4JPZB

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
EPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Fibroblast growth factor 13
publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 142
sequence length 142
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jpzB01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jpzB02
2E30A 3PALA 2KYCA 1NPQA 1A4PA 1JFKA 2WNDA 3EK7A 5HKZA 2H61A 2OPOA 2ISDA 2JT8A 3HX4A 1JF0A 2HPSA 2HQWA 4L9MA 1NCZA 4QJ4B 1DGVA 2GGZA 3EKHA 3PN7C 3PLFB 5B8IB 1HQVA 5HKWA 5F6TA 3KEVA 1BODA 2KQ6A 3KF9A 3NSKA 1TNQA 5IBWA 1QVIZ 2KSPA 3I5GC 1F8HA 2EHBA 3EVRA 1M39A 2P6BB 3CS1A 2K7BA 1IJ6A 1OE9B 2CCMA 3I5GB 3TS5C 1NYAA 4MVFA 1KFUL 1UHKA 2LNKA 1J55A 4D1EA 1XK4C 3EVUA 1BLQA 2EGDA 3C1VA 1SK6D 1TRFA 1KQMC 3D10A 5KTYA 2K7CA 3BUXB 1WDCC 3CLNA 5DKRA 2WORA 1G33A 5CSIA 2CXJA 4PCWA 4HRGA 3GK4X 1KQMB 4F0ZB 5KSZA 1QVIY 1XK4A 1DF0A 2COLB 1WDCB 2Y4QA 2I94A 1JBAA 1F54A 1CLMA 2LAPA 1KK8B 3IQOA 1RECA 1Q80A 1SY9A 1H8BA 2E6WA 4MZKA 5CSFA 3NXAA 2F2OA 4DIRA 3EVVA 1UHNA 1DVIA 4ETOA 1JWDA 3PSRA 2L4IA 2FCDA 1CDLA 2HETA 2MLEC 1AUIB 1PVAA 3CR5X 1BG1A 1B4CA 1F4QA 1FBVA 1IG5A 1RTP1 1ZMZA 2LVVA 1OZOA 1UURA 2JZIA 3JTDC 1KFXS 2G2BA 3A4UB 4WQ3A 1CMGA 1TCOB 4MZJA 1CNPA 2D8NA 2ZN9A 3NSOA 4QJ3B 4BY4A 3OB1B 5J3XA 1SR6C 1K90D 2JULA 4NDDA 3JTDB 3OX5A 4GGFA 5JJGA 4GBAA 2F2PA 1BOCA 1AJ4A 3O78A 4BY5A 1SR6B 1B1GA 4GPLB 3O2PA 4A4CA 3SIAA 3LK0A 2KHNA 2JT0A 2Y1MA 2M3WA 1B7TY 2K0JA 1PK0D 5CSNA 2G9BA 2JTTA 2WCBA 2JQ6A 2I7AA 2JOJA 1PVBA 3EKJA 1X02A 2LMVA 4WRIA 2NZ0A 2KBIA 1MUXA 2F33A 1M45A 2TN4A 4N1GA 2JC2A 1YUTA 3AKAA 2QPTA 1IRJA 1OMVA 4TNCA 1NIWA 2CTNA 4I5JA 2FOTA 1DJIA 2JXLA 1DJWA 4YGBB 1MQ1A 1XO5A 2M97A 3BUOB 4NDBA 1C7WA 1QS7A 1WRLA 1CLLA 1ODBA 3I5FC 2A4JA 4M2QA 4YI9A 4ZCUA 3ZWHA 3D0YA 1NCXA 1S5GY 4MSPA 2LLSA 3I5FB 2KGBC 2L51A 3CR2A 1OZSA 1RJVA 1AJ5A 5I2LA 2OS8B 2KQYA 3GK1A 4E68A 1QXPA 2K8MB 1SL7A 4UPGA 4GGNA 1SNLA 1J7OA 2LVJA 1R6PA 2WCFA 1Y1AA 1TNXA 4OR9B 2F3YA 2LM5A 1CB1A 4MEWA 3DVEA 4A4BA 2LHIA 4N1FA 1WLMA 1Y6WA 4MRXA 1CFCA 1H4BA 1XA5A 4P2YB 1UHIA 1MXEA 1NX3A 2L5XB 2EC6C 3LK1A 2H61C 1EXRA 1PSBA 1LVCD 2SASA 2ZRSA 3KHEA 3LL8B 2AMIA 2Q91A 2NCPA 1SRAA 1M31A 1YURA 5GQQC 3I5IC 2L4HA 1XFYO 4R1EA 1N65A 1K8UA 2M29A 2M8UA 1MF8B 3BUWB 1K94A 2LC5A 1XFZO 1CDPA 3OX6A 4NDCA 2PVBA 3TDUA 5AFPA 1GGZA 1QIVA 1DMOA 1YVHA 2LE9B 2B1UA 3SG6A 3IF7A 4YGDB 1M46A 1OMRA 1QASA 1SL9A 1CDNA 5CSJA 1AHRA 1S1EA 5ER5A 3FWBA 2LP2A 2NLNA 2KI4C 3QRXA 4C0KA 4ICBA 5FYXA 1CDMA 1KFUS 1SCMC 3KPXA 1ZFSA 3PN7B 2Y9ZA 3OHMB 2LV7A 2LUXA 2MRDA 1WLZA 2KI4B 2OTGC 3TZ1A 1SCMB 1LA3A 1NP8A 1TNPA 2L0PA 2M7LA 1IH0A 1DJZA 1XYDA 1KK7Z 2OTGB 1F71A 5PALA 2KOTA 3NSLA 3TS5B 2KDHA 2BECA 5AANA 1DTLA 2M7NA 3OP0A 3ICBA 2KYFA 2Y1NA 2M9GA 1QLSA 5D69A 2MBXA 1DF0B 2ZNDA 5HKYA 2LLTA 2KFGA 1R2UA 4I5LB 1M63B 1RK9A 1FW4A 2BKIB 4C0JA 1CMFA 1NX2A 4AQJA 4DRWA 4PHJA 2K2AA 1GGWA 2BKHB 1U5IA 3PFVA 1KK7Y 1QIWA 1TTXA 2BBMA 2RGIA 3FIAA 2JXCA 4IL1A 4JWQA 1QLKA 1IGVA 2JNXA 2LCPA 5AXIA 1G8IA 1EG4A 3E3RA 4CFQA 3TDZA 1B7TZ 2MJWB 5DKNA 1HT9A 1B8RA 1PULA 1CM4A 2KGRA 4GGFC 2FCEA 2LUCA 3AAJA 1V1FA 2O5GA 2WOSA 4P5OE 2K7DA 2DOQA 1GJYA 3DF0A 1S6IA 2KBMA 3BUMB 4HRHA 3BYAA 2LLUA 4ORCB 3WHTB 4DUQA 3JVTC 1YRUB 1CM1A 2LMTA 3SG5A 1KSMA 1OMDA 4OV2A 2CT9A 1K93D 1QX5B 3TUYC 1D1OA 1S5GZ 3JVTB 2FJUB 3PATA 1WY9A 4USLA 3SG2A 2JU0A 4OKHA 2JTZA 4YI8A 3CZTX 2BE6A 2MAZA 1LA0A 3TDIA 2ZNEA 1FPWA 2GV5A 1JC2A 4JPZB 2M1UA 1K96A 3RM1A 5CPVA 3CTNA 2M1KB 1YUUA 1PALA 1QX2A 1ZOTB 4GNKB 3D0YB 2LANA 2R2IA 5KU1A 3VRQA 3I5HC 2PALA 2PASA 3DVMA 4U8DA 1YVLA 2SCPA 4YRUA 4MBEA 1DT7B 1ZUZA 4PALA 3I5HB 1N0YA 1TNWA 3OB2B 3DVKA 4CIDA 1AVSA 4HREE 1QV1A 5BPJA 4ZCVA 3BOWA 1MR8A 1NX0A 4DS7A 2LVKA 2KNEA 1XFWO 2V53A 3VGOA 3O4YA 4M2PA 1B9AA 3SIBA 1DJGA 4GUKA 3MSEB 1BJFA 4NQGA 1E8AA 1N2DA 3AKBA 1OSAA 1OOJA 2L50A 2L2EA 2ZRTA 1DJYA 1EG3A 1YX7A 1F70A 1W7IB 4HSZA 1IQ5A 1A2XA 3K21A 1EH2A 3PM8A 4OCIA 2BCXA 1A03A 3M0WA 4YGAA 2EC6B 3WXAA 2BCAA 2M0RA 2KFHA 1J1EA 2QACA 3EK8A 3O6BA 3AAKA 2M49B 1BU3A 1K9UA 1SCVA 1QATA 2AAOA 3EK4A 1RWYA 1UHHA 2K61A 2KFFA 2Q4UA 1ALWA 2LHLA 2ZKMX 1NSHA 3I5IB 2F8PA 3WHUB 1FI5A 3GK2A 2HF5A 3BUNB 3HCMA 1IWQA 1JF2A 5HLVA 1CFFA 1K9KA 3FWCA 2I2RE 1UUSA 4FTGA 1SKTA 1MHOA 1UWOA 1W7JB 4AQIA 4MN0A 1JSAA 1C7VA 3IQQA 1BF5A 2K7OA 5D7FA 1S36A 4FQOA 1QJTA 1NCYA 1RFJA 1V1GA 2LVIA 2ZFDA 4QJ5B 2BCBA 3VRRA 3KO0A 2NCOA 1BMOA 2LMUA 2PRUA 3DVJA 1VRKA 4MRYA 4GFTA 1RROA 1WRZA 2L98A 2CNPA 4MZLA 3WNXB 1JFJA 1NWDA 1PRWA 3SG4A 1KQVA 1TCFA 4ORBB 2ZN8A 1BR4B 1F4OA 4PHKA 1S3PA 1XFXO 4GAOA 1JUOA 1J7RA 1QTXA 1U5IB 1KWOC 1K9PA 1BR1B 1SYMA 2JT3A 4PHMA 5HYDA 1MWNA 3SG7A 1XVJA 1S6CA 1YTZC 2PSRA 3RLZA 1FF1A 2HQ8A 1KWOB 1C07A 4JQ0D 3CR4X 1QX7A 2K2FA 2F3ZA 2LP3A 1FI6A 1UHJA 1S6JA 4XYNA 1KK8C 3DF0B 2Y9YA 1SPYA 5TNCA 1J7PA 2I18A 3LCPC 2VRGA 1A75B 1F55A 2H2KA 1AP4A 4PE4A 1A75A 4I5NB 1SW8A 4XJKB 1IQ3A 4N5XA 3CWGA 1CLBA 2WC8A 3VROA 4XJKA 5DKQA 4ORAB 1GQMA 2KI6D 4CFRA 1CKKA 3BXKA 2NXQA 3CGAA 1YUSA 1L2OC 4I5KA 1NX1A 1Y0VH 4YGCB 3VRPA 1WRKA 1ZACA 3TUYB 2CBLA 2JNFA 1XFVO 2JRFA 1EL4A 3A8RA 1L2OB 1L7ZA 4OVNF 1UP5A 2KAYA 1Y1UA 4Q04A 1KFXL 2BE4A 2KI6C 1Y1XA 1CTRA 4PE1A 4DCKA 1DJHA 1B47A 1B8LA 1DGUA 1QV0A 1SMGA 1KCYA 4CLNA 5I2QA 1YR5A 3BQ3A 1IJ5A 1PSRA 2MA2A 1A29A 3BOWB 1J7QA 1LXFC 1KSOA 4PE7A 2KAXA 1CFDA 5JOLA 2Y5IA 1ALVA 4PE0A 2BBNA 4MLWA 1S26D 5AERA 5AEQA 4YBHB 3H4SE 1J1DA 2JWWA 4WQ2A 5G08A 1LKJA 1DJXA 3SJSA 1TIZA 3GOFA 2OS8C 1YRTB 1K95A 3NSIA 1OFCX 2IS9A 4M2OA 1XFUO 2O60A 2JPTA 4PDZA 4CPVA 2GGMA 1AK8A 1SL8A 2PMYA 2KAVA 3VRNA 4PHNA 3LLEA 1SBJA 2MLFC 2AUCA 5I8NA 4AOMA 1BT6A 4YGEB 3DD4A 1B8CA 1TOPA 1LINA 5HLOA 2WCEA 1OQPA 5K89A 5ER4X 2BL0C 3SG3A 1TN4A 1G4YR 1NUBA 4C0LA 1CFPA 1EJ3A 3ZNIA 3F45A 3FS7A 1YX8A 5I2OA 2BL0B 1IKUA 1K2HA 2MHHA 1MXLC
chains in the Genus database with same CATH superfamily
