SQVE 1BDCA 2HODA 2L51A 5DICA 2D2CC 3CLNA 1MXLC 3CS1A 3CCQP 4GGNA 2ZXXA 4ZCUA 3AE7C 4M2PA 4EYYQ 1KILB 1KQMC 2FXPA 2G8YA 1GJYA 2ZT9D 2ISDA 3L70E 1OX3A 5AFPA 4HRHA 3M9HA 3V4QA 4CPVA 3L73G 1MFZA 5AW4B 3G71P 1S2EA 3BXKA 2YKQA 1NKZB 2L50A 4PE0A 2HR3A 2HQWA 2FYUK 2M8RA 2WSEJ 3HD7B 1DJYA 1N7SB 1HF9A 1PZQA 2SCPA 1UUSA 1YJNP 5KSZA 1CFPA 3CCLP 3HUSB 2HG5D 2K7CA 1G2CB 1Y8AA 4GAOA 1TU3F 1Q90D 5GTIH 2K7DA 1NU1J 1SQVK 2KLDA 3EVUA 4HKZH 1KYOI 1HBWA 2VRGA 3VP8A 2M29A 3CABA 2JWWA 2XNDH 2I18A 5AVXB 1OSAA 1VDFA 3R2PA 4MBEA 1F8HA 1VQMP 1QX2A 1M56D 1F54A 1OZSA 4D6TG 3H1HG 1A75A 3SWYA 1BCCD 4H13B 1FDIA 2PGDA 3VB1A 3NSIA 1S5GZ 4GOFA 1SQPK 1KZUB 3RK2D 1BMOA 4A4CA 3L4FA 2C9LY 2L2CA 2Y1NA 4BY5A 3CWBG 2IBZI 1XK4A 1YI2P 2ZNDA 1HTLC 4U8DA 4HYTB 2FY8A 1AVYA 1J1DA 1JUNA 1WRLA 5KAIH 2P70A 2FYUE 2Q1KA 1DC1A 2FJUB 4RJTA 3FWCA 2ZN9A 2QACA 2Y5IA 1GM0A 1L0LD 3KXDA 5APTA 3AEGC 2LANA 4DS7A 2WPSA 3WHTB 1M39A 1NTKG 2KNEA 1KK8C 2CPBA 1W9ZA 2AXTE 2HF5A 3D78A 3HD7D 3L74D 2N1TD 1UHKA 1PRWA 2QEOA 2FBWC 2WSFH 3B88A 2LMUA 2WWWA 2JPOA 3DZTA 4U3FG 1QX7A 2ZNEA 1P84I 2WMMA 1BF5A 2WSEH 1EL4A 1PGQA 1H89A 1PP9D 2SASA 1KQLA 5BPJA 1Y47A 1D1OA 1FZBA 2IS9A 4OGQD 1GGZA 2OYOA 5K5GB 3CYZA 5CCGA 4DT0A 1KB9E 3DD4A 3CWGA 3L72D 2WVRA 1EDJA 3CZ0A 3ZNIA 2K2AA 1LS8A 1KC8Q 1XFVO 1H0TA 4CFQA 2WPQA 4MRYA 1R5SA 3CR4X 4WQ3A 1Q2NA 2KSEA 2OYIA 3DXLA 2IZ0A 2KP8A 2HFED 4YXDC 3RBZA 3MP7B 1DJWA 1BGYJ 1LXFC 1KYOD 1SQXK 2BCCJ 4YPCA 1FZCB 1RE3C 1BGYG 1KFUS 1SCMB 1C3YA 2LLTA 2AAOA 2WCLA 1WY9A 1JF0A 3HD7A 1NU1K 2P58A 3B5NB 2KDHA 2LR2A 1OMVA 4PD4D 1NOHA 1QS7A 3ZWHA 1FU1A 2KGRA 2OS8C 4CLNA 1CI6A 3L72E 3GW6A 1N8RQ 3PJSK 1OW8A 1Z4HA 1DEEG 3TGUE 1W7IB 1S5GY 3O6QA 2A45I 3H1IJ 2NCOA 2RGIA 2J58A 1UHNA 5E79H 2P67A 2JRFA 5CSIA 1G8IA 2LLSA 1Q82Q 1YVHA 3KPXA 3HE5A 1VQ7P 4PHKA 1SQXJ 3MGNA 1QATA 3CZTX 5HLOA 1T8ZA 3VMYA 5KLVE 3JTDB 2KUBA 5PALA 4H44C 2KLUA 2BCCD 1JCDA 1L0ND 3O6QB 1BCCG 1SQPD 3MTUE 4GT1A 1PPJE 3L47A 3EFFK 4MN4C 1C3ZA 2BCBA 1Z56A 2K1AA 2ZN8A 5EFWB 5KTYA 1OZOA 4FQTA 1DEKA 4AQIA 3BASA 3JSVC 1D7MA 1L0LE 5I2QA 1URQA 3H1IE 1SS1A 5AW2B 2WC5A 1XTGB 1K9MQ 2KZJA 5AW3B 3RK3D 3AEFC 2KSJA 1QL1A 3LIDA 3R1VA 3O2PA 1XFUO 4UB8H 1TUZA 1IZNB 1SK6D 3HRNA 1YITP 1XO5A 1L0LK 5GTHH 2QE7H 2YO2A 1B7TZ 2PMYA 3VMAA 2NLNA 1K96A 1PPJD 1CZQA 3H1JE 4Y28J 3SWKA 3H4SE 1L0NE 5AW1B 3TF5A 3Q8IA 1GK6A 3H1HJ 4OCIA 2M3EA 2YMKA 4PE1A 2M97A 1PGPA 1GTWA 4JPZB 1YJ9P 2KSPA 5CCHC 2WPVB 4DOJA 1K8UA 2WOSA 2I8DA 1KQGB 2LP2A 4GKGA 2M1KB 4R4MA 1KWOC 4WWIA 3IQOA 3ZDMA 3CC4P 1CDLA 2BKHB 1RF1C 2WC6A 4CFRA 1LTIC 3C8VA 1GMJA 2QEVA 4HRGA 1N73B 2YGUA 1GW3A 4PDZA 1HWTC 2E75B 1ALVA 3SG6A 2P6BB 4OH8B 1VRKA 2AEMA 1KV4A 3NSOA 2CK3H 1UP5A 3B87A 4M3LA 2NPSB 4I2LC 1Y1UA 1S5LE 4C7NA 1XTCC 3P8CD 1J2JB 3SG7A 2FFDC 3SS3A 1KYOE 1KILE 4OR9B 4YTPC 1N7SD 1BR4B 3CCRP 1SQXG 1CW5A 2LAPA 1IRJA 4EDFA 4Y99B 1BLQA 2JPTA 3VRNA 2W6BA 5BU5A 3HX4A 2N9BA 1M63B
chains in the Genus database with same CATH topology
5CSFA 2JC2A 1K90D 1K94A 5HLVA 2LVJA 1Q80A 4DCKA 1SKTA 2NZ0A 4FTGA 4OKHA 3I5IB 3NXAA 2BBNA 5J3XA 1C07A 1H8BA 5I2OA 1JFKA 1L7ZA 1F55A 1GGWA 2PRUA 2KYCA 1S6IA 1MR8A 1TCOB 3JTDC 2MAZA 1YTZC 1U5IA 1G33A 1MF8B 1QV1A 3BUXB 1CDMA 4MRXA 1RK9A 2O5GA 3FS7A 1JBAA 1K2HA 2KGBC 2CNPA 2LMVA 2BL0B 3O78A 3A4UB 3M0WA 1GQMA 1K9UA 3IQQA 1NWDA 1NX3A 2AUCA 2CXJA 2WCFA 3OX5A 4D1EA 2JNFA 1CNPA 4DUQA 2LUCA 2EHBA 2LM5A 1U5IB 4N1FA 4NDBA 2MJWB 3TUYC 2L0PA 1LVCD 2QPTA 4M2QA 2F3YA 3MSEB 2L2EA 3IF7A 3I5GC 1YURA 2B1UA 3BYAA 1TNXA 1L2OB 1FF1A 1DJZA 1WLMA 1RJVA 5TNCA 1WRKA 2M8UA 2M49B 2HETA 3I5HC 1SCVA 3OX6A 1DGVA 1SRAA 2JXCA 1R6PA 1JSAA 4N1GA 3BQ3A 1LA3A 1N65A 1FI6A 2M9GA 3VRRA 1BU3A 2I94A 3LCPC 2H2KA 3TS5B 2LHLA 2Q91A 1CFCA 2H61A 2WNDA 4BY4A 5IBWA 1V1FA 1YRUB 2EGDA 4C0LA 1CFFA 2Y4QA 1DT7B 3KHEA 1YR5A 5DKRA 4I5LB 3OB2B 1QV0A 1QJTA 2MLEC 2PVBA 4ICBA 4MVFA 1TTXA 2K7BA 4OVNF 5ER4X 3DVJA 2KBIA 2JT3A 4P2YB 2K8MB 2JU0A 2L51A 1AJ5A 4NDDA 1XK4C 1IKUA 4R1EA 3VGOA 1QASA 3CLNA 2LLUA 5AEQA 2BBMA 1MXLC 3CS1A 3QRXA 4GGNA 1RWYA 3GK4X 1MWNA 4ZCUA 5AERA 2BCAA 1EXRA 4M2PA 3OB1B 1K9PA 2OTGC 3PN7C 1AK8A 1JUOA 1KQMC 1NCYA 1KWOB 3BUWB 3RLZA 3E3RA 4AQJA 1EH2A 1DJXA 3PATA 1GJYA 2ISDA 1F71A 5JOLA 3CGAA 2CCMA 1EG3A 5AFPA 3EKHA 4HRHA 1KCYA 3SG4A 3BUOB 4CPVA 5CPVA 1IWQA 1ZFSA 1S6JA 1SW8A 3BOWA 4C0KA 2KI6C 4MZJA 4QJ5B 2MHHA 1QX5B 3BXKA 1S3PA 2L4IA 2L50A 2LNKA 1A03A 1SL7A 5I2LA 4PE0A 1RECA 1CLLA 2M3WA 2HQWA 3I5GB 3VRQA 1DJYA 1L2OC 2F3ZA 1KK8B 2CTNA 2SCPA 1B8LA 1UUSA 3OHMB 5HKWA 4ETOA 5KSZA 1XFYO 1OMDA 1CFPA 2K7CA 3VRPA 1XVJA 2M7LA 1UHJA 1JF2A 4GAOA 3K21A 3CR5X 1KFXS 2K7DA 3AAKA 4JWQA 4A4BA 1IH0A 1TIZA 1NYAA 5AANA 1B9AA 3GK2A 3EVUA 4M2OA 1CMGA 1ZMZA 1X02A 1NIWA 1CMFA 2VRGA 3EK4A 1DJHA 1AVSA 2M29A 1NSHA 2JWWA 2OS8B 1KFUL 2ZFDA 3C1VA 2I18A 3CTNA 1F4OA 5CSNA 1F70A 3JVTB 1OSAA 1DJIA 1S36A 4MBEA 2E6WA 5FYXA 1J1EA 4MEWA 1WLZA 4P5OE 1F8HA 2KFHA 4I5KA 1QX2A 1F54A 1OZSA 1RROA 3BOWB 1NP8A 1A75A 1NCZA 1QIVA 3I5IC 1AHRA 1MHOA 1JFJA 2O60A 3NSIA 1LA0A 2JXLA 1EJ3A 3EKJA 1S5GZ 3SJSA 1BMOA 2LMTA 4A4CA 1KSOA 1TNQA 2Y1NA 4BY5A 3DVKA 3I5FC 1PVAA 2BE6A 3GOFA 1XK4A 2HPSA 3FWBA 2KQYA 1IQ3A 2ZNDA 1YUUA 4U8DA 1MQ1A 1UHHA 3WHUB 1J1DA 3LLEA 1WRLA 1SPYA 4NQGA 2FJUB 4YGCB 4IL1A 5KU1A 3FWCA 1FPWA 2G2BA 2ZN9A 2A4JA 2TN4A 1PALA 1K95A 1AJ4A 1SNLA 2JTTA 2QACA 2Y5IA 1M45A 1BG1A 1N0YA 2LANA 4YRUA 4DS7A 1K9KA 4NDCA 2MBXA 4YGAA 1G4YR 2I7AA 1CTRA 4XJKB 3WHTB 1J7PA 1M39A 2KNEA 2HQ8A 1KK8C 1B47A 2LVIA 2ZRSA 1UURA 5K89A 1TN4A 4MZKA 1SY9A 4USLA 3AAJA 2LUXA 2JTZA 1QXPA 3TDIA 1IQ5A 4GPLB 2HF5A 3SG3A 2WORA 1PK0D 1CB1A 3SIBA 1UHKA 1PRWA 1Y0VH 1IG5A 2LMUA 1BOCA 1OOJA 4GFTA 1PULA 2E30A 2BCXA 1TOPA 2LP3A 1H4BA 4GGFA 4YGBB 2Y9ZA 2PALA 1AUIB 1QX7A 4GGFC 1YUSA 2ZNEA 1BF5A 3HCMA 1XFZO 4XYNA 2AMIA 1EL4A 1NPQA 2CT9A 3D0YB 2KYFA 2SASA 3TDUA 2L5XB 2BECA 5BPJA 1D1OA 1CLBA 1N2DA 2IS9A 3A8RA 