4JPZB

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
EPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor 13
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 43
structure length 142
sequence length 142
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jpzB01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jpzB02
2JC2A 4QJ5B 1F54A 1A03A 2I2RE 4NDDA 3BUXB 1PRWA 1YVHA 4DS7A 2LLSA 2MHHA 4PHKA 1G33A 1NCYA 4YGEB 2KYCA 1J7QA 1TNWA 2ZKMX 1VRKA 3I5HB 2ZNEA 1K90D 3PN7B 3PFVA 1C07A 3A8RA 4HSZA 3NSOA 1NCXA 2OTGB 2BCAA 3EK4A 1DJWA 2Q91A 3M0WA 3O78A 1NIWA 3O4YA 4DUQA 1NX0A 5HLVA 1OFCX 3IF7A 3CTNA 1S5GY 1SCMB 1DTLA 2I18A 3GK4X 5J3XA 1AP4A 1MWNA 2M7NA 1J1DA 2COLB 1EH2A 1B7TZ 1MF8B 1ODBA 3PLFB 1CLLA 1MXEA 1PULA 1QXPA 1S36A 1TNXA 2Y5IA 1IWQA 1CDPA 2ZFDA 2KAXA 3BOWA 3DVEA 1IGVA 4OVNF 4JPZB 1OMVA 3AAKA 1XA5A 2NCPA 1DJZA 1NSHA 1CB1A 1GGZA 1Y1XA 3VROA 4PE4A 2ZN9A 2L4HA 2CT9A 5CSIA 5I2OA 1DJHA 5JOLA 3SG6A 2KGBC 4XJKA 5DKNA 5I2LA 4MLWA 2L98A 3OB1B 2KGRA 1FF1A 2WORA 4ICBA 3I5FC 1KQMB 1M31A 1DJYA 5AERA 1TIZA 2F2PA 1SPYA 1TNQA 2BE6A 1KK8C 2KI4C 1RWYA 2M0RA 3D10A 5KSZA 1PALA 1YX7A 4NDBA 1QLKA 1BT6A 2KAVA 4M2OA 1B1GA 1QX7A 2BL0C 3KF9A 1QJTA 5G08A 1KK7Y 2A4JA 1WRZA 2LM5A 4I5LB 1R6PA 3DVMA 1CM1A 1ALWA 2AUCA 1SW8A 1MUXA 1XK4A 3AKBA 5AEQA 4OV2A 1NP8A 1SL9A 1KSMA 1CKKA 1M46A 2KFHA 5AXIA 1Y1AA 1XFWO 2BECA 3KHEA 4GBAA 1XFYO 1S5GZ 4MZLA 1B4CA 4TNCA 1RJVA 2LLTA 1U5IB 3JTDC 4ZCVA 2B1UA 3O6BA 1C7VA 1OQPA 1SK6D 3H4SE 1SKTA 2KSPA 2M97A 1BLQA 2LUXA 1NPQA 1J1EA 3OP0A 4E68A 4AQJA 5K89A 2P6BB 3FWBA 5B8IB 2EGDA 4PE1A 5HKWA 5KTYA 4QJ3B 1CDMA 4BY4A 2JQ6A 2OPOA 1RFJA 3ICBA 4M2QA 1LA0A 4DRWA 2E6WA 1MR8A 2Y1MA 1YURA 4XYNA 1L7ZA 1YR5A 1G4YR 2L4IA 2MA2A 5JJGA 3SG5A 2PALA 1SR6B 1TCFA 2BKIB 4GUKA 4MSPA 4N1GA 1RROA 5HYDA 1BR4B 1NX3A 3JVTC 5I2QA 1M45A 2JNFA 1JC2A 1WY9A 1YUSA 4Q04A 2CNPA 1KCYA 1IJ5A 2MJWB 1XFZO 4GAOA 4GGNA 3TUYC 1IG5A 1IQ3A 1KK7Z 1S6JA 1XO5A 4WRIA 4C0KA 1JFKA 4YGDB 3FIAA 3LK0A 5CSFA 4YGBB 1AK8A 2WCEA 1TCOB 3A4UB 1H8BA 1WDCB 2WOSA 2KI6C 4F0ZB 1XYDA 1ZACA 2KQ6A 2GGMA 3SIAA 1AJ4A 2JULA 1KWOC 3NSKA 3OB2B 1BOCA 2Y9YA 4BY5A 2M1KB 1B47A 2SASA 2FCEA 1A4PA 1U5IA 1IQ5A 2BBMA 2FOTA 1YUTA 2H61C 2JPTA 2LP3A 2PRUA 3GK2A 3HCMA 2JTZA 1QS7A 3KO0A 1L2OB 2JRFA 2OS8C 1W7JB 5CSNA 3SJSA 1UHKA 2LMVA 4IL1A 1EG4A 1IRJA 1N65A 3I5GC 1JUOA 3EVVA 1KK8B 1A75B 1F71A 3TS5B 4PALA 2BL0B 4ORBB 2JT0A 4OKHA 3F45A 1W7IB 2TN4A 2KYFA 2LNKA 3NSLA 1F4QA 2GV5A 1EL4A 3PSRA 2IS9A 1DVIA 4FTGA 4JQ0D 5D69A 4C0JA 4ETOA 1KQVA 3BUWB 1OZSA 1K8UA 4GGFA 1C7WA 4OCIA 1ZMZA 2F3ZA 4PDZA 3WXAA 1YTZC 1K2HA 2BBNA 2BCXA 2K7BA 4DIRA 1BG1A 2JXLA 2HETA 4C0LA 1SL8A 3AAJA 2KBMA 1DGVA 3MSEB 4YBHB 1UHHA 1B9AA 2JZIA 2KFGA 1DJXA 1JWDA 2LCPA 1XFVO 1CLBA 1CFPA 4ORAB 2VRGA 1FBVA 1ZOTB 2LMTA 1JSAA 4N1FA 2EC6C 4NDCA 2CBLA 1MXLC 1QATA 2OTGC 1QVIY 5BPJA 3TDUA 1KFUS 1DF0B 1EG3A 2MLEC 5HLOA 1A2XA 2MRDA 3CR4X 4YGAA 4CLNA 4M2PA 1WLMA 1K96A 4PE7A 3E3RA 4CIDA 3OHMB 1HQVA 1WRKA 3JVTB 1SCMC 1IKUA 2I94A 1OMRA 1QIVA 1PVAA 1GGWA 1Y6WA 1SL7A 2PASA 1DT7B 1CMFA 1BR1B 1YVLA 1LKJA 2LLUA 2FJUB 1QTXA 3CGAA 3KEVA 1PVBA 2LANA 1MQ1A 1A75A 2PSRA 2LAPA 2Y4QA 2K7OA 4D1EA 3NSIA 1M63B 1TRFA 3LLEA 2KI6D 4GFTA 2G2BA 5CSJA 1SMGA 1KSOA 5CPVA 2HPSA 3BUOB 2O60A 2JU0A 1QIWA 2Y9ZA 1AJ5A 1MHOA 1DJIA 1LA3A 3C1VA 4HRHA 5FYXA 3SG7A 4CPVA 2SCPA 1KFXS 4HRGA 2KNEA 2Y1NA 1M39A 5ER4X 2K0JA 1AUIB 1DJGA 1KWOB 5TNCA 4YRUA 2ZRTA 2LP2A 1JFJA 1H4BA 1OE9B 1LINA 3LK1A 1K94A 1AHRA 1CNPA 1KQMC 1DGUA 3GK1A 4PHNA 2M1UA 3DF0B 1LXFC 2L2EA 1PSBA 4JWQA 3KPXA 5D7FA 2OS8B 2BKHB 2WCFA 2M3WA 4WQ3A 2I7AA 2JNXA 1K9UA 3EKHA 4L9MA 2BCBA 2LHIA 1UHNA 5I8NA 1QVIZ 1HT9A 2LMUA 3TDIA 4FQOA 3WNXB 1GQMA 4CFQA 3WHUB 1UWOA 3TZ1A 2K7DA 5GQQC 1SRAA 1XFUO 3O2PA 3VRNA 1NWDA 3I5IC 1FI6A 3FWCA 1BMOA 4I5KA 2M8UA 3CS1A 3DVKA 4PHJA 3DD4A 1XFXO 3BQ3A 4YI8A 2MBXA 4AOMA 1DF0A 3NXAA 1AVSA 4AQIA 5F6TA 1QLSA 2L5XB 1TN4A 2DOQA 3OX5A 2NLNA 4USLA 3RM1A 1R2UA 4P2YB 3VRQA 1CMGA 3D0YB 1OMDA 1QV0A 1YRTB 2KDHA 5DKQA 3CZTX 2F33A 2HQ8A 1BODA 1FW4A 2L50A 3I5FB 2JOJA 4MVFA 1CLMA 1X02A 4PHMA 5ER5A 2K7CA 3BYAA 2KI4B 2M7LA 2JT8A 2HQWA 2WC8A 3BUMB 1D1OA 2AMIA 4U8DA 3SG2A 1ZFSA 4QJ4B 1JBAA 2GGZA 3EKJA 4I5NB 1B8LA 3IQQA 4ZCUA 1F70A 2LHLA 1SR6C 2EC6B 4GGFC 2K8MB 1NCZA 1UP5A 1OZOA 1ALVA 4GPLB 4PE0A 1YUUA 1TNPA 1EXRA 3AKAA 4CFRA 3CR5X 1IH0A 1OSAA 1RK9A 1SCVA 2QACA 3EVRA 5AFPA 1TTXA 2K2AA 4GNKB 1CFDA 2LVIA 1NX1A 1WRLA 2CCMA 1SYMA 1TOPA 3K21A 1PSRA 2H61A 3LL8B 3JTDB 3DF0A 1BF5A 4A4CA 1OOJA 1A29A 2F2OA 2LVJA 1EJ3A 2LVVA 2LVKA 4R1EA 3TDZA 1JF0A 4UPGA 1B8CA 5KU1A 1K93D 2F8PA 2ZN8A 1SNLA 2QPTA 1CTRA 1UUSA 2M29A 5AANA 1F4OA 1WDCC 5IBWA 1QV1A 4ORCB 1XK4C 1BJFA 3DVJA 5DKRA 1IJ6A 4MEWA 2JTTA 1J7OA 3WHTB 2PMYA 2WNDA 3I5HC 3SIBA 3PN7C 1CFCA 1RTP1 1NX2A 2H2KA 2R2IA 3PATA 1B8RA 3BXKA 1L2OC 4YI9A 2M49B 1N2DA 3EK7A 2BE4A 1QX2A 1S6IA 1Q80A 1ZUZA 1LVCD 1S1EA 2F3YA 2JT3A 2ZRSA 1PK0D 2CXJA 3CR2A 4I5JA 2RGIA 4MBEA 3D0YA 1SY9A 1GJYA 2D8NA 4PCWA 1CM4A 3PM8A 3TS5C 2CTNA 5HKZA 2KAYA 2KFFA 1WLZA 3TUYB 1S3PA 1V1FA 2NXQA 3RLZA 1YRUB 1N0YA 3FS7A 4DCKA 4OR9B 2G9BA 3I5IB 2MLFC 2KBIA 2K2FA 2KOTA 1E8AA 1K95A 3LCPC 3VRRA 2PVBA 2JWWA 3IQOA 2MAZA 2ISDA 1J7RA 4HREE 1J55A 1UURA 2JXCA 1QASA 3OX6A 4MZJA 3ZWHA 1CFFA 1J7PA 2WCBA 3SG4A 5PALA 3QRXA 1QX5B 1F55A 1JF2A 4N5XA 1KFUL 3CWGA 3SG3A 4A4BA 1DMOA 4WQ2A 1FI5A 4MRYA 2O5GA 2KQYA 2V53A 1CDNA 2NZ0A 4MZKA 3I5GB 2LE9B 2K61A 3HX4A 3BOWB 3ZNIA 1FPWA 1K9KA 2ZNDA 2E30A 2NCOA 1RECA 3GOFA 1B7TY 1NYAA 2Q4UA 3CLNA 4MN0A 4YGCB 2L51A 2LUCA 1F8HA 1CDLA 3VGOA 3PALA 4NQGA 2LC5A 4MRXA 4XJKB 2LV7A 2AAOA 1Y0VH 1S26D 2KHNA 4P5OE 1UHIA 1Y1UA 1V1GA 1XVJA 2EHBA 3EVUA 5HKYA 3EK8A 2M9GA 1BU3A 3VRPA 1K9PA 1SBJA 3BUNB 2HF5A 1KFXL 1S6CA 1NUBA 1UHJA 2FCDA 1YX8A 1G8IA 2L0PA
chains in the Genus database with same CATH superfamily
2JC2A 1ZP0C 3HUSA 5AW1B 3VMYA 4N6JA 3NFQA 1MFZA 1BCCD 1YVHA 3SS4A 3S0AA 3V2QA 3PLNA 4DS7A 2LLSA 3CX5H 3QH9A 2QEBA 2WMMA 3VMAA 2GTEA 4PHKA 2GM4A 3SWYA 1GD2E 1TNWA 4YTPC 2WSFJ 2QE7H 5CCHC 3L71J 1U7MA 3VMZA 3ITKA 1M90Q 1DJWA 2Q91A 2QEOA 4DUQA 1K8AQ 3IF7A 2K60A 1VDFA 1YTZT 1ZR4A 1MWNA 3GHGA 1J1DA 1EH2A 3H1HG 1MF8B 1ODBA 1SQPE 3PLFB 1MXEA 1TNXA 2Y5IA 5CJ0A 1CDPA 3BCCE 2OYHC 4GKGA 1CB1A 1L0LK 4IOIH 2CT9A 5JOLA 2KGBC 1NU1D 2QJKB 2XU6A 4IL6X 1NHLA 4AUWA 1FF1A 5AERA 1JTHB 4IL6E 5L8RJ 3WUVA 2A45H 2M0RA 1AVOA 2A06D 3KQGA 1Z56A 1PALA 1YX7A 2YGUA 4M2OA 5G08A 3CWBG 4I5LB 4OV2A 5AW5B 1CKKA 3CCMP 1S4XA 3JC22 1XFWO 1Q90D 2FYUD 3O8ZA 4GBAA 1XFYO 1S5GZ 3CZ1A 4ZCVA 2B1UA 2CK3H 4NPDA 2IPPA 3H6PA 2KSPA 1HTLC 1ZN5A 2KXPB 1BLQA 3M0DC 3AEEC 2WSEJ 2NRGA 1KV4A 1HUCA 2V7QH 3FWBA 5B8IB 2EGDA 5HKWA 2XV5A 3R4YA 1L0LG 3T97B 3ICBA 3W67A 5CCHD 1YIJP 3G6EP 5H2FE 4DRWA 2JWDA 3AE2C 1YURA 1LGHB 2J5UA 1FU1A 1RE3A 4YPCA 2L4IA 4A7PA 3VMXA 3SG5A 1Y9BA 4N1GA 1BR4B 1NX3A 3JVTC 3N4XA 1GW4A 1M45A 4H0LB 1EC5A 3BCCJ 2KZJA 4GAOA 1OXZA 1KK7Z 1JTHA 3RK3C 1XO5A 3FE8A 1Y47A 1Q81Q 4OGQB 2ZYDA 5KLVJ 1H8BA 3QWOC 2WOSA 1IJDB 3RBXA 3R1PA 3OB2B 5KKZB 2Y9YA 2FFDC 1B47A 2FOTA 2PRUA 3HCMA 3H32B 5CBOA 1L2OB 1JMBA 2O3JA 2OS8C 4PT1A 2BAPA 5CSNA 3SJSA 4PV1B 1IZNB 3I5GC 1JUOA 3L70D 1RF1B 2W6BA 2BL0B 3T97A 2JT0A 3F45A 1W7IB 2TN4A 3USSA 1T14A 3NSLA 1F4QA 3PSRA 2O1KA 2IS9A 1DVIA 1KILB 4FTGA 1KQVA 1HH0A 4OCIA 1K8UA 3WXAA 4ASWA 1K2HA 1URQC 2BBNA 2LXBA 3CC7P 2BCXA 1LTIC 4EOTA 2BCCE 2IZ1A 4K35A 3TGUE 2KNCA 4F7FA 2OGUA 1JWDA 1DJXA 1NH4A 3CMEP 3M9HA 3BRTB 1GM0A 1CFPA 3PJSK 1JSAA 2EC6C 4NDCA 4U3FD 2CBLA 5TISH 1QATA 2KPHA 1S9KD 1ZW0A 5BPJA 3TDUA 1SQQE 1EG3A 2MRDA 3CR4X 4CLNA 2A45I 1WLMA 4CIDA 5B5EH 1NTMD 1ZOYC 3OHMB 1HQVA 1PPJE 1NJIQ 2Q7CA 3H32A 1YI2P 1OMRA 3RK3D 3B5NB 2FXOA 3GF3A 2PASA 1HWTC 1MKMA 1YVLA 1LKJA 2LLUA 1OIPA 3CGAA 2P10A 5AW7B 3KEVA 3IF4A 4BWNA 1RF1A 5E79H 3NSIA 3UO9A 5AVQB 1KFNA 3ZDMA 1SMGA 1XTGB 1KSOA 1SQXD 3BUOB 3L35A 3H1LE 4UB8H 1QIWA 3C1VA 2P71A 1BGYJ 3SS3A 4HRGA 1KILA 5ER4X 2K0JA 1BCCE 4PJ0E 2WCKA 1OE9B 1SQVE 2PAJA 1DGUA 2R5DA 3CZ0A 3DF0B 2O01N 3CX5E 1PP9E 2YKOA 3MZWB 5AVUB 3EKHA 4L9MA 5KAIH 2E43A 