1QVFO 2KYCA 1T3UA 2OPOA 1SQBD 3H1LG 1JF0A 4L9MA 1RF0A 3FE8A 1MV8A 3U1AA 5B8IB 2AXCA 5IBWA 3I5GC 2P6BB 3H6PA 2AEFA 3FE9A 4WY4D 3G4SP 4WWIA 5TJHA 5CJ4A 2XU6A 4MVFA 1KFUL 2LNKA 1J55A 1RF1B 3EVUA 4QMAA 5CCGA 3CX5E 1RF1A 3BUXB 5GTHH 3CLNA 4AQRD 5CSIA 4HRGA 2D2CB 2W6JH 5KSZA 1UIIA 5KLVK 1KQGB 3H1LJ 2LAPA 1SY9A 2IPPA 2PFXA 2WPVB 1QWVA 1SQVE 2PAJA 2L4IA 2ZAEB 2QJPC 2HETA 2MLEC 1BG1A 1IG5A 1OZOA 1EDIA 1UURA 3U59A 2FKWB 1SQBG 3KDPB 4KHXA 1RE3A 1CMGA 1CNPA 1GD2E 2JULA 4NDDA 3OX5A 3CCQP 1NVOA 4GGFA 3RBXA 4GBAA 2F2PA 3AEAC 1AJ4A 1IFJA 1SR6B 1B1GA 2KLDA 4A4CA 3LK0A 2KHNA 1HBWA 1NTMD 2K0JA 4NPEA 5CSNA 2J59M 3B5ND 2JOJA 1NJIQ 2LMVA 3BASA 2KBIA 1IC2A 1M45A 2TN4A 2JC2A 3AKAA 4TNCA 1M1KQ 3PTZA 1KILC 1WRGA 1EC5A 2YGUA 1DJIA 5GTHE 1J1DB 1DJWA 1LGHB 4YGBB 5AW2B 1XO5A 2M97A 1VF5B 1WRLA 1ODBA 3I5FC 5GTIE 2A4JA 2WT7A 1FOSE 1HVVA 5D3OA 1SQBJ 3WU2E 2LLSA 2KGBC 2L51A 2HPCB 1VQLP 3GK1A 1QXPA 1TNXA 1GL2B 2LM5A 4EIJA 1H4BA 1GL2A 1CFCA 2IDBA 2E75C 3SWYA 4Y99B 2L5XB 2B87B 2MJZA 1LP1A 1JO5A 3LK1A 1EXRA 1PSBA 1LVCD 2ZRSA 1GTWA 3DXLA 2OYIB 3H1HE 3RL0D 1OW4A 1JY3N 1N65A 2W6AA 1OOGA 1K94A 1FC2C 2QA4P 1P84H 1XFZO 5CCGD 3SS4A 5EFWB 1KQFB 2PVBA 5AFPA 1BGYE 1NTMG 1QIVA 1WMKA 2IBZG 1J2JB 3TGUE 1YVHA 1FZBA 3IF7A 1QASA 2JPOA 2WPRA 1CDNA 1L0ND 2ZXXA 1AHRA 1DEEG 1ZR2A 2NLNA 5KKZC 5AVVB 2D2CD 1KFUS 2Y9ZA 1VQOP 2LV7A 3S0DA 2IFMA 1JY2O 3HE4A 1D7MA 1N73B 2M7LA 2L0PA 4L73A 1DJZA 3CZ2A 1NTZD 1G1IA 2OTGB 3PH0A 2KOTA 1EZVI 3GMAA 1H0TA 1JUNA 3CWBG 5M1BA 3CABA 1QLSA 5HKYA 1GZLA 1DF0B 2Q3IA 3ABVC 5APXA 3RK2D 2KFGA 5KJ7A 1RK9A 1NTMJ 2E74B 5KLIC 3PJSK 1U5IA 2ERBA 2YXRB 3L71D 3FIAA 2JXCA 1QLKA 1IGVA 2LCPA 5AXIA 4H13B 3E3RA 1IJDB 5DKNA 3SS3A 1W5CE 2LUCA 3AAJA 1V1FA 2O5GA 3DF0A 2DW3A 5AVUB 2PQLA 2P7JA 2YNYA 1L0LK 3D78A 1BE3D 3WHTB 3CWBJ 1EZVE 4OV2A 1D1OA 3TUYC 3KPEA 3MGNA 4USLA 1S9KD 1EQ7A 3SG2A 4N6JA 1NTZG 2NZ2A 2BE6A 1LA0A 2QEHA 5AVTB 2CPBA 4OH8B 1GL2D 2M1KB 1YUUA 3CPWO 1PPJE 2JEEA 2K3RA 1PALA 1LWUC 5KU1A 3I5HC 2N1TC 2PALA 2PASA 3DVMA 3S0AA 4ASVA 3S0GA 3N7NA 3RK3C 1M90Q 4PALA 3HE5B 4YTPC 1IFPA 3IFMA 3DVKA 3L71G 1SQQE 1AVSA 1SQXD 2KOGA 1KD1Q 1P28A 3QWOC 2LVKA 3VGOA 1ZMEC 3SIBA 4M2PA 4GUKA 4BRYA 3MSEB 4NQGA 3VP9A 1OSAA 2L2EA 4IJ7A 1W2EA 2ZRTA 1DJYA 2L5GB 1SSEB 1NTZJ 1F70A 1W7IB 3MTUE 4CPGA 1A2XA 2ZFCA 2BCAA 2KFHA 3EQ2A 1U57A 2WPQA 2LXBA 5KLVG 1QATA 3EK4A 4C7RA 1RWYA 1UHHA 2Q4UA 5BU8B 2LHLA 2WSSH 3GK2A 3IAOA 1JF2A 1Z56A 5KAIE 1CFFA 1IK7A 1U7MA 3FWCA 4L75A 3H1ID 3L71J 5KJ7D 3VP8A 1DELA 3L4AA 2OTKE 1UWOA 1LJ2A 3C1LA 3WUTA 2LXCB 2E74D 1JSAA 1YQ3C 3JCUH 5D7FA 1ZXGA 2XKMA 4AUWA 1N7SB 1CI6A 5APTA 2NCOA 3EFGA 1BMOA 1N7SA 4MRYA 4W7ZA 5CBNA 1OOFA 5KLVJ 4PHKA 1BR4B 3CMAP 1RQUA 1XFXO 5E79H 2E5YA 1AV1A 1KFNA 2JT3A 2KZIA 5TISE 1XVJA 3JSVC 4EOTA 1S6CA 3L70G 2F3ZA 2LP3A 1ZW0A 4RO0A 2Y9YA 1YJ9P 5APQA 3OW2O 2JDIH 2M3BA 3GHGB 1SW8A 4N5XA 1GDTA 3B8EB 2R3CA 3NHTA 3VROA 3H1IG 3JC22 4GOEA 1T3JA 2A45H 3M91A 2KI6D 3BXKA 2K88A 1DD3A 1G2CB 2H7HA 3D77A 3CGAA 2B9BA 1PP9G 4OGQB 1L2OC 4I5KA 3VRPA 1Q90D 3TUYB 1XFVO 2JRFA 3L73E 1R5SA 1EL4A 3HRNA 3B71A 1Y1UA 4U7JA 1KFXL 2KP8A 3L70J 1LT9B 1S2EA 1B8LA 1SQVK 2M5AA 1L0LD 3AECC 1SMGA 1KCYA 2IZ1A 2O01N 5I2QA 1YR5A 2P2UA 2PP6A 1A29A 3D71A 3BOWB 2L91A 3CCJP 1JY3O 1RE4A 1L4AC 3H1IJ 1PGOA 1BCCD 4PE0A 1KMIZ 1W2BO 5AEQA 4YBHB 2OYOA 1OMIA 1M1JC 1YI2P 3B4SA 1PP9J 2OS8C 2J58A 2IS9A 3MUDC 1XFUO 2JPTA 4PDZA 1SQPE 3HUSB 2GGMA 3BCCE 1SL8A 1NTKE 2QEVA 3LLEA 2H88C 2P1JA 2Z5IA 4AOMA 1BT6A 1X9VA 3A3YB 1LINA 1N7SD 2WCEA 5K89A 1CFPA 1G4YR 3Q5RA 4DT0A 3V2LA 2L5YA 1IFNA 2AXTE 1YX8A 1DX7A 1F71A 1MXLC 2E30A 3AE8C 1JFKA 1JM0A 1FZCB 1PZQA 1URQB 4HB1A 3HX4A 2HQWA 1ZP0C 2NPSB 1FZCA 1NCZA 1L0LG 1KILE 2ZT9D 1DEKA 3PLFB 2XV5A 5FI7A 4IFDK 1BODA 3RL0C 1GK6A 3T97A 4UB6E 3FE6A 2EHBA 3GF3A 2WSCJ 1HF9A 2K7BA 1KZUB 4I1LA 1RF1C 1PGQA 2CCMA 5EL2A 3LW5H 3RL0g 1TRFA 2D2CC 1SFCA 3S1KA 2R5DA 1G33A 4PCWA 4OGQD 1Q81Q 3CYZA 3CLQA 1K73Q 4F0ZB 4D6TE 4FQTA 1KYOD 1WDCB 2I94A 1JBAA 1F54A 1CLMA 1S72P 1L0LJ 4WY4B 1VQ9P 4B86A 4MZKA 2WMMA 2F2OA 1UHNA 1DVIA 1A02F 1CDLA 1FJKA 2KIKA 3CR5X 3RK2C 1B4CA 1F4QA 1RTP1 5AW1B 1KFXS 2KSEA 3UNWA 2HODA 2D8NA 3NSOA 4QJ3B 4BY4A 1NU1E 1SR6C 3F5HA 3JTDB 5H2FH 4IL6E 5AW7B 2IYOA 4N78E 5APSA 2Q7CA 3M06A 1KC8Q 2IZ0A 3HD7A 1Q2NA 2M3WA 1C3ZA 3H1KG 3CC4P 2JTTA 1TWOA 2NZ0A 1MUUA 2QPTA 1IRJA 1OMVA 2CTNA 1QX8A 1YIJP 4O9BA 2JXLA 2KLUA 2FYUE 3NHIA 1QS7A 4INXA 1HGVA 3CX5D 2H8PD 3USSA 3D0YA 4LGDE 2K1AA 4NPDA 1S5GY 3CL3D 1T8ZA 3B5NB 1G1JA 2OS8B 1GL2C 1L0NK 4E68A 2K8MB 1J7OA 2C0WA 4OR9B 2O1KA 1SQVD 4Y99C 3R1PA 1NKZB 1X79B 3AE3C 4EYYQ 2JO1A 4N1FA 2R32A 5DJTB 3H1KJ 1XA5A 5B66E 1MXEA 3N4XA 2OYIC 2M0BA 2H61C 2A06E 4GIFA 3LL8B 4Z1MH 2NCPA 4PV1B 1M31A 3I5IC 2L4HA 1XFYO 2W6BA 3CD6P 2FBWC 3L72D 1JOCA 3CI9A 3V5BA 1CDPA 1KFMA 3FX0A 2E43A 1GGZA 3D70A 1SFCD 3U1CA 4YGDB 1XFRA 1SL9A 5CSJA 2KPHA 1S1EA 1JCCA 2LP2A 4ICBA 3CCUP 2YIUB 2K60A 1N73C 2QEXP 3RL0B 2LUXA 3LIDA 1WLZA 2KI4B 2OTGC 1SCMB 1LA3A 1TNPA 1SLQA 3TF5A 1KN7A 5PALA 1VDFA 3NSLA 1OXZA 2P67A 4YXDC 5AANA 3OP0A 2IX7C 2Y1NA 1N86A 5D69A 2MBXA 2E74C 1R2UA 2WVRA 3G6EP 3PM2A 1NX2A 3L74E 4DRWA 3A0BE 4H13C 2BKHB 3HD7D 2RGIA 2JNXA 1G8IA 3R1OA 2WCMA 4CFQA 2QE7H 3E7KA 4C46A 3L75E 2KGRA 1CM4A 3L72G 4IFMA 2V7QJ 3H1HD 3RK2B 2K7DA 2KBMA 3CXHH 1H88A 3V2RA 3W68A 3BYAA 1R5LA 2LLUA 3TGUD 1BGYD 4ORCB 4GT1A 3SSUA 1DIPA 1FZGA 2BNXA 1SQXK 4H44D 2LMTA 2O01J 1OVUA 1QX5B 1S5GZ 3JVTB 3CXHI 3PATA 1WY9A 1KORA 2KZJA 5AW6B 3CZTX 4JPZB 1HUCA 2M1UA 4C7NA 1K96A 4XFJA 3K5BA 1QL2A 1K8AQ 2C9LY 5CPVA 3CTNA 3BRTB 3Q8IA 2ZYAA 5B5EH 2WT7B 3VRQA 3L72J 4U8DA 1YVLA 2SCPA 4PV1D 1OVVA 1QV1A 3CCEP 4ZCVA 1MR8A 4DS7A 2QJYB 1ZLLA 1BDCA 2V53A 1B9AA 1FAVA 3V2QA 1LP1B 3H1HG 1T14A 3VMZA 1N2DA 3AKBA 3CXHE 3P32A 1VQNP 3H32A 3BFAA 2IBZI 2OQQA 1KQLA 1EH2A 3S9OA 2KS1A 1J1EB 1UIXA 2M3EA 2ZJSE 3TGUG 3M0WA 4YGAA 3SS5A 1BGYG 3WXAA 1J1EA 3EK8A 3R72A 1SCVA 1K9UA 1USDA 2OYHA 3I5IB 2PGDA 1ALWA 1FI5A 1NSHA 2F8PA 1E79H 2YO3A 1Y47A 2WCHA 2HF5A 1EZVD 2JWAA 3AE9C 3CZ1A 