1QTXA 1R2UA 2FCDA 2K2FA 1GGZA 1DF0A 1C7VA 2OTGB 1EG4A 3DVEA 2GGZA 4TNCA 1RTP1 5D69A 3DD4A 3CWGA 1QVIZ 1BR1B 4ORAB 3LL8B 5DKQA 3ZNIA 1JC2A 1ZOTB 2K2AA 3I5FB 2L4HA 1XFVO 3SG5A 1SR6C 1ZACA 5G08A 4DIRA 2JNXA 4CFQA 2KI6D 4MRYA 1FBVA 3ICBA 1B4CA 2KI4C 3CR4X 4WQ3A 1QIWA 1XFXO 1CDNA 1MXEA 4F0ZB 4QJ4B 1C7WA 1DJWA 1SYMA 3GK1A 4HREE 1LXFC 2L98A 2I2RE 2LCPA 2M0RA 3NSKA 1Y6WA 1J7OA 1UWOA 3AKAA 4PE4A 1YUTA 3OP0A 1A29A 1KFUS 4WQ2A 1SCMB 2LLTA 1KK7Y 2AAOA 3BUMB 1FI5A 2M7NA 5F6TA 4AOMA 2KAYA 1WY9A 1ODBA 1YX8A 1JF0A 3PLFB 5JJGA 5GQQC 2KDHA 1PSBA 2K61A 3RM1A 3LK0A 3DF0A 1OMVA 4GBAA 2KBMA 1Y1XA 1DF0B 1KK7Z 1QS7A 3ZWHA 2KGRA 1XYDA 2DOQA 1J55A 1S1EA 2OS8C 2V53A 1ALWA 3F45A 4JQ0D 4CLNA 1YVLA 4YGDB 4FQOA 1ZUZA 3DF0B 2JT8A 1W7IB 4GUKA 1LINA 1WDCB 1S5GY 2EC6B 1K93D 2JOJA 3O6BA 2NCOA 1DJGA 2RGIA 1IGVA 2K0JA 1UHNA 2JRFA 5CSIA 2Y1MA 1G8IA 2LLSA 1YVHA 3KPXA 1SL8A 4I5NB 1BJFA 3BUNB 1DVIA 3D0YA 4WRIA 1TNWA 4ORBB 1PVBA 2WC8A 4PHKA 1B7TY 3DVMA 1QATA 3CZTX 2PASA 5HLOA 2KFGA 3JTDB 5PALA 4UPGA 1J7QA 1NX2A 1TCFA 3WNXB 5D7FA 1IJ6A 2JQ6A 4OV2A 1B8RA 4PALA 2D8NA 1UHIA 1XA5A 2BCBA 2ZRTA 4ORCB 2ZN8A 2JULA 4PHNA 2KHNA 3KO0A 5HYDA 2KI4B 1TNPA 3CR2A 3PFVA 5KTYA 1CKKA 1OZOA 2F8PA 2KOTA 3TUYB 4AQIA 3KEVA 1SL9A 5I2QA 1NCXA 1NX1A 2K7OA 2H61C 1JWDA 2COLB 3EVRA 1KSMA 4I5JA 3EVVA 1B8CA 3O4YA 2Y9YA 3I5HB 4MN0A 5HKZA 3O2PA 5I8NA 1OFCX 1XFUO 1OMRA 1OQPA 2LV7A 2FCEA 4C0JA 1DMOA 4YI9A 1CLMA 1RFJA 1M31A 1E8AA 3PSRA 3SIAA 1AP4A 1SK6D 2F2PA 1W7JB 1IJ5A 1XO5A 4PHJA 2LVVA 2MLFC 1CFDA 1PSRA 1QLKA 2F2OA 2KAXA 1KQVA 1B7TZ 2PMYA 4PHMA 2NLNA 3VROA 1K96A 3EK8A 4Q04A 2PSRA 3H4SE 4CIDA 4YGEB 1DTLA 5DKNA 4OCIA 1QVIY 4PE1A 1OE9B 1TRFA 2M97A 1FW4A 4HSZA 4JPZB 2NXQA 2KSPA 1HT9A 3AKBA 4YI8A 4DRWA 1QLSA 1K8UA 2WOSA 3PN7B 1SR6B 2LP2A 2LVKA 2BL0C 2KAVA 3FIAA 2M1KB 1KQMB 1Y1AA 1KWOC 2FOTA 3IQOA 1CM4A 1CDLA 2BKHB 1YX7A 3TZ1A 1B1GA 4CFRA 1F4QA 2MRDA 1LKJA 1WRZA 3PM8A 3D10A 4HRGA 5B8IB 1S26D 2JZIA 1J7RA 4PDZA 4E68A 1CDPA 4L9MA 1A75B 2GV5A 4MSPA 1ALVA 3SG6A 2P6BB 4PE7A 3KF9A 2WCBA 1NX0A 1VRKA 1A4PA 5HKYA 1HQVA 1SCMC 2CBLA 1M46A 2OPOA 3NSOA 4YBHB 2F33A 2ZKMX 2M1UA 4XJKA 1UP5A 1Y1UA 1A2XA 1S6CA 2WCEA 2NCPA 2LE9B 1DGUA 1BODA 1YRTB 3SG7A 3LK1A 2MA2A 3SG2A 4PCWA 2LHIA 3TS5C 2KQ6A 4GNKB 3PALA 2LC5A 4OR9B 1CM1A 3NSLA 1SMGA 1MUXA 1NUBA 1BR4B 2JT0A 2KFFA 4QJ3B 1XFWO 2R2IA 2G9BA 2BKIB 1BT6A 2BE4A 5ER5A 1SBJA 2LAPA 1IRJA 3EK7A 4ZCVA 1WDCC 2EC6C 3JVTC 5AXIA 2JPTA 3WXAA 2Q4UA 4MZLA 4N5XA 4MLWA 3TDZA 3VRNA 1BLQA 5CSJA 1V1GA 1KFXL 3HX4A 2GGMA 1M63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSF A;  2JC2 A;  1K90 D;  1K94 A;  5HLV A;  2LVJ A;  1Q80 A;  4DCK A;  1SKT A;  2NZ0 A;  4FTG A;  4OKH A;  3I5I B;  3NXA A;  2BBN A;  5J3X A;  1C07 A;  1H8B A;  5I2O A;  1JFK A;  1L7Z A;  1F55 A;  1GGW A;  2PRU A;  2KYC A;  1S6I A;  1MR8 A;  1TCO B;  3JTD C;  2MAZ A;  1YTZ C;  1U5I A;  1G33 A;  1MF8 B;  1QV1 A;  3BUX B;  1CDM A;  4MRX A;  1RK9 A;  2O5G A;  3FS7 A;  1JBA A;  1K2H A;  2KGB C;  2CNP A;  2LMV A;  2BL0 B;  3O78 A;  3A4U B;  3M0W A;  1GQM A;  1K9U A;  3IQQ A;  1NWD A;  1NX3 A;  2AUC A;  2CXJ A;  2WCF A;  3OX5 A;  4D1E A;  2JNF A;  1CNP A;  4DUQ A;  2LUC A;  2EHB A;  2LM5 A;  1U5I B;  4N1F A;  4NDB A;  2MJW B;  3TUY C;  2L0P A;  1LVC D;  2QPT A;  4M2Q A;  2F3Y A;  3MSE B;  2L2E A;  3IF7 A;  3I5G C;  1YUR A;  2B1U A;  3BYA A;  1TNX A;  1L2O B;  1FF1 A;  1DJZ A;  1WLM A;  1RJV A;  5TNC A;  1WRK A;  2M8U A;  2M49 B;  2HET A;  3I5H C;  1SCV A;  3OX6 A;  1DGV A;  1SRA A;  2JXC A;  1R6P A;  1JSA A;  4N1G A;  3BQ3 A;  1LA3 A;  1N65 A;  1FI6 A;  2M9G A;  3VRR A;  1BU3 A;  2I94 A;  3LCP C;  2H2K A;  3TS5 B;  2LHL A;  2Q91 A;  1CFC A;  2H61 A;  2WND A;  4BY4 A;  5IBW A;  1V1F A;  1YRU B;  2EGD A;  4C0L A;  1CFF A;  2Y4Q A;  1DT7 B;  3KHE A;  1YR5 A;  5DKR A;  4I5L B;  3OB2 B;  1QV0 A;  1QJT A;  2MLE C;  2PVB A;  4ICB A;  4MVF A;  1TTX A;  2K7B A;  4OVN F;  5ER4 X;  3DVJ A;  2KBI A;  2JT3 A;  4P2Y B;  2K8M B;  2JU0 A;  2L51 A;  1AJ5 A;  4NDD A;  1XK4 C;  1IKU A;  4R1E A;  3VGO A;  1QAS A;  3CLN A;  2LLU A;  5AEQ A;  2BBM A;  1MXL C;  3CS1 A;  3QRX A;  4GGN A;  1RWY A;  3GK4 X;  1MWN A;  4ZCU A;  5AER A;  2BCA A;  1EXR A;  4M2P A;  3OB1 B;  1K9P A;  2OTG C;  3PN7 C;  1AK8 A;  1JUO A;  1KQM C;  1NCY A;  1KWO B;  3BUW B;  3RLZ A;  3E3R A;  4AQJ A;  1EH2 A;  1DJX A;  3PAT A;  1GJY A;  2ISD A;  1F71 A;  5JOL A;  3CGA A;  2CCM A;  1EG3 A;  5AFP A;  3EKH A;  4HRH A;  1KCY A;  3SG4 A;  3BUO B;  4CPV A;  5CPV A;  1IWQ A;  1ZFS A;  1S6J A;  1SW8 A;  3BOW A;  4C0K A;  2KI6 C;  4MZJ A;  4QJ5 B;  2MHH A;  1QX5 B;  3BXK A;  1S3P A;  2L4I A;  2L50 A;  2LNK A;  1A03 A;  1SL7 A;  5I2L A;  4PE0 A;  1REC A;  1CLL A;  2M3W A;  2HQW A;  3I5G B;  3VRQ A;  1DJY A;  1L2O C;  2F3Z A;  1KK8 B;  2CTN A;  2SCP A;  1B8L A;  1UUS A;  3OHM B;  5HKW A;  4ETO A;  5KSZ A;  1XFY O;  1OMD A;  1CFP A;  2K7C A;  3VRP A;  1XVJ A;  2M7L A;  1UHJ A;  1JF2 A;  4GAO A;  3K21 A;  3CR5 X;  1KFX S;  2K7D A;  3AAK A;  4JWQ A;  4A4B A;  1IH0 A;  1TIZ A;  1NYA A;  5AAN A;  1B9A A;  3GK2 A;  3EVU A;  4M2O A;  1CMG A;  1ZMZ A;  1X02 A;  1NIW A;  1CMF A;  2VRG A;  3EK4 A;  1DJH A;  1AVS A;  2M29 A;  1NSH A;  2JWW A;  2OS8 B;  1KFU L;  2ZFD A;  3C1V A;  2I18 A;  3CTN A;  1F4O A;  5CSN A;  1F70 A;  3JVT B;  1OSA A;  1DJI A;  1S36 A;  4MBE A;  2E6W A;  5FYX A;  1J1E A;  4MEW A;  1WLZ A;  4P5O E;  1F8H A;  2KFH A;  4I5K A;  1QX2 A;  1F54 A;  1OZS A;  1RRO A;  3BOW B;  1NP8 A;  1A75 A;  1NCZ A;  1QIV A;  3I5I C;  1AHR A;  1MHO A;  1JFJ A;  2O60 A;  3NSI A;  1LA0 A;  2JXL A;  1EJ3 A;  3EKJ A;  1S5G Z;  3SJS A;  1BMO A;  2LMT A;  4A4C A;  1KSO A;  1TNQ A;  2Y1N A;  4BY5 A;  3DVK A;  3I5F C;  1PVA A;  2BE6 A;  3GOF A;  1XK4 A;  2HPS A;  3FWB A;  2KQY A;  1IQ3 A;  2ZND A;  1YUU