1UHNA 2WPVB 1WRGA 1HT9A 2KP8A 3WNXB 2XNDH 2HODA 3SWFA 2IYPA 1SRAA 3EQ2A 3VRNA 1NWDA 2QIWA 4AOMA 1KTMA 2BCCJ 2QJYB 2FYNB 3NXAA 3TGUJ 1URQD 5F6TA 1RE4A 1EDIA 1W2EA 1N73C 2DOQA 3OX5A 3RM1A 3VRQA 3ABVC 1FOSF 5DKQA 4IFDK 3B5NA 1KQSO 5CBNA 2AXTH 1NU1E 1SQQJ 3I5FB 1IFNA 1JY2N 1OX3A 1CLMA 2K7CA 1BE3J 2YIUB 3SG2A 1ZFSA 2GGZA 3GG2A 3EKJA 2LHLA 3V2LA 2K8MB 1N7LA 2A06E 4XFJA 2I8DA 2D2CC 1ALVA 1VQ8P 4GPLB 3RK2B 2WZ7A 1RK9A 2QACA 2IDBA 1TTXA 2K2AA 4GNKB 3R1VA 1LTTC 1CFDA 2B89A 5FI7A 3BFBA 5CCGA 3DF0A 1SQPG 4A4CA 1OOJA 3H1LJ 2FYUE 2WCMA 1EJ3A 2P67A 3TDZA 1B8CA 3DY9A 1G1JA 2YKQA 1K93D 2PFXA 1DC1A 3BCCG 3SWKA 1BCCJ 2QPTA 1FZCB 1LWUC 5AANA 1F4OA 3KPEA 1SQVJ 3Q2YA 4MEWA 3WHTB 1M57D 1HF9A 3I5HC 4LLHA 3E1IA 1NX2A 2W6AA 1PP9J 2RN0A 3C1LA 3PATA 1AQTA 3GMAA 1N2DA 3EK7A 1S6IA 2ZRSA 1LVCD 4I5JA 1PK0D 1SY9A 3R2PA 4C46A 3TSIA 2H8VA 4PCWA 1LT9B 1L4AB 3HE4B 3WUTA 3O6QB 2IYOA 3D6YA 4IFFA 2MKVA 3OBVA 3R72A 3DXLA 2GUSA 5M1BA 3MUDC 4B86A 1S3PA 1LTJB 4D6TD 1P84H 2RH0A 4OH8B 1GTWA 1U57A 3D70A 2WPSA 3AE9C 2ZT9B 2JWWA 1NU1J 1J7RA 1J55A 3AE6C 2JXCA 1QASA 3CCSP 1J7PA 2WCBA 3SG4A 1F55A 4EIJA 1FZBA 4WQ2A 1FI5A 2O5GA 2KQYA 1CDNA 3D73A 1FZFA 3BFHA 2LE9B 3HX4A 3G3ZA 1FZCA 3BOWB 1FPWA 1FJPA 3K5BA 3M06A 2D2CD 1RECA 3GOFA 3FE9A 4YGCB 1XFRA 1HJ0A 3H1JD 1RY3A 3L70E 3PALA 2FYUJ 4NQGA 3M9BA 1UHIA 1Y1UA 1OW6A 2NPSB 1XVJA 4I2LC 5HKYA 3EK8A 2M9GA 2HLOA 1K9PA 3H1KG 1X8YA 3I56P 1NUBA 1UHJA 4L75A 2L0PA 1LT9A 1JB0J 3HE4A 3O6QA 4QJ5B 1A03A 2I2RE 3AE4C 5KLIC 3FX0A 2KUBA 2V7QJ 1G33A 1KMIZ 1PGJA 2KYCA 1J7QA 3GW6A 2PRRA 3PN7B 4QMAA 3A8RA 1NCXA 2OTGB 1SQQK 2WC5A 1QGKB 3M0WA 1NIWA 4U3FE 2KK7A 5AVZB 1NX0A 2I18A 3GK4X 3V4QA 1AP4A 1E79H 2COLB 5TISE 1PULA 1ORGA 2XZRA 2ZFDA 3RK3E 3BOWA 1K9MQ 2QDIA 2KLEA 5B5EE 4JPZB 3L72D 3P8MC 4Y99B 3VROA 4PE4A 2ZN9A 3NHTA 3BVHA 2L4HA 2FXPA 5I2OA 1DJHA 4MLWA 3OB1B 2OYIC 2NPSA 2JO1A 1EXIA 2BCCG 1SQVK 1VL2A 3TGUG 5E79E 3S0FA 1SP4A 1TNQA 1KK8C 5KSZA 1RWYA 4INXA 5APWA 4UB8E 3L70J 2FJYA 1SVFA 4NPEA 1B1GA 1GU4A 1SQQG 2A4JA 1R6PA 3L73E 1CM1A 1SW8A 2AUCA 5AEQA 5I94A 3AEGC 2W90A 1PPJG 1Y1AA 2BECA 3KXDA 1B4CA 4Z1MH 1RJVA 2LLTA 1U5IB 2BNXA 3JTDC 3KYQA 3KZIH 1NTZD 1OQPA 1SK6D 2IFMA 1HGZA 2KOGA 5KAIE 1P84I 1SQBD 4E68A 2XNXA 3RBZA 2K9JB 2KLVA 1JCCA 4PE1A 2Z5HA 2IBZD 1NU1K 3H1LG 2OPOA 3O4XA 1RFJA 2WPQA 3IFMA 3S9OA 1LA0A 1BCCG 1L7ZA 2KSJA 2PALA 5APYA 5HYDA 4XA4A 2AXTE 5APUA 1JC2A 3HD7C 4Q04A 3L4FA 2CNPA 1IJ5A 2MJWB 1XFZO 3TUYC 1IG5A 2ZAEB 4TT3H 4LC1A 1N7SC 3IAOA 1Z2CB 4WRIA 2K37A 2FYUK 4YGDB 1VQ4P 3IN6A 4YGBB 2WPRA 1FZGA 2WCEA 3A4UB 1IK9A 3SFEC 1Q2NA 3VTPC 4W7ZA 2OYHB 1ZACA 2KQ6A 1IFMA 2GGMA 3RGUA 5FI2A 1KWOC 3TYYA 3Q5PA 3D6ZA 1U5IA 1IQ5A 2BBMA 3GK2A 2C0XA 2LP3A 5B66H 3V6IA 2M5AB 2JTZA 3KO0A 1J1DC 1NTKD 1NU1G 3L73J 2K9JA 4IL1A 1HJBA 1N65A 1RQUA 2ZJSE 1U7JA 1A75B 3CDNA 1BSHA 4WY4C 4PALA 2MJZA 2A06G 3B6XA 2LNKA 1J2JB 2ZVOB 1EL4A 1CSBA 2V4HA 3BUWB 1YQ4C 5CCHA 1AV1A 2A45G 4GGFA 1FOSE 2F3ZA 1YTZC 3BRVB 4D6TE 3C9IA 1X9VA 4ZKUA 2FYUG 2K7BA 2JJLA 3MGNA 2JXLA 2POHA 1SL8A 1P84E 3CL3D 2KBMA 4TLFA 4WB4A 3S0DA 1S72P 1L0ND 1UHHA 1B9AA 3AE8C 5AW2B 2LCPA 1Q82Q 1NOHA 2E75B 4Y28J 4ORAB 2VRGA 1FBVA 1MXLC 1QVIY 3K1EA 2OYHA 1OWAA 3P8CD 1DF0B 5HL1A 3LIEA 1HVVA 4GODA 4PE7A 3HD7D 3H1HD 5APXA 5AW6B 3JVTB 1IKUA 1N7SD 2M5AA 1K04A 5BU5A 1PVAA 5AW8B 1SL7A 3BJHA 4UB6H 3RK3B 2LANA 1MQ1A 1A75A 1Z4HA 2LAPA 2Y4QA 1EQ7A 1M63B 5CSJA 1DEEG 1JY2O 4ZNCA 2O60A 5FYXA 1LA3A 3SG7A 3SS5A 2QJKC 2ZXEB 4BRYB 2KNEA 1IFJA 2FBWC 3MTUE 4YRUA 2H43A 4BXLA 3KDPB 1AHRA 2K88A 1ZRTD 1SQPJ 3GK1A 4PHNA 3CXHH 1PSBA 3KPXA 4PD4H 2OS8B 3M0DA 2M3WA 3CWBD 1W9ZA 4WY4D 2I7AA 3OAKA 3NXSA 4HH2A 2LHIA 3MHVA 2KNCB 3CXHD 3H1KE 3TDIA 2LMUA 4FQOA 2J59M 4PD4D 1AFOA 3JSVC 3WHUB 5APQA 1XFUO 1W2BO 3L70G 2WWWA 3I5IC 1G1IA 3FWCA 4I5KA 4C7NA 2M8UA 4PHJA 3DD4A 3BQ3A 2Q9IA 2MBXA 5DJUB 1DF0A 4KYNA 3MD0A 2KLUA 2QA4P 1AVSA 4AQIA 3VB1A 3BASA 4USLA 4RO0A 1R2UA 3L72E 1CMGA 3D0YB 1L0LD 2WSCH 1OMDA 1QV0A 1YRTB 2KDHA 3CZTX 4EYYQ 2HQ8A 3MP7B 2HG5D 1RH5B 5ER5A 1NAYA 2KI4B 2M7LA 3CCLP 3BUMB 2AMIA 4KT0J 2VRSA 2PGDA 2EC6B 2PQLA 1NCZA 1OOHA 1UP5A 1OZOA 2W83C 3H1ID 1W5CE 4BRYA 1YUUA 1JEKA 1TNPA 3AKAA 4U3FG 4CFRA 1IH0A 1FZAA 1OSAA 1SCVA 1QL1A 1QVGO 2LVIA 1LP1B 1NX1A 1WRLA 1SYMA 1TOPA 1JY3N 1NTMG 2QRXA 2OARA 1NWQA 2F2OA 2LVVA 1JCDA 4R1EA 2QG4A 4OGQC 5KU1A 1A02J 3CZ2A 1SNLA 2YKPA 1CTRA 5IBWA 2QVAA 1QV1A 1SQBE 1XK4C 1BJFA 2HODB 2IZ0A 2JTTA 5AVTB 2Q1KA 3KZIE 3L36A 5KKZC 1SSEB 3OGNA 4H13C 1SFCC 3L75D 1SQXG 2WC6A 3HTKA 2R2IA 3L74D 1L2OC 2M49B 3H1KJ 4DZOA 2YNYA 4PV1C 3OJAB 1ZUZA 1J1EC 1S1EA 2P2UA 3LIDA 4MBEA 2RGIA 3D0YA 2ITAA 4IFMA 5AVXB 1GJYA 2D8NA 1RF1C 1CM4A 3PM8A 5HKZA 1GU5A 1KB9H 1KORA 1WLZA 3L73G 1R5SA 2NXQA 2SPZA 4JD9A 3RLZA 2RKLA 1KILC 4OWFA 3M0AA 1ZMEC 2OTKE 1LT1A 1QVFO 1KB9D 1M56D 4HYTB 2B88A 2K2FA 3MIWA 4WWIA 3Q3DA 3IQOA 1T8ZA 4RESB 4HREE 2PYQA 1UURA 1WT6A 5AVYB 1NAFA 2B9BA 5PALA 1LP1A 1LTBC 1QX5B 1YHQP 3CYZA 2E74B 2KLDA 1KC8Q 1DMOA 3AE5C 2NZ0A 4MZKA 5FI6A 2K61A 2IFNA 1NTKE 3VP8A 4NPFX 3CLQA 1SQPK 3CXHI 1RE4C 4MN0A 4CPGA 2L51A 4PD4I 3L71D 5B66E 2YMYA 3LW5H 2LC5A 5APVA 4MRXA 4XJKB 4I6MC 1Y0VH 1S26D 4I7ZC 1V1GA 1YTZI 1BU3A 2ZYGA 5C39A 1H89A 2PSRA 1YX8A 3DVMA 2YXQB 2O01H 1F54A 1NKZB 1H88A 2FKWB 1IFPA 1LWUB 1M1JB 4H13D 1SFCD 3VP9A 2I1JA 5APSA 3BATA 2ZKMX 3NHIA 3NGVA 1L0NE 3I5HB 3AE1C 2ZNEA 2P1JA 1K90D 2ZFCA 1C07A 4PV1D 4HSZA 3NSOA 1X0TA 1MZ9A 3AECC 3EK4A 4K3AA 1DD3A 2R44A 3O4YA 1N73A 3PTZA 5HLVA 1OFCX 2E76B 2ZYAA 3B8EB 3CTNA 4MN4C 1S5GY 1SCMB 5J3XA 1PGQA 3M9QA 1KYOD 1B7TZ 1KILD 3CCJP 3L4AA 3RL0B 1ZLLA 3DVEA 3PRJA 1IGVA 1ZXGA 2QJYC 2FYNC 1QEXA 3AAKA 1XA5A 2NCPA 1DJZA 4GOEA 2QEXP 4D6TG 1SLQA 3SG6A 4XJKA 5DKNA 5I2LA 2WCLA 2L91A 3AEBC 2GUVA 2L98A 2XDJA 1IC2A 4UB6E 1NTKJ 3D71A 3DYEA 3L47A 3I5FC 1KQMB 1M31A 2C9LY 1TIZA 1VQNP 2F2PA 1Y8AA 2QSIA 5DICA 2YIUC 1LTAC 1QLKA 1BT6A 3KF9A 3DZTA 1QJTA 1KK7Y 1LWUA 1M1JA 2LM5A 1ALWA 2JDIH 1MUXA 3RK2C 1SL9A 2KSEA 3CXHE 2WSSH 3KHEA 4PD4E 5CHXA 4TNCA 1KB9I 1TUJA 5DJTB 1VF5B 2M97A 3BCCD 1LJ2A 1FDOA 2LUXA 1RF0C 1DELA 4AQJA 5K89A 3L37A 2P6BB 1FZCC 1L0NJ 1GL2C 5KTYA 5AW3B 4QJ3B 1CDMA 2OYOA 1USEA 5KLVD 4EI2A 3CCQP 1C3ZA 1PGPA 5AVWB 1G4YR 3QMEA 2MA2A 2YO2A 1NVOA 1SR6B 1RROA 3H25A 1WY9A 1GK4A 1L4AC 1LT9C 1YUSA 2JWAA 1KCYA 4INWA 3PP5A 1IQ3A 1PL5A 1KD1Q 1S6JA 4C0KA 1LTJC 2HPCB 1JFKA 2C0WA 5BVZA 3FIAA 3LK0A 5CSFA 1AK8A 1NYHA 1TCOB 2H89C 4DJGA 1JO5A 1WDCB 2KI6C 4U7JA 1LNQA 1AJ4A 3AEAC 2JULA 3Q5RA 3L72G 3II6A 4BY5A 2SASA 2FCEA 1HBWA 2H61C 1BDDA 2E5YA 1QS7A 2JRFA 2R3CA 1W7JB 3L75E 1S9KE 2NZ2A 5KJ7C 1L2PA 4ZMDA 3EVVA 1KK8B 2KYVA 1NTME 3TS5B 1AJYA 3A3YB 4ORBB 3RK2D 1KYOI 4OKHA 2KYFA 2OTLP 2GV5A 2QJPC 5D69A 4JQ0D 4ETOA 2Z5IA 2NPSC 4YXDC 1C7WA 1ZMZA 3PM2A 4PDZA 3SFDC 3D74A 3IR9A 3AEDC 4H44C 1KB9E 1SQXE 4DIRA 1RHZB 1XTCC 3CCUP 2BEZF 1GL2D 1JY2P 1T2KC 1K05A 2LKMA 1FAVA 2YMKA 3AAJA 1AVYA 3MSEB 2IX7C 4YBHB 1SQBG 2KFGA 2HPCA 1EDLA 3OW2O 3W68A 1LTGC 1NTKK 1KQFB 1BGYD 2OTGC 2AEFA 2B87B 5AW4B 2W6JH 5HLOA 1A2XA 3FWNA 3E3RA 1L4AD 4OZDA 3PJIA 2WQYC 2LR2A 3D76A 4KHXA 2OYIA 3L71E 1GGWA 1DT7B 1CMFA 1BR1B 2HFED 3GF7A 4HB1A 2FJUB 1N7SB 2L2CA 2K7OA 3RL0g 1TRFA 2KI6D 2L5YA 1UIIA 2RMZA 5CPVA 2H7HA 2N1TC 1MHOA 1DJIA 4U3FJ 2BCCD 2SCPA 1KQLA 1KFXS 2R5BA 4C7RA 1M39A 1AUIB 1KWOB 1L0NK 5TNCA 1JFJA 2ZRTA 2LP2A 1VQ7P 3P7KA 1LINA 1CNPA 3UIAA 1NTMJ 1EZVD 5KJ7D 3OA7A 1LXFC 2L2EA 1VQPP 5D7FA 1SS1A 3HUSC 1SQQD 1QL2A 1NTKG 1JY3O 3AE7C 1BE3D 1S2EA 1GQMA 4CFQA 3N7HA 1UWOA 3TZ1A 2CPBA 2WITA 1G2CB 2XKMA 2NPSD 3VN0A 1GK6A 1SQXJ 1M1KQ 3C8VA 1XFXO 2B87A 4H44D 2L5XB 1TN4A 1VQ9P 2NLNA 1YYCA 4P2YB 1T2KD 3GHGC 2F33A 4M3LA 3HRNA 3PHLA 2L50A 2W8ZA 4MVFA 2JOJA 5EL2A 2WCHA 1N7SA 4PHMA 1SQVD 2R3SA 2JPOA 2HQWA 1JOCA 1KN7A 1JBAA 4QJ4B 1FZEA 1L0NG 1TUZA 1USDA 3IQQA 1F70A 4GGFC 3CX5D 3WUUA 1PP9D 2JR8A 2QM7A 2KIKA 3EVRA 3TDKA 2KI7B 4DOJA 3A5TA 3UNWA 3K21A 2CCMA 3LL8B 2FY8A 3LW5J 1VPCA 1BF5A 4UPGA 3PH0A 2F8PA 2ZN8A 4N78D 2N1TD 2C9NY 4ORCB 4WY4A 3SSUA 1IJ6A 2O01J 1J7OA 1G2CA 1VQMP 2WNDA 1KZUB 4C7NB 1RTP1 3D77A 1T3UA 2H2KA 1QLED 