2GM4A 3EWKA 3G9RA 3S0EA 3BRVB 1P84I 4JYCA 1LTJA 3HE4B 1W7JB 3V4WA 1N7SC 3IQQA 1BF5A 1PPJD 3H1HJ 2MKVA 1NCYA 1V1GA 3L37A 2ZFDA 1H0TB 2QEBA 2WCKA 3DVJA 2IBZE 4GFTA 3TGUJ 1BGYJ 1S1CX 2L98A 5C39A 2JP3A 1NWDA 3KYQA 4GAOA 3V2PA 1QTXA 1U5IB 1K9PA 5HYDA 1SYMA 3VMYA 1JY2P 4JYBA 3CC2P 1YTZC 5CJ0A 1FF1A 2HQ8A 4JQ0D 1JCDA 3M9BA 1P84E 1Q7YQ 1S6JA 4XYNA 1KK8C 3DF0B 3GHGC 1J7PA 3CWBE 3LCPC 3GLMA 2WC5A 1EZVG 4HH2A 4H0LD 1L0NG 4XJKB 4W7YA 4LLHA 4IL6X 4XJKA 5DKQA 1KB9D 4ORAB 1OIPA 4OGQC 1K05A 4CFRA 2NXQA 1RQVA 2P70A 4YGCB 4M3LA 1ZACA 1PPJG 2CBLA 3PRJA 2JNFA 2HR3A 1JMBA 3PJIA 1LT9C 3A8RA 2W27A 3P8CE 1UP5A 2KAYA 1DQEA 1VQPP 2BE4A 2KNCA 4JBZA 4PE1A 4DCKA 3C8VA 5BU5A 4DOJA 1B47A 2IFNA 1QV0A 5L8RJ 1AVYA 4CLNA 3TNUA 3BQ3A 1L0NJ 1KSOA 1CFDA 4PT1A 5JOLA 3W67A 3PHLA 2Y5IA 2BBNA 4BRYB 1NTZE 3H25A 4XE5B 1FDMA 2OTJP 3D75A 4WQ2A 1NU1K 1K9MQ 1MFZA 1DJXA 3HUSC 2OTLP 1Y9BA 1KILA 2Q9IA 1Y8AA 3AEBC 2O60A 1BE3G 4IOIH 1ZR4A 3VRNA 1GU5A 3P7KA 2MLFC 2AUCA 2ITAA 1TUZA 1TOPA 4I7ZB 2Z4EA 4C0LA 1GW3A 3WMM0 2G8YA 1EJ3A 2FYUK 1HJ0A 5I2OA 4A7PA 2BL0B 1IKUA 4EDFA 4GNKB 1FZCC 1URQC 3M9QA 1NPQA 2NPSC 3O8ZA 1A4PA 4LC1A 3L73D 3EK7A 1T6AA 2Z5HA 2JT8A 3L47A 2HPSA 1CI6B 4QJ4B 3I5CA 1C3YA 3EKHA 5KLVE 4TT3H 3B7AA 4HJGH 1HQVA 3KEVA 1BE3J 1SQXG 3OBVA 5CMZA 3SWKA 1QVIZ 3S0BA 3TDKA 4BXLA 1M39A 2PYQA 3CS1A 1FZFA 1IJ6A 1SFCC 2XNXA 2BEQD 1NYAA 2XZRA 3MHVA 4D1EA 3H1JD 2C9NY 4ZKUA 2EGDA 3D10A 2ZT9B 5KTYA 2K7CA 5CCHA 2YKOA 1WDCC 2POHA 4WB4A 4WVZA 1KQMB 1XK4A 1SQPD 2WSFJ 1FDOA 4WY4C 3G71P 1VQ8P 2WQYC 3BCCD 2QDIA 1KK8B 3IQOA 1H8BA 2E6WA 5CSFA 1LTSC 3EVVA 3NMDA 2K9JA 3V6IA 1SQXJ 2QG4A 1AUIB 1VPCA 3JCUE 1FBVA 1ZV8A 1ZMZA 2LVVA 2JZIA 3JTDC 2WPSA 4JKTA 1TCOB 3L70E 4MZJA 1EDJA 2W8ZA 2KLEA 2GA1A 3KHUA 2A45I 4HYTB 3M0AA 1DH3A 5JJGA 2KLVA 1CSBA 1VQ4P 1KILD 4OWFA 4GPLB 3B87A 3SIAA 2M5AB 2Y1MA 5E79E 3D76A 2OARA 1B7TY 4Y28J 1PL5A 3HTKA 1AJYA 4AYCA 2G9BA 1FZEA 2I7AA 1X02A 1MUXA 2YMYA 2WSCH 4N1GA 3H1JG 1WT6A 1NIWA 1PP9E 3VN0A 3Q5SA 4I5JA 2FOTA 2JJLA 3AEGC 4NDBA 3BUOB 1C7WA 1CLLA 4M2QA 1NAYA 3ZWHA 3B5NC 3BCCG 1NCXA 3NXSA 2E75D 1R8EA 4MSPA 4D6TD 3CR2A 3CCRP 1AJ5A 1USEA 1YBKA 1LWUA 2N1TA 4UPGA 4GGNA 1SNLA 1R6PA 1JY3P 1CB1A 3RGUA 4A4BA 5DICA 1WLMA 1Y6WA 3R4YA 2BASA 1NX3A 1QGKB 4PV1C 3S0FA 2Q1KA 2Q91A 2BAPA 3H1JJ 1SRAA 1ZRTE 5GQQC 1RF0C 2BCCE 1NU1D 1K8UA 2M29A 1FE6A 2W83C 1YHQP 4N3YB 1QLED 4KJMA 1BSHA 2LC5A 3OX6A 4K3AA 1JNMA 1FJPA 4NDCA 4R4MA 3TDUA 1DMOA 2W90A 4N78D 3BCCJ 2QEOA 2FFDA 5CCHD 2B1UA 2YIUC 1M46A 3Q5PA 3T97B 5ER5A 3FWBA 3NTNA 2KI4C 5FYXA 1CDMA 1K04A 1SCMC 3KPXA 1ZFSA 1E5WA 1BCCG 1MFTA 5HL1A 5CCGC 2MRDA 1AQTA 5KAFH 3TZ1A 1EDLA 4EI2A 1NP8A 1IH0A 4K35A 2YXQB 1XYDA 2FYUD 1KK7Z 1SFCB 3L35A 4D6TG 3NGVA 2KDHA 2I1JA 2BECA 1DTLA 2M7NA 3B88A 1L0LE 2ZNDA 2LLTA 4PD4H 2BKIB 1CMFA 1M7LA 4I6MC 1GGWA 3AE7C 3PFVA 1TTXA 2BBMA 4IL1A 4JWQA 1RE3C 3PP5A 3VB1A 4PD4I 1BCCJ 1B7TZ 2MJWB 1NU1G 2A06D 1YTZI 3FGAD 1B8RA 4GGFC 4ASWA 2HODB 4U3FE 2R44A 2WOSA 4P5OE 2DOQA 3SWFA 1S6IA 2WZ7A 2ZVNB 2FXMA 2YKPA 1OX3A 4JD9A 3BATA 3AE5C 3HD7B 3JVTC 3F89A 1CM1A 1JEKA 1KYOH 2YO2A 1KSMA 1OMDA 2CK3H 5KAFE 2CT9A 3CDNA 3OJAB 2FJUB 2N1TD 3AE6C 4GKGA 1ZN5A 2JTZA 4YI8A 2FYUG 2ZNEA 2GV5A 1JC2A 3DY9A 3PLNA 3A0HH 4L76A 3RM1A 3SFDC 5AVXB 1ZOTB 3D0YB 1NU1J 2R2IA 4H44B 4PD4E 2RKLA 1XTGB 3VOPA 4YRUA 3QMEA 2E76B 4MBEA 5DJUB 2VRSA 2QJYC 1N0YA 1TNWA 3FWNA 3H1KE 1CW5A 3L74D 1M56D 2KYVA 2H89C 2N9BA 1IZNB 2A06G 1DJGA 1LTTC 1L4AA 1YYCA 1J1EC 1E8AA 2LKMA 2ZXEB 3L75D 2FYUJ 2KI7B 1IQ5A 1U7JA 5H2FE 1A03A 2V7QH 1M1JA 3CX5H 2M0RA 3O6BA 2GUVA 2K61A 2KFFA 2ZKMX 1SQQK 1Q86Q 3BUNB 3HCMA 1IWQA 2O01H 1YJWP 2B89A 3A0HE 1UUSA 4FTGA 3RK3E 4I2LC 3O6QA 3L36A 1YQ4C 3I55P 3TYYA 2K7OA 3AE2C 1TUJA 4FQOA 1RFJA 5AW8B 4QJ5B 1JTHB 1OW7A 1OW6A 3KO0A 1YTZT 5KJ7C 3D74A 2M8RA 1JTHA 3MP7B 3H1LE 1T2KD 3WNXB 2HYNA 3L74G 1PRWA 3SG4A 1TCFA 1SQVG 2ZYGA 1OOIX 4PHMA 1BR1B 3B86A 1MWNA 2LR2A 3IF4A 1IK9A 4W80A 3L75G 2PSRA 2QSIA 3L4FA 1KWOB 1LTGC 3CXHD 4RJTA 1QX7A 2K2FA 5AVQB 1FI6A 1QVGO 1FBMA 1NHLA 3KQGA 5GTIH 1YITP 3DYEA 2VRGA 1A75B 1F55A 3WU2H 2H2KA 1AP4A 1HGZA 4PE4A 3MD0A 1A75A 1IQ3A 3CWGA 1CLBA 2WC8A 3CZ0A 2RN0A 3L74J 2FXOA 1L2PA 1CKKA 2E76D 1VQMP 1SQVJ 1Y0VH 1VQ7P 1WRKA 2RMZA 2JWDA 2H8VA 5AVSB 4C7NB 2WWWA 3BJHA 2NRGA 1L7ZA 3L72E 3L75J 2JKVA 1SQBE 2WSEH 4H0LB 1L4AD 2KI6C 1Y1XA 1CTRA 1S3JA 5AVWB 3ITKA 5AVYB 3CMEP 2IBZD 2R5BA 1HTLC 1IJ5A 1PSRA 2MA2A 3AEEC 1XTCC 4HKZH 3M9HA 3VMAA 3D6YA 4PE7A 3KZIH 2KAXA 1YJNP 1ORGA 3TK1A 1ALVA 1S26D 5AERA 4KYNA 1J1DA 2SPZA 3GW6A 3SJSA 3H32B 4NPFX 3FWLA 1OFCX 2Y0CA 2KS1B 4UB8H 1P84D 1AK8A 3CWBD 2HPCA 4PHNA 1JMMA 4I7ZC 3N7HA 2OYHB 1SBJA 3G3ZA 1RH5B 1X22A 5HLOA 3UIAA 1OQPA 2BL0C 1GW4A 4PJ0H 2QJKB 2Q3EA 4IFFA 3ZNIA 3F45A 3FS7A 1PIXA 1LTJB 2B87A 3M0DA 1PFIA 1K2HA 2YKQA 2MHHA 4F7FA 1VQKP 5B5EE 3PALA 2AEJA 1HJBA 2QVAA 3E1RA 2OYIA 2WNDA 2WTYA 5HKZA 3P8CD 2H61A 2ISDA 3V4QA 1SQPK 2WSEJ 1IIOA 1GK4A 1NTKK 3P8MC 3TSIA 1KQSO 1DGVA 1A02J 2GGZA 1LTAC 3PN7C 3R1VA 3C9IA 5HKWA 5F6TA 1NTME 3KZIE 5CHXA 2KQ6A 3KF9A 1DEBA 3NSKA 3D6ZA 1TNQA 3NFQA 2KSPA 1F8HA 1QL1A 3IR9A 3EVRA 3FXEA 1PGJA 1SQQD 1OE9B 2FYNC 3I5GB 5CCHC 3TS5C 2ZT9C 1UHKA 4UB8E 1NKNA 1N73A 1XK4C 1BLQA 3C1VA 4OZDA 2FJYA 1SK6D 1KQMC 5DKRA 2WORA 1DD4A 2CXJA 3GK4X 3IN6A 1QVIY 1DF0A 2COLB 2Y4QA 4PJ0E 1RECA 1Q80A 3CCVP 3NXAA 4DIRA 1JWDA 4ETOA 1VQ6P 3PSRA 5AW9B 2XDJA 1X0TA 5CBOA 3CCSP 2FCDA 1PVAA 1NGMB 4GDOA 2QJPB 3A5TA 5FI2A 2G2BA 3A4UB 4WQ3A 2QM8A 2O3JA 1GM0A 2ZN9A 3OB1B 5J3XA 1Z4HA 1K90D 4DJGA 1LT1A 2KNCB 5AW0B 1BOCA 3O78A 4BY5A 1VF5D 5KLVD 3O2PA 3EG5B 3MZWB 1RE4C 2JT0A 1L0NE 1SQQG 3TNUB 1PK0D 3VMXA 1AVOA 1OWAA 2HG5D 2WCBA 2JQ6A 3EKJA 1PVBA 4WRIA 1S5LH 1KB9H 1LTIC 2F33A 5KAIH 3VYIA 1YUTA 3GF7A 2YMKA 1EXJA 1OW8A 3MIWA 5APYA 2FYZA 1CZQA 1MQ1A 1KILB 4YI9A 4ZCUA 3Q1MA 1KB9I 2IYPA 3I5FB 1NAFA 2WCLA 1OZSA 1RJVA 2WSFH 5I2LA 2KQYA 3HE5A 3LIEA 1SL7A 5AW5B 1LTBC 2LVJA 2I8DA 3V2NA 2WCFA 1Y1AA 2F3YA 