A;  4U8D A;  1MQ1 A;  1UHH A;  3WHU B;  1J1D A;  3LLE A;  1WRL A;  1SPY A;  4NQG A;  2FJU B;  4YGC B;  4IL1 A;  5KU1 A;  3FWC A;  1FPW A;  2G2B A;  2ZN9 A;  2A4J A;  2TN4 A;  1PAL A;  1K95 A;  1AJ4 A;  1SNL A;  2JTT A;  2QAC A;  2Y5I A;  1M45 A;  1BG1 A;  1N0Y A;  2LAN A;  4YRU A;  4DS7 A;  1K9K A;  4NDC A;  2MBX A;  4YGA A;  1G4Y R;  2I7A A;  1CTR A;  4XJK B;  3WHT B;  1J7P A;  1M39 A;  2KNE A;  2HQ8 A;  1KK8 C;  1B47 A;  2LVI A;  2ZRS A;  1UUR A;  5K89 A;  1TN4 A;  4MZK A;  1SY9 A;  4USL A;  3AAJ A;  2LUX A;  2JTZ A;  1QXP A;  3TDI A;  1IQ5 A;  4GPL B;  2HF5 A;  3SG3 A;  2WOR A;  1PK0 D;  1CB1 A;  3SIB A;  1UHK A;  1PRW A;  1Y0V H;  1IG5 A;  2LMU A;  1BOC A;  1OOJ A;  4GFT A;  1PUL A;  2E30 A;  2BCX A;  1TOP A;  2LP3 A;  1H4B A;  4GGF A;  4YGB B;  2Y9Z A;  2PAL A;  1AUI B;  1QX7 A;  4GGF C;  1YUS A;  2ZNE A;  1BF5 A;  3HCM A;  1XFZ O;  4XYN A;  2AMI A;  1EL4 A;  1NPQ A;  2CT9 A;  3D0Y B;  2KYF A;  2SAS A;  3TDU A;  2L5X B;  2BEC A;  5BPJ A;  1D1O A;  1CLB A;  1N2D A;  2IS9 A;  3A8R A;  1QTX A;  1R2U A;  2FCD A;  2K2F A;  1GGZ A;  1DF0 A;  1C7V A;  2OTG B;  1EG4 A;  3DVE A;  2GGZ A;  4TNC A;  1RTP 1;  5D69 A;  3DD4 A;  3CWG A;  1QVI Z;  1BR1 B;  4ORA B;  3LL8 B;  5DKQ A;  3ZNI A;  1JC2 A;  1ZOT B;  2K2A A;  3I5F B;  2L4H A;  1XFV O;  3SG5 A;  1SR6 C;  1ZAC A;  5G08 A;  4DIR A;  2JNX A;  4CFQ A;  2KI6 D;  4MRY A;  1FBV A;  3ICB A;  1B4C A;  2KI4 C;  3CR4 X;  4WQ3 A;  1QIW A;  1XFX O;  1CDN A;  1MXE A;  4F0Z B;  4QJ4 B;  1C7W A;  1DJW A;  1SYM A;  3GK1 A;  4HRE E;  1LXF C;  2L98 A;  2I2R E;  2LCP A;  2M0R A;  3NSK A;  1Y6W A;  1J7O A;  1UWO A;  3AKA A;  4PE4 A;  1YUT A;  3OP0 A;  1A29 A;  1KFU S;  4WQ2 A;  1SCM B;  2LLT A;  1KK7 Y;  2AAO A;  3BUM B;  1FI5 A;  2M7N A;  5F6T A;  4AOM A;  2KAY A;  1WY9 A;  1ODB A;  1YX8 A;  1JF0 A;  3PLF B;  5JJG A;  5GQQ C;  2KDH A;  1PSB A;  2K61 A;  3RM1 A;  3LK0 A;  3DF0 A;  1OMV A;  4GBA A;  2KBM A;  1Y1X A;  1DF0 B;  1KK7 Z;  1QS7 A;  3ZWH A;  2KGR A;  1XYD A;  2DOQ A;  1J55 A;  1S1E A;  2OS8 C;  2V53 A;  1ALW A;  3F45 A;  4JQ0 D;  4CLN A;  1YVL A;  4YGD B;  4FQO A;  1ZUZ A;  3DF0 B;  2JT8 A;  1W7I B;  4GUK A;  1LIN A;  1WDC B;  1S5G Y;  2EC6 B;  1K93 D;  2JOJ A;  3O6B A;  2NCO A;  1DJG A;  2RGI A;  1IGV A;  2K0J A;  1UHN A;  2JRF A;  5CSI A;  2Y1M A;  1G8I A;  2LLS A;  1YVH A;  3KPX A;  1SL8 A;  4I5N B;  1BJF A;  3BUN B;  1DVI A;  3D0Y A;  4WRI A;  1TNW A;  4ORB B;  1PVB A;  2WC8 A;  4PHK A;  1B7T Y;  3DVM A;  1QAT A;  3CZT X;  2PAS A;  5HLO A;  2KFG A;  3JTD B;  5PAL A;  4UPG A;  1J7Q A;  1NX2 A;  1TCF A;  3WNX B;  5D7F A;  1IJ6 A;  2JQ6 A;  4OV2 A;  1B8R A;  4PAL A;  2D8N A;  1UHI A;  1XA5 A;  2BCB A;  2ZRT A;  4ORC B;  2ZN8 A;  2JUL A;  4PHN A;  2KHN A;  3KO0 A;  5HYD A;  2KI4 B;  1TNP A;  3CR2 A;  3PFV A;  5KTY A;  1CKK A;  1OZO A;  2F8P A;  2KOT A;  3TUY B;  4AQI A;  3KEV A;  1SL9 A;  5I2Q A;  1NCX A;  1NX1 A;  2K7O A;  2H61 C;  1JWD A;  2COL B;  3EVR A;  1KSM A;  4I5J A;  3EVV A;  1B8C A;  3O4Y A;  2Y9Y A;  3I5H B;  4MN0 A;  5HKZ A;  3O2P A;  5I8N A;  1OFC X;  1XFU O;  1OMR A;  1OQP A;  2LV7 A;  2FCE A;  4C0J A;  1DMO A;  4YI9 A;  1CLM A;  1RFJ A;  1M31 A;  1E8A A;  3PSR A;  3SIA A;  1AP4 A;  1SK6 D;  2F2P A;  1W7J B;  1IJ5 A;  1XO5 A;  4PHJ A;  2LVV A;  2MLF C;  1CFD A;  1PSR A;  1QLK A;  2F2O A;  2KAX A;  1KQV A;  1B7T Z;  2PMY A;  4PHM A;  2NLN A;  3VRO A;  1K96 A;  3EK8 A;  4Q04 A;  2PSR A;  3H4S E;  4CID A;  4YGE B;  1DTL A;  5DKN A;  4OCI A;  1QVI Y;  4PE1 A;  1OE9 B;  1TRF A;  2M97 A;  1FW4 A;  4HSZ A;  4JPZ B;  2NXQ A;  2KSP A;  1HT9 A;  3AKB A;  4YI8 A;  4DRW A;  1QLS A;  1K8U A;  2WOS A;  3PN7 B;  1SR6 B;  2LP2 A;  2LVK A;  2BL0 C;  2KAV A;  3FIA A;  2M1K B;  1KQM B;  1Y1A A;  1KWO C;  2FOT A;  3IQO A;  1CM4 A;  1CDL A;  2BKH B;  1YX7 A;  3TZ1 A;  1B1G A;  4CFR A;  1F4Q A;  2MRD A;  1LKJ A;  1WRZ A;  3PM8 A;  3D10 A;  4HRG A;  5B8I B;  1S26 D;  2JZI A;  1J7R A;  4PDZ A;  4E68 A;  1CDP A;  4L9M A;  1A75 B;  2GV5 A;  4MSP A;  1ALV A;  3SG6 A;  2P6B B;  4PE7 A;  3KF9 A;  2WCB A;  1NX0 A;  1VRK A;  1A4P A;  5HKY A;  1HQV A;  1SCM C;  2CBL A;  1M46 A;  2OPO A;  3NSO A;  4YBH B;  2F33 A;  2ZKM X;  2M1U A;  4XJK A;  1UP5 A;  1Y1U A;  1A2X A;  1S6C A;  2WCE A;  2NCP A;  2LE9 B;  1DGU A;  1BOD A;  1YRT B;  3SG7 A;  3LK1 A;  2MA2 A;  3SG2 A;  4PCW A;  2LHI A;  3TS5 C;  2KQ6 A;  4GNK B;  3PAL A;  2LC5 A;  4OR9 B;  1CM1 A;  3NSL A;  1SMG A;  1MUX A;  1NUB A;  1BR4 B;  2JT0 A;  2KFF A;  4QJ3 B;  1XFW O;  2R2I A;  2G9B A;  2BKI B;  1BT6 A;  2BE4 A;  5ER5 A;  1SBJ A;  2LAP A;  1IRJ A;  3EK7 A;  4ZCV A;  1WDC C;  2EC6 C;  3JVT C;  5AXI A;  2JPT A;  3WXA A;  2Q4U A;  4MZL A;  4N5X A;  4MLW A;  3TDZ A;  3VRN A;  1BLQ A;  5CSJ A;  1V1G A;  1KFX L;  3HX4 A;  2GGM A;  1M63 B; 
#chains in the Genus database with same CATH topology
 1N86 A;  1K90 D;  1K94 A;  3FWN A;  1Q80 A;  4OKH A;  3NXA A;  3BCC D;  3PTZ A;  3S0D A;  4N78 E;  1GGW A;  5BU8 B;  3L74 E;  1TCO B;  4UB6 H;  3S1K A;  1YTZ C;  4U7J A;  1T3J A;  3B4S A;  3BCC J;  5B66 H;  3H1K D;  2ZYA A;  1CDM A;  1K2H A;  1X9V A;  2KIK A;  2KGB C;  2CNP A;  3O78 A;  3FXD A;  3M0W A;  1GQM A;  1M1J B;  1NWD A;  2YO3 A;  1GW4 A;  2JNF A;  2LM5 A;  4N1F A;  4NDB A;  1YJW P;  1HVV A;  2L0P A;  4EI2 A;  4WY4 C;  3W68 A;  2OYH A;  3IF7 A;  3A0B H;  1ZRT E;  1TNX A;  1T2K D;  2CPS A;  3S0A A;  3II6 A;  1WLM A;  1RJV A;  1LWU B;  1FZE A;  2R32 A;  3I5H C;  1RQU A;  1DGV A;  3AEB C;  3H1L J;  1S5L X;  4N1G A;  3UNW A;  5AVW B;  1OVV A;  4Z1M H;  5AW9 B;  3UO9 A;  2H89 C;  2I94 A;  1JO5 A;  2R3C A;  2H2K A;  3TS5 B;  4XFJ A;  2P71 A;  2Y4Q A;  3KDP B;  3I5C A;  4K3A A;  1FOS E;  2YIU C;  4ASV A;  4ICB A;  4MVF A;  1TTX A;  1EDI A;  4OVN F;  