1VQ5P 3G4SP 2K3RA 3V4WA 1KQGB 5KLVE 2AEJA 3BXKA 3B86A 5K5GB 1QX2A 2F3YA 2JT3A 3AE3C 3CR2A 4L74A 1DX7A 5APTA 3H1JE 2WTYA 2CTNA 2KAYA 2KFFA 4RKUJ 4YXWH 1VQKP 2ERBA 3FS7A 1N0YA 1AQ5A 4OR9B 3U1CA 2Y0EA 3TK1A 4R4LA 1RE3C 3I5IB 2IBZI 2KOTA 1E8AA 1K95A 3R1OA 3VRRA 1CW5A 2ISDA 3FXEA 1VQ6P 1FC2C 4JYBA 1JUNA 4MZJA 1CFFA 2FFDB 1GW3A 3QRXA 3WU2H 1JF2A 4N5XA 3SG3A 2L5GB 3N7NA 1OOIX 1EZVI 2E75C 4GDOA 5AVRB 3S4RA 3I5GB 4JF7A 3ZNIA 1YITP 1NTMK 3G71P 1FJKA 4D6TJ 1UIXA 3CLNA 2OQQA 2LUCA 1CDLA 4O9BA 3EG5B 2AAOA 4JYCA 3HTKB 3EFFK 2KHNA 4P5OE 4EDFA 2Q3EA 3EVUA 2EHBA 3H1IG 5KAFH 1DEKA 3A7OA 4HJGH 1SBJA 3B71A 2HF5A 1KFXL 1S6CA 1URQB 2FCDA 1SQXK 1DQEA 1G8IA 1Q86Q 4NDDA 1GMJA 3BUXB 1PRWA 2DW3A 5D3OA 1JMMA 2UWJE 4AQRD 2MHHA 1YBKA 1NCYA 4FQTA 4YGEB 5GTIH 1FE6A 1VRKA 2P58A 4H13B 1SFCB 1JM0A 3PFVA 3H1JJ 3A0BH 1AA0A 2BCAA 4H0LC 4N3YB 3CX5I 3L75G 1OVVA 2N9YB 3O78A 1NKNA 1S5LH 3A0HH 1BGYE 2FXMA 2FFDA 1J1EB 3L74G 1DTLA 2BEQD 2M7NA 1Q7YQ 5GTHH 1CLLA 1QXPA 1S36A 3P32A 3NMDA 5TJHA 3GLMA 1IWQA 1NTZE 2Y0DA 3CCEP 2KAXA 1YJNP 4OVNF 5AVVB 1OMVA 1YJ9P 1NSHA 1GGZA 1Y1XA 4JKTA 5CSIA 2IBZE 3I5CA 2KGRA 3F89A 3KHUA 3JCUH 3IVTA 2ZXXA 2WORA 4ICBA 2E75D 1DJYA 1CI6B 1URQA 1SPYA 2BE6A 2KI4C 3D10A 2JKVA 2WT7B 4NDBA 2KAVA 1OZHA 2QM8A 5AVSB 1QX7A 2BL0C 1EZVE 1N8RQ 1NGMB 1S3JA 1HGVA 1WRZA 1IFDA 3TNUB 1XK4A 3AKBA 3M91A 2CPSA 1NP8A 3L72J 1KSMA 1M46A 2KFHA 5AXIA 1BE3E 1SFCA 3F5HA 4MZLA 1IFIA 3Q5SA 2YXRB 3O6BA 1C7VA 3L71G 4I7ZB 3H4SE 2E5TA 1SKTA 1OOGA 2I1KA 1N73B 1NPQA 1J1EA 3OP0A 2KB7P 1IO4A 3AEFC 4BY4A 2ZVNB 2WSFH 2JQ6A 1MV8A 4M2QA 4KJMA 3A2AA 5EFWB 2E6WA 1MR8A 2Y1MA 4XYNA 1PIXA 1YR5A 1M8OB 4H0LD 5JJGA 3CD6P 4W7YA 1TCFA 2BKIB 2N9BA 4GUKA 4MSPA 2D2CB 5I2QA 3NTNA 4W80A 2JNFA 1NTZJ 3B5NC 3L73D 1E5WA 1SQBJ 4GGNA 2W27A 4OGQD 1CI6A 2WT7A 3CC4P 1MUUA 4GIFA 3EWKA 2M3BA 3TNUA 4F0ZB 1XYDA 3SIAA 4N78E 3NSKA 4GOFA 1BOCA 2M1KB 1A4PA 1YUTA 2JPTA 2E74C 5CCGC 5KLVK 1KYOH 1S1CX 3E7KA 3S0BA 3B4SA 1UHKA 2LMVA 1RQVA 1EG4A 3P8CE 1IRJA 5AW0B 2H88C 4WBAA 1F71A 1T3JA 3H1HE 1IIOA 1H8AA 1D7MA 1TU3F 1JNMA 1DH3A 3CCRP 4C0JA 1DD4A 1TWOA 2Q6QA 1VQOP 2WSEH 1OZSA 1N2DC 2Y0CA 1QWVA 4ZKPA 1FDIA 2HR3A 3WMM0 3B88A 2PP6A 1X79B 3U1AA 1T6AA 1BG1A 3V2NA 5CJ4A 2HETA 4C0LA 1DGVA 2AEMA 2M3EA 1M1JC 2JZIA 1GL2B 1XFVO 1CLBA 1ZRTE 2YO3A 1ZOTB 2LMTA 4N1FA 5CMZA 3CWBE 1KFUS 3U59A 5KLVG 2MLEC 3WU2E 4YGAA 4M2PA 2K9YA 1K96A 3B5ND 1A02F 2E42A 1JY3P 2E76C 1SQPD 1WRKA 1SCMC 1H0TB 2I94A 1OMIA 3H1JG 1QIVA 1P28A 4GT1A 1Y6WA 2FYZA 1OVUA 1NO4A 2R32A 1QTXA 1FBMA 3RL0C 1PVBA 4D1EA 3LLEA 4IL6H 4GFTA 2G2BA 1BSNA 5KLIB 1L0LE 2HPSA 2JU0A 1ZR2A 3MUDA 2Y9ZA 1AJ5A 3B7AA 4HRHA 4CPVA 5KAFE 1LS8A 1P84D 1GDTA 2Y1NA 2E74D 5CCGD 2AXCA 1DJGA 4L73A 1H4BA 3LK1A 1K94A 1DIPA 1KQMC 1OVRA 3H1HJ 2M1UA 3FXDA 4JWQA 3CI9A 5KTBA 2BKHB 2WCFA 1WMKA 3FE6A 4WQ3A 3H1IE 3D78A 2JNXA 1RF0A 1K9UA 2BCBA 5GTIE 2P70A 1QVIZ 3D75A 5I8NA 1GL2A 1S5LX 3EFGA 1N86A 3A0BE 2K7DA 5GQQC 3O2PA 4HKZH 1NTZK 1FI6A 3FWLA 1BMOA 3VOPA 4DT0A 2Q5UA 3CS1A 1S5LE 2ZT9C 3DVKA 4YI8A 1SQBK 3A0HE 2QJPB 1VF5C 1QLSA 5H2FH 3G9RA 2JEEA 2Z4EA 3HE5B 2LXCB 4H44B 5GTHE 1H0TA 1OW4A 2OYIB 3Q8IA 1L4AA 1R8EA 1BODA 1FW4A 3CWBJ 1X02A 3L74E 1DEBA 3BYAA 3CPWO 1LTJA 2JT8A 2WC8A 1D1OA 4U8DA 2KZIA 4I5NB 2QEVA 1B8LA 4ZCUA 1PFIA 1SR6C 3BFAA 4I1LA 3RZSA 1QX8A 4JBZA 4R4MA 2E76D 4PE0A 2KS1B 3JCUE 2GA1A 1EXRA 3CC2P 3CR5X 3H1KD 1BGYG 5AFPA 1OW7A 3Q1MA 3S0GA 1PV3A 1PSRA 2H61A 3JTDB 1BDCA 1VQLP 2Q3IA 3RL0D 1L0LJ 2K1AA 4L76A 4LGDE 1A29A 2LVJA 2LVKA 4XE5B 1JF0A 3CMAP 3TF5A 1NTZG 5KJ7A 1UUSA 2M29A 2WSCJ 1WDCC 2H8PD 1K73Q 3DVJA 5DKRA 1R5LA 3V2PA 2PMYA 2N1TB 3SIBA 3PN7C 1CFCA 1FS0E 2IBZG 4AYCA 3H1IJ 2M0BA 1B8RA 4YI9A 2BE4A 1Q80A 3HE5A 2CXJA 2O1JA 3CABA 1KFMA 3V5BA 3HD7B 3TS5C 1EZVG 3HUSB 3CCVP 1C3YA 2BASA 3TUYB 1CZQA 1V1FA 3V2RA 2QEHA 4ASVA 3S0EA 1YRUB 1LTSC 4DCKA 1OW8A 2ZT9D 2G9BA 2WVRA 2P7JA 1MFTA 3I55P 5AW9B 1BE3G 1VF5D 4Y99C 4WVZA 5BU8B 2JP3A 2MLFC 2KBIA 2J58A 1PZQA 1OOFA 3LCPC 2PVBA 1EDKA 3L75J 2KS1A 2MAZA 3TGUD 3E1RA 2WCJA 3L74J 1YQ3C 1EDJA 3OX6A 3ZWHA 1M7LA 3FGAD 1FDMA 2OTJP 3B87A 1KFUL 1PGOA 3CWGA 2G8YA 3GHGB 4A4BA 1J1DB 4MRYA 2V53A 2G3AA 1IK7A 1K9KA 1PPJD 2ZNDA 2HYNA 2E30A 1ZV8A 4WY4B 2NCOA 1SQVG 1B7TY 1NYAA 2Q4UA 2M8RA 1EXJA 2N1TA 3L4LA 1F8HA 3VGOA 1KYOE 3VYIA 2LV7A 1GZLA 1X22A 1KILE 3S1KA 1YJWP 1PP9G 4IJ7A 4PJ0H 3BUNB 4RJTA 3H1LD 3VRPA 3HD7A
chains in the Genus database with same CATH topology
2JC2A 4QJ5B 1F54A 1A03A 2I2RE 4NDDA 3BUXB 1PRWA 1YVHA 4DS7A 2LLSA 2MHHA 4PHKA 1G33A 1NCYA 4YGEB 2KYCA 1J7QA 1TNWA 2ZKMX 1VRKA 3I5HB 2ZNEA 1K90D 3PN7B 3PFVA 1C07A 3A8RA 4HSZA 3NSOA 1NCXA 2OTGB 2BCAA 3EK4A 1DJWA 2Q91A 3M0WA 3O78A 1NIWA 3O4YA 4DUQA 1NX0A 5HLVA 1OFCX 3IF7A 3CTNA 1S5GY 1SCMB 1DTLA 2I18A 3GK4X 5J3XA 1AP4A 1MWNA 2M7NA 1J1DA 2COLB 1EH2A 1B7TZ 1MF8B 1ODBA 3PLFB 1CLLA 1MXEA 1PULA 1QXPA 1S36A 1TNXA 2Y5IA 1IWQA 1CDPA 2ZFDA 2KAXA 3BOWA 3DVEA 1IGVA 4OVNF 4JPZB 1OMVA 3AAKA 1XA5A 2NCPA 1DJZA 1NSHA 1CB1A 1GGZA 1Y1XA 3VROA 4PE4A 2ZN9A 2L4HA 2CT9A 5CSIA 5I2OA 1DJHA 5JOLA 3SG6A 2KGBC 4XJKA 5DKNA 5I2LA 4MLWA 2L98A 3OB1B 2KGRA 1FF1A 2WORA 4ICBA 3I5FC 1KQMB 1M31A 1DJYA 5AERA 1TIZA 2F2PA 1SPYA 1TNQA 2BE6A 1KK8C 2KI4C 1RWYA 2M0RA 3D10A 5KSZA 1PALA 1YX7A 4NDBA 1QLKA 1BT6A 2KAVA 4M2OA 1B1GA 1QX7A 2BL0C 3KF9A 1QJTA 5G08A 1KK7Y 2A4JA 1WRZA 2LM5A 4I5LB 1R6PA 3DVMA 1CM1A 1ALWA 2AUCA 1SW8A 1MUXA 1XK4A 3AKBA 5AEQA 4OV2A 1NP8A 1SL9A 1KSMA 1CKKA 1M46A 2KFHA 5AXIA 1Y1AA 1XFWO 2BECA 3KHEA 4GBAA 1XFYO 1S5GZ 4MZLA 1B4CA 4TNCA 1RJVA 2LLTA 1U5IB 3JTDC 4ZCVA 2B1UA 3O6BA 1C7VA 1OQPA 1SK6D 3H4SE 1SKTA 2KSPA 2M97A 1BLQA 2LUXA 1NPQA 1J1EA 3OP0A 4E68A 4AQJA 5K89A 2P6BB 3FWBA 5B8IB 2EGDA 4PE1A 5HKWA 5KTYA 4QJ3B 1CDMA 4BY4A 2JQ6A 2OPOA 1RFJA 3ICBA 4M2QA 1LA0A 4DRWA 2E6WA 1MR8A 2Y1MA 1YURA 4XYNA 1L7ZA 1YR5A 1G4YR 2L4IA 2MA2A 5JJGA 3SG5A 2PALA 1SR6B 1TCFA 2BKIB 4GUKA 4MSPA 4N1GA 1RROA 5HYDA 1BR4B 1NX3A 3JVTC 5I2QA 1M45A 2JNFA 1JC2A 1WY9A 1YUSA 4Q04A 2CNPA 1KCYA 1IJ5A 2MJWB 1XFZO 4GAOA 4GGNA 3TUYC 1IG5A 1IQ3A 1KK7Z 1S6JA 1XO5A 4WRIA 4C0KA 1JFKA 4YGDB 3FIAA 3LK0A 5CSFA 4YGBB 1AK8A 2WCEA 1TCOB 3A4UB 1H8BA 1WDCB 2WOSA 2KI6C 4F0ZB 1XYDA 1ZACA 2KQ6A 2GGMA 3SIAA 1AJ4A 2JULA 1KWOC 3NSKA 3OB2B 1BOCA 2Y9YA 4BY5A 2M1KB 1B47A 2SASA 2FCEA 1A4PA 1U5IA 1IQ5A 2BBMA 2FOTA 1YUTA 2H61C 2JPTA 2LP3A 2PRUA 3GK2A 3HCMA 2JTZA 1QS7A 3KO0A 1L2OB 2JRFA 2OS8C 1W7JB 5CSNA 3SJSA 1UHKA 2LMVA 4IL1A 1EG4A 1IRJA 1N65A 3I5GC 1JUOA 3EVVA 1KK8B 1A75B 1F71A 3TS5B 4PALA 2BL0B 4ORBB 2JT0A 4OKHA 3F45A 1W7IB 2TN4A 2KYFA 2LNKA 3NSLA 1F4QA 2GV5A 1EL4A 3PSRA 2IS9A 1DVIA 4FTGA 4JQ0D 5D69A 4C0JA 4ETOA 1KQVA 3BUWB 1OZSA 1K8UA 4GGFA 1C7WA 4OCIA 1ZMZA 2F3ZA 4PDZA 3WXAA 1YTZC 1K2HA 2BBNA 2BCXA 2K7BA 4DIRA 1BG1A 2JXLA 2HETA 4C0LA 1SL8A 3AAJA 2KBMA 1DGVA 3MSEB 4YBHB 1UHHA 1B9AA 2JZIA 2KFGA 1DJXA 1JWDA 2LCPA 1XFVO 1CLBA 1CFPA 4ORAB 2VRGA 1FBVA 1ZOTB 2LMTA 1JSAA 4N1FA 2EC6C 4NDCA 2CBLA 1MXLC 1QATA 2OTGC 1QVIY 5BPJA 3TDUA 1KFUS 1DF0B 1EG3A 2MLEC 5HLOA 1A2XA 2MRDA 3CR4X 4YGAA 4CLNA 4M2PA 1WLMA 1K96A 4PE7A 3E3RA 4CIDA 3OHMB 1HQVA 1WRKA 3JVTB 1SCMC 1IKUA 2I94A 1OMRA 1QIVA 1PVAA 1GGWA 1Y6WA 1SL7A 2PASA 1DT7B 1CMFA 1BR1B 1YVLA 1LKJA 2LLUA 2FJUB 1QTXA 3CGAA 3KEVA 1PVBA 2LANA 1MQ1A 1A75A 2PSRA 2LAPA 2Y4QA 2K7OA 4D1EA 3NSIA 1M63B 1TRFA 3LLEA 2KI6D 4GFTA 2G2BA 5CSJA 1SMGA 1KSOA 5CPVA 2HPSA 3BUOB 2O60A 2JU0A 1QIWA 2Y9ZA 1AJ5A 1MHOA 1DJIA 1LA3A 3C1VA 4HRHA 5FYXA 3SG7A 4CPVA 2SCPA 1KFXS 4HRGA 2KNEA 2Y1NA 1M39A 5ER4X 2K0JA 1AUIB 1DJGA 1KWOB 5TNCA 4YRUA 2ZRTA 2LP2A 1JFJA 1H4BA 1OE9B 1LINA 3LK1A 1K94A 1AHRA 1CNPA 1KQMC 1DGUA 3GK1A 4PHNA 2M1UA 3DF0B 1LXFC 2L2EA 1PSBA 4JWQA 3KPXA 5D7FA 2OS8B 2BKHB 2WCFA 2M3WA 4WQ3A 2I7AA 2JNXA 1K9UA 3EKHA 4L9MA 2BCBA 2LHIA 1UHNA 5I8NA 1QVIZ 1HT9A 2LMUA 3TDIA 4FQOA 3WNXB 1GQMA 4CFQA 3WHUB 1UWOA 3TZ1A 2K7DA 5GQQC 1SRAA 1XFUO 3O2PA 3VRNA 1NWDA 3I5IC 1FI6A 3FWCA 1BMOA 4I5KA 2M8UA 3CS1A 3DVKA 4PHJA 3DD4A 1XFXO 3BQ3A 4YI8A 2MBXA 4AOMA 1DF0A 3NXAA 1AVSA 4AQIA 5F6TA 1QLSA 2L5XB 1TN4A 2DOQA 3OX5A 2NLNA 4USLA 3RM1A 1R2UA 4P2YB 