4MEWA 3L71E 3DVEA 2LHIA 4MRXA 1SQQJ 4P2YB 1SS1A 1UHIA 4KT0J 2EC6C 2R3SA 1NWQA 5TISH 2K9YA 2SASA 3KHEA 2E75B 2AMIA 1VQ5P 2ZYDA 1YURA 5AVZB 3BFBA 4RESB 2PRRA 2FFDC 3L70D 4R1EA 3EFFK 2M8UA 1Z2CB 1MF8B 3BUWB 2JR8A 1BE3E 2LE9B 4TLFA 3SG6A 1S5LE 1KB9E 1OMRA 3R2PA 1GMJA 2K37A 1PGPA 3FXDA 3QRXA 4C0KA 1S9KE 3PN7B 3OHMB 5KKZB 4YPCA 1PP9D 1H8AA 3E1IA 2H43A 1OZHA 3AEFC 2FYNB 4DZOA 4ZKPA 4H13D 1N8RQ 3TS5B 1EXIA 4GOFA 3ICBA 2KYFA 3SFEC 2M9GA 1MKMA 2QRXA 3BVHA 1NTKD 4I5LB 2N9YB 1IO4A 1M63B 1SQXE 1FW4A 4C0JA 3Q3DA 4AQJA 2P71A 4PHJA 2K9JB 2K2AA 2V4HA 1DC1A 3DZTA 1N7LA 4YXWH 1KK7Y 1QIWA 1T2KC 1RY3A 4L74A 3WUVA 3UO9A 3AE4C 3BFHA 1EG4A 1IFIA 5KLIB 1RHZB 3TDZA 1HT9A 3L73G 1PULA 2FCEA 1ZRTD 5AVRB 3RBZA 1GJYA 2BCCD 2BEZF 2Q5UA 3HD7C 2L2CA 3BUMB 1NOHA 4HRHA 3O4XA 1GU4A 1BSNA 3L4LA 3GHGA 4DUQA 3AEDC 2C0XA 1YRUB 2KB7P 3SG5A 1LNQA 3HTKB 1K93D 2GUSA 1QEXA 3H1IE 1G2CA 3CC7P 2JU0A 4OKHA 4ZMDA 2MAZA 3TDIA 1EDKA 1FPWA 1NH4A 4BWNA 2AXTH 4H44C 3B6XA 1TU3F 1QX2A 1FZAA 2E76C 2LANA 3L73J 1SQPG 1X8YA 4XA4A 1LT9A 1JB0J 1HH0A 1NTKG 2Y0EA 2A45G 1FS0E 1LWUB 1DT7B 1ZUZA 1SP4A 3I5HB 2N1TB 3OB2B 3RK3B 4CIDA 4HREE 2O1JA 5BPJA 3BOWA 1NX0A 2KNEA 4UB6H 1XFWO 3O4YA 2OGUA 2G3AA 3H1JE 1BJFA 5AW4B 2WC6A 1OOJA 1SQBK 2BCCG 2L50A 2ZVOB 1EG3A 1YX7A 4HSZA 1W9ZA 3K21A 2J5UA 4U3FD 3PM8A 4OCIA 2BCXA 2EC6B 3HUSA 2QACA 1FU1A 3AAKA 2M49B 1BU3A 2AAOA 2FFDB 1SQPJ 1LS8A 3WHUB 1NTKJ 5BVZA 3K1EA 2KK7A 1KV4A 5HLVA 2HLOA 3A2AA 1K9KA 3IVTA 2I2RE 2FY8A 2RH0A 5APVA 2XNDH 4JF7A 1SKTA 1MHOA 2HFED 1AFOA 1M57D 4AQIA 4MN0A 1C7VA 1H89A 1NO4A 2I1KA 1S36A 1QJTA 2LVIA 1URQA 1ZOYC 2BCCJ 2BCBA 3VRRA 1M8OB 3D73A 1S4XA 2NPSA 2QM7A 1IFMA 4PD4D 3Q2YA 2LMUA 2PRUA 3A7OA 2KXPB 1VRKA 4INWA 2E5TA 1RROA 1WRZA 4IL6H 2Q6QA 2CNPA 4MZLA 1JFJA 4ZNCA 1KQVA 3GG2A 4ORBB 2ZN8A 1F4OA 2GTEA 1S3PA 3H1KD 1JUOA 2QIWA 1FOSF 1J7RA 3QH9A 1KWOC 1BCCE 4WBAA 3SG7A 2FXPA 3CCMP 5APUA 1OOHA 3RLZA 2WCJA 4U3FG 2KUBA 1C07A 1SVFA 3CR4X 1UHJA 1IFDA 2P58A 2UWJE 4RKUJ 5KTBA 1SPYA 5TNCA 2I18A 3OGNA 1NTMK 1JY2N 1AA0A 4I5NB 3KXDA 4D6TJ 4WY4A 3OAKA 3VTPC 1GQMA 2KSJA 5AW3B 1YUSA 1NX1A 3RK3D 5B66H 4H0LC 1KYOI 1PV3A 1L2OB 4OVNF 2B88A 4U3FJ 2E42A 4R4LA 4Q04A 1DJHA 1Q82Q 3H1LD 3S4RA 4GODA 1DGUA 3WUUA 1NYHA 1HWTC 1OVRA 4MN4C 1J1DC 1VL2A 1J7QA 5APWA 1LXFC 1FDIA 1N2DC 1VF5C 2P10A 3LW5J 4MLWA 3H4SE 1L4AB 2JWWA 3RZSA 5G08A 3I56P 1LKJA 1KTMA 1TIZA 3GOFA 1YRTB 1K95A 3AE1C 3NSIA 5I94A 2OYHC 4M2OA 1M1JB 4CPVA 3OA7A 1KYOE 2PMYA 2AEMA 2KAVA 3B5NA 2CPSA 5K5GB 5I8NA 1URQD 3MUDA 4YGEB 2QJKC 2NPSD 3DD4A 1B8CA 3M0DC 1AQ5A 2Y0DA 5ER4X 3SG3A 1TN4A 1LTJC 1NUBA 3ZDMA 5FI6A 1S5LX 1BDDA 3CX5I 3A0BH 3CCLP 1NTZK 1MZ9A 2WITA 3II6A 3O6QB
chains in the Genus database with same CATH topology
2E30A 3PALA 2KYCA 1NPQA 1A4PA 1JFKA 2WNDA 3EK7A 5HKZA 2H61A 2OPOA 2ISDA 2JT8A 3HX4A 1JF0A 2HPSA 2HQWA 4L9MA 1NCZA 4QJ4B 1DGVA 2GGZA 3EKHA 3PN7C 3PLFB 5B8IB 1HQVA 5HKWA 5F6TA 3KEVA 1BODA 2KQ6A 3KF9A 3NSKA 1TNQA 5IBWA 1QVIZ 2KSPA 3I5GC 1F8HA 2EHBA 3EVRA 1M39A 2P6BB 3CS1A 2K7BA 1IJ6A 1OE9B 2CCMA 3I5GB 3TS5C 1NYAA 4MVFA 1KFUL 1UHKA 2LNKA 1J55A 4D1EA 1XK4C 3EVUA 1BLQA 2EGDA 3C1VA 1SK6D 1TRFA 1KQMC 3D10A 5KTYA 2K7CA 3BUXB 1WDCC 3CLNA 5DKRA 2WORA 1G33A 5CSIA 2CXJA 4PCWA 4HRGA 3GK4X 1KQMB 4F0ZB 5KSZA 1QVIY 1XK4A 1DF0A 2COLB 1WDCB 2Y4QA 2I94A 1JBAA 1F54A 1CLMA 2LAPA 1KK8B 3IQOA 1RECA 1Q80A 1SY9A 1H8BA 2E6WA 4MZKA 5CSFA 3NXAA 2F2OA 4DIRA 3EVVA 1UHNA 1DVIA 4ETOA 1JWDA 3PSRA 2L4IA 2FCDA 1CDLA 2HETA 2MLEC 1AUIB 1PVAA 3CR5X 1BG1A 1B4CA 1F4QA 1FBVA 1IG5A 1RTP1 1ZMZA 2LVVA 1OZOA 1UURA 2JZIA 3JTDC 1KFXS 2G2BA 3A4UB 4WQ3A 1CMGA 1TCOB 4MZJA 1CNPA 2D8NA 2ZN9A 3NSOA 4QJ3B 4BY4A 3OB1B 5J3XA 1SR6C 1K90D 2JULA 4NDDA 3JTDB 3OX5A 4GGFA 5JJGA 4GBAA 2F2PA 1BOCA 1AJ4A 3O78A 4BY5A 1SR6B 1B1GA 4GPLB 3O2PA 4A4CA 3SIAA 3LK0A 2KHNA 2JT0A 2Y1MA 2M3WA 1B7TY 2K0JA 1PK0D 5CSNA 2G9BA 2JTTA 2WCBA 2JQ6A 2I7AA 2JOJA 1PVBA 3EKJA 1X02A 2LMVA 4WRIA 2NZ0A 2KBIA 1MUXA 2F33A 1M45A 2TN4A 4N1GA 2JC2A 1YUTA 3AKAA 2QPTA 1IRJA 1OMVA 4TNCA 1NIWA 2CTNA 4I5JA 2FOTA 1DJIA 2JXLA 1DJWA 4YGBB 1MQ1A 1XO5A 2M97A 3BUOB 4NDBA 1C7WA 1QS7A 1WRLA 1CLLA 1ODBA 3I5FC 2A4JA 4M2QA 4YI9A 4ZCUA 3ZWHA 3D0YA 1NCXA 1S5GY 4MSPA 2LLSA 3I5FB 2KGBC 2L51A 3CR2A 1OZSA 1RJVA 1AJ5A 5I2LA 2OS8B 2KQYA 3GK1A 4E68A 1QXPA 2K8MB 1SL7A 4UPGA 4GGNA 1SNLA 1J7OA 2LVJA 1R6PA 2WCFA 1Y1AA 1TNXA 4OR9B 2F3YA 2LM5A 1CB1A 4MEWA 3DVEA 4A4BA 2LHIA 4N1FA 1WLMA 1Y6WA 4MRXA 1CFCA 1H4BA 1XA5A 4P2YB 1UHIA 1MXEA 1NX3A 2L5XB 2EC6C 3LK1A 2H61C 1EXRA 1PSBA 1LVCD 2SASA 2ZRSA 3KHEA 3LL8B 2AMIA 2Q91A 2NCPA 1SRAA 1M31A 1YURA 5GQQC 3I5IC 2L4HA 1XFYO 4R1EA 1N65A 1K8UA 2M29A 2M8UA 1MF8B 3BUWB 1K94A 2LC5A 1XFZO 1CDPA 3OX6A 4NDCA 2PVBA 3TDUA 5AFPA 1GGZA 1QIVA 1DMOA 1YVHA 2LE9B 2B1UA 3SG6A 3IF7A 4YGDB 1M46A 1OMRA 1QASA 1SL9A 1CDNA 5CSJA 1AHRA 1S1EA 5ER5A 3FWBA 2LP2A 2NLNA 2KI4C 3QRXA 4C0KA 4ICBA 5FYXA 1CDMA 1KFUS 1SCMC 3KPXA 1ZFSA 3PN7B 2Y9ZA 3OHMB 2LV7A 2LUXA 2MRDA 1WLZA 2KI4B 2OTGC 3TZ1A 1SCMB 1LA3A 1NP8A 1TNPA 2L0PA 2M7LA 1IH0A 1DJZA 1XYDA 1KK7Z 2OTGB 1F71A 5PALA 2KOTA 3NSLA 3TS5B 2KDHA 2BECA 5AANA 1DTLA 2M7NA 3OP0A 3ICBA 2KYFA 2Y1NA 2M9GA 1QLSA 5D69A 2MBXA 1DF0B 2ZNDA 5HKYA 2LLTA 2KFGA 1R2UA 4I5LB 1M63B 1RK9A 1FW4A 2BKIB 4C0JA 1CMFA 1NX2A 4AQJA 4DRWA 4PHJA 2K2AA 1GGWA 2BKHB 1U5IA 3PFVA 1KK7Y 1QIWA 1TTXA 2BBMA 2RGIA 3FIAA 2JXCA 4IL1A 4JWQA 1QLKA 1IGVA 2JNXA 2LCPA 5AXIA 1G8IA 1EG4A 3E3RA 4CFQA 3TDZA 1B7TZ 2MJWB 5DKNA 1HT9A 1B8RA 1PULA 1CM4A 2KGRA 4GGFC 2FCEA 2LUCA 3AAJA 1V1FA 2O5GA 2WOSA 4P5OE 2K7DA 2DOQA 1GJYA 3DF0A 1S6IA 2KBMA 3BUMB 4HRHA 3BYAA 2LLUA 4ORCB 3WHTB 4DUQA 3JVTC 1YRUB 1CM1A 2LMTA 3SG5A 1KSMA 1OMDA 4OV2A 2CT9A 1K93D 1QX5B 3TUYC 1D1OA 1S5GZ 3JVTB 2FJUB 3PATA 1WY9A 4USLA 3SG2A 2JU0A 4OKHA 2JTZA 4YI8A 3CZTX 2BE6A 2MAZA 1LA0A 3TDIA 2ZNEA 1FPWA 2GV5A 1JC2A 4JPZB 2M1UA 1K96A 3RM1A 5CPVA 3CTNA 2M1KB 1YUUA 1PALA 1QX2A 1ZOTB 4GNKB 3D0YB 2LANA 2R2IA 5KU1A 3VRQA 3I5HC 