3BFH A;  2JT3 A;  1IKU A;  2JU0 A;  1AJ5 A;  4NDD A;  5FI7 A;  4R1E A;  3VGO A;  3ITK A;  2QJP C;  5AEQ A;  4A7P A;  2BAS A;  3QRX A;  3CLQ A;  1LTG C;  1HGV A;  3KZI H;  1K9P A;  1JUO A;  3K5B A;  1NCY A;  2IFN A;  5APU A;  1K05 A;  3JCU E;  2YNY A;  2L5Y A;  1DJX A;  1LT9 C;  3HE4 A;  5JOL A;  2CCM A;  2Z5H A;  1A02 F;  2GM4 A;  1IWQ A;  1S6J A;  4C0K A;  5TIS H;  2MHH A;  1NTM K;  1QX5 B;  1S3P A;  4NPF X;  1IK7 A;  1REC A;  2BEZ F;  2M3W A;  1EZV G;  2M5A A;  2C0W A;  3V2Q A;  4ETO A;  3L70 G;  3NMD A;  3CWB E;  1XVJ A;  1VL2 A;  1UHJ A;  3CX5 H;  3K21 A;  1OXZ A;  3AAK A;  1TIZ A;  2R5D A;  5AW6 B;  2KNC B;  2E5T A;  2WCH A;  1JY3 N;  2HOD B;  2FYU G;  5AVV B;  1NIW A;  4GIF A;  1DJH A;  1GL2 A;  1NYH A;  1KFU L;  3RK3 B;  3U1C A;  1F4O A;  3H1I G;  1QVF O;  1YQ3 C;  3BOW B;  3SSU A;  3AEE C;  3U1A A;  1SQQ J;  1ZR2 A;  3L37 A;  1EJ3 A;  1A02 J;  3EKJ A;  1FBM A;  1SQX D;  3Q5S A;  5CCG C;  1KSO A;  4AUW A;  2W8Z A;  1EDK A;  4U3F J;  3VMX A;  3MUD C;  1NO4 A;  3BFB A;  3WHU B;  3LLE A;  4NQG A;  4H0L B;  3W67 A;  5KU1 A;  1T3U A;  1G2C A;  1AA0 A;  3GF3 A;  4YRU A;  1K9K A;  4NDC A;  2MBX A;  1SQQ E;  3H32 B;  1Q86 Q;  2I7A A;  1KIL D;  3H1L D;  3FWL A;  1J7P A;  1YQ4 C;  2MKV A;  2ZRS A;  1K04 A;  1TN4 A;  4MZK A;  3CXH H;  3FXE A;  4BRY A;  1OOF A;  1SY9 A;  4USL A;  2H8P D;  2JTZ A;  1QXP A;  4INW A;  1M57 D;  4GPL B;  3ABV C;  1RE4 A;  3RGU A;  2HLO A;  2QJY C;  1DQE A;  1HH0 A;  4ZKP A;  1BOC A;  3M91 A;  3KZI E;  2KPH A;  1H4B A;  2LP3 A;  1DEL A;  2FYN C;  4UB6 E;  4YGB B;  1JB0 J;  3VN0 A;  1VQ6 P;  3CWB J;  1AUI B;  3HCM A;  1XFZ O;  1J1D C;  2FKW B;  2AMI A;  3D0Y B;  1NPQ A;  4ZMD A;  1J1E C;  3O8Z A;  1N2D A;  2RMZ A;  1QTX A;  3N4X A;  3L72 J;  2FCD A;  3IFM A;  1AQ5 A;  1C7V A;  2OTG B;  1EG4 A;  4TNC A;  5D69 A;  3P8M C;  4ORA B;  1NTZ G;  3M06 A;  3LL8 B;  1ZOT B;  3VOP A;  4I6M C;  5AVS B;  1SR6 C;  1ZAC A;  1MZ9 A;  4DIR A;  1FBV A;  3ICB A;  5CMZ A;  2D2C D;  5AVR B;  2L91 A;  1B4C A;  2W6A A;  1ZN5 A;  1QIW A;  1XFX O;  2E74 C;  4HRE E;  2L98 A;  3BFA A;  5CBO A;  1NKN A;  2ZT9 C;  1SQP G;  1LWU A;  4PE4 A;  3RK2 B;  2Q9I A;  1ZW0 A;  4AOM A;  5JJG A;  2ITA A;  1FAV A;  5APW A;  1LP1 B;  3S0E A;  5GQQ C;  1PSB A;  2K61 A;  1FS0 E;  1L0L J;  3BJH A;  3DF0 A;  3RK3 E;  1YBK A;  2KBM A;  3L73 J;  2KXP B;  1DF0 B;  1NTZ E;  2RH0 A;  1SFC A;  4JQ0 D;  4FQO A;  5B66 E;  1ZUZ A;  1SQB G;  3DF0 B;  1OOI X;  1P84 E;  3PRJ A;  3V6I A;  3B86 A;  3WUT A;  4GUK A;  2XV5 A;  1FDO A;  4H13 C;  1K93 D;  1NTM J;  1U7J A;  2WCM A;  1IGV A;  2K0J A;  1OIP A;  2P7J A;  5CCG D;  2Y1M A;  2NPS D;  2I1K A;  2M3B A;  1SQP E;  3D0Y A;  1IFM A;  1TNW A;  3D6Z A;  4ORB B;  3S0B A;  2XKM A;  1M1J A;  1TCF A;  3WNX B;  2QEX P;  2PYQ A;  2RN0 A;  2UWJ E;  2OYH C;  3A0H E;  1IJ6 A;  4OV2 A;  1B8R A;  4PAL A;  1UHI A;  1XA5 A;  2JUL A;  4PHN A;  3KO0 A;  1TNP A;  3CR2 A;  3SFD C;  3M0D A;  2F8P A;  2XDJ A;  1QGK B;  3TUY B;  3CME P;  2IPP A;  2Q3E A;  1JWD A;  2COL B;  1S1C X;  3H1K J;  5L8R J;  3EVR A;  1KSM A;  4I5J A;  2WSF J;  2P10 A;  3S0G A;  3T97 A;  2IBZ E;  5I8N A;  1OQP A;  2OTJ P;  3DY9 A;  3FGA D;  1H88 A;  4YI9 A;  1JCC A;  3GHG B;  2PRR A;  3USS A;  1RFJ A;  4BXL A;  2F2P A;  2WTY A;  1LGH B;  4TLF A;  2R44 A;  4IFM A;  2F2O A;  3RL0 D;  1YTZ T;  2AXT H;  3L71 G;  1JY2 N;  4IJ7 A;  2YKP A;  1AJY A;  1MFT A;  1SQB J;  4YGE B;  1DTL A;  2Y0C A;  1L4A A;  2N1T C;  1N73 A;  1OE9 B;  1TRF A;  5BVZ A;  3HE4 B;  4JKT A;  4IFD K;  4HSZ A;  3VTP C;  1EZV E;  2NXQ A;  1HT9 A;  3AKB A;  1ZRT D;  2E75 D;  1KIL C;  1KTM A;  2BL0 C;  1NTK D;  5APX A;  2FOT A;  1CM4 A;  2YKO A;  1NAY A;  3R1O A;  2E74 D;  2NZ2 A;  3MD0 A;  3D73 A;  1B1G A;  1X79 B;  2XZR A;  1F4Q A;  1G1J A;  4PV1 D;  1SVF A;  4O9B A;  3CL3 D;  3D10 A;  5B8I B;  1BSN A;  2JZI A;  5KLV G;  3R72 A;  1SP4 A;  4L9M A;  3SS4 A;  1VQK P;  3PHL A;  2OQQ A;  4PE7 A;  4W7Y A;  2CBL A;  1M46 A;  2F33 A;  4INX A;  4XJK A;  5CCH A;  3O4X A;  1A2X A;  2WCE A;  2NCP A;  2Q7C A;  2LE9 B;  3HUS C;  1BOD A;  2LHI A;  2GUS A;  3PAL A;  3CZ1 A;  1MUX A;  2WSC H;  2KFF A;  4QJ3 B;  1PV3 A;  3Q1M A;  1MKM A;  1BT6 A;  2JEE A;  2V7Q H;  3EWK A;  3CMA P;  3EK7 A;  2L5G B;  4ZCV A;  1WDC C;  3H25 A;  2EC6 C;  3AED C;  3WXA A;  3L75 E;  5KAF H;  4N5X A;  5FI6 A;  1SSE B;  3V2P A;  1QWV A;  2JC2 A;  1KB9 I;  1RQV A;  5APV A;  5KLV K;  3I5I B;  2N1T B;  1JFK A;  2PRU A;  1LTB C;  4AQR D;  1MR8 A;  3JTD C;  2MAZ A;  3GMA A;  5M1B A;  1QV1 A;  2WCJ A;  3BRV B;  1BE3 E;  4MRX A;  1RK9 A;  3FS7 A;  1USD A;  4W80 A;  2BL0 B;  3A4U B;  1K9U A;  1NX3 A;  2OAR A;  2B89 A;  2FXM A;  2LUC A;  1U5I B;  3CXH E;  3AE8 C;  5CJ4 A;  2F3Y A;  3MSE B;  3I5G C;  2B1U A;  1L0N J;  2WPR A;  3L74 G;  3L70 J;  3D71 A;  1L2O B;  1FZC A;  3M9Q A;  2HYN A;  1NGM B;  1WRK A;  2HET A;  3B71 A;  2VRS A;  1SRA A;  3IF4 A;  1R6P A;  2NPS C;  1H0T B;  3QWO C;  1JMM A;  1LA3 A;  3DYE A;  1FI6 A;  2Y0E A;  1FZG A;  4QMA A;  2M9G A;  1EC5 A;  3KQG A;  5KKZ B;  1NU1 E;  2WND A;  3RL0 C;  4DJG A;  1Z2C B;  3CX5 I;  3L4L A;  1PGJ A;  1SQV J;  2WIT A;  3S4R A;  2C9N Y;  1FC2 C;  3OB2 B;  1QV0 A;  3V5B A;  5KJ7 A;  3N7N A;  2K7B A;  3H32 A;  3DVJ A;  2KBI A;  4P2Y B;  1KD1 Q;  3IN6 A;  1BDD A;  1XK4 C;  2YXR B;  2FYU J;  1QAS A;  2LLU A;  5H2F E;  2BBM A;  1FZF A;  3GK4 X;  2BCA A;  3PN7 C;  1AK8 A;  3RLZ A;  5I94 A;  2XNX A;  1RF1 B;  1F71 A;  1KYO H;  1SLQ A;  3E7K A;  3EKH A;  1IFN A;  1VF5 B;  4JD9 A;  5CPV A;  1SQB K;  1N73 C;  2BNX A;  1SW8 A;  2KI6 C;  4MZJ A;  2JO1 A;  3L75 G;  1RE4 C;  2H88 C;  2L4I A;  1A03 A;  1SL7 A;  5I2L A;  3TNU A;  1LP1 A;  3VRQ A;  2ZYD A;  1L2O C;  1G1I A;  2K9Y A;  2CTN A;  1FZC