3VRQA 1CMGA 3D0YB 1OMDA 1QV0A 1YRTB 2KDHA 5DKQA 3CZTX 2F33A 2HQ8A 1BODA 1FW4A 2L50A 3I5FB 2JOJA 4MVFA 1CLMA 1X02A 4PHMA 5ER5A 2K7CA 3BYAA 2KI4B 2M7LA 2JT8A 2HQWA 2WC8A 3BUMB 1D1OA 2AMIA 4U8DA 3SG2A 1ZFSA 4QJ4B 1JBAA 2GGZA 3EKJA 4I5NB 1B8LA 3IQQA 4ZCUA 1F70A 2LHLA 1SR6C 2EC6B 4GGFC 2K8MB 1NCZA 1UP5A 1OZOA 1ALVA 4GPLB 4PE0A 1YUUA 1TNPA 1EXRA 3AKAA 4CFRA 3CR5X 1IH0A 1OSAA 1RK9A 1SCVA 2QACA 3EVRA 5AFPA 1TTXA 2K2AA 4GNKB 1CFDA 2LVIA 1NX1A 1WRLA 2CCMA 1SYMA 1TOPA 3K21A 1PSRA 2H61A 3LL8B 3JTDB 3DF0A 1BF5A 4A4CA 1OOJA 1A29A 2F2OA 2LVJA 1EJ3A 2LVVA 2LVKA 4R1EA 3TDZA 1JF0A 4UPGA 1B8CA 5KU1A 1K93D 2F8PA 2ZN8A 1SNLA 2QPTA 1CTRA 1UUSA 2M29A 5AANA 1F4OA 1WDCC 5IBWA 1QV1A 4ORCB 1XK4C 1BJFA 3DVJA 5DKRA 1IJ6A 4MEWA 2JTTA 1J7OA 3WHTB 2PMYA 2WNDA 3I5HC 3SIBA 3PN7C 1CFCA 1RTP1 1NX2A 2H2KA 2R2IA 3PATA 1B8RA 3BXKA 1L2OC 4YI9A 2M49B 1N2DA 3EK7A 2BE4A 1QX2A 1S6IA 1Q80A 1ZUZA 1LVCD 1S1EA 2F3YA 2JT3A 2ZRSA 1PK0D 2CXJA 3CR2A 4I5JA 2RGIA 4MBEA 3D0YA 1SY9A 1GJYA 2D8NA 4PCWA 1CM4A 3PM8A 3TS5C 2CTNA 5HKZA 2KAYA 2KFFA 1WLZA 3TUYB 1S3PA 1V1FA 2NXQA 3RLZA 1YRUB 1N0YA 3FS7A 4DCKA 4OR9B 2G9BA 3I5IB 2MLFC 2KBIA 2K2FA 2KOTA 1E8AA 1K95A 3LCPC 3VRRA 2PVBA 2JWWA 3IQOA 2MAZA 2ISDA 1J7RA 4HREE 1J55A 1UURA 2JXCA 1QASA 3OX6A 4MZJA 3ZWHA 1CFFA 1J7PA 2WCBA 3SG4A 5PALA 3QRXA 1QX5B 1F55A 1JF2A 4N5XA 1KFUL 3CWGA 3SG3A 4A4BA 1DMOA 4WQ2A 1FI5A 4MRYA 2O5GA 2KQYA 2V53A 1CDNA 2NZ0A 4MZKA 3I5GB 2LE9B 2K61A 3HX4A 3BOWB 3ZNIA 1FPWA 1K9KA 2ZNDA 2E30A 2NCOA 1RECA 3GOFA 1B7TY 1NYAA 2Q4UA 3CLNA 4MN0A 4YGCB 2L51A 2LUCA 1F8HA 1CDLA 3VGOA 3PALA 4NQGA 2LC5A 4MRXA 4XJKB 2LV7A 2AAOA 1Y0VH 1S26D 2KHNA 4P5OE 1UHIA 1Y1UA 1V1GA 1XVJA 2EHBA 3EVUA 5HKYA 3EK8A 2M9GA 1BU3A 3VRPA 1K9PA 1SBJA 3BUNB 2HF5A 1KFXL 1S6CA 1NUBA 1UHJA 2FCDA 1YX8A 1G8IA 2L0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC2 A;  4QJ5 B;  1F54 A;  1A03 A;  2I2R E;  4NDD A;  3BUX B;  1PRW A;  1YVH A;  4DS7 A;  2LLS A;  2MHH A;  4PHK A;  1G33 A;  1NCY A;  4YGE B;  2KYC A;  1J7Q A;  1TNW A;  2ZKM X;  1VRK A;  3I5H B;  2ZNE A;  1K90 D;  3PN7 B;  3PFV A;  1C07 A;  3A8R A;  4HSZ A;  3NSO A;  1NCX A;  2OTG B;  2BCA A;  3EK4 A;  1DJW A;  2Q91 A;  3M0W A;  3O78 A;  1NIW A;  3O4Y A;  4DUQ A;  1NX0 A;  5HLV A;  1OFC X;  3IF7 A;  3CTN A;  1S5G Y;  1SCM B;  1DTL A;  2I18 A;  3GK4 X;  5J3X A;  1AP4 A;  1MWN A;  2M7N A;  1J1D A;  2COL B;  1EH2 A;  1B7T Z;  1MF8 B;  1ODB A;  3PLF B;  1CLL A;  1MXE A;  1PUL A;  1QXP A;  1S36 A;  1TNX A;  2Y5I A;  1IWQ A;  1CDP A;  2ZFD A;  2KAX A;  3BOW A;  3DVE A;  1IGV A;  4OVN F;  4JPZ B;  1OMV A;  3AAK A;  1XA5 A;  2NCP A;  1DJZ A;  1NSH A;  1CB1 A;  1GGZ A;  1Y1X A;  3VRO A;  4PE4 A;  2ZN9 A;  2L4H A;  2CT9 A;  5CSI A;  5I2O A;  1DJH A;  5JOL A;  3SG6 A;  2KGB C;  4XJK A;  5DKN A;  5I2L A;  4MLW A;  2L98 A;  3OB1 B;  2KGR A;  1FF1 A;  2WOR A;  4ICB A;  3I5F C;  1KQM B;  1M31 A;  1DJY A;  5AER A;  1TIZ A;  2F2P A;  1SPY A;  1TNQ A;  2BE6 A;  1KK8 C;  2KI4 C;  1RWY A;  2M0R A;  3D10 A;  5KSZ A;  1PAL A;  1YX7 A;  4NDB A;  1QLK A;  1BT6 A;  2KAV A;  4M2O A;  1B1G A;  1QX7 A;  2BL0 C;  3KF9 A;  1QJT A;  5G08 A;  1KK7 Y;  2A4J A;  1WRZ A;  2LM5 A;  4I5L B;  1R6P A;  3DVM A;  1CM1 A;  1ALW A;  2AUC A;  1SW8 A;  1MUX A;  1XK4 A;  3AKB A;  5AEQ A;  4OV2 A;  1NP8 A;  1SL9 A;  1KSM A;  1CKK A;  1M46 A;  2KFH A;  5AXI A;  1Y1A A;  1XFW O;  2BEC A;  3KHE A;  4GBA A;  1XFY O;  1S5G Z;  4MZL A;  1B4C A;  4TNC A;  1RJV A;  2LLT A;  1U5I B;  3JTD C;  4ZCV A;  2B1U A;  3O6B A;  1C7V A;  1OQP A;  1SK6 D;  3H4S E;  1SKT A;  2KSP A;  2M97 A;  1BLQ A;  2LUX A;  1NPQ A;  1J1E A;  3OP0 A;  4E68 A;  4AQJ A;  5K89 A;  2P6B B;  3FWB A;  5B8I B;  2EGD A;  4PE1 A;  5HKW A;  5KTY A;  4QJ3 B;  1CDM A;  4BY4 A;  2JQ6 A;  2OPO A;  1RFJ A;  3ICB A;  4M2Q A;  1LA0 A;  4DRW A;  2E6W A;  1MR8 A;  2Y1M A;  1YUR A;  4XYN A;  1L7Z A;  1YR5 A;  1G4Y R;  2L4I A;  2MA2 A;  5JJG A;  3SG5 A;  2PAL A;  1SR6 B;  1TCF A;  2BKI B;  4GUK A;  4MSP A;  4N1G A;  1RRO A;  5HYD A;  1BR4 B;  1NX3 A;  3JVT C;  5I2Q A;  1M45 A;  2JNF A;  1JC2 A;  1WY9 A;  1YUS A;  4Q04 A;  2CNP A;  1KCY A;  1IJ5 A;  2MJW B;  1XFZ O;  4GAO A;  4GGN A;  3TUY C;  1IG5 A;  1IQ3 A;  1KK7 Z;  1S6J A;  1XO5 A;  4WRI A;  4C0K A;  1JFK A;  4YGD B;  3FIA A;  3LK0 A;  5CSF A;  4YGB B;  1AK8 A;  2WCE A;  1TCO B;  3A4U B;  1H8B A;  1WDC B;  2WOS A;  2KI6 C;  4F0Z B;  1XYD A;  1ZAC A;  2KQ6 A;  2GGM A;  3SIA A;  1AJ4 A;  2JUL A;  1KWO C;  3NSK A;  3OB2 B;  1BOC A;  2Y9Y A;  4BY5 A;  2M1K B;  1B47 A;  2SAS A;  2FCE A;  1A4P A;  1U5I A;  1IQ5 A;  2BBM A;  2FOT A;  1YUT A;  2H61 C;  2JPT A;  2LP3 A;  2PRU A;  3GK2 A;  3HCM A;  2JTZ A;  1QS7 A;  3KO0 A;  1L2O B;  2JRF A;  2OS8 C;  1W7J B;  5CSN A;  3SJS A;  1UHK A;  2LMV A;  4IL1 A;  1EG4 A;  1IRJ A;  1N65 A;  3I5G C;  1JUO A;  3EVV A;  1KK8 B;  1A75 B;  1F71 A;  3TS5 B;  4PAL A;  2BL0 B;  4ORB B;  2JT0 A;  4OKH A;  3F45 A;  1W7I B;  2TN4 A;  2KYF A;  2LNK A;  3NSL A;  1F4Q A;  2GV5 A;  1EL4 A;  3PSR A;  2IS9 A;  1DVI A;  4FTG A;  4JQ0 D;  5D69 A;  4C0J A;  4ETO A;  1KQV A;  3BUW B;  1OZS A;  1K8U A;  4GGF A;  1C7W A;  4OCI A;  1ZMZ A;  2F3Z A;  4PDZ A;  3WXA A;  1YTZ C;  1K2H A;  2BBN A;  2BCX A;  2K7B A;  4DIR A;  1BG1 A;  2JXL A;  2HET A;  4C0L A;  1SL8 A;  3AAJ A;  2KBM A;  1DGV A;  3MSE B;  4YBH B;  1UHH A;  1B9A A;  2JZI A;  2KFG A;  1DJX A;  1JWD A;  2LCP A;  1XFV O;  1CLB A;  1CFP A;  4ORA B;  2VRG A;  1FBV A;  1ZOT B;  2LMT A;  1JSA A;  4N1F A;  2EC6 C;  4NDC A;  2CBL A;  1MXL C;  1QAT A;  2OTG C;  1QVI Y;  5BPJ A;  3TDU A;  1KFU S;  1DF0 B;  1EG3 A;  2MLE C;  5HLO A;  1A2X A;  2MRD A;  3CR4 X;  4YGA A;  4CLN A;  4M2P A;  1WLM A;  1K96 A;  4PE7 A;  3E3R A;  4CID A;  3OHM B;  1HQV A;  1WRK A;  3JVT B;  1SCM C;  1IKU A;  2I94 A;  1OMR A;  1QIV A;  1PVA A;  1GGW A;  1Y6W A;  1SL7 A;  2PAS A;  1DT7 B;  1CMF A;  1BR1 B;  1YVL A;  1LKJ A;  2LLU A;  2FJU B;  1QTX A;  3CGA A;  3KEV A;  1PVB A;  2LAN A;  1MQ1 A;  1A75 A;  2PSR A;  2LAP A;  2Y4Q A;  2K7O A;  4D1E A;  3NSI A;  1M63 B;  1TRF A;  3LLE A;  2KI6 D;  4GFT A;  2G2B A;  5CSJ A;  1SMG A;  1KSO A;  5CPV A;  2HPS A;  3BUO B;  2O60 A;  2JU0 A;  1QIW A;  2Y9Z A;  1AJ5 A;  1MHO A;  1DJI A;  1LA3 A;  3C1V A;  4HRH A;  5FYX A;  3SG7 A;  4CPV A;  2SCP A;  1KFX S;  4HRG A;  2KNE A;  2Y1N A;  1M39 A;  5ER4 X;  2K0J A;  1AUI B;  1DJG A;  1KWO B;  5TNC A;  4YRU A;  2ZRT A;  2LP2 A;  1JFJ A;  1H4B A;  1OE9 B;  1LIN A;  3LK1 A;  1K94 A;  1AHR A;  1CNP A;  1KQM C;  1DGU A;  3GK1 A;  4PHN A;  2M1U A;  3DF0 B;  1LXF C;  2L2E A;  1PSB A;  4JWQ A;  3KPX A;  5D7F A;  2OS8 B;  2BKH B;  2WCF A;  2M3W A;  4WQ3 A;  2I7A A;  2JNX A;  1K9U A;  3EKH A;  4L9M A;  2BCB A;  2LHI A;  1UHN A;  5I8N A;  1QVI Z;  1HT9 A;  2LMU A;  3TDI A;  4FQO A;  3WNX B;  1GQM A;  4CFQ A;  3WHU B;  1UWO A;  3TZ1 A;  2K7D A;  5GQQ C;  1SRA A;  1XFU O;  3O2P A;  3VRN A;  1NWD A;  3I5I C;  1FI6 A;  3FWC A;  1BMO A;  4I5K A;  2M8U A;  3CS1 A;  3DVK A;  4PHJ A;  3DD4 A;  1XFX O;  3BQ3 A;  4YI8 A;  2MBX A;  4AOM A;  1DF0 A;  3NXA A;  1AVS A;  4AQI A;  5F6T A;  1QLS A;  2L5X B;  1TN4 A;  2DOQ A;  3OX5 A;  2NLN A;  4USL A;  3RM1 A;  1R2U A;  4P2Y B;  3VRQ A;  1CMG A;  3D0Y B;  1OMD A;  1QV0 A;  1YRT B;  2KDH A;  5DKQ A;  3CZT X;  2F33 A;  2HQ8 A;  1BOD A;  1FW4 A;  2L50 A;  3I5F B;  2JOJ A;  4MVF A;  1CLM A;  1X02 A;  4PHM A;  5ER5 A;  2K7C A;  3BYA A;  2KI4 B;  2M7L A;  2JT8 A;  2HQW A;  2WC8 A;  3BUM B;  1D1O A;  2AMI A;  4U8D A;  3SG2 A;  1ZFS A;  4QJ4 B;  1JBA A;  2GGZ A;  3EKJ A;  4I5N B;  1B8L A;  3IQQ A;  4ZCU A;  1F70 A;  2LHL A;  1SR6 C;  2EC6 B;  4GGF C;  2K8M B;  1NCZ A;  1UP5 A;  1OZO A;  1ALV A;  4GPL B;  4PE0 A;  1YUU A;  1TNP A;  1EXR A;  3AKA A;  4CFR A;  3CR5 X;  1IH0 A;  1OSA A;  1RK9 A;  1SCV A;  2QAC A;  3EVR A;  5AFP A;  1TTX A;  2K2A A;  4GNK B;  1CFD A;  2LVI A;  1NX1 A;  1WRL A;  2CCM A;  1SYM A;  1TOP A;  3K21 A;  1PSR A;  2H61 A;  