2PALA 2PASA 3DVMA 4U8DA 1YVLA 2SCPA 4YRUA 4MBEA 1DT7B 1ZUZA 4PALA 3I5HB 1N0YA 1TNWA 3OB2B 3DVKA 4CIDA 1AVSA 4HREE 1QV1A 5BPJA 4ZCVA 3BOWA 1MR8A 1NX0A 4DS7A 2LVKA 2KNEA 1XFWO 2V53A 3VGOA 3O4YA 4M2PA 1B9AA 3SIBA 1DJGA 4GUKA 3MSEB 1BJFA 4NQGA 1E8AA 1N2DA 3AKBA 1OSAA 1OOJA 2L50A 2L2EA 2ZRTA 1DJYA 1EG3A 1YX7A 1F70A 1W7IB 4HSZA 1IQ5A 1A2XA 3K21A 1EH2A 3PM8A 4OCIA 2BCXA 1A03A 3M0WA 4YGAA 2EC6B 3WXAA 2BCAA 2M0RA 2KFHA 1J1EA 2QACA 3EK8A 3O6BA 3AAKA 2M49B 1BU3A 1K9UA 1SCVA 1QATA 2AAOA 3EK4A 1RWYA 1UHHA 2K61A 2KFFA 2Q4UA 1ALWA 2LHLA 2ZKMX 1NSHA 3I5IB 2F8PA 3WHUB 1FI5A 3GK2A 2HF5A 3BUNB 3HCMA 1IWQA 1JF2A 5HLVA 1CFFA 1K9KA 3FWCA 2I2RE 1UUSA 4FTGA 1SKTA 1MHOA 1UWOA 1W7JB 4AQIA 4MN0A 1JSAA 1C7VA 3IQQA 1BF5A 2K7OA 5D7FA 1S36A 4FQOA 1QJTA 1NCYA 1RFJA 1V1GA 2LVIA 2ZFDA 4QJ5B 2BCBA 3VRRA 3KO0A 2NCOA 1BMOA 2LMUA 2PRUA 3DVJA 1VRKA 4MRYA 4GFTA 1RROA 1WRZA 2L98A 2CNPA 4MZLA 3WNXB 1JFJA 1NWDA 1PRWA 3SG4A 1KQVA 1TCFA 4ORBB 2ZN8A 1BR4B 1F4OA 4PHKA 1S3PA 1XFXO 4GAOA 1JUOA 1J7RA 1QTXA 1U5IB 1KWOC 1K9PA 1BR1B 1SYMA 2JT3A 4PHMA 5HYDA 1MWNA 3SG7A 1XVJA 1S6CA 1YTZC 2PSRA 3RLZA 1FF1A 2HQ8A 1KWOB 1C07A 4JQ0D 3CR4X 1QX7A 2K2FA 2F3ZA 2LP3A 1FI6A 1UHJA 1S6JA 4XYNA 1KK8C 3DF0B 2Y9YA 1SPYA 5TNCA 1J7PA 2I18A 3LCPC 2VRGA 1A75B 1F55A 2H2KA 1AP4A 4PE4A 1A75A 4I5NB 1SW8A 4XJKB 1IQ3A 4N5XA 3CWGA 1CLBA 2WC8A 3VROA 4XJKA 5DKQA 4ORAB 1GQMA 2KI6D 4CFRA 1CKKA 3BXKA 2NXQA 3CGAA 1YUSA 1L2OC 4I5KA 1NX1A 1Y0VH 4YGCB 3VRPA 1WRKA 1ZACA 3TUYB 2CBLA 2JNFA 1XFVO 2JRFA 1EL4A 3A8RA 1L2OB 1L7ZA 4OVNF 1UP5A 2KAYA 1Y1UA 4Q04A 1KFXL 2BE4A 2KI6C 1Y1XA 1CTRA 4PE1A 4DCKA 1DJHA 1B47A 1B8LA 1DGUA 1QV0A 1SMGA 1KCYA 4CLNA 5I2QA 1YR5A 3BQ3A 1IJ5A 1PSRA 2MA2A 1A29A 3BOWB 1J7QA 1LXFC 1KSOA 4PE7A 2KAXA 1CFDA 5JOLA 2Y5IA 1ALVA 4PE0A 2BBNA 4MLWA 1S26D 5AERA 5AEQA 4YBHB 3H4SE 1J1DA 2JWWA 4WQ2A 5G08A 1LKJA 1DJXA 3SJSA 1TIZA 3GOFA 2OS8C 1YRTB 1K95A 3NSIA 1OFCX 2IS9A 4M2OA 1XFUO 2O60A 2JPTA 4PDZA 4CPVA 2GGMA 1AK8A 1SL8A 2PMYA 2KAVA 3VRNA 4PHNA 3LLEA 1SBJA 2MLFC 2AUCA 5I8NA 4AOMA 1BT6A 4YGEB 3DD4A 1B8CA 1TOPA 1LINA 5HLOA 2WCEA 1OQPA 5K89A 5ER4X 2BL0C 3SG3A 1TN4A 1G4YR 1NUBA 4C0LA 1CFPA 1EJ3A 3ZNIA 3F45A 3FS7A 1YX8A 5I2OA 2BL0B 1IKUA 1K2HA 2MHHA 1MXLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E30 A;  3PAL A;  2KYC A;  1NPQ A;  1A4P A;  1JFK A;  2WND A;  3EK7 A;  5HKZ A;  2H61 A;  2OPO A;  2ISD A;  2JT8 A;  3HX4 A;  1JF0 A;  2HPS A;  2HQW A;  4L9M A;  1NCZ A;  4QJ4 B;  1DGV A;  2GGZ A;  3EKH A;  3PN7 C;  3PLF B;  5B8I B;  1HQV A;  5HKW A;  5F6T A;  3KEV A;  1BOD A;  2KQ6 A;  3KF9 A;  3NSK A;  1TNQ A;  5IBW A;  1QVI Z;  2KSP A;  3I5G C;  1F8H A;  2EHB A;  3EVR A;  1M39 A;  2P6B B;  3CS1 A;  2K7B A;  1IJ6 A;  1OE9 B;  2CCM A;  3I5G B;  3TS5 C;  1NYA A;  4MVF A;  1KFU L;  1UHK A;  2LNK A;  1J55 A;  4D1E A;  1XK4 C;  3EVU A;  1BLQ A;  2EGD A;  3C1V A;  1SK6 D;  1TRF A;  1KQM C;  3D10 A;  5KTY A;  2K7C A;  3BUX B;  1WDC C;  3CLN A;  5DKR A;  2WOR A;  1G33 A;  5CSI A;  2CXJ A;  4PCW A;  4HRG A;  3GK4 X;  1KQM B;  4F0Z B;  5KSZ A;  1QVI Y;  1XK4 A;  1DF0 A;  2COL B;  1WDC B;  2Y4Q A;  2I94 A;  1JBA A;  1F54 A;  1CLM A;  2LAP A;  1KK8 B;  3IQO A;  1REC A;  1Q80 A;  1SY9 A;  1H8B A;  2E6W A;  4MZK A;  5CSF A;  3NXA A;  2F2O A;  4DIR A;  3EVV A;  1UHN A;  1DVI A;  4ETO A;  1JWD A;  3PSR A;  2L4I A;  2FCD A;  1CDL A;  2HET A;  2MLE C;  1AUI B;  1PVA A;  3CR5 X;  1BG1 A;  1B4C A;  1F4Q A;  1FBV A;  1IG5 A;  1RTP 1;  1ZMZ A;  2LVV A;  1OZO A;  1UUR A;  2JZI A;  3JTD C;  1KFX S;  2G2B A;  3A4U B;  4WQ3 A;  1CMG A;  1TCO B;  4MZJ A;  1CNP A;  2D8N A;  2ZN9 A;  3NSO A;  4QJ3 B;  4BY4 A;  3OB1 B;  5J3X A;  1SR6 C;  1K90 D;  2JUL A;  4NDD A;  3JTD B;  3OX5 A;  4GGF A;  5JJG A;  4GBA A;  2F2P A;  1BOC A;  1AJ4 A;  3O78 A;  4BY5 A;  1SR6 B;  1B1G A;  4GPL B;  3O2P A;  4A4C A;  3SIA A;  3LK0 A;  2KHN A;  2JT0 A;  2Y1M A;  2M3W A;  1B7T Y;  2K0J A;  1PK0 D;  5CSN A;  2G9B A;  2JTT A;  2WCB A;  2JQ6 A;  2I7A A;  2JOJ A;  1PVB A;  3EKJ A;  1X02 A;  2LMV A;  4WRI A;  2NZ0 A;  2KBI A;  1MUX A;  2F33 A;  1M45 A;  2TN4 A;  4N1G A;  2JC2 A;  1YUT A;  3AKA A;  2QPT A;  1IRJ A;  1OMV A;  4TNC A;  1NIW A;  2CTN A;  4I5J A;  2FOT A;  1DJI A;  2JXL A;  1DJW A;  4YGB B;  1MQ1 A;  1XO5 A;  2M97 A;  3BUO B;  4NDB A;  1C7W A;  1QS7 A;  1WRL A;  1CLL A;  1ODB A;  3I5F C;  2A4J A;  4M2Q A;  4YI9 A;  4ZCU A;  3ZWH A;  3D0Y A;  1NCX A;  1S5G Y;  4MSP A;  2LLS A;  3I5F B;  2KGB C;  2L51 A;  3CR2 A;  1OZS A;  1RJV A;  1AJ5 A;  5I2L A;  2OS8 B;  2KQY A;  3GK1 A;  4E68 A;  1QXP A;  2K8M B;  1SL7 A;  4UPG A;  4GGN A;  1SNL A;  1J7O A;  2LVJ A;  1R6P A;  2WCF A;  1Y1A A;  1TNX A;  4OR9 B;  2F3Y A;  2LM5 A;  1CB1 A;  4MEW A;  3DVE A;  4A4B A;  2LHI A;  4N1F A;  1WLM A;  1Y6W A;  4MRX A;  1CFC A;  1H4B A;  1XA5 A;  4P2Y B;  1UHI A;  1MXE A;  1NX3 A;  2L5X B;  2EC6 C;  3LK1 A;  2H61 C;  1EXR A;  1PSB A;  1LVC D;  2SAS A;  2ZRS A;  3KHE A;  3LL8 B;  2AMI A;  2Q91 A;  2NCP A;  1SRA A;  1M31 A;  1YUR A;  5GQQ C;  3I5I C;  2L4H A;  1XFY O;  4R1E A;  1N65 A;  1K8U A;  2M29 A;  2M8U A;  1MF8 B;  3BUW B;  1K94 A;  2LC5 A;  1XFZ O;  1CDP A;  3OX6 A;  4NDC A;  2PVB A;  3TDU A;  5AFP A;  1GGZ A;  1QIV A;  1DMO A;  1YVH A;  2LE9 B;  2B1U A;  3SG6 A;  3IF7 A;  4YGD B;  1M46 A;  1OMR A;  1QAS A;  1SL9 A;  1CDN A;  5CSJ A;  1AHR A;  1S1E A;  5ER5 A;  3FWB A;  2LP2 A;  2NLN A;  2KI4 C;  3QRX A;  4C0K A;  4ICB A;  5FYX A;  1CDM A;  1KFU S;  1SCM C;  3KPX A;  1ZFS A;  3PN7 B;  2Y9Z A;  3OHM B;  2LV7 A;  2LUX A;  2MRD A;  1WLZ A;  2KI4 B;  2OTG C;  3TZ1 A;  1SCM B;  1LA3 A;  1NP8 A;  1TNP A;  2L0P A;  2M7L A;  1IH0 A;  1DJZ A;  1XYD A;  1KK7 Z;  2OTG B;  1F71 A;  5PAL A;  2KOT A;  3NSL A;  3TS5 B;  2KDH A;  2BEC A;  5AAN A;  1DTL A;  2M7N A;  3OP0 A;  3ICB A;  2KYF A;  2Y1N A;  2M9G A;  1QLS A;  5D69 A;  2MBX A;  1DF0 B;  