C;  3OHM B;  3OBV A;  4D6T E;  1XFY O;  1OMD A;  3U59 A;  3TDK A;  2M7L A;  1RHZ B;  1YYC A;  4JWQ A;  1IH0 A;  3SFE C;  1PP9 J;  1B9A A;  3B5N C;  1UIX A;  3GK2 A;  1NTK E;  2O01 N;  4I7Z C;  1CMF A;  1NSH A;  1JNM A;  3CTN A;  3C1V A;  2B87 A;  1F70 A;  4Y99 C;  3JVT B;  1RH5 B;  1DJI A;  4PD4 E;  1EQ7 A;  3MUD A;  1J1E A;  4MEW A;  1WLZ A;  1BE3 G;  4PV1 C;  1NP8 A;  3AE1 C;  1GDT A;  4IL6 H;  4L76 A;  1NCZ A;  2W6J H;  2O1K A;  5AW5 B;  3LIE A;  1QIV A;  2ZXE B;  3B8E B;  3L71 J;  1AHR A;  2IYO A;  1LA0 A;  2JXL A;  1AVO A;  3SJS A;  3M9B A;  2LMT A;  3B6X A;  1TNQ A;  4TT3 H;  1P84 H;  3I5F C;  1PVA A;  2BE6 A;  1EZV I;  1M1J C;  3MHV A;  1NTM D;  1OMI A;  1YUU A;  2ZYG A;  3K1E A;  1UHH A;  4KJM A;  2KYV A;  2LKM A;  1SPY A;  5DJT B;  1X22 A;  5AW0 B;  3IAO A;  4YGC B;  1SQV D;  1TUJ A;  1FPW A;  1HGZ A;  1QX8 A;  1PAL A;  2ZJS E;  1K95 A;  1SNL A;  2JTT A;  1M45 A;  1BG1 A;  5C39 A;  4LGD E;  4PJ0 H;  1G4Y R;  1CTR A;  3NHT A;  1KFN A;  2QEH A;  1SFC C;  4WB4 A;  1B47 A;  1PP9 E;  2IX7 C;  1VQP P;  3PP5 A;  2I1J A;  2AEJ A;  4IFF A;  5KAF E;  1QL2 A;  4EOT A;  2LUX A;  4N78 D;  1IQ5 A;  2WOR A;  4ZKU A;  3SIB A;  3E1R A;  1K73 Q;  2YIU B;  1OOJ A;  3OA7 A;  1MUU A;  2E30 A;  2BCX A;  4GGF A;  2PAL A;  4GGF C;  1YUS A;  1T14 A;  2CT9 A;  3TDU A;  2L5X B;  1CLB A;  1NU1 D;  4IL6 X;  1VQN P;  3A8R A;  2ZVO B;  3A5T A;  1R8E A;  3AE5 C;  2GGZ A;  3TGU J;  1BR1 B;  3FE6 A;  2L4H A;  4B86 A;  2FJY A;  2KI6 D;  2K3R A;  1KQS O;  4JYC A;  2IFM A;  1FJP A;  2KI4 C;  2E5Y A;  3VYI A;  4WBA A;  5AVQ B;  1MXE A;  3BVH A;  1C7W A;  1SYM A;  1JTH A;  4H44 D;  2LCP A;  2IYP A;  1FOS F;  1YIJ P;  3V2R A;  1UWO A;  3AKA A;  2KOG A;  3OP0 A;  5KLI B;  4WQ2 A;  2KK7 A;  3BUM B;  1FI5 A;  2M7N A;  3OAK A;  2KAY A;  5D3O A;  3B5N D;  2QJK B;  1ODB A;  1YX8 A;  3A3Y B;  1XFR A;  1KMI Z;  1GL2 D;  3M0D C;  4GBA A;  1N7L A;  4GOD A;  1KK7 Z;  3PM2 A;  1XYD A;  4KT0 J;  1J55 A;  1S1E A;  2IBZ G;  1LTJ C;  1ALW A;  3F45 A;  3CXH D;  3KHU A;  2K9J A;  3RK3 C;  1YVL A;  4OGQ C;  3H1J D;  3TGU G;  1PFI A;  5GTI E;  2JT8 A;  3FE8 A;  1DD4 A;  3VMZ A;  1ZLL A;  5CJ0 A;  2JOJ A;  1DJG A;  2E76 D;  1J1D B;  1JTH B;  2ZFC A;  2IZ1 A;  1K8A Q;  1LTS C;  1SL8 A;  4RO0 A;  4HJG H;  3BUN B;  4WRI A;  1B7T Y;  3DVM A;  2PAS A;  1LJ2 A;  4LLH A;  1J7Q A;  2WSC J;  1T6A A;  5D7F A;  3L36 A;  1GD2 E;  2E76 B;  2D8N A;  4ORC B;  4YXW H;  3PFV A;  1CKK A;  3CCM P;  1S9K D;  2A06 D;  2P2U A;  3KEV A;  3CX5 D;  2JWD A;  1NCX A;  1NX1 A;  2K7O A;  1E79 H;  2H61 C;  2A06 E;  2IDB A;  4H0L D;  3EVV A;  1L4A C;  1B8C A;  2O3J A;  1NTZ K;  4UB8 E;  3I5H B;  5KAI E;  5KLV D;  1OFC X;  3GG2 A;  2LV7 A;  3V2N A;  4C7R A;  2QJK C;  2LXB A;  3V2L A;  1DMO A;  1M31 A;  2QJY B;  3SIA A;  1AP4 A;  4BRY B;  2KNC A;  1W7J B;  2QRX A;  1IJ5 A;  4PHJ A;  4N6J A;  3RZS A;  2LVV A;  2OTL P;  1LTJ B;  2MLF C;  1CFD A;  2KAX A;  3H1K E;  4PHM A;  3VRO A;  4NPE A;  1U7M A;  2K9J B;  3G3Z A;  1SQQ G;  4XE5 B;  1J1E B;  2NRG A;  2O01 H;  5DKN A;  4OZD A;  1LT1 A;  4BWN A;  1ZR4 A;  1GZL A;  5AVU B;  2D2C B;  2H7H A;  3AE6 C;  2Y0D A;  3CCV P;  3G4S P;  3LW5 J;  3CC2 P;  5APS A;  1SR6 B;  3AEA C;  1OVR A;  2KLV A;  1SFC D;  3FIA A;  1KQM B;  1Y1A A;  1IJD B;  3HE5 B;  1GL2 B;  1PP9 G;  1MV8 A;  1LT9 B;  1YX7 A;  2OYH B;  2Q3I A;  2J5U A;  2PQL A;  4PJ0 E;  5AVY B;  1KFM A;  4D6T D;  1WRZ A;  1SQB E;  3BRT B;  1J7R A;  1KB9 H;  3PH0 A;  4E68 A;  1IFD A;  1SQX E;  1E5W A;  5KJ7 D;  1NTK J;  3KF9 A;  2WCB A;  2ERB A;  1A4P A;  2OPO A;  1SCM C;  3Q3D A;  2ZKM X;  4PD4 H;  3WU2 E;  1RY3 A;  3CCU P;  1OWA A;  3IR9 A;  4L74 A;  2WT7 B;  1S6C A;  3Q5P A;  1URQ C;  1EDL A;  3S0F A;  5TJH A;  1KB9 D;  1YRT B;  3LK1 A;  2MA2 A;  3SG2 A;  4PCW A;  3L71 D;  1BCC J;  1T2K C;  2LC5 A;  1SQB D;  1CM1 A;  3GLM A;  1SMG A;  1ZME C;  1NUB A;  5ER5 A;  3P32 A;  2FYZ A;  1OW7 A;  3UIA A;  2QSI A;  5AXI A;  2Q4U A;  3TDZ A;  1V1G A;  5HKY A;  1GK4 A;  5CSF A;  2JKV A;  5HLV A;  2R5B A;  4XA4 A;  4DCK A;  1SKT A;  2H8V A;  2NZ0 A;  4FTG A;  5J3X A;  1H8B A;  2KZI A;  2BBN A;  2BAP A;  2KYC A;  1S6I A;  1S4X A;  1U5I A;  1G33 A;  1JBA A;  4K35 A;  3PJI A;  3V4W A;  2DW3 A;  3OX5 A;  2AUC A;  1JM0 A;  2CXJ A;  1GL2 C;  1DD3 A;  1QLE D;  4D1E A;  3H1L G;  3SWF A;  2EHB A;  3Q5R A;  2LXC B;  2XU6 A;  2MJW B;  3MZW B;  3TUY C;  2J59 M;  1Q81 Q;  3B7A A;  4H0L C;  2QPT A;  3HTK B;  3KPE A;  3BYA A;  3HD7 C;  2BCC G;  4N3Y B;  3N7H A;  1N7S C;  1FF1 A;  1VQ5 P;  2Z4E A;  1SCV A;  3TK1 A;  5AVZ B;  1OOG A;  3BQ3 A;  1VF5 D;  1YHQ P;  3GHG C;  3P7K A;  3CX5 E;  3VRR A;  2HPC B;  1BU3 A;  1M90 Q;  3LCP C;  3D70 A;  2Q91 A;  1CFC A;  2H61 A;  4BY4 A;  2OYI C;  2GTE A;  5EL2 A;  1CFF A;  4C0L A;  4D6T J;  1DT7 B;  2K60 A;  4I5L B;  1KN7 A;  2MLE C;  1QJT A;  3BCC E;  2PVB A;  1EXI A;  2E42 A;  2FYN B;  2OGU A;  2W83 C;  5ER4 X;  1JY2 P;  1AV1 A;  3OJA B;  1P28 A;  2K8M B;  3JC2 2;  3I55 P;  3AE4 C;  3EFG A;  4U3F D;  1RWY A;  1MWN A;  5AER A;  1EXR A;  1NU1 G;  3OB1 B;  2OTG C;  3BUW B;  1KWO B;  3AE3 C;  3E3R A;  1FDM A;  4AQJ A;  3H1H D;  1EH2 A;  3C9I A;  3PAT A;  1SQQ D;  2KB7 P;  3CGA A;  1S72 P;  1EG3 A;  1KCY A;  3SG4 A;  3BUO B;  1L2P A;  2WCK A;  4L75 A;  2YXQ B;  1ZFS A;  3NFQ A;  3BOW A;  4QJ5 B;  3TYY A;  2E75 C;  5TIS E;  1IIO A;  2V4H A;  2LNK A;  4KHX A;  2RKL A;  1CLL A;  3I5G B;  3A7O A;  3E1I A;  2ZT9 B;  4L73 A;  2F3Z A;  2PP6 A;  1KK8 B;  5KLV J;  1B8L A;  5HKW A;  3VRP A;  5B5E H;  3C1L A;  2FFD B;  1JF2 A;  2QIW A;  1VQ4 P;  3CR5 X;  1KFX S;  4A4B A;  1NYA A;  5AAN A;  4M2O A;  1CMG A;  1ZMZ A;  1X02 A;  5E79 E;  3EK4 A;  1NWQ A;  1AVS A;  5CBN A;  2OS8 B;  2ZFD A;  2OYI B;  2QM8 A;  