3LL8 B;  3JTD B;  3DF0 A;  1BF5 A;  4A4C A;  1OOJ A;  1A29 A;  2F2O A;  2LVJ A;  1EJ3 A;  2LVV A;  2LVK A;  4R1E A;  3TDZ A;  1JF0 A;  4UPG A;  1B8C A;  5KU1 A;  1K93 D;  2F8P A;  2ZN8 A;  1SNL A;  2QPT A;  1CTR A;  1UUS A;  2M29 A;  5AAN A;  1F4O A;  1WDC C;  5IBW A;  1QV1 A;  4ORC B;  1XK4 C;  1BJF A;  3DVJ A;  5DKR A;  1IJ6 A;  4MEW A;  2JTT A;  1J7O A;  3WHT B;  2PMY A;  2WND A;  3I5H C;  3SIB A;  3PN7 C;  1CFC A;  1RTP 1;  1NX2 A;  2H2K A;  2R2I A;  3PAT A;  1B8R A;  3BXK A;  1L2O C;  4YI9 A;  2M49 B;  1N2D A;  3EK7 A;  2BE4 A;  1QX2 A;  1S6I A;  1Q80 A;  1ZUZ A;  1LVC D;  1S1E A;  2F3Y A;  2JT3 A;  2ZRS A;  1PK0 D;  2CXJ A;  3CR2 A;  4I5J A;  2RGI A;  4MBE A;  3D0Y A;  1SY9 A;  1GJY A;  2D8N A;  4PCW A;  1CM4 A;  3PM8 A;  3TS5 C;  2CTN A;  5HKZ A;  2KAY A;  2KFF A;  1WLZ A;  3TUY B;  1S3P A;  1V1F A;  2NXQ A;  3RLZ A;  1YRU B;  1N0Y A;  3FS7 A;  4DCK A;  4OR9 B;  2G9B A;  3I5I B;  2MLF C;  2KBI A;  2K2F A;  2KOT A;  1E8A A;  1K95 A;  3LCP C;  3VRR A;  2PVB A;  2JWW A;  3IQO A;  2MAZ A;  2ISD A;  1J7R A;  4HRE E;  1J55 A;  1UUR A;  2JXC A;  1QAS A;  3OX6 A;  4MZJ A;  3ZWH A;  1CFF A;  1J7P A;  2WCB A;  3SG4 A;  5PAL A;  3QRX A;  1QX5 B;  1F55 A;  1JF2 A;  4N5X A;  1KFU L;  3CWG A;  3SG3 A;  4A4B A;  1DMO A;  4WQ2 A;  1FI5 A;  4MRY A;  2O5G A;  2KQY A;  2V53 A;  1CDN A;  2NZ0 A;  4MZK A;  3I5G B;  2LE9 B;  2K61 A;  3HX4 A;  3BOW B;  3ZNI A;  1FPW A;  1K9K A;  2ZND A;  2E30 A;  2NCO A;  1REC A;  3GOF A;  1B7T Y;  1NYA A;  2Q4U A;  3CLN A;  4MN0 A;  4YGC B;  2L51 A;  2LUC A;  1F8H A;  1CDL A;  3VGO A;  3PAL A;  4NQG A;  2LC5 A;  4MRX A;  4XJK B;  2LV7 A;  2AAO A;  1Y0V H;  1S26 D;  2KHN A;  4P5O E;  1UHI A;  1Y1U A;  1V1G A;  1XVJ A;  2EHB A;  3EVU A;  5HKY A;  3EK8 A;  2M9G A;  1BU3 A;  3VRP A;  1K9P A;  1SBJ A;  3BUN B;  2HF5 A;  1KFX L;  1S6C A;  1NUB A;  1UHJ A;  2FCD A;  1YX8 A;  1G8I A;  2L0P A; 
#chains in the Genus database with same CATH topology
 2JC2 A;  1ZP0 C;  3HUS A;  5AW1 B;  3VMY A;  4N6J A;  3NFQ A;  1MFZ A;  1BCC D;  1YVH A;  3SS4 A;  3S0A A;  3V2Q A;  3PLN A;  4DS7 A;  2LLS A;  3CX5 H;  3QH9 A;  2QEB A;  2WMM A;  3VMA A;  2GTE A;  4PHK A;  2GM4 A;  3SWY A;  1GD2 E;  1TNW A;  4YTP C;  2WSF J;  2QE7 H;  5CCH C;  3L71 J;  1U7M A;  3VMZ A;  3ITK A;  1M90 Q;  1DJW A;  2Q91 A;  2QEO A;  4DUQ A;  1K8A Q;  3IF7 A;  2K60 A;  1VDF A;  1YTZ T;  1ZR4 A;  1MWN A;  3GHG A;  1J1D A;  1EH2 A;  3H1H G;  1MF8 B;  1ODB A;  1SQP E;  3PLF B;  1MXE A;  1TNX A;  2Y5I A;  5CJ0 A;  1CDP A;  3BCC E;  2OYH C;  4GKG A;  1CB1 A;  1L0L K;  4IOI H;  2CT9 A;  5JOL A;  2KGB C;  1NU1 D;  2QJK B;  2XU6 A;  4IL6 X;  1NHL A;  4AUW A;  1FF1 A;  5AER A;  1JTH B;  4IL6 E;  5L8R J;  3WUV A;  2A45 H;  2M0R A;  1AVO A;  2A06 D;  3KQG A;  1Z56 A;  1PAL A;  1YX7 A;  2YGU A;  4M2O A;  5G08 A;  3CWB G;  4I5L B;  4OV2 A;  5AW5 B;  1CKK A;  3CCM P;  1S4X A;  3JC2 2;  1XFW O;  1Q90 D;  2FYU D;  3O8Z A;  4GBA A;  1XFY O;  1S5G Z;  3CZ1 A;  4ZCV A;  2B1U A;  2CK3 H;  4NPD A;  2IPP A;  3H6P A;  2KSP A;  1HTL C;  1ZN5 A;  2KXP B;  1BLQ A;  3M0D C;  3AEE C;  2WSE J;  2NRG A;  1KV4 A;  1HUC A;  2V7Q H;  3FWB A;  5B8I B;  2EGD A;  5HKW A;  2XV5 A;  3R4Y A;  1L0L G;  3T97 B;  3ICB A;  3W67 A;  5CCH D;  1YIJ P;  3G6E P;  5H2F E;  4DRW A;  2JWD A;  3AE2 C;  1YUR A;  1LGH B;  2J5U A;  1FU1 A;  1RE3 A;  4YPC A;  2L4I A;  4A7P A;  3VMX A;  3SG5 A;  1Y9B A;  4N1G A;  1BR4 B;  1NX3 A;  3JVT C;  3N4X A;  1GW4 A;  1M45 A;  4H0L B;  1EC5 A;  3BCC J;  2KZJ A;  4GAO A;  1OXZ A;  1KK7 Z;  1JTH A;  3RK3 C;  1XO5 A;  3FE8 A;  1Y47 A;  1Q81 Q;  4OGQ B;  2ZYD A;  5KLV J;  1H8B A;  3QWO C;  2WOS A;  1IJD B;  3RBX A;  3R1P A;  3OB2 B;  5KKZ B;  2Y9Y A;  2FFD C;  1B47 A;  2FOT A;  2PRU A;  3HCM A;  3H32 B;  5CBO A;  1L2O B;  1JMB A;  2O3J A;  2OS8 C;  4PT1 A;  2BAP A;  5CSN A;  3SJS A;  4PV1 B;  1IZN B;  3I5G C;  1JUO A;  3L70 D;  1RF1 B;  2W6B A;  2BL0 B;  3T97 A;  2JT0 A;  3F45 A;  1W7I B;  2TN4 A;  3USS A;  1T14 A;  3NSL A;  1F4Q A;  3PSR A;  2O1K A;  2IS9 A;  1DVI A;  1KIL B;  4FTG A;  1KQV A;  1HH0 A;  4OCI A;  1K8U A;  3WXA A;  4ASW A;  1K2H A;  1URQ C;  2BBN A;  2LXB A;  3CC7 P;  2BCX A;  1LTI C;  4EOT A;  2BCC E;  2IZ1 A;  4K35 A;  3TGU E;  2KNC A;  4F7F A;  2OGU A;  1JWD A;  1DJX A;  1NH4 A;  3CME P;  3M9H A;  3BRT B;  1GM0 A;  1CFP A;  3PJS K;  1JSA A;  2EC6 C;  4NDC A;  4U3F D;  2CBL A;  5TIS H;  1QAT A;  2KPH A;  1S9K D;  1ZW0 A;  5BPJ A;  3TDU A;  1SQQ E;  1EG3 A;  2MRD A;  3CR4 X;  4CLN A;  2A45 I;  1WLM A;  4CID A;  5B5E H;  1NTM D;  1ZOY C;  3OHM B;  1HQV A;  1PPJ E;  1NJI Q;  2Q7C A;  3H32 A;  1YI2 P;  1OMR A;  3RK3 D;  3B5N B;  2FXO A;  3GF3 A;  2PAS A;  1HWT C;  1MKM A;  1YVL A;  1LKJ A;  2LLU A;  1OIP A;  3CGA A;  2P10 A;  5AW7 B;  3KEV A;  3IF4 A;  4BWN A;  1RF1 A;  5E79 H;  3NSI A;  3UO9 A;  5AVQ B;  1KFN A;  3ZDM A;  1SMG A;  1XTG B;  1KSO A;  1SQX D;  3BUO B;  3L35 A;  3H1L E;  4UB8 H;  1QIW A;  3C1V A;  2P71 A;  1BGY J;  3SS3 A;  4HRG A;  1KIL A;  5ER4 X;  2K0J A;  1BCC E;  4PJ0 E;  2WCK A;  1OE9 B;  1SQV E;  2PAJ A;  1DGU A;  2R5D A;  3CZ0 A;  3DF0 B;  2O01 N;  3CX5 E;  1PP9 E;  2YKO A;  3MZW B;  5AVU B;  3EKH A;  4L9M A;  5KAI H;  2E43 A;  1UHN A;  2WPV B;  1WRG A;  1HT9 A;  2KP8 A;  3WNX B;  2XND H;  2HOD A;  3SWF A;  2IYP A;  1SRA A;  3EQ2 A;  3VRN A;  1NWD A;  2QIW A;  4AOM A;  1KTM A;  2BCC J;  2QJY B;  2FYN B;  3NXA A;  3TGU J;  1URQ D;  5F6T A;  1RE4 A;  1EDI A;  1W2E A;  1N73 C;  2DOQ A;  3OX5 A;  3RM1 A;  3VRQ A;  3ABV C;  1FOS F;  5DKQ A;  4IFD K;  3B5N A;  1KQS O;  5CBN A;  2AXT H;  1NU1 E;  1SQQ J;  3I5F B;  1IFN A;  1JY2 N;  1OX3 A;  1CLM A;  2K7C A;  1BE3 J;  2YIU B;  3SG2 A;  1ZFS A;  2GGZ A;  3GG2 A;  3EKJ A;  2LHL A;  3V2L A;  2K8M B;  1N7L A;  2A06 E;  4XFJ A;  2I8D A;  2D2C C;  1ALV A;  1VQ8 P;  4GPL B;  3RK2 B;  2WZ7 A;  1RK9 A;  2QAC A;  2IDB A;  1TTX A;  2K2A A;  4GNK B;  3R1V A;  1LTT C;  1CFD A;  2B89 A;  5FI7 A;  3BFB A;  5CCG A;  3DF0 A;  1SQP G;  4A4C A;  1OOJ A;  3H1L J;  2FYU E;  2WCM A;  1EJ3 A;  2P67 A;  3TDZ A;  1B8C A;  3DY9 A;  1G1J A;  2YKQ A;  1K93 D;  2PFX A;  1DC1 A;  3BCC G;  3SWK A;  1BCC J;  2QPT A;  1FZC B;  1LWU C;  5AAN A;  1F4O A;  3KPE A;  1SQV J;  3Q2Y A;  4MEW A;  3WHT B;  1M57 D;  1HF9 A;  3I5H C;  4LLH A;  3E1I A;  1NX2 A;  2W6A A;  1PP9 J;  2RN0 A;  3C1L A;  3PAT A;  1AQT A;  3GMA A;  1N2D A;  3EK7 A;  1S6I A;  2ZRS A;  1LVC D;  4I5J A;  1PK0 D;  1SY9 A;  3R2P A;  4C46 A;  3TSI A;  2H8V A;  4PCW A;  1LT9 B;  1L4A B;  3HE4 B;  3WUT A;  3O6Q B;  2IYO A;  3D6Y A;  4IFF A;  2MKV A;  3OBV A;  3R72 A;  3DXL A;  2GUS A;  5M1B A;  3MUD C;  4B86 A;  1S3P A;  1LTJ B;  4D6T D;  1P84 H;  2RH0 A;  4OH8 B;  1GTW A;  1U57 A;  3D70 A;  2WPS A;  3AE9 C;  2ZT9 B;  2JWW A;  1NU1 J;  1J7R A;  1J55 A;  3AE6 C;  2JXC A;  1QAS A;  3CCS P;  1J7P A;  2WCB A;  3SG4 A;  1F55 A;  4EIJ A;  1FZB A;  4WQ2 A;  1FI5 A;  2O5G A;  2KQY A;  1CDN A;  3D73 A;  1FZF A;  3BFH A;  2LE9 B;  3HX4 A;  3G3Z A;  1FZC A;  3BOW B;  1FPW A;  1FJP A;  3K5B A;  3M06 A;  2D2C D;  1REC A;  3GOF A;  3FE9 A;  4YGC B;  1XFR A;  1HJ0 A;  3H1J D;  1RY3 A;  3L70 E;  3PAL A;  2FYU J;  4NQG A;  3M9B A;  1UHI A;  1Y1U A;  1OW6 A;  2NPS B;  1XVJ A;  4I2L C;  5HKY A;  3EK8 A;  2M9G A;  2HLO A;  1K9P A;  3H1K G;  1X8Y A;  3I56 P;  1NUB A;  1UHJ A;  4L75 A;  2L0P A;  1LT9 A;  1JB0 J;  3HE4 A;  3O6Q A;  4QJ5 B;  1A03 A;  2I2R E;  3AE4 C;  5KLI C;  3FX0 A;  2KUB A;  2V7Q J;  1G33 A;  1KMI Z;  1PGJ A;  2KYC A;  1J7Q A;  3GW6 A;  2PRR A;  3PN7 B;  4QMA A;  3A8R A;  1NCX A;  2OTG B;  1SQQ K;  2WC5 A;  1QGK B;  3M0W A;  1NIW A;  4U3F E;  2KK7 A;  5AVZ B;  1NX0 A;  2I18 A;  3GK4 X;  3V4Q A;  1AP4 A;  1E79 H;  2COL B;  5TIS E;  1PUL A;  1ORG A;  2XZR A;  2ZFD A;  3RK3 E;  3BOW A;  1K9M Q;  2QDI A;  2KLE A;  5B5E E;  4JPZ B;  3L72 D;  3P8M C;  4Y99 B;  3VRO A;  4PE4 A;  2ZN9 A;  3NHT A;  