2ZND A;  5HKY A;  2LLT A;  2KFG A;  1R2U A;  4I5L B;  1M63 B;  1RK9 A;  1FW4 A;  2BKI B;  4C0J A;  1CMF A;  1NX2 A;  4AQJ A;  4DRW A;  4PHJ A;  2K2A A;  1GGW A;  2BKH B;  1U5I A;  3PFV A;  1KK7 Y;  1QIW A;  1TTX A;  2BBM A;  2RGI A;  3FIA A;  2JXC A;  4IL1 A;  4JWQ A;  1QLK A;  1IGV A;  2JNX A;  2LCP A;  5AXI A;  1G8I A;  1EG4 A;  3E3R A;  4CFQ A;  3TDZ A;  1B7T Z;  2MJW B;  5DKN A;  1HT9 A;  1B8R A;  1PUL A;  1CM4 A;  2KGR A;  4GGF C;  2FCE A;  2LUC A;  3AAJ A;  1V1F A;  2O5G A;  2WOS A;  4P5O E;  2K7D A;  2DOQ A;  1GJY A;  3DF0 A;  1S6I A;  2KBM A;  3BUM B;  4HRH A;  3BYA A;  2LLU A;  4ORC B;  3WHT B;  4DUQ A;  3JVT C;  1YRU B;  1CM1 A;  2LMT A;  3SG5 A;  1KSM A;  1OMD A;  4OV2 A;  2CT9 A;  1K93 D;  1QX5 B;  3TUY C;  1D1O A;  1S5G Z;  3JVT B;  2FJU B;  3PAT A;  1WY9 A;  4USL A;  3SG2 A;  2JU0 A;  4OKH A;  2JTZ A;  4YI8 A;  3CZT X;  2BE6 A;  2MAZ A;  1LA0 A;  3TDI A;  2ZNE A;  1FPW A;  2GV5 A;  1JC2 A;  4JPZ B;  2M1U A;  1K96 A;  3RM1 A;  5CPV A;  3CTN A;  2M1K B;  1YUU A;  1PAL A;  1QX2 A;  1ZOT B;  4GNK B;  3D0Y B;  2LAN A;  2R2I A;  5KU1 A;  3VRQ A;  3I5H C;  2PAL A;  2PAS A;  3DVM A;  4U8D A;  1YVL A;  2SCP A;  4YRU A;  4MBE A;  1DT7 B;  1ZUZ A;  4PAL A;  3I5H B;  1N0Y A;  1TNW A;  3OB2 B;  3DVK A;  4CID A;  1AVS A;  4HRE E;  1QV1 A;  5BPJ A;  4ZCV A;  3BOW A;  1MR8 A;  1NX0 A;  4DS7 A;  2LVK A;  2KNE A;  1XFW O;  2V53 A;  3VGO A;  3O4Y A;  4M2P A;  1B9A A;  3SIB A;  1DJG A;  4GUK A;  3MSE B;  1BJF A;  4NQG A;  1E8A A;  1N2D A;  3AKB A;  1OSA A;  1OOJ A;  2L50 A;  2L2E A;  2ZRT A;  1DJY A;  1EG3 A;  1YX7 A;  1F70 A;  1W7I B;  4HSZ A;  1IQ5 A;  1A2X A;  3K21 A;  1EH2 A;  3PM8 A;  4OCI A;  2BCX A;  1A03 A;  3M0W A;  4YGA A;  2EC6 B;  3WXA A;  2BCA A;  2M0R A;  2KFH A;  1J1E A;  2QAC A;  3EK8 A;  3O6B A;  3AAK A;  2M49 B;  1BU3 A;  1K9U A;  1SCV A;  1QAT A;  2AAO A;  3EK4 A;  1RWY A;  1UHH A;  2K61 A;  2KFF A;  2Q4U A;  1ALW A;  2LHL A;  2ZKM X;  1NSH A;  3I5I B;  2F8P A;  3WHU B;  1FI5 A;  3GK2 A;  2HF5 A;  3BUN B;  3HCM A;  1IWQ A;  1JF2 A;  5HLV A;  1CFF A;  1K9K A;  3FWC A;  2I2R E;  1UUS A;  4FTG A;  1SKT A;  1MHO A;  1UWO A;  1W7J B;  4AQI A;  4MN0 A;  1JSA A;  1C7V A;  3IQQ A;  1BF5 A;  2K7O A;  5D7F A;  1S36 A;  4FQO A;  1QJT A;  1NCY A;  1RFJ A;  1V1G A;  2LVI A;  2ZFD A;  4QJ5 B;  2BCB A;  3VRR A;  3KO0 A;  2NCO A;  1BMO A;  2LMU A;  2PRU A;  3DVJ A;  1VRK A;  4MRY A;  4GFT A;  1RRO A;  1WRZ A;  2L98 A;  2CNP A;  4MZL A;  3WNX B;  1JFJ A;  1NWD A;  1PRW A;  3SG4 A;  1KQV A;  1TCF A;  4ORB B;  2ZN8 A;  1BR4 B;  1F4O A;  4PHK A;  1S3P A;  1XFX O;  4GAO A;  1JUO A;  1J7R A;  1QTX A;  1U5I B;  1KWO C;  1K9P A;  1BR1 B;  1SYM A;  2JT3 A;  4PHM A;  5HYD A;  1MWN A;  3SG7 A;  1XVJ A;  1S6C A;  1YTZ C;  2PSR A;  3RLZ A;  1FF1 A;  2HQ8 A;  1KWO B;  1C07 A;  4JQ0 D;  3CR4 X;  1QX7 A;  2K2F A;  2F3Z A;  2LP3 A;  1FI6 A;  1UHJ A;  1S6J A;  4XYN A;  1KK8 C;  3DF0 B;  2Y9Y A;  1SPY A;  5TNC A;  1J7P A;  2I18 A;  3LCP C;  2VRG A;  1A75 B;  1F55 A;  2H2K A;  1AP4 A;  4PE4 A;  1A75 A;  4I5N B;  1SW8 A;  4XJK B;  1IQ3 A;  4N5X A;  3CWG A;  1CLB A;  2WC8 A;  3VRO A;  4XJK A;  5DKQ A;  4ORA B;  1GQM A;  2KI6 D;  4CFR A;  1CKK A;  3BXK A;  2NXQ A;  3CGA A;  1YUS A;  1L2O C;  4I5K A;  1NX1 A;  1Y0V H;  4YGC B;  3VRP A;  1WRK A;  1ZAC A;  3TUY B;  2CBL A;  2JNF A;  1XFV O;  2JRF A;  1EL4 A;  3A8R A;  1L2O B;  1L7Z A;  4OVN F;  1UP5 A;  2KAY A;  1Y1U A;  4Q04 A;  1KFX L;  2BE4 A;  2KI6 C;  1Y1X A;  1CTR A;  4PE1 A;  4DCK A;  1DJH A;  1B47 A;  1B8L A;  1DGU A;  1QV0 A;  1SMG A;  1KCY A;  4CLN A;  5I2Q A;  1YR5 A;  3BQ3 A;  1IJ5 A;  1PSR A;  2MA2 A;  1A29 A;  3BOW B;  1J7Q A;  1LXF C;  1KSO A;  4PE7 A;  2KAX A;  1CFD A;  5JOL A;  2Y5I A;  1ALV A;  4PE0 A;  2BBN A;  4MLW A;  1S26 D;  5AER A;  5AEQ A;  4YBH B;  3H4S E;  1J1D A;  2JWW A;  4WQ2 A;  5G08 A;  1LKJ A;  1DJX A;  3SJS A;  1TIZ A;  3GOF A;  2OS8 C;  1YRT B;  1K95 A;  3NSI A;  1OFC X;  2IS9 A;  4M2O A;  1XFU O;  2O60 A;  2JPT A;  4PDZ A;  4CPV A;  2GGM A;  1AK8 A;  1SL8 A;  2PMY A;  2KAV A;  3VRN A;  4PHN A;  3LLE A;  1SBJ A;  2MLF C;  2AUC A;  5I8N A;  4AOM A;  1BT6 A;  4YGE B;  3DD4 A;  1B8C A;  1TOP A;  1LIN A;  5HLO A;  2WCE A;  1OQP A;  5K89 A;  5ER4 X;  2BL0 C;  3SG3 A;  1TN4 A;  1G4Y R;  1NUB A;  4C0L A;  1CFP A;  1EJ3 A;  3ZNI A;  3F45 A;  3FS7 A;  1YX8 A;  5I2O A;  2BL0 B;  1IKU A;  1K2H A;  2MHH A;  1MXL C; 
#chains in the Genus database with same CATH topology
 1QVF O;  2KYC A;  1T3U A;  2OPO A;  1SQB D;  3H1L G;  1JF0 A;  4L9M A;  1RF0 A;  3FE8 A;  1MV8 A;  3U1A A;  5B8I B;  2AXC A;  5IBW A;  3I5G C;  2P6B B;  3H6P A;  2AEF A;  3FE9 A;  4WY4 D;  3G4S P;  4WWI A;  5TJH A;  5CJ4 A;  2XU6 A;  4MVF A;  1KFU L;  2LNK A;  1J55 A;  1RF1 B;  3EVU A;  4QMA A;  5CCG A;  3CX5 E;  1RF1 A;  3BUX B;  5GTH H;  3CLN A;  4AQR D;  5CSI A;  4HRG A;  2D2C B;  2W6J H;  5KSZ A;  1UII A;  5KLV K;  1KQG B;  3H1L J;  2LAP A;  1SY9 A;  2IPP A;  2PFX A;  2WPV B;  1QWV A;  1SQV E;  2PAJ A;  2L4I A;  2ZAE B;  2QJP C;  2HET A;  2MLE C;  1BG1 A;  1IG5 A;  1OZO A;  1EDI A;  1UUR A;  3U59 A;  2FKW B;  1SQB G;  3KDP B;  4KHX A;  1RE3 A;  1CMG A;  1CNP A;  1GD2 E;  2JUL A;  4NDD A;  3OX5 A;  3CCQ P;  1NVO A;  4GGF A;  3RBX A;  4GBA A;  2F2P A;  3AEA C;  1AJ4 A;  1IFJ A;  1SR6 B;  1B1G A;  2KLD A;  4A4C A;  3LK0 A;  2KHN A;  1HBW A;  1NTM D;  2K0J A;  4NPE A;  5CSN A;  2J59 M;  3B5N D;  2JOJ A;  1NJI Q;  2LMV A;  3BAS A;  2KBI A;  1IC2 A;  1M45 A;  2TN4 A;  2JC2 A;  3AKA A;  4TNC A;  1M1K Q;  3PTZ A;  1KIL C;  1WRG A;  1EC5 A;  2YGU A;  1DJI A;  5GTH E;  1J1D B;  1DJW A;  1LGH B;  4YGB B;  5AW2 B;  1XO5 A;  2M97 A;  1VF5 B;  1WRL A;  1ODB A;  3I5F C;  5GTI E;  2A4J A;  2WT7 A;  1FOS E;  1HVV A;  5D3O A;  1SQB J;  3WU2 E;  2LLS A;  2KGB C;  2L51 A;  2HPC B;  1VQL