5CSN A;  3CXH I;  1S36 A;  3HUS A;  2E6W A;  5FYX A;  1Y9B A;  4PT1 A;  3G9R A;  3S9O A;  1R5L A;  4P5O E;  2KFH A;  4I5K A;  2H43 A;  1RRO A;  4AYC A;  2JP3 A;  3GF7 A;  1BE3 J;  3I5I C;  1MHO A;  1JFJ A;  2O60 A;  3B5N A;  5AW8 B;  3AEC C;  5GTH E;  5KJ7 C;  1DH3 A;  1ZV8 A;  3DVK A;  4HB1 A;  1VQL P;  3GOF A;  2HPS A;  3FWB A;  2KQY A;  1IQ3 A;  3LW5 H;  1URQ D;  1MQ1 A;  3EG5 B;  2PFX A;  4U3F E;  3TSI A;  3WU2 H;  1KIL A;  1LT9 A;  3F5H A;  4WY4 B;  2O01 J;  2FFD A;  4IL1 A;  2G2B A;  2A4J A;  2TN4 A;  3H1K G;  3NHI A;  5HL1 A;  1AJ4 A;  1N0Y A;  2KI7 B;  3RL0 g;  4YGA A;  4GOE A;  4XJK B;  1OOH A;  1JOC A;  5K89 A;  2HQ8 A;  2LVI A;  1OW6 A;  1UUR A;  1IFJ A;  3WUV A;  3AAJ A;  1BE3 D;  5KKZ C;  1CI6 B;  3TDI A;  3A0H H;  1BCC E;  3JCU H;  3SG3 A;  1VPC A;  1CB1 A;  1PK0 D;  2V7Q J;  4IOI H;  1JEK A;  2POH A;  1BGY D;  1Y0V H;  1IG5 A;  5CCH D;  4GFT A;  3EQ2 A;  1PUL A;  1TOP A;  1NHL A;  1NTM E;  1QEX A;  1LTA C;  2Y9Z A;  1DX7 A;  4RES B;  1OVU A;  4XYN A;  2W27 A;  2KYF A;  1W2E A;  1EXJ A;  3AE2 C;  2BEC A;  3HTK A;  3FE9 A;  1PPJ G;  1ZP0 C;  1R2U A;  3TGU D;  2K2F A;  1DF0 A;  3DVE A;  1RTP 1;  3R1P A;  2NPS A;  1QVI Z;  4H44 B;  4H13 D;  5DKQ A;  2QEB A;  3CZ2 A;  1JC2 A;  3I5F B;  3SG5 A;  5G08 A;  2JNX A;  1W5C E;  1VF5 C;  2KS1 B;  1DIP A;  3L75 D;  4JBZ A;  5APQ A;  3AE9 C;  1CDN A;  2AEF A;  2C0X A;  3L4A A;  4F0Z B;  1SQQ K;  1LNQ A;  4QJ4 B;  2GA1 A;  3D74 A;  1OZH A;  3GK1 A;  1S5L H;  2Z5I A;  3NTN A;  2I2R E;  2M0R A;  1L0N G;  3L74 J;  3NSK A;  1Y6W A;  1J7O A;  1WT6 A;  2WQY C;  1YUT A;  1LTT C;  1A29 A;  2QG4 A;  2QA4 P;  1KK7 Y;  1HJB A;  5F6T A;  2A06 G;  1SFC B;  3PLF B;  3F89 A;  3BAT A;  3A0B E;  2HPC A;  3RM1 A;  3LK0 A;  4I7Z B;  3CCJ P;  1Y1X A;  2DOQ A;  1EZV D;  2V53 A;  3Q2Y A;  4YGD B;  2R3S A;  2JDI H;  3D6Y A;  1KOR A;  3NGV A;  4PV1 B;  4WY4 A;  1LIN A;  1WDC B;  1S9K E;  2EC6 B;  3O6B A;  3L73 D;  3NXS A;  1QVG O;  1GU5 A;  3GHG A;  4I5N B;  1M1K Q;  1BJF A;  1DVI A;  2K37 A;  2JJL A;  1PVB A;  2WC8 A;  3IVT A;  4WY4 D;  3OW2 O;  2KFG A;  1N7S A;  1GU4 A;  4UPG A;  1NX2 A;  3H6P A;  1RF0 C;  4W7Z A;  3QH9 A;  2JQ6 A;  4EIJ A;  1SQV G;  2ZVN B;  2KLE A;  2ZRT A;  1WRG A;  5HYD A;  2KHN A;  1UII A;  2KI4 B;  3I56 P;  1IO4 A;  2KOT A;  3H1H E;  3L75 J;  1IK9 A;  1SL9 A;  2B87 B;  2P1J A;  2YMY A;  4ZNC A;  2A45 H;  2JR8 A;  1WMK A;  1TWO A;  2IBZ D;  3CD6 P;  1IC2 A;  1CSB A;  2N9Y B;  3O4Y A;  3H1J G;  1FJK A;  2G3A A;  2Y9Y A;  5KLI C;  1ZXG A;  4MN0 A;  5HKZ A;  4I1L A;  1LTJ A;  1PL5 A;  2QM7 A;  5DJU B;  1OMR A;  4HH2 A;  2FCE A;  4C0J A;  4GDO A;  3CCE P;  1NAF A;  1CLM A;  5CHX A;  1E8A A;  3PSR A;  1OW4 A;  5H2F H;  4OWF A;  3CWB D;  3CCS P;  3RL0 B;  1VQO P;  1PSR A;  1QLK A;  3L71 E;  1KQV A;  3CC7 P;  1DEB A;  2Q6Q A;  2B9B A;  3EK8 A;  4Q04 A;  2PSR A;  4LC1 A;  3M0A A;  4CID A;  4C7N B;  4F7F A;  1QVI Y;  3PLN A;  1JMB A;  5APY A;  1HJ0 A;  1FW4 A;  4JYB A;  1RF1 A;  4DZO A;  1PGO A;  4YI8 A;  4DRW A;  1QLS A;  2FYU D;  3PN7 B;  2LVK A;  3FX0 A;  2KAV A;  2WSS H;  1HUC A;  3SS5 A;  2WZ7 A;  5FI2 A;  2M0B A;  3D77 A;  3H1I D;  2MJZ A;  3TZ1 A;  1NVO A;  3CPW O;  1P84 D;  2MRD A;  5B5E E;  1LKJ A;  3TNU B;  2E74 B;  3H1J J;  3PM8 A;  1S26 D;  4C46 A;  1NTZ D;  1CDP A;  1A75 B;  2GV5 A;  4MSP A;  1YTZ I;  1AQT A;  3RK2 C;  2B88 A;  1NX0 A;  1LWU C;  1X0T A;  1HQV A;  2SPZ A;  3CI9 A;  4YBH B;  2M1U A;  3D75 A;  1VQ8 P;  1L4A B;  2OTK E;  2K88 A;  1JY3 P;  1H8A A;  1AFO A;  1DGU A;  4IL6 E;  4JF7 A;  4PD4 I;  5AVT B;  1BSH A;  2GUV A;  3L70 D;  3TS5 C;  2KQ6 A;  4GNK B;  3D76 A;  3NSL A;  3CDN A;  2JT0 A;  4RKU J;  4OGQ B;  1JY2 O;  3T97 B;  1XFW O;  2R2I A;  1L0N K;  2G9B A;  2BKI B;  5AW7 B;  2BE4 A;  3G6E P;  1SBJ A;  1NTK K;  1FE6 A;  2M5A B;  1RF0 A;  3JVT C;  1IFI A;  4MZL A;  4ASW A;  4MLW A;  2BCC E;  5CSJ A;  1USE A;  1KFX L;  2PAJ A;  2GGM A;  2W90 A;  1NTM G;  3MIW A;  1U57 A;  3WMM 0;  3RBX A;  1BGY E;  2QJP B;  2LVJ A;  2Q5U A;  4CPG A;  1RE3 A;  4WVZ A;  2E43 A;  1C07 A;  1X8Y A;  5I2O A;  1IFP A;  1L7Z A;  1NJI Q;  1F55 A;  1M8O B;  4R4L A;  2ZAE B;  1MF8 B;  1M7L A;  3BUX B;  3A2A A;  3L35 A;  2O5G A;  1KQF B;  2KS1 A;  1L0L G;  2N1T A;  2LMV A;  2E76 C;  1VQ9 P;  3IQQ A;  2WCF A;  1CNP A;  4DUQ A;  1NH4 A;  1ORG A;  3R4Y A;  3QME A;  3KYQ A;  3WUU A;  2JWA A;  1LVC D;  4M2Q A;  1SQP J;  2L2E A;  2BEQ D;  1YUR A;  2FXO A;  2AXC A;  1DJZ A;  3OGN A;  1JY3 O;  5TNC A;  2M8U A;  2M49 B;  2QDI A;  3OX6 A;  1ZOY C;  1FZA A;  2JXC A;  3H1L E;  1JSA A;  1URQ B;  1N65 A;  2WT7 A;  3P8C E;  1N2D C;  2QVA A;  3L73 E;  2LHL A;  1Q7Y Q;  1NTZ J;  5IBW A;  1V1F A;  1YRU B;  3BCC G;  1L4A D;  2EGD A;  1W2B O;  3KHE A;  1YR5 A;  5DKR A;  1PIX A;  3L72 G;  5KTB A;  2O1J A;  2A45 G;  3VP9 A;  4NPD A;  1S3J A;  4KYN A;  1SQV E;  1BDC A;  2HOD A;  2L51 A;  5DIC A;  2D2C C;  3CLN A;  1MXL C;  3CS1 A;  3CCQ P;  4GGN A;  2ZXX A;  4ZCU A;  3AE7 C;  4M2P A;  4EYY Q;  1KIL B;  1KQM C;  2FXP A;  2G8Y A;  1GJY A;  2ZT9 D;  2ISD A;  3L70 E;  1OX3 A;  5AFP A;  4HRH A;  3M9H A;  3V4Q A;  4CPV A;  3L73 G;  1MFZ A;  5AW4 B;  3G71 P;  1S2E A;  3BXK A;  2YKQ A;  1NKZ B;  2L50 A;  4PE0 A;  2HR3 A;  2HQW A;  2FYU K;  2M8R A;  2WSE J;  3HD7 B;  1DJY A;  1N7S B;  1HF9 A;  1PZQ A;  2SCP A;  1UUS A;  1YJN P;  5KSZ A;  1CFP A;  3CCL P;  3HUS B;  2HG5 D;  2K7C A;  1G2C B;  1Y8A A;  4GAO A;  1TU3 F;  1Q90 D;  5GTI H;  2K7D A;  1NU1 J;  1SQV K;  2KLD A;  3EVU A;  4HKZ H;  1KYO I;  1HBW A;  2VRG A;  3VP8 A;  2M29 A;  3CAB A;  2JWW A;  2XND H;  2I18 A;  5AVX B;  1OSA A;  1VDF A;  3R2P A;  4MBE A;  1F8H A;  1VQM P;  1QX2 A;  1M56 D;  1F54 A;  1OZS A;  4D6T G;  3H1H G;  1A75 A;  3SWY A;  1BCC