3BVH A;  2L4H A;  2FXP A;  5I2O A;  1DJH A;  4MLW A;  3OB1 B;  2OYI C;  2NPS A;  2JO1 A;  1EXI A;  2BCC G;  1SQV K;  1VL2 A;  3TGU G;  5E79 E;  3S0F A;  1SP4 A;  1TNQ A;  1KK8 C;  5KSZ A;  1RWY A;  4INX A;  5APW A;  4UB8 E;  3L70 J;  2FJY A;  1SVF A;  4NPE A;  1B1G A;  1GU4 A;  1SQQ G;  2A4J A;  1R6P A;  3L73 E;  1CM1 A;  1SW8 A;  2AUC A;  5AEQ A;  5I94 A;  3AEG C;  2W90 A;  1PPJ G;  1Y1A A;  2BEC A;  3KXD A;  1B4C A;  4Z1M H;  1RJV A;  2LLT A;  1U5I B;  2BNX A;  3JTD C;  3KYQ A;  3KZI H;  1NTZ D;  1OQP A;  1SK6 D;  2IFM A;  1HGZ A;  2KOG A;  5KAI E;  1P84 I;  1SQB D;  4E68 A;  2XNX A;  3RBZ A;  2K9J B;  2KLV A;  1JCC A;  4PE1 A;  2Z5H A;  2IBZ D;  1NU1 K;  3H1L G;  2OPO A;  3O4X A;  1RFJ A;  2WPQ A;  3IFM A;  3S9O A;  1LA0 A;  1BCC G;  1L7Z A;  2KSJ A;  2PAL A;  5APY A;  5HYD A;  4XA4 A;  2AXT E;  5APU A;  1JC2 A;  3HD7 C;  4Q04 A;  3L4F A;  2CNP A;  1IJ5 A;  2MJW B;  1XFZ O;  3TUY C;  1IG5 A;  2ZAE B;  4TT3 H;  4LC1 A;  1N7S C;  3IAO A;  1Z2C B;  4WRI A;  2K37 A;  2FYU K;  4YGD B;  1VQ4 P;  3IN6 A;  4YGB B;  2WPR A;  1FZG A;  2WCE A;  3A4U B;  1IK9 A;  3SFE C;  1Q2N A;  3VTP C;  4W7Z A;  2OYH B;  1ZAC A;  2KQ6 A;  1IFM A;  2GGM A;  3RGU A;  5FI2 A;  1KWO C;  3TYY A;  3Q5P A;  3D6Z A;  1U5I A;  1IQ5 A;  2BBM A;  3GK2 A;  2C0X A;  2LP3 A;  5B66 H;  3V6I A;  2M5A B;  2JTZ A;  3KO0 A;  1J1D C;  1NTK D;  1NU1 G;  3L73 J;  2K9J A;  4IL1 A;  1HJB A;  1N65 A;  1RQU A;  2ZJS E;  1U7J A;  1A75 B;  3CDN A;  1BSH A;  4WY4 C;  4PAL A;  2MJZ A;  2A06 G;  3B6X A;  2LNK A;  1J2J B;  2ZVO B;  1EL4 A;  1CSB A;  2V4H A;  3BUW B;  1YQ4 C;  5CCH A;  1AV1 A;  2A45 G;  4GGF A;  1FOS E;  2F3Z A;  1YTZ C;  3BRV B;  4D6T E;  3C9I A;  1X9V A;  4ZKU A;  2FYU G;  2K7B A;  2JJL A;  3MGN A;  2JXL A;  2POH A;  1SL8 A;  1P84 E;  3CL3 D;  2KBM A;  4TLF A;  4WB4 A;  3S0D A;  1S72 P;  1L0N D;  1UHH A;  1B9A A;  3AE8 C;  5AW2 B;  2LCP A;  1Q82 Q;  1NOH A;  2E75 B;  4Y28 J;  4ORA B;  2VRG A;  1FBV A;  1MXL C;  1QVI Y;  3K1E A;  2OYH A;  1OWA A;  3P8C D;  1DF0 B;  5HL1 A;  3LIE A;  1HVV A;  4GOD A;  4PE7 A;  3HD7 D;  3H1H D;  5APX A;  5AW6 B;  3JVT B;  1IKU A;  1N7S D;  2M5A A;  1K04 A;  5BU5 A;  1PVA A;  5AW8 B;  1SL7 A;  3BJH A;  4UB6 H;  3RK3 B;  2LAN A;  1MQ1 A;  1A75 A;  1Z4H A;  2LAP A;  2Y4Q A;  1EQ7 A;  1M63 B;  5CSJ A;  1DEE G;  1JY2 O;  4ZNC A;  2O60 A;  5FYX A;  1LA3 A;  3SG7 A;  3SS5 A;  2QJK C;  2ZXE B;  4BRY B;  2KNE A;  1IFJ A;  2FBW C;  3MTU E;  4YRU A;  2H43 A;  4BXL A;  3KDP B;  1AHR A;  2K88 A;  1ZRT D;  1SQP J;  3GK1 A;  4PHN A;  3CXH H;  1PSB A;  3KPX A;  4PD4 H;  2OS8 B;  3M0D A;  2M3W A;  3CWB D;  1W9Z A;  4WY4 D;  2I7A A;  3OAK A;  3NXS A;  4HH2 A;  2LHI A;  3MHV A;  2KNC B;  3CXH D;  3H1K E;  3TDI A;  2LMU A;  4FQO A;  2J59 M;  4PD4 D;  1AFO A;  3JSV C;  3WHU B;  5APQ A;  1XFU O;  1W2B O;  3L70 G;  2WWW A;  3I5I C;  1G1I A;  3FWC A;  4I5K A;  4C7N A;  2M8U A;  4PHJ A;  3DD4 A;  3BQ3 A;  2Q9I A;  2MBX A;  5DJU B;  1DF0 A;  4KYN A;  3MD0 A;  2KLU A;  2QA4 P;  1AVS A;  4AQI A;  3VB1 A;  3BAS A;  4USL A;  4RO0 A;  1R2U A;  3L72 E;  1CMG A;  3D0Y B;  1L0L D;  2WSC H;  1OMD A;  1QV0 A;  1YRT B;  2KDH A;  3CZT X;  4EYY Q;  2HQ8 A;  3MP7 B;  2HG5 D;  1RH5 B;  5ER5 A;  1NAY A;  2KI4 B;  2M7L A;  3CCL P;  3BUM B;  2AMI A;  4KT0 J;  2VRS A;  2PGD A;  2EC6 B;  2PQL A;  1NCZ A;  1OOH A;  1UP5 A;  1OZO A;  2W83 C;  3H1I D;  1W5C E;  4BRY A;  1YUU A;  1JEK A;  1TNP A;  3AKA A;  4U3F G;  4CFR A;  1IH0 A;  1FZA A;  1OSA A;  1SCV A;  1QL1 A;  1QVG O;  2LVI A;  1LP1 B;  1NX1 A;  1WRL A;  1SYM A;  1TOP A;  1JY3 N;  1NTM G;  2QRX A;  2OAR A;  1NWQ A;  2F2O A;  2LVV A;  1JCD A;  4R1E A;  2QG4 A;  4OGQ C;  5KU1 A;  1A02 J;  3CZ2 A;  1SNL A;  2YKP A;  1CTR A;  5IBW A;  2QVA A;  1QV1 A;  1SQB E;  1XK4 C;  1BJF A;  2HOD B;  2IZ0 A;  2JTT A;  5AVT B;  2Q1K A;  3KZI E;  3L36 A;  5KKZ C;  1SSE B;  3OGN A;  4H13 C;  1SFC C;  3L75 D;  1SQX G;  2WC6 A;  3HTK A;  2R2I A;  3L74 D;  1L2O C;  2M49 B;  3H1K J;  4DZO A;  2YNY A;  4PV1 C;  3OJA B;  1ZUZ A;  1J1E C;  1S1E A;  2P2U A;  3LID A;  4MBE A;  2RGI A;  3D0Y A;  2ITA A;  4IFM A;  5AVX B;  1GJY A;  2D8N A;  1RF1 C;  1CM4 A;  3PM8 A;  5HKZ A;  1GU5 A;  1KB9 H;  1KOR A;  1WLZ A;  3L73 G;  1R5S A;  2NXQ A;  2SPZ A;  4JD9 A;  3RLZ A;  2RKL A;  1KIL C;  4OWF A;  3M0A A;  1ZME C;  2OTK E;  1LT1 A;  1QVF O;  1KB9 D;  1M56 D;  4HYT B;  2B88 A;  2K2F A;  3MIW A;  4WWI A;  3Q3D A;  3IQO A;  1T8Z A;  4RES B;  4HRE E;  2PYQ A;  1UUR A;  1WT6 A;  5AVY B;  1NAF A;  2B9B A;  5PAL A;  1LP1 A;  1LTB C;  1QX5 B;  1YHQ P;  3CYZ A;  2E74 B;  2KLD A;  1KC8 Q;  1DMO A;  3AE5 C;  2NZ0 A;  4MZK A;  5FI6 A;  2K61 A;  2IFN A;  1NTK E;  3VP8 A;  4NPF X;  3CLQ A;  1SQP K;  3CXH I;  1RE4 C;  4MN0 A;  4CPG A;  2L51 A;  4PD4 I;  3L71 D;  5B66 E;  2YMY A;  3LW5 H;  2LC5 A;  5APV A;  4MRX A;  4XJK B;  4I6M C;  1Y0V H;  1S26 D;  4I7Z C;  1V1G A;  1YTZ I;  1BU3 A;  2ZYG A;  5C39 A;  1H89 A;  2PSR A;  1YX8 A;  3DVM A;  2YXQ B;  2O01 H;  1F54 A;  1NKZ B;  1H88 A;  2FKW B;  1IFP A;  1LWU B;  1M1J B;  4H13 D;  1SFC D;  3VP9 A;  2I1J A;  5APS A;  3BAT A;  2ZKM X;  3NHI A;  3NGV A;  1L0N E;  3I5H B;  3AE1 C;  2ZNE A;  2P1J A;  1K90 D;  2ZFC A;  1C07 A;  4PV1 D;  4HSZ A;  3NSO A;  1X0T A;  1MZ9 A;  3AEC C;  3EK4 A;  4K3A A;  1DD3 A;  2R44 A;  3O4Y A;  1N73 A;  3PTZ A;  5HLV A;  1OFC X;  2E76 B;  2ZYA A;  3B8E B;  3CTN A;  4MN4 C;  1S5G Y;  1SCM B;  5J3X A;  1PGQ A;  3M9Q A;  1KYO D;  1B7T Z;  1KIL D;  3CCJ P;  3L4A A;  3RL0 B;  1ZLL A;  3DVE A;  3PRJ A;  1IGV A;  1ZXG A;  2QJY C;  2FYN C;  1QEX A;  3AAK A;  1XA5 A;  2NCP A;  1DJZ A;  4GOE A;  2QEX P;  4D6T G;  1SLQ A;  3SG6 A;  4XJK A;  5DKN A;  5I2L A;  2WCL A;  2L91 A;  3AEB C;  2GUV A;  2L98 A;  2XDJ A;  1IC2 A;  4UB6 E;  1NTK J;  3D71 A;  3DYE A;  3L47 A;  3I5F C;  1KQM B;  1M31 A;  2C9L Y;  1TIZ A;  1VQN P;  2F2P A;  1Y8A A;  2QSI A;  5DIC A;  2YIU C;  1LTA C;  1QLK A;  1BT6 A;  3KF9 A;  3DZT A;  1QJT A;  1KK7 Y;  1LWU A;  1M1J A;  2LM5 A;  1ALW A;  2JDI H;  1MUX A;  3RK2 C;  1SL9 A;  2KSE A;  3CXH E;  2WSS H;  3KHE A;  4PD4 E;  5CHX A;  4TNC A;  1KB9 I;  1TUJ A;  5DJT B;  1VF5 B;  2M97 A;  3BCC D;  1LJ2 A;  1FDO A;  2LUX A;  1RF0 C;  1DEL A;  4AQJ A;  5K89 A;  3L37 A;  2P6B B;  1FZC C;  1L0N J;  1GL2 C;  5KTY A;  5AW3 B;  4QJ3 B;  1CDM A;  2OYO A;  1USE A;  5KLV D;  4EI2 A;  3CCQ P;  1C3Z A;  1PGP A;  5AVW B;  1G4Y R;  3QME A;  2MA2 A;  2YO2 A;  1NVO A;  1SR6 B;  1RRO A;  3H25 A;  1WY9 A;  1GK4 A;  1L4A C;  1LT9 C;  1YUS A;  2JWA A;  1KCY A;  4INW A;  3PP5 A;  1IQ3 A;  1PL5 A;  1KD1 Q;  1S6J A;  4C0K A;  1LTJ C;  2HPC B;  1JFK A;  2C0W A;  5BVZ A;  3FIA A;  3LK0 A;  5CSF A;  1AK8 A;  1NYH A;  1TCO B;  2H89 C;  4DJG A;  1JO5 A;  1WDC B;  2KI6 C;  4U7J A;  1LNQ A;  1AJ4 A;  3AEA C;  2JUL A;  3Q5R A;  3L72 G;  3II6 A;  4BY5 A;  2SAS A;  2FCE A;  1HBW A;  2H61 C;  1BDD A;  2E5Y A;  1QS7 A;  2JRF A;  2R3C A;  1W7J B;  3L75 E;  1S9K E;  2NZ2 A;  5KJ7 C;  1L2P A;  4ZMD A;  3EVV A;  1KK8 B;  2KYV A;  1NTM E;  3TS5 B;  1AJY A;  3A3Y B;  4ORB B;  3RK2 D;  1KYO I;  4OKH A;  2KYF A;  2OTL P;  2GV5 A;  2QJP C;  5D69 A;  4JQ0 D;  4ETO A;  2Z5I A;  2NPS C;  4YXD C;  1C7W A;  1ZMZ A;  3PM2 A;  4PDZ A;  3SFD C;  3D74 A;  3IR9 A;  3AED C;  4H44 C;  1KB9 E;  1SQX E;  4DIR A;  1RHZ B;  1XTC C;  3CCU P;  2BEZ F;  1GL2 D;  1JY2 P;  1T2K C;  1K05 A;  2LKM A;  1FAV A;  2YMK A;  3AAJ A;  1AVY A;  3MSE B;  2IX7 C;  4YBH B;  1SQB G;  2KFG A;  2HPC A;  1EDL A;  3OW2 O;  3W68 A;  1LTG C;  1NTK K;  1KQF B;  1BGY D;  2OTG C;  2AEF A;  2B87 B;  5AW4 B;  2W6J H;  5HLO A;  1A2X A;  3FWN A;  3E3R A;  1L4A D;  4OZD A;  3PJI A;  2WQY C;  2LR2 A;  3D76 A;  4KHX A;  2OYI A;  3L71 E;  1GGW A;  1DT7 B;  1CMF A;  1BR1 B;  2HFE D;  3GF7 A;  4HB1 A;  2FJU B;  1N7S B;  2L2C A;  2K7O A;  3RL0 g;  1TRF A;  2KI6 D;  2L5Y A;  1UII A;  2RMZ A;  5CPV A;  2H7H A;  