P;  3GK1 A;  1QXP A;  1TNX A;  1GL2 B;  2LM5 A;  4EIJ A;  1H4B A;  1GL2 A;  1CFC A;  2IDB A;  2E75 C;  3SWY A;  4Y99 B;  2L5X B;  2B87 B;  2MJZ A;  1LP1 A;  1JO5 A;  3LK1 A;  1EXR A;  1PSB A;  1LVC D;  2ZRS A;  1GTW A;  3DXL A;  2OYI B;  3H1H E;  3RL0 D;  1OW4 A;  1JY3 N;  1N65 A;  2W6A A;  1OOG A;  1K94 A;  1FC2 C;  2QA4 P;  1P84 H;  1XFZ O;  5CCG D;  3SS4 A;  5EFW B;  1KQF B;  2PVB A;  5AFP A;  1BGY E;  1NTM G;  1QIV A;  1WMK A;  2IBZ G;  1J2J B;  3TGU E;  1YVH A;  1FZB A;  3IF7 A;  1QAS A;  2JPO A;  2WPR A;  1CDN A;  1L0N D;  2ZXX A;  1AHR A;  1DEE G;  1ZR2 A;  2NLN A;  5KKZ C;  5AVV B;  2D2C D;  1KFU S;  2Y9Z A;  1VQO P;  2LV7 A;  3S0D A;  2IFM A;  1JY2 O;  3HE4 A;  1D7M A;  1N73 B;  2M7L A;  2L0P A;  4L73 A;  1DJZ A;  3CZ2 A;  1NTZ D;  1G1I A;  2OTG B;  3PH0 A;  2KOT A;  1EZV I;  3GMA A;  1H0T A;  1JUN A;  3CWB G;  5M1B A;  3CAB A;  1QLS A;  5HKY A;  1GZL A;  1DF0 B;  2Q3I A;  3ABV C;  5APX A;  3RK2 D;  2KFG A;  5KJ7 A;  1RK9 A;  1NTM J;  2E74 B;  5KLI C;  3PJS K;  1U5I A;  2ERB A;  2YXR B;  3L71 D;  3FIA A;  2JXC A;  1QLK A;  1IGV A;  2LCP A;  5AXI A;  4H13 B;  3E3R A;  1IJD B;  5DKN A;  3SS3 A;  1W5C E;  2LUC A;  3AAJ A;  1V1F A;  2O5G A;  3DF0 A;  2DW3 A;  5AVU B;  2PQL A;  2P7J A;  2YNY A;  1L0L K;  3D78 A;  1BE3 D;  3WHT B;  3CWB J;  1EZV E;  4OV2 A;  1D1O A;  3TUY C;  3KPE A;  3MGN A;  4USL A;  1S9K D;  1EQ7 A;  3SG2 A;  4N6J A;  1NTZ G;  2NZ2 A;  2BE6 A;  1LA0 A;  2QEH A;  5AVT B;  2CPB A;  4OH8 B;  1GL2 D;  2M1K B;  1YUU A;  3CPW O;  1PPJ E;  2JEE A;  2K3R A;  1PAL A;  1LWU C;  5KU1 A;  3I5H C;  2N1T C;  2PAL A;  2PAS A;  3DVM A;  3S0A A;  4ASV A;  3S0G A;  3N7N A;  3RK3 C;  1M90 Q;  4PAL A;  3HE5 B;  4YTP C;  1IFP A;  3IFM A;  3DVK A;  3L71 G;  1SQQ E;  1AVS A;  1SQX D;  2KOG A;  1KD1 Q;  1P28 A;  3QWO C;  2LVK A;  3VGO A;  1ZME C;  3SIB A;  4M2P A;  4GUK A;  4BRY A;  3MSE B;  4NQG A;  3VP9 A;  1OSA A;  2L2E A;  4IJ7 A;  1W2E A;  2ZRT A;  1DJY A;  2L5G B;  1SSE B;  1NTZ J;  1F70 A;  1W7I B;  3MTU E;  4CPG A;  1A2X A;  2ZFC A;  2BCA A;  2KFH A;  3EQ2 A;  1U57 A;  2WPQ A;  2LXB A;  5KLV G;  1QAT A;  3EK4 A;  4C7R A;  1RWY A;  1UHH A;  2Q4U A;  5BU8 B;  2LHL A;  2WSS H;  3GK2 A;  3IAO A;  1JF2 A;  1Z56 A;  5KAI E;  1CFF A;  1IK7 A;  1U7M A;  3FWC A;  4L75 A;  3H1I D;  3L71 J;  5KJ7 D;  3VP8 A;  1DEL A;  3L4A A;  2OTK E;  1UWO A;  1LJ2 A;  3C1L A;  3WUT A;  2LXC B;  2E74 D;  1JSA A;  1YQ3 C;  3JCU H;  5D7F A;  1ZXG A;  2XKM A;  4AUW A;  1N7S B;  1CI6 A;  5APT A;  2NCO A;  3EFG A;  1BMO A;  1N7S A;  4MRY A;  4W7Z A;  5CBN A;  1OOF A;  5KLV J;  4PHK A;  1BR4 B;  3CMA P;  1RQU A;  1XFX O;  5E79 H;  2E5Y A;  1AV1 A;  1KFN A;  2JT3 A;  2KZI A;  5TIS E;  1XVJ A;  3JSV C;  4EOT A;  1S6C A;  3L70 G;  2F3Z A;  2LP3 A;  1ZW0 A;  4RO0 A;  2Y9Y A;  1YJ9 P;  5APQ A;  3OW2 O;  2JDI H;  2M3B A;  3GHG B;  1SW8 A;  4N5X A;  1GDT A;  3B8E B;  2R3C A;  3NHT A;  3VRO A;  3H1I G;  3JC2 2;  4GOE A;  1T3J A;  2A45 H;  3M91 A;  2KI6 D;  3BXK A;  2K88 A;  1DD3 A;  1G2C B;  2H7H A;  3D77 A;  3CGA A;  2B9B A;  1PP9 G;  4OGQ B;  1L2O C;  4I5K A;  3VRP A;  1Q90 D;  3TUY B;  1XFV O;  2JRF A;  3L73 E;  1R5S A;  1EL4 A;  3HRN A;  3B71 A;  1Y1U A;  4U7J A;  1KFX L;  2KP8 A;  3L70 J;  1LT9 B;  1S2E A;  1B8L A;  1SQV K;  2M5A A;  1L0L D;  3AEC C;  1SMG A;  1KCY A;  2IZ1 A;  2O01 N;  5I2Q A;  1YR5 A;  2P2U A;  2PP6 A;  1A29 A;  3D71 A;  3BOW B;  2L91 A;  3CCJ P;  1JY3 O;  1RE4 A;  1L4A C;  3H1I J;  1PGO A;  1BCC D;  4PE0 A;  1KMI Z;  1W2B O;  5AEQ A;  4YBH B;  2OYO A;  1OMI A;  1M1J C;  1YI2 P;  3B4S A;  1PP9 J;  2OS8 C;  2J58 A;  2IS9 A;  3MUD C;  1XFU O;  2JPT A;  4PDZ A;  1SQP E;  3HUS B;  2GGM A;  3BCC E;  1SL8 A;  1NTK E;  2QEV A;  3LLE A;  2H88 C;  2P1J A;  2Z5I A;  4AOM A;  1BT6 A;  1X9V A;  3A3Y B;  1LIN A;  1N7S D;  2WCE A;  5K89 A;  1CFP A;  1G4Y R;  3Q5R A;  4DT0 A;  3V2L A;  2L5Y A;  1IFN A;  2AXT E;  1YX8 A;  1DX7 A;  1F71 A;  1MXL C;  2E30 A;  3AE8 C;  1JFK A;  1JM0 A;  1FZC B;  1PZQ A;  1URQ B;  4HB1 A;  3HX4 A;  2HQW A;  1ZP0 C;  2NPS B;  1FZC A;  1NCZ A;  1L0L G;  1KIL E;  2ZT9 D;  1DEK A;  3PLF B;  2XV5 A;  5FI7 A;  4IFD K;  1BOD A;  3RL0 C;  1GK6 A;  3T97 A;  4UB6 E;  3FE6 A;  2EHB A;  3GF3 A;  2WSC J;  1HF9 A;  2K7B A;  1KZU B;  4I1L A;  1RF1 C;  1PGQ A;  2CCM A;  5EL2 A;  3LW5 H;  3RL0 g;  1TRF A;  2D2C C;  1SFC A;  3S1K A;  2R5D A;  1G33 A;  4PCW A;  4OGQ D;  1Q81 Q;  3CYZ A;  3CLQ A;  1K73 Q;  4F0Z B;  4D6T E;  4FQT A;  1KYO D;  1WDC B;  2I94 A;  1JBA A;  1F54 A;  1CLM A;  1S72 P;  1L0L J;  4WY4 B;  1VQ9 P;  4B86 A;  4MZK A;  2WMM A;  2F2O A;  1UHN A;  1DVI A;  1A02 F;  1CDL A;  1FJK A;  2KIK A;  3CR5 X;  3RK2 C;  1B4C A;  1F4Q A;  1RTP 1;  5AW1 B;  1KFX S;  2KSE A;  3UNW A;  2HOD A;  2D8N A;  3NSO A;  4QJ3 B;  4BY4 A;  1NU1 E;  1SR6 C;  3F5H A;  3JTD B;  5H2F H;  4IL6 E;  5AW7 B;  2IYO A;  4N78 E;  5APS A;  2Q7C A;  3M06 A;  1KC8 Q;  2IZ0 A;  3HD7 A;  1Q2N A;  2M3W A;  1C3Z A;  3H1K G;  3CC4 P;  2JTT A;  1TWO A;  2NZ0 A;  1MUU A;  2QPT A;  1IRJ A;  1OMV A;  2CTN A;  1QX8 A;  1YIJ P;  4O9B A;  2JXL A;  2KLU A;  2FYU E;  3NHI A;  1QS7 A;  4INX A;  1HGV A;  3CX5 D;  2H8P D;  3USS A;  3D0Y A;  4LGD E;  2K1A A;  4NPD A;  1S5G Y;  3CL3 D;  1T8Z A;  3B5N B;  1G1J A;  2OS8 B;  1GL2 C;  1L0N K;  4E68 A;  2K8M B;  1J7O A;  2C0W A;  4OR9 B;  2O1K A;  1SQV D;  4Y99 C;  3R1P A;  1NKZ B;  1X79 B;  3AE3 C;  4EYY Q;  2JO1 A;  4N1F A;  2R32 A;  5DJT B;  3H1K J;  1XA5 A;  5B66 E;  1MXE A;  3N4X A;  2OYI C;  2M0B A;  2H61 C;  2A06 E;  4GIF A;  3LL8 B;  4Z1M H;  2NCP A;  4PV1 B;  1M31 A;  3I5I C;  2L4H A;  1XFY O;  2W6B A;  3CD6 P;  2FBW C;  3L72 D;  1JOC A;  3CI9 A;  3V5B A;  1CDP A;  1KFM A;  3FX0 A;  2E43 A;  1GGZ A;  3D70 A;  1SFC D;  3U1C A;  4YGD B;  1XFR A;  1SL9 A;  5CSJ A;  2KPH A;  1S1E A;  