D;  4H13 B;  1FDI A;  2PGD A;  3VB1 A;  3NSI A;  1S5G Z;  4GOF A;  1SQP K;  1KZU B;  3RK2 D;  1BMO A;  4A4C A;  3L4F A;  2C9L Y;  2L2C A;  2Y1N A;  4BY5 A;  3CWB G;  2IBZ I;  1XK4 A;  1YI2 P;  2ZND A;  1HTL C;  4U8D A;  4HYT B;  2FY8 A;  1AVY A;  1J1D A;  1JUN A;  1WRL A;  5KAI H;  2P70 A;  2FYU E;  2Q1K A;  1DC1 A;  2FJU B;  4RJT A;  3FWC A;  2ZN9 A;  2QAC A;  2Y5I A;  1GM0 A;  1L0L D;  3KXD A;  5APT A;  3AEG C;  2LAN A;  4DS7 A;  2WPS A;  3WHT B;  1M39 A;  1NTK G;  2KNE A;  1KK8 C;  2CPB A;  1W9Z A;  2AXT E;  2HF5 A;  3D78 A;  3HD7 D;  3L74 D;  2N1T D;  1UHK A;  1PRW A;  2QEO A;  2FBW C;  2WSF H;  3B88 A;  2LMU A;  2WWW A;  2JPO A;  3DZT A;  4U3F G;  1QX7 A;  2ZNE A;  1P84 I;  2WMM A;  1BF5 A;  2WSE H;  1EL4 A;  1PGQ A;  1H89 A;  1PP9 D;  2SAS A;  1KQL A;  5BPJ A;  1Y47 A;  1D1O A;  1FZB A;  2IS9 A;  4OGQ D;  1GGZ A;  2OYO A;  5K5G B;  3CYZ A;  5CCG A;  4DT0 A;  1KB9 E;  3DD4 A;  3CWG A;  3L72 D;  2WVR A;  1EDJ A;  3CZ0 A;  3ZNI A;  2K2A A;  1LS8 A;  1KC8 Q;  1XFV O;  1H0T A;  4CFQ A;  2WPQ A;  4MRY A;  1R5S A;  3CR4 X;  4WQ3 A;  1Q2N A;  2KSE A;  2OYI A;  3DXL A;  2IZ0 A;  2KP8 A;  2HFE D;  4YXD C;  3RBZ A;  3MP7 B;  1DJW A;  1BGY J;  1LXF C;  1KYO D;  1SQX K;  2BCC J;  4YPC A;  1FZC B;  1RE3 C;  1BGY G;  1KFU S;  1SCM B;  1C3Y A;  2LLT A;  2AAO A;  2WCL A;  1WY9 A;  1JF0 A;  3HD7 A;  1NU1 K;  2P58 A;  3B5N B;  2KDH A;  2LR2 A;  1OMV A;  4PD4 D;  1NOH A;  1QS7 A;  3ZWH A;  1FU1 A;  2KGR A;  2OS8 C;  4CLN A;  1CI6 A;  3L72 E;  3GW6 A;  1N8R Q;  3PJS K;  1OW8 A;  1Z4H A;  1DEE G;  3TGU E;  1W7I B;  1S5G Y;  3O6Q A;  2A45 I;  3H1I J;  2NCO A;  2RGI A;  2J58 A;  1UHN A;  5E79 H;  2P67 A;  2JRF A;  5CSI A;  1G8I A;  2LLS A;  1Q82 Q;  1YVH A;  3KPX A;  3HE5 A;  1VQ7 P;  4PHK A;  1SQX J;  3MGN A;  1QAT A;  3CZT X;  5HLO A;  1T8Z A;  3VMY A;  5KLV E;  3JTD B;  2KUB A;  5PAL A;  4H44 C;  2KLU A;  2BCC D;  1JCD A;  1L0N D;  3O6Q B;  1BCC G;  1SQP D;  3MTU E;  4GT1 A;  1PPJ E;  3L47 A;  3EFF K;  4MN4 C;  1C3Z A;  2BCB A;  1Z56 A;  2K1A A;  2ZN8 A;  5EFW B;  5KTY A;  1OZO A;  4FQT A;  1DEK A;  4AQI A;  3BAS A;  3JSV C;  1D7M A;  1L0L E;  5I2Q A;  1URQ A;  3H1I E;  1SS1 A;  5AW2 B;  2WC5 A;  1XTG B;  1K9M Q;  2KZJ A;  5AW3 B;  3RK3 D;  3AEF C;  2KSJ A;  1QL1 A;  3LID A;  3R1V A;  3O2P A;  1XFU O;  4UB8 H;  1TUZ A;  1IZN B;  1SK6 D;  3HRN A;  1YIT P;  1XO5 A;  1L0L K;  5GTH H;  2QE7 H;  2YO2 A;  1B7T Z;  2PMY A;  3VMA A;  2NLN A;  1K96 A;  1PPJ D;  1CZQ A;  3H1J E;  4Y28 J;  3SWK A;  3H4S E;  1L0N E;  5AW1 B;  3TF5 A;  3Q8I A;  1GK6 A;  3H1H J;  4OCI A;  2M3E A;  2YMK A;  4PE1 A;  2M97 A;  1PGP A;  1GTW A;  4JPZ B;  1YJ9 P;  2KSP A;  5CCH C;  2WPV B;  4DOJ A;  1K8U A;  2WOS A;  2I8D A;  1KQG B;  2LP2 A;  4GKG A;  2M1K B;  4R4M A;  1KWO C;  4WWI A;  3IQO A;  3ZDM A;  3CC4 P;  1CDL A;  2BKH B;  1RF1 C;  2WC6 A;  4CFR A;  1LTI C;  3C8V A;  1GMJ A;  2QEV A;  4HRG A;  1N73 B;  2YGU A;  1GW3 A;  4PDZ A;  1HWT C;  2E75 B;  1ALV A;  3SG6 A;  2P6B B;  4OH8 B;  1VRK A;  2AEM A;  1KV4 A;  3NSO A;  2CK3 H;  1UP5 A;  3B87 A;  4M3L A;  2NPS B;  4I2L C;  1Y1U A;  1S5L E;  4C7N A;  1XTC C;  3P8C D;  1J2J B;  3SG7 A;  2FFD C;  3SS3 A;  1KYO E;  1KIL E;  4OR9 B;  4YTP C;  1N7S D;  1BR4 B;  3CCR P;  1SQX G;  1CW5 A;  2LAP A;  1IRJ A;  4EDF A;  4Y99 B;  1BLQ A;  2JPT A;  3VRN A;  2W6B A;  5BU5 A;  3HX4 A;  2N9B A;  1M63 B; 
#chains in the Genus database with same CATH homology
 5CSF A;  2JC2 A;  1K90 D;  1K94 A;  5HLV A;  2LVJ A;  1Q80 A;  4DCK A;  1SKT A;  2NZ0 A;  4FTG A;  4OKH A;  3I5I B;  3NXA A;  2BBN A;  5J3X A;  1C07 A;  1H8B A;  5I2O A;  1JFK A;  1L7Z A;  1F55 A;  1GGW A;  2PRU A;  2KYC A;  1S6I A;  1MR8 A;  1TCO B;  3JTD C;  2MAZ A;  1YTZ C;  1U5I A;  1G33 A;  1MF8 B;  1QV1 A;  3BUX B;  1CDM A;  4MRX A;  1RK9 A;  2O5G A;  3FS7 A;  1JBA A;  1K2H A;  2KGB C;  2CNP A;  2LMV A;  2BL0 B;  3O78 A;  3A4U B;  3M0W A;  1GQM A;  1K9U A;  3IQQ A;  1NWD A;  1NX3 A;  2AUC A;  2CXJ A;  2WCF A;  3OX5 A;  4D1E A;  2JNF A;  1CNP A;  4DUQ A;  2LUC A;  2EHB A;  2LM5 A;  1U5I B;  4N1F A;  4NDB A;  2MJW B;  3TUY C;  2L0P A;  1LVC D;  2QPT A;  4M2Q A;  2F3Y A;  3MSE B;  2L2E A;  3IF7 A;  3I5G C;  1YUR A;  2B1U A;  3BYA A;  1TNX A;  1L2O B;  1FF1 A;  1DJZ A;  1WLM A;  1RJV A;  5TNC A;  1WRK A;  2M8U A;  2M49 B;  2HET A;  3I5H C;  1SCV A;  3OX6 A;  1DGV A;  1SRA A;  2JXC A;  1R6P A;  1JSA A;  4N1G A;  3BQ3 A;  1LA3 A;  1N65 A;  1FI6 A;  2M9G A;  3VRR A;  1BU3 A;  2I94 A;  3LCP C;  2H2K A;  3TS5 B;  2LHL A;  2Q91 A;  1CFC A;  2H61 A;  2WND A;  4BY4 A;  5IBW A;  1V1F A;  1YRU B;  2EGD A;  4C0L A;  1CFF A;  2Y4Q A;  1DT7 B;  3KHE A;  1YR5 A;  5DKR A;  4I5L B;  3OB2 B;  1QV0 A;  1QJT A;  2MLE C;  2PVB A;  4ICB A;  4MVF A;  1TTX A;  2K7B A;  4OVN F;  5ER4 X;  3DVJ A;  2KBI A;  2JT3 A;  4P2Y B;  2K8M B;  2JU0 A;  2L51 A;  1AJ5 A;  4NDD A;  1XK4 C;  1IKU A;  4R1E A;  3VGO A;  1QAS A;  3CLN A;  2LLU A;  5AEQ A;  2BBM A;  1MXL C;  3CS1 A;  3QRX A;  4GGN A;  1RWY A;  3GK4 X;  1MWN A;  4ZCU A;  5AER A;  2BCA A;  1EXR A;  4M2P A;  3OB1 B;  1K9P A;  2OTG C;  3PN7 C;  1AK8 A;  1JUO A;  1KQM C;  1NCY A;  1KWO B;  3BUW B;  3RLZ A;  3E3R A;  4AQJ A;  1EH2 A;  1DJX A;  3PAT A;  1GJY A;  2ISD A;  1F71 A;  5JOL A;  3CGA A;  2CCM A;  1EG3 A;  5AFP A;  3EKH A;  4HRH A;  1KCY A;  3SG4 A;  3BUO B;  4CPV A;  5CPV A;  1IWQ A;  1ZFS A;  1S6J A;  1SW8 A;  3BOW A;  4C0K A;  2KI6 C;  4MZJ A;  4QJ5 B;  2MHH A;  1QX5 B;  3BXK A;  1S3P A;  2L4I A;  2L50 A;  2LNK A;  1A03 A;  1SL7 A;  5I2L A;  4PE0 A;  1REC A;  1CLL A;  2M3W A;  2HQW A;  3I5G B;  3VRQ A;  1DJY A;  1L2O C;  2F3Z A;  1KK8 B;  2CTN A;  2SCP A;  1B8L A;  1UUS A;  3OHM B;  5HKW A;  4ETO A;  5KSZ A;  1XFY O;  1OMD A;  1CFP A;  