2N1T C;  1MHO A;  1DJI A;  4U3F J;  2BCC D;  2SCP A;  1KQL A;  1KFX S;  2R5B A;  4C7R A;  1M39 A;  1AUI B;  1KWO B;  1L0N K;  5TNC A;  1JFJ A;  2ZRT A;  2LP2 A;  1VQ7 P;  3P7K A;  1LIN A;  1CNP A;  3UIA A;  1NTM J;  1EZV D;  5KJ7 D;  3OA7 A;  1LXF C;  2L2E A;  1VQP P;  5D7F A;  1SS1 A;  3HUS C;  1SQQ D;  1QL2 A;  1NTK G;  1JY3 O;  3AE7 C;  1BE3 D;  1S2E A;  1GQM A;  4CFQ A;  3N7H A;  1UWO A;  3TZ1 A;  2CPB A;  2WIT A;  1G2C B;  2XKM A;  2NPS D;  3VN0 A;  1GK6 A;  1SQX J;  1M1K Q;  3C8V A;  1XFX O;  2B87 A;  4H44 D;  2L5X B;  1TN4 A;  1VQ9 P;  2NLN A;  1YYC A;  4P2Y B;  1T2K D;  3GHG C;  2F33 A;  4M3L A;  3HRN A;  3PHL A;  2L50 A;  2W8Z A;  4MVF A;  2JOJ A;  5EL2 A;  2WCH A;  1N7S A;  4PHM A;  1SQV D;  2R3S A;  2JPO A;  2HQW A;  1JOC A;  1KN7 A;  1JBA A;  4QJ4 B;  1FZE A;  1L0N G;  1TUZ A;  1USD A;  3IQQ A;  1F70 A;  4GGF C;  3CX5 D;  3WUU A;  1PP9 D;  2JR8 A;  2QM7 A;  2KIK A;  3EVR A;  3TDK A;  2KI7 B;  4DOJ A;  3A5T A;  3UNW A;  3K21 A;  2CCM A;  3LL8 B;  2FY8 A;  3LW5 J;  1VPC A;  1BF5 A;  4UPG A;  3PH0 A;  2F8P A;  2ZN8 A;  4N78 D;  2N1T D;  2C9N Y;  4ORC B;  4WY4 A;  3SSU A;  1IJ6 A;  2O01 J;  1J7O A;  1G2C A;  1VQM P;  2WND A;  1KZU B;  4C7N B;  1RTP 1;  3D77 A;  1T3U A;  2H2K A;  1QLE D;  1VQ5 P;  3G4S P;  2K3R A;  3V4W A;  1KQG B;  5KLV E;  2AEJ A;  3BXK A;  3B86 A;  5K5G B;  1QX2 A;  2F3Y A;  2JT3 A;  3AE3 C;  3CR2 A;  4L74 A;  1DX7 A;  5APT A;  3H1J E;  2WTY A;  2CTN A;  2KAY A;  2KFF A;  4RKU J;  4YXW H;  1VQK P;  2ERB A;  3FS7 A;  1N0Y A;  1AQ5 A;  4OR9 B;  3U1C A;  2Y0E A;  3TK1 A;  4R4L A;  1RE3 C;  3I5I B;  2IBZ I;  2KOT A;  1E8A A;  1K95 A;  3R1O A;  3VRR A;  1CW5 A;  2ISD A;  3FXE A;  1VQ6 P;  1FC2 C;  4JYB A;  1JUN A;  4MZJ A;  1CFF A;  2FFD B;  1GW3 A;  3QRX A;  3WU2 H;  1JF2 A;  4N5X A;  3SG3 A;  2L5G B;  3N7N A;  1OOI X;  1EZV I;  2E75 C;  4GDO A;  5AVR B;  3S4R A;  3I5G B;  4JF7 A;  3ZNI A;  1YIT P;  1NTM K;  3G71 P;  1FJK A;  4D6T J;  1UIX A;  3CLN A;  2OQQ A;  2LUC A;  1CDL A;  4O9B A;  3EG5 B;  2AAO A;  4JYC A;  3HTK B;  3EFF K;  2KHN A;  4P5O E;  4EDF A;  2Q3E A;  3EVU A;  2EHB A;  3H1I G;  5KAF H;  1DEK A;  3A7O A;  4HJG H;  1SBJ A;  3B71 A;  2HF5 A;  1KFX L;  1S6C A;  1URQ B;  2FCD A;  1SQX K;  1DQE A;  1G8I A;  1Q86 Q;  4NDD A;  1GMJ A;  3BUX B;  1PRW A;  2DW3 A;  5D3O A;  1JMM A;  2UWJ E;  4AQR D;  2MHH A;  1YBK A;  1NCY A;  4FQT A;  4YGE B;  5GTI H;  1FE6 A;  1VRK A;  2P58 A;  4H13 B;  1SFC B;  1JM0 A;  3PFV A;  3H1J J;  3A0B H;  1AA0 A;  2BCA A;  4H0L C;  4N3Y B;  3CX5 I;  3L75 G;  1OVV A;  2N9Y B;  3O78 A;  1NKN A;  1S5L H;  3A0H H;  1BGY E;  2FXM A;  2FFD A;  1J1E B;  3L74 G;  1DTL A;  2BEQ D;  2M7N A;  1Q7Y Q;  5GTH H;  1CLL A;  1QXP A;  1S36 A;  3P32 A;  3NMD A;  5TJH A;  3GLM A;  1IWQ A;  1NTZ E;  2Y0D A;  3CCE P;  2KAX A;  1YJN P;  4OVN F;  5AVV B;  1OMV A;  1YJ9 P;  1NSH A;  1GGZ A;  1Y1X A;  4JKT A;  5CSI A;  2IBZ E;  3I5C A;  2KGR A;  3F89 A;  3KHU A;  3JCU H;  3IVT A;  2ZXX A;  2WOR A;  4ICB A;  2E75 D;  1DJY A;  1CI6 B;  1URQ A;  1SPY A;  2BE6 A;  2KI4 C;  3D10 A;  2JKV A;  2WT7 B;  4NDB A;  2KAV A;  1OZH A;  2QM8 A;  5AVS B;  1QX7 A;  2BL0 C;  1EZV E;  1N8R Q;  1NGM B;  1S3J A;  1HGV A;  1WRZ A;  1IFD A;  3TNU B;  1XK4 A;  3AKB A;  3M91 A;  2CPS A;  1NP8 A;  3L72 J;  1KSM A;  1M46 A;  2KFH A;  5AXI A;  1BE3 E;  1SFC A;  3F5H A;  4MZL A;  1IFI A;  3Q5S A;  2YXR B;  3O6B A;  1C7V A;  3L71 G;  4I7Z B;  3H4S E;  2E5T A;  1SKT A;  1OOG A;  2I1K A;  1N73 B;  1NPQ A;  1J1E A;  3OP0 A;  2KB7 P;  1IO4 A;  3AEF C;  4BY4 A;  2ZVN B;  2WSF H;  2JQ6 A;  1MV8 A;  4M2Q A;  4KJM A;  3A2A A;  5EFW B;  2E6W A;  1MR8 A;  2Y1M A;  4XYN A;  1PIX A;  1YR5 A;  1M8O B;  4H0L D;  5JJG A;  3CD6 P;  4W7Y A;  1TCF A;  2BKI B;  2N9B A;  4GUK A;  4MSP A;  2D2C B;  5I2Q A;  3NTN A;  4W80 A;  2JNF A;  1NTZ J;  3B5N C;  3L73 D;  1E5W A;  1SQB J;  4GGN A;  2W27 A;  4OGQ D;  1CI6 A;  2WT7 A;  3CC4 P;  1MUU A;  4GIF A;  3EWK A;  2M3B A;  3TNU A;  4F0Z B;  1XYD A;  3SIA A;  4N78 E;  3NSK A;  4GOF A;  1BOC A;  2M1K B;  1A4P A;  1YUT A;  2JPT A;  2E74 C;  5CCG C;  5KLV K;  1KYO H;  1S1C X;  3E7K A;  3S0B A;  3B4S A;  1UHK A;  2LMV A;  1RQV A;  1EG4 A;  3P8C E;  1IRJ A;  5AW0 B;  2H88 C;  4WBA A;  1F71 A;  1T3J A;  3H1H E;  1IIO A;  1H8A A;  1D7M A;  1TU3 F;  1JNM A;  1DH3 A;  3CCR P;  4C0J A;  1DD4 A;  1TWO A;  2Q6Q A;  1VQO P;  2WSE H;  1OZS A;  1N2D C;  2Y0C A;  1QWV A;  4ZKP A;  1FDI A;  2HR3 A;  3WMM 0;  3B88 A;  2PP6 A;  1X79 B;  3U1A A;  1T6A A;  1BG1 A;  3V2N A;  5CJ4 A;  2HET A;  4C0L A;  1DGV A;  2AEM A;  2M3E A;  1M1J C;  2JZI A;  1GL2 B;  1XFV O;  1CLB A;  1ZRT E;  2YO3 A;  1ZOT B;  2LMT A;  4N1F A;  5CMZ A;  3CWB E;  1KFU S;  3U59 A;  5KLV G;  2MLE C;  3WU2 E;  4YGA A;  4M2P A;  2K9Y A;  1K96 A;  3B5N D;  1A02 F;  2E42 A;  1JY3 P;  2E76 C;  1SQP D;  1WRK A;  1SCM C;  1H0T B;  2I94 A;  1OMI A;  3H1J G;  1QIV A;  1P28 A;  4GT1 A;  1Y6W A;  2FYZ A;  1OVU A;  1NO4 A;  2R32 A;  1QTX A;  1FBM A;  3RL0 C;  1PVB A;  4D1E A;  3LLE A;  4IL6 H;  4GFT A;  2G2B A;  1BSN A;  5KLI B;  1L0L E;  2HPS A;  2JU0 A;  1ZR2 A;  3MUD A;  2Y9Z A;  1AJ5 A;  3B7A A;  4HRH A;  4CPV A;  5KAF E;  1LS8 A;  1P84 D;  1GDT A;  2Y1N A;  2E74 D;  5CCG D;  2AXC A;  1DJG A;  4L73 A;  1H4B A;  3LK1 A;  1K94 A;  1DIP A;  1KQM C;  1OVR A;  3H1H J;  2M1U A;  3FXD A;  4JWQ A;  3CI9 A;  5KTB A;  2BKH B;  2WCF A;  1WMK A;  3FE6 A;  4WQ3 A;  3H1I E;  3D78 A;  2JNX A;  1RF0 A;  1K9U A;  2BCB A;  5GTI E;  2P70 A;  1QVI Z;  3D75 A;  5I8N A;  1GL2 A;  1S5L X;  3EFG A;  1N86 A;  3A0B E;  2K7D A;  5GQQ C;  3O2P A;  4HKZ H;  1NTZ K;  1FI6 A;  3FWL A;  1BMO A;  3VOP A;  4DT0 A;  2Q5U A;  3CS1 A;  1S5L E;  2ZT9 C;  3DVK A;  4YI8 A;  1SQB K;  3A0H E;  2QJP B;  1VF5 C;  1QLS A;  5H2F H;  3G9R A;  2JEE A;  2Z4E A;  3HE5 B;  2LXC B;  4H44 B;  5GTH E;  1H0T A;  1OW4 A;  2OYI B;  3Q8I A;  1L4A A;  1R8E A;  1BOD A;  1FW4 A;  3CWB J;  1X02 A;  3L74 E;  1DEB A;  3BYA A;  3CPW O;  1LTJ A;  2JT8 A;  2WC8 A;  1D1O A;  4U8D A;  2KZI A;  4I5N B;  2QEV A;  1B8L A;  4ZCU A;  1PFI A;  1SR6 C;  3BFA A;  4I1L A;  3RZS A;  1QX8 A;  4JBZ A;  4R4M A;  2E76 D;  4PE0 A;  2KS1 B;  3JCU E;  2GA1 A;  1EXR A;  3CC2 P;  3CR5 X;  3H1K D;  1BGY G;  5AFP A;  1OW7 A;  3Q1M A;  3S0G A;  1PV3 A;  1PSR A;  2H61 A;  3JTD B;  1BDC A;  1VQL P;  2Q3I A;  3RL0 D;  1L0L J;  2K1A A;  4L76 A;  4LGD E;  1A29 A;  2LVJ A;  2LVK A;  4XE5 B;  1JF0 A;  3CMA P;  3TF5 A;  1NTZ G;  5KJ7 A;  1UUS A;  2M29 A;  2WSC J;  1WDC C;  2H8P D;  1K73 Q;  3DVJ A;  5DKR A;  1R5L A;  3V2P A;  2PMY A;  2N1T B;  3SIB A;  3PN7 C;  1CFC A;  1FS0 E;  2IBZ G;  4AYC A;  3H1I J;  2M0B A;  1B8R A;  4YI9 A;  2BE4 A;  1Q80 A;  3HE5 A;  2CXJ A;  2O1J A;  3CAB A;  1KFM A;  3V5B A;  3HD7 B;  3TS5 C;  1EZV G;  3HUS B;  3CCV P;  1C3Y A;  2BAS A;  3TUY B;  1CZQ A;  1V1F A;  3V2R A;  2QEH A;  4ASV A;  3S0E A;  1YRU B;  1LTS C;  4DCK A;  1OW8 A;  2ZT9 D;  2G9B A;  2WVR A;  2P7J A;  1MFT A;  3I55 P;  5AW9 B;  1BE3 G;  1VF5 D;  4Y99 C;  4WVZ A;  5BU8 B;  2JP3 A;  2MLF C;  2KBI A;  2J58 A;  1PZQ A;  1OOF A;  3LCP C;  2PVB A;  1EDK A;  3L75 J;  2KS1 A;  2MAZ A;  3TGU D;  3E1R A;  2WCJ A;  3L74 J;  1YQ3 C;  1EDJ A;  3OX6 A;  3ZWH A;  1M7L A;  3FGA D;  1FDM A;  2OTJ P;  3B87 A;  1KFU L;  1PGO A;  3CWG A;  2G8Y A;  3GHG B;  4A4B A;  1J1D B;  4MRY A;  2V53 A;  2G3A A;  1IK7 A;  1K9K A;  1PPJ D;  2ZND A;  2HYN A;  2E30 A;  1ZV8 A;  4WY4 B;  2NCO A;  1SQV G;  1B7T Y;  1NYA A;  2Q4U A;  2M8R A;  1EXJ A;  2N1T A;  3L4L A;  1F8H A;  3VGO A;  1KYO E;  3VYI A;  2LV7 A;  1GZL A;  1X22 A;  1KIL E;  3S1K A;  1YJW P;  1PP9 G;  4IJ7 A;  4PJ0 H;  3BUN B;  4RJT A;  3H1L D;  3VRP A;  3HD7 A; 
#chains in the Genus database with same CATH homology