2K7C A;  3VRP A;  1XVJ A;  2M7L A;  1UHJ A;  1JF2 A;  4GAO A;  3K21 A;  3CR5 X;  1KFX S;  2K7D A;  3AAK A;  4JWQ A;  4A4B A;  1IH0 A;  1TIZ A;  1NYA A;  5AAN A;  1B9A A;  3GK2 A;  3EVU A;  4M2O A;  1CMG A;  1ZMZ A;  1X02 A;  1NIW A;  1CMF A;  2VRG A;  3EK4 A;  1DJH A;  1AVS A;  2M29 A;  1NSH A;  2JWW A;  2OS8 B;  1KFU L;  2ZFD A;  3C1V A;  2I18 A;  3CTN A;  1F4O A;  5CSN A;  1F70 A;  3JVT B;  1OSA A;  1DJI A;  1S36 A;  4MBE A;  2E6W A;  5FYX A;  1J1E A;  4MEW A;  1WLZ A;  4P5O E;  1F8H A;  2KFH A;  4I5K A;  1QX2 A;  1F54 A;  1OZS A;  1RRO A;  3BOW B;  1NP8 A;  1A75 A;  1NCZ A;  1QIV A;  3I5I C;  1AHR A;  1MHO A;  1JFJ A;  2O60 A;  3NSI A;  1LA0 A;  2JXL A;  1EJ3 A;  3EKJ A;  1S5G Z;  3SJS A;  1BMO A;  2LMT A;  4A4C A;  1KSO A;  1TNQ A;  2Y1N A;  4BY5 A;  3DVK A;  3I5F C;  1PVA A;  2BE6 A;  3GOF A;  1XK4 A;  2HPS A;  3FWB A;  2KQY A;  1IQ3 A;  2ZND A;  1YUU A;  4U8D A;  1MQ1 A;  1UHH A;  3WHU B;  1J1D A;  3LLE A;  1WRL A;  1SPY A;  4NQG A;  2FJU B;  4YGC B;  4IL1 A;  5KU1 A;  3FWC A;  1FPW A;  2G2B A;  2ZN9 A;  2A4J A;  2TN4 A;  1PAL A;  1K95 A;  1AJ4 A;  1SNL A;  2JTT A;  2QAC A;  2Y5I A;  1M45 A;  1BG1 A;  1N0Y A;  2LAN A;  4YRU A;  4DS7 A;  1K9K A;  4NDC A;  2MBX A;  4YGA A;  1G4Y R;  2I7A A;  1CTR A;  4XJK B;  3WHT B;  1J7P A;  1M39 A;  2KNE A;  2HQ8 A;  1KK8 C;  1B47 A;  2LVI A;  2ZRS A;  1UUR A;  5K89 A;  1TN4 A;  4MZK A;  1SY9 A;  4USL A;  3AAJ A;  2LUX A;  2JTZ A;  1QXP A;  3TDI A;  1IQ5 A;  4GPL B;  2HF5 A;  3SG3 A;  2WOR A;  1PK0 D;  1CB1 A;  3SIB A;  1UHK A;  1PRW A;  1Y0V H;  1IG5 A;  2LMU A;  1BOC A;  1OOJ A;  4GFT A;  1PUL A;  2E30 A;  2BCX A;  1TOP A;  2LP3 A;  1H4B A;  4GGF A;  4YGB B;  2Y9Z A;  2PAL A;  1AUI B;  1QX7 A;  4GGF C;  1YUS A;  2ZNE A;  1BF5 A;  3HCM A;  1XFZ O;  4XYN A;  2AMI A;  1EL4 A;  1NPQ A;  2CT9 A;  3D0Y B;  2KYF A;  2SAS A;  3TDU A;  2L5X B;  2BEC A;  5BPJ A;  1D1O A;  1CLB A;  1N2D A;  2IS9 A;  3A8R A;  1QTX A;  1R2U A;  2FCD A;  2K2F A;  1GGZ A;  1DF0 A;  1C7V A;  2OTG B;  1EG4 A;  3DVE A;  2GGZ A;  4TNC A;  1RTP 1;  5D69 A;  3DD4 A;  3CWG A;  1QVI Z;  1BR1 B;  4ORA B;  3LL8 B;  5DKQ A;  3ZNI A;  1JC2 A;  1ZOT B;  2K2A A;  3I5F B;  2L4H A;  1XFV O;  3SG5 A;  1SR6 C;  1ZAC A;  5G08 A;  4DIR A;  2JNX A;  4CFQ A;  2KI6 D;  4MRY A;  1FBV A;  3ICB A;  1B4C A;  2KI4 C;  3CR4 X;  4WQ3 A;  1QIW A;  1XFX O;  1CDN A;  1MXE A;  4F0Z B;  4QJ4 B;  1C7W A;  1DJW A;  1SYM A;  3GK1 A;  4HRE E;  1LXF C;  2L98 A;  2I2R E;  2LCP A;  2M0R A;  3NSK A;  1Y6W A;  1J7O A;  1UWO A;  3AKA A;  4PE4 A;  1YUT A;  3OP0 A;  1A29 A;  1KFU S;  4WQ2 A;  1SCM B;  2LLT A;  1KK7 Y;  2AAO A;  3BUM B;  1FI5 A;  2M7N A;  5F6T A;  4AOM A;  2KAY A;  1WY9 A;  1ODB A;  1YX8 A;  1JF0 A;  3PLF B;  5JJG A;  5GQQ C;  2KDH A;  1PSB A;  2K61 A;  3RM1 A;  3LK0 A;  3DF0 A;  1OMV A;  4GBA A;  2KBM A;  1Y1X A;  1DF0 B;  1KK7 Z;  1QS7 A;  3ZWH A;  2KGR A;  1XYD A;  2DOQ A;  1J55 A;  1S1E A;  2OS8 C;  2V53 A;  1ALW A;  3F45 A;  4JQ0 D;  4CLN A;  1YVL A;  4YGD B;  4FQO A;  1ZUZ A;  3DF0 B;  2JT8 A;  1W7I B;  4GUK A;  1LIN A;  1WDC B;  1S5G Y;  2EC6 B;  1K93 D;  2JOJ A;  3O6B A;  2NCO A;  1DJG A;  2RGI A;  1IGV A;  2K0J A;  1UHN A;  2JRF A;  5CSI A;  2Y1M A;  1G8I A;  2LLS A;  1YVH A;  3KPX A;  1SL8 A;  4I5N B;  1BJF A;  3BUN B;  1DVI A;  3D0Y A;  4WRI A;  1TNW A;  4ORB B;  1PVB A;  2WC8 A;  4PHK A;  1B7T Y;  3DVM A;  1QAT A;  3CZT X;  2PAS A;  5HLO A;  2KFG A;  3JTD B;  5PAL A;  4UPG A;  1J7Q A;  1NX2 A;  1TCF A;  3WNX B;  5D7F A;  1IJ6 A;  2JQ6 A;  4OV2 A;  1B8R A;  4PAL A;  2D8N A;  1UHI A;  1XA5 A;  2BCB A;  2ZRT A;  4ORC B;  2ZN8 A;  2JUL A;  4PHN A;  2KHN A;  3KO0 A;  5HYD A;  2KI4 B;  1TNP A;  3CR2 A;  3PFV A;  5KTY A;  1CKK A;  1OZO A;  2F8P A;  2KOT A;  3TUY B;  4AQI A;  3KEV A;  1SL9 A;  5I2Q A;  1NCX A;  1NX1 A;  2K7O A;  2H61 C;  1JWD A;  2COL B;  3EVR A;  1KSM A;  4I5J A;  3EVV A;  1B8C A;  3O4Y A;  2Y9Y A;  3I5H B;  4MN0 A;  5HKZ A;  3O2P A;  5I8N A;  1OFC X;  1XFU O;  1OMR A;  1OQP A;  2LV7 A;  2FCE A;  4C0J A;  1DMO A;  4YI9 A;  1CLM A;  1RFJ A;  1M31 A;  1E8A A;  3PSR A;  3SIA A;  1AP4 A;  1SK6 D;  2F2P A;  1W7J B;  1IJ5 A;  1XO5 A;  4PHJ A;  2LVV A;  2MLF C;  1CFD A;  1PSR A;  1QLK A;  2F2O A;  2KAX A;  1KQV A;  1B7T Z;  2PMY A;  4PHM A;  2NLN A;  3VRO A;  1K96 A;  3EK8 A;  4Q04 A;  2PSR A;  3H4S E;  4CID A;  4YGE B;  1DTL A;  5DKN A;  4OCI A;  1QVI Y;  4PE1 A;  1OE9 B;  1TRF A;  2M97 A;  1FW4 A;  4HSZ A;  4JPZ B;  2NXQ A;  2KSP A;  1HT9 A;  3AKB A;  4YI8 A;  4DRW A;  1QLS A;  1K8U A;  2WOS A;  3PN7 B;  1SR6 B;  2LP2 A;  2LVK A;  2BL0 C;  2KAV A;  3FIA A;  2M1K B;  1KQM B;  1Y1A A;  1KWO C;  2FOT A;  3IQO A;  1CM4 A;  1CDL A;  2BKH B;  1YX7 A;  3TZ1 A;  1B1G A;  4CFR A;  1F4Q A;  2MRD A;  1LKJ A;  1WRZ A;  3PM8 A;  3D10 A;  4HRG A;  5B8I B;  1S26 D;  2JZI A;  1J7R A;  4PDZ A;  4E68 A;  1CDP A;  4L9M A;  1A75 B;  2GV5 A;  4MSP A;  1ALV A;  3SG6 A;  2P6B B;  4PE7 A;  3KF9 A;  2WCB A;  1NX0 A;  1VRK A;  1A4P A;  5HKY A;  1HQV A;  1SCM C;  2CBL A;  1M46 A;  2OPO A;  3NSO A;  4YBH B;  2F33 A;  2ZKM X;  2M1U A;  4XJK A;  1UP5 A;  1Y1U A;  1A2X A;  1S6C A;  2WCE A;  2NCP A;  2LE9 B;  1DGU A;  1BOD A;  1YRT B;  3SG7 A;  3LK1 A;  2MA2 A;  3SG2 A;  4PCW A;  2LHI A;  3TS5 C;  2KQ6 A;  4GNK B;  3PAL A;  2LC5 A;  4OR9 B;  1CM1 A;  3NSL A;  1SMG A;  1MUX A;  1NUB A;  1BR4 B;  2JT0 A;  2KFF A;  4QJ3 B;  1XFW O;  2R2I A;  2G9B A;  2BKI B;  1BT6 A;  2BE4 A;  5ER5 A;  1SBJ A;  2LAP A;  1IRJ A;  3EK7 A;  4ZCV A;  1WDC C;  2EC6 C;  3JVT C;  5AXI A;  2JPT A;  3WXA A;  2Q4U A;  4MZL A;  4N5X A;  4MLW A;  3TDZ A;  3VRN A;  1BLQ A;  5CSJ A;  1V1G A;  1KFX L;  3HX4 A;  2GGM A;  1M63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...