 2JC2 A;  4QJ5 B;  1F54 A;  1A03 A;  2I2R E;  4NDD A;  3BUX B;  1PRW A;  1YVH A;  4DS7 A;  2LLS A;  2MHH A;  4PHK A;  1G33 A;  1NCY A;  4YGE B;  2KYC A;  1J7Q A;  1TNW A;  2ZKM X;  1VRK A;  3I5H B;  2ZNE A;  1K90 D;  3PN7 B;  3PFV A;  1C07 A;  3A8R A;  4HSZ A;  3NSO A;  1NCX A;  2OTG B;  2BCA A;  3EK4 A;  1DJW A;  2Q91 A;  3M0W A;  3O78 A;  1NIW A;  3O4Y A;  4DUQ A;  1NX0 A;  5HLV A;  1OFC X;  3IF7 A;  3CTN A;  1S5G Y;  1SCM B;  1DTL A;  2I18 A;  3GK4 X;  5J3X A;  1AP4 A;  1MWN A;  2M7N A;  1J1D A;  2COL B;  1EH2 A;  1B7T Z;  1MF8 B;  1ODB A;  3PLF B;  1CLL A;  1MXE A;  1PUL A;  1QXP A;  1S36 A;  1TNX A;  2Y5I A;  1IWQ A;  1CDP A;  2ZFD A;  2KAX A;  3BOW A;  3DVE A;  1IGV A;  4OVN F;  4JPZ B;  1OMV A;  3AAK A;  1XA5 A;  2NCP A;  1DJZ A;  1NSH A;  1CB1 A;  1GGZ A;  1Y1X A;  3VRO A;  4PE4 A;  2ZN9 A;  2L4H A;  2CT9 A;  5CSI A;  5I2O A;  1DJH A;  5JOL A;  3SG6 A;  2KGB C;  4XJK A;  5DKN A;  5I2L A;  4MLW A;  2L98 A;  3OB1 B;  2KGR A;  1FF1 A;  2WOR A;  4ICB A;  3I5F C;  1KQM B;  1M31 A;  1DJY A;  5AER A;  1TIZ A;  2F2P A;  1SPY A;  1TNQ A;  2BE6 A;  1KK8 C;  2KI4 C;  1RWY A;  2M0R A;  3D10 A;  5KSZ A;  1PAL A;  1YX7 A;  4NDB A;  1QLK A;  1BT6 A;  2KAV A;  4M2O A;  1B1G A;  1QX7 A;  2BL0 C;  3KF9 A;  1QJT A;  5G08 A;  1KK7 Y;  2A4J A;  1WRZ A;  2LM5 A;  4I5L B;  1R6P A;  3DVM A;  1CM1 A;  1ALW A;  2AUC A;  1SW8 A;  1MUX A;  1XK4 A;  3AKB A;  5AEQ A;  4OV2 A;  1NP8 A;  1SL9 A;  1KSM A;  1CKK A;  1M46 A;  2KFH A;  5AXI A;  1Y1A A;  1XFW O;  2BEC A;  3KHE A;  4GBA A;  1XFY O;  1S5G Z;  4MZL A;  1B4C A;  4TNC A;  1RJV A;  2LLT A;  1U5I B;  3JTD C;  4ZCV A;  2B1U A;  3O6B A;  1C7V A;  1OQP A;  1SK6 D;  3H4S E;  1SKT A;  2KSP A;  2M97 A;  1BLQ A;  2LUX A;  1NPQ A;  1J1E A;  3OP0 A;  4E68 A;  4AQJ A;  5K89 A;  2P6B B;  3FWB A;  5B8I B;  2EGD A;  4PE1 A;  5HKW A;  5KTY A;  4QJ3 B;  1CDM A;  4BY4 A;  2JQ6 A;  2OPO A;  1RFJ A;  3ICB A;  4M2Q A;  1LA0 A;  4DRW A;  2E6W A;  1MR8 A;  2Y1M A;  1YUR A;  4XYN A;  1L7Z A;  1YR5 A;  1G4Y R;  2L4I A;  2MA2 A;  5JJG A;  3SG5 A;  2PAL A;  1SR6 B;  1TCF A;  2BKI B;  4GUK A;  4MSP A;  4N1G A;  1RRO A;  5HYD A;  1BR4 B;  1NX3 A;  3JVT C;  5I2Q A;  1M45 A;  2JNF A;  1JC2 A;  1WY9 A;  1YUS A;  4Q04 A;  2CNP A;  1KCY A;  1IJ5 A;  2MJW B;  1XFZ O;  4GAO A;  4GGN A;  3TUY C;  1IG5 A;  1IQ3 A;  1KK7 Z;  1S6J A;  1XO5 A;  4WRI A;  4C0K A;  1JFK A;  4YGD B;  3FIA A;  3LK0 A;  5CSF A;  4YGB B;  1AK8 A;  2WCE A;  1TCO B;  3A4U B;  1H8B A;  1WDC B;  2WOS A;  2KI6 C;  4F0Z B;  1XYD A;  1ZAC A;  2KQ6 A;  2GGM A;  3SIA A;  1AJ4 A;  2JUL A;  1KWO C;  3NSK A;  3OB2 B;  1BOC A;  2Y9Y A;  4BY5 A;  2M1K B;  1B47 A;  2SAS A;  2FCE A;  1A4P A;  1U5I A;  1IQ5 A;  2BBM A;  2FOT A;  1YUT A;  2H61 C;  2JPT A;  2LP3 A;  2PRU A;  3GK2 A;  3HCM A;  2JTZ A;  1QS7 A;  3KO0 A;  1L2O B;  2JRF A;  2OS8 C;  1W7J B;  5CSN A;  3SJS A;  1UHK A;  2LMV A;  4IL1 A;  1EG4 A;  1IRJ A;  1N65 A;  3I5G C;  1JUO A;  3EVV A;  1KK8 B;  1A75 B;  1F71 A;  3TS5 B;  4PAL A;  2BL0 B;  4ORB B;  2JT0 A;  4OKH A;  3F45 A;  1W7I B;  2TN4 A;  2KYF A;  2LNK A;  3NSL A;  1F4Q A;  2GV5 A;  1EL4 A;  3PSR A;  2IS9 A;  1DVI A;  4FTG A;  4JQ0 D;  5D69 A;  4C0J A;  4ETO A;  1KQV A;  3BUW B;  1OZS A;  1K8U A;  4GGF A;  1C7W A;  4OCI A;  1ZMZ A;  2F3Z A;  4PDZ A;  3WXA A;  1YTZ C;  1K2H A;  2BBN A;  2BCX A;  2K7B A;  4DIR A;  1BG1 A;  2JXL A;  2HET A;  4C0L A;  1SL8 A;  3AAJ A;  2KBM A;  1DGV A;  3MSE B;  4YBH B;  1UHH A;  1B9A A;  2JZI A;  2KFG A;  1DJX A;  1JWD A;  2LCP A;  1XFV O;  1CLB A;  1CFP A;  4ORA B;  2VRG A;  1FBV A;  1ZOT B;  2LMT A;  1JSA A;  4N1F A;  2EC6 C;  4NDC A;  2CBL A;  1MXL C;  1QAT A;  2OTG C;  1QVI Y;  5BPJ A;  3TDU A;  1KFU S;  1DF0 B;  1EG3 A;  2MLE C;  5HLO A;  1A2X A;  2MRD A;  3CR4 X;  4YGA A;  4CLN A;  4M2P A;  1WLM A;  1K96 A;  4PE7 A;  3E3R A;  4CID A;  3OHM B;  1HQV A;  1WRK A;  3JVT B;  1SCM C;  1IKU A;  2I94 A;  1OMR A;  1QIV A;  1PVA A;  1GGW A;  1Y6W A;  1SL7 A;  2PAS A;  1DT7 B;  1CMF A;  1BR1 B;  1YVL A;  1LKJ A;  2LLU A;  2FJU B;  1QTX A;  3CGA A;  3KEV A;  1PVB A;  2LAN A;  1MQ1 A;  1A75 A;  2PSR A;  2LAP A;  2Y4Q A;  2K7O A;  4D1E A;  3NSI A;  1M63 B;  1TRF A;  3LLE A;  2KI6 D;  4GFT A;  2G2B A;  5CSJ A;  1SMG A;  1KSO A;  5CPV A;  2HPS A;  3BUO B;  2O60 A;  2JU0 A;  1QIW A;  2Y9Z A;  1AJ5 A;  1MHO A;  1DJI A;  1LA3 A;  3C1V A;  4HRH A;  5FYX A;  3SG7 A;  4CPV A;  2SCP A;  1KFX S;  4HRG A;  2KNE A;  2Y1N A;  1M39 A;  5ER4 X;  2K0J A;  1AUI B;  1DJG A;  1KWO B;  5TNC A;  4YRU A;  2ZRT A;  2LP2 A;  1JFJ A;  1H4B A;  1OE9 B;  1LIN A;  3LK1 A;  1K94 A;  1AHR A;  1CNP A;  1KQM C;  1DGU A;  3GK1 A;  4PHN A;  2M1U A;  3DF0 B;  1LXF C;  2L2E A;  1PSB A;  4JWQ A;  3KPX A;  5D7F A;  2OS8 B;  2BKH B;  2WCF A;  2M3W A;  4WQ3 A;  2I7A A;  2JNX A;  1K9U A;  3EKH A;  4L9M A;  2BCB A;  2LHI A;  1UHN A;  5I8N A;  1QVI Z;  1HT9 A;  2LMU A;  3TDI A;  4FQO A;  3WNX B;  1GQM A;  4CFQ A;  3WHU B;  1UWO A;  3TZ1 A;  2K7D A;  5GQQ C;  1SRA A;  1XFU O;  3O2P A;  3VRN A;  1NWD A;  3I5I C;  1FI6 A;  3FWC A;  1BMO A;  4I5K A;  2M8U A;  3CS1 A;  3DVK A;  4PHJ A;  3DD4 A;  1XFX O;  3BQ3 A;  4YI8 A;  2MBX A;  4AOM A;  1DF0 A;  3NXA A;  1AVS A;  4AQI A;  5F6T A;  1QLS A;  2L5X B;  1TN4 A;  2DOQ A;  3OX5 A;  2NLN A;  4USL A;  3RM1 A;  1R2U A;  4P2Y B;  3VRQ A;  1CMG A;  3D0Y B;  1OMD A;  1QV0 A;  1YRT B;  2KDH A;  5DKQ A;  3CZT X;  2F33 A;  2HQ8 A;  1BOD A;  1FW4 A;  2L50 A;  3I5F B;  2JOJ A;  4MVF A;  1CLM A;  1X02 A;  4PHM A;  5ER5 A;  2K7C A;  3BYA A;  2KI4 B;  2M7L A;  2JT8 A;  2HQW A;  2WC8 A;  3BUM B;  1D1O A;  2AMI A;  4U8D A;  3SG2 A;  1ZFS A;  4QJ4 B;  1JBA A;  2GGZ A;  3EKJ A;  4I5N B;  1B8L A;  3IQQ A;  4ZCU A;  1F70 A;  2LHL A;  1SR6 C;  2EC6 B;  4GGF C;  2K8M B;  1NCZ A;  1UP5 A;  1OZO A;  1ALV A;  4GPL B;  4PE0 A;  1YUU A;  1TNP A;  1EXR A;  3AKA A;  4CFR A;  3CR5 X;  1IH0 A;  1OSA A;  1RK9 A;  1SCV A;  2QAC A;  3EVR A;  5AFP A;  1TTX A;  2K2A A;  4GNK B;  1CFD A;  2LVI A;  1NX1 A;  1WRL A;  2CCM A;  1SYM A;  1TOP A;  3K21 A;  1PSR A;  2H61 A;  3LL8 B;  3JTD B;  3DF0 A;  1BF5 A;  4A4C A;  1OOJ A;  1A29 A;  2F2O A;  2LVJ A;  1EJ3 A;  2LVV A;  2LVK A;  4R1E A;  3TDZ A;  1JF0 A;  4UPG A;  1B8C A;  5KU1 A;  1K93 D;  2F8P A;  2ZN8 A;  1SNL A;  2QPT A;  1CTR A;  1UUS A;  2M29 A;  5AAN A;  1F4O A;  1WDC C;  5IBW A;  1QV1 A;  4ORC B;  1XK4 C;  1BJF A;  3DVJ A;  5DKR A;  1IJ6 A;  4MEW A;  2JTT A;  1J7O A;  3WHT B;  2PMY A;  2WND A;  3I5H C;  3SIB A;  3PN7 C;  1CFC A;  1RTP 1;  1NX2 A;  2H2K A;  2R2I A;  3PAT A;  1B8R A;  3BXK A;  1L2O C;  4YI9 A;  2M49 B;  1N2D A;  3EK7 A;  2BE4 A;  1QX2 A;  1S6I A;  1Q80 A;  1ZUZ A;  1LVC D;  1S1E A;  2F3Y A;  2JT3 A;  2ZRS A;  1PK0 D;  2CXJ A;  3CR2 A;  4I5J A;  2RGI A;  4MBE A;  3D0Y A;  1SY9 A;  1GJY A;  2D8N A;  4PCW A;  1CM4 A;  3PM8 A;  3TS5 C;  2CTN A;  5HKZ A;  2KAY A;  2KFF A;  1WLZ A;  3TUY B;  1S3P A;  1V1F A;  2NXQ A;  3RLZ A;  1YRU B;  1N0Y A;  3FS7 A;  4DCK A;  4OR9 B;  2G9B A;  3I5I B;  2MLF C;  2KBI A;  2K2F A;  2KOT A;  1E8A A;  1K95 A;  3LCP C;  3VRR A;  2PVB A;  2JWW A;  3IQO A;  2MAZ A;  2ISD A;  1J7R A;  4HRE E;  1J55 A;  1UUR A;  2JXC A;  1QAS A;  3OX6 A;  4MZJ A;  3ZWH A;  1CFF A;  1J7P A;  2WCB A;  3SG4 A;  5PAL A;  3QRX A;  1QX5 B;  1F55 A;  1JF2 A;  4N5X A;  1KFU L;  3CWG A;  3SG3 A;  4A4B A;  1DMO A;  4WQ2 A;  1FI5 A;  4MRY A;  2O5G A;  2KQY A;  2V53 A;  1CDN A;  2NZ0 A;  4MZK A;  3I5G B;  2LE9 B;  2K61 A;  3HX4 A;  3BOW B;  3ZNI A;  1FPW A;  1K9K A;  2ZND A;  2E30 A;  2NCO A;  1REC A;  3GOF A;  1B7T Y;  1NYA A;  2Q4U A;  3CLN A;  4MN0 A;  4YGC B;  2L51 A;  2LUC A;  1F8H A;  1CDL A;  3VGO A;  3PAL A;  4NQG A;  2LC5 A;  4MRX A;  4XJK B;  2LV7 A;  2AAO A;  1Y0V H;  1S26 D;  2KHN A;  4P5O E;  1UHI A;  1Y1U A;  1V1G A;  1XVJ A;  2EHB A;  3EVU A;  5HKY A;  3EK8 A;  2M9G A;  1BU3 A;  3VRP A;  1K9P A;  1SBJ A;  3BUN B;  2HF5 A;  1KFX L;  1S6C A;  1NUB A;  1UHJ A;  2FCD A;  1YX8 A;  1G8I A;  2L0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...