1JCC A;  2LP2 A;  4ICB A;  3CCU P;  2YIU B;  2K60 A;  1N73 C;  2QEX P;  3RL0 B;  2LUX A;  3LID A;  1WLZ A;  2KI4 B;  2OTG C;  1SCM B;  1LA3 A;  1TNP A;  1SLQ A;  3TF5 A;  1KN7 A;  5PAL A;  1VDF A;  3NSL A;  1OXZ A;  2P67 A;  4YXD C;  5AAN A;  3OP0 A;  2IX7 C;  2Y1N A;  1N86 A;  5D69 A;  2MBX A;  2E74 C;  1R2U A;  2WVR A;  3G6E P;  3PM2 A;  1NX2 A;  3L74 E;  4DRW A;  3A0B E;  4H13 C;  2BKH B;  3HD7 D;  2RGI A;  2JNX A;  1G8I A;  3R1O A;  2WCM A;  4CFQ A;  2QE7 H;  3E7K A;  4C46 A;  3L75 E;  2KGR A;  1CM4 A;  3L72 G;  4IFM A;  2V7Q J;  3H1H D;  3RK2 B;  2K7D A;  2KBM A;  3CXH H;  1H88 A;  3V2R A;  3W68 A;  3BYA A;  1R5L A;  2LLU A;  3TGU D;  1BGY D;  4ORC B;  4GT1 A;  3SSU A;  1DIP A;  1FZG A;  2BNX A;  1SQX K;  4H44 D;  2LMT A;  2O01 J;  1OVU A;  1QX5 B;  1S5G Z;  3JVT B;  3CXH I;  3PAT A;  1WY9 A;  1KOR A;  2KZJ A;  5AW6 B;  3CZT X;  4JPZ B;  1HUC A;  2M1U A;  4C7N A;  1K96 A;  4XFJ A;  3K5B A;  1QL2 A;  1K8A Q;  2C9L Y;  5CPV A;  3CTN A;  3BRT B;  3Q8I A;  2ZYA A;  5B5E H;  2WT7 B;  3VRQ A;  3L72 J;  4U8D A;  1YVL A;  2SCP A;  4PV1 D;  1OVV A;  1QV1 A;  3CCE P;  4ZCV A;  1MR8 A;  4DS7 A;  2QJY B;  1ZLL A;  1BDC A;  2V53 A;  1B9A A;  1FAV A;  3V2Q A;  1LP1 B;  3H1H G;  1T14 A;  3VMZ A;  1N2D A;  3AKB A;  3CXH E;  3P32 A;  1VQN P;  3H32 A;  3BFA A;  2IBZ I;  2OQQ A;  1KQL A;  1EH2 A;  3S9O A;  2KS1 A;  1J1E B;  1UIX A;  2M3E A;  2ZJS E;  3TGU G;  3M0W A;  4YGA A;  3SS5 A;  1BGY G;  3WXA A;  1J1E A;  3EK8 A;  3R72 A;  1SCV A;  1K9U A;  1USD A;  2OYH A;  3I5I B;  2PGD A;  1ALW A;  1FI5 A;  1NSH A;  2F8P A;  1E79 H;  2YO3 A;  1Y47 A;  2WCH A;  2HF5 A;  1EZV D;  2JWA A;  3AE9 C;  3CZ1 A;  2GM4 A;  3EWK A;  3G9R A;  3S0E A;  3BRV B;  1P84 I;  4JYC A;  1LTJ A;  3HE4 B;  1W7J B;  3V4W A;  1N7S C;  3IQQ A;  1BF5 A;  1PPJ D;  3H1H J;  2MKV A;  1NCY A;  1V1G A;  3L37 A;  2ZFD A;  1H0T B;  2QEB A;  2WCK A;  3DVJ A;  2IBZ E;  4GFT A;  3TGU J;  1BGY J;  1S1C X;  2L98 A;  5C39 A;  2JP3 A;  1NWD A;  3KYQ A;  4GAO A;  3V2P A;  1QTX A;  1U5I B;  1K9P A;  5HYD A;  1SYM A;  3VMY A;  1JY2 P;  4JYB A;  3CC2 P;  1YTZ C;  5CJ0 A;  1FF1 A;  2HQ8 A;  4JQ0 D;  1JCD A;  3M9B A;  1P84 E;  1Q7Y Q;  1S6J A;  4XYN A;  1KK8 C;  3DF0 B;  3GHG C;  1J7P A;  3CWB E;  3LCP C;  3GLM A;  2WC5 A;  1EZV G;  4HH2 A;  4H0L D;  1L0N G;  4XJK B;  4W7Y A;  4LLH A;  4IL6 X;  4XJK A;  5DKQ A;  1KB9 D;  4ORA B;  1OIP A;  4OGQ C;  1K05 A;  4CFR A;  2NXQ A;  1RQV A;  2P70 A;  4YGC B;  4M3L A;  1ZAC A;  1PPJ G;  2CBL A;  3PRJ A;  2JNF A;  2HR3 A;  1JMB A;  3PJI A;  1LT9 C;  3A8R A;  2W27 A;  3P8C E;  1UP5 A;  2KAY A;  1DQE A;  1VQP P;  2BE4 A;  2KNC A;  4JBZ A;  4PE1 A;  4DCK A;  3C8V A;  5BU5 A;  4DOJ A;  1B47 A;  2IFN A;  1QV0 A;  5L8R J;  1AVY A;  4CLN A;  3TNU A;  3BQ3 A;  1L0N J;  1KSO A;  1CFD A;  4PT1 A;  5JOL A;  3W67 A;  3PHL A;  2Y5I A;  2BBN A;  4BRY B;  1NTZ E;  3H25 A;  4XE5 B;  1FDM A;  2OTJ P;  3D75 A;  4WQ2 A;  1NU1 K;  1K9M Q;  1MFZ A;  1DJX A;  3HUS C;  2OTL P;  1Y9B A;  1KIL A;  2Q9I A;  1Y8A A;  3AEB C;  2O60 A;  1BE3 G;  4IOI H;  1ZR4 A;  3VRN A;  1GU5 A;  3P7K A;  2MLF C;  2AUC A;  2ITA A;  1TUZ A;  1TOP A;  4I7Z B;  2Z4E A;  4C0L A;  1GW3 A;  3WMM 0;  2G8Y A;  1EJ3 A;  2FYU K;  1HJ0 A;  5I2O A;  4A7P A;  2BL0 B;  1IKU A;  4EDF A;  4GNK B;  1FZC C;  1URQ C;  3M9Q A;  1NPQ A;  2NPS C;  3O8Z A;  1A4P A;  4LC1 A;  3L73 D;  3EK7 A;  1T6A A;  2Z5H A;  2JT8 A;  3L47 A;  2HPS A;  1CI6 B;  4QJ4 B;  3I5C A;  1C3Y A;  3EKH A;  5KLV E;  4TT3 H;  3B7A A;  4HJG H;  1HQV A;  3KEV A;  1BE3 J;  1SQX G;  3OBV A;  5CMZ A;  3SWK A;  1QVI Z;  3S0B A;  3TDK A;  4BXL A;  1M39 A;  2PYQ A;  3CS1 A;  1FZF A;  1IJ6 A;  1SFC C;  2XNX A;  2BEQ D;  1NYA A;  2XZR A;  3MHV A;  4D1E A;  3H1J D;  2C9N Y;  4ZKU A;  2EGD A;  3D10 A;  2ZT9 B;  5KTY A;  2K7C A;  5CCH A;  2YKO A;  1WDC C;  2POH A;  4WB4 A;  4WVZ A;  1KQM B;  1XK4 A;  1SQP D;  2WSF J;  1FDO A;  4WY4 C;  3G71 P;  1VQ8 P;  2WQY C;  3BCC D;  2QDI A;  1KK8 B;  3IQO A;  1H8B A;  2E6W A;  5CSF A;  1LTS C;  3EVV A;  3NMD A;  2K9J A;  3V6I A;  1SQX J;  2QG4 A;  1AUI B;  1VPC A;  3JCU E;  1FBV A;  1ZV8 A;  1ZMZ A;  2LVV A;  2JZI A;  3JTD C;  2WPS A;  4JKT A;  1TCO B;  3L70 E;  4MZJ A;  1EDJ A;  2W8Z A;  2KLE A;  2GA1 A;  3KHU A;  2A45 I;  4HYT B;  3M0A A;  1DH3 A;  5JJG A;  2KLV A;  1CSB A;  1VQ4 P;  1KIL D;  4OWF A;  4GPL B;  3B87 A;  3SIA A;  2M5A B;  2Y1M A;  5E79 E;  3D76 A;  2OAR A;  1B7T Y;  4Y28 J;  1PL5 A;  3HTK A;  1AJY A;  4AYC A;  2G9B A;  1FZE A;  2I7A A;  1X02 A;  1MUX A;  2YMY A;  2WSC H;  4N1G A;  3H1J G;  1WT6 A;  1NIW A;  1PP9 E;  3VN0 A;  3Q5S A;  4I5J A;  2FOT A;  2JJL A;  3AEG C;  4NDB A;  3BUO B;  1C7W A;  1CLL A;  4M2Q A;  1NAY A;  3ZWH A;  3B5N C;  3BCC G;  1NCX A;  3NXS A;  2E75 D;  1R8E A;  4MSP A;  4D6T D;  3CR2 A;  3CCR P;  1AJ5 A;  1USE A;  1YBK A;  1LWU A;  2N1T A;  4UPG A;  4GGN A;  1SNL A;  1R6P A;  1JY3 P;  1CB1 A;  3RGU A;  4A4B A;  5DIC A;  1WLM A;  1Y6W A;  3R4Y A;  2BAS A;  1NX3 A;  1QGK B;  4PV1 C;  3S0F A;  2Q1K A;  2Q91 A;  2BAP A;  3H1J J;  1SRA A;  1ZRT E;  5GQQ C;  1RF0 C;  2BCC E;  1NU1 D;  1K8U A;  2M29 A;  1FE6 A;  2W83 C;  1YHQ P;  4N3Y B;  1QLE D;  4KJM A;  1BSH A;  2LC5 A;  3OX6 A;  4K3A A;  1JNM A;  1FJP A;  4NDC A;  4R4M A;  3TDU A;  1DMO A;  2W90 A;  4N78 D;  3BCC J;  2QEO A;  2FFD A;  5CCH D;  2B1U A;  2YIU C;  1M46 A;  3Q5P A;  3T97 B;  5ER5 A;  3FWB A;  3NTN A;  2KI4 C;  5FYX A;  1CDM A;  1K04 A;  1SCM C;  3KPX A;  1ZFS A;  1E5W A;  1BCC G;  1MFT A;  5HL1 A;  5CCG C;  2MRD A;  1AQT A;  5KAF H;  3TZ1 A;  1EDL A;  4EI2 A;  1NP8 A;  1IH0 A;  4K35 A;  2YXQ B;  1XYD A;  2FYU D;  1KK7 Z;  1SFC B;  3L35 A;  4D6T G;  3NGV A;  2KDH A;  2I1J A;  2BEC A;  1DTL A;  2M7N A;  3B88 A;  1L0L E;  2ZND A;  2LLT A;  4PD4 H;  2BKI B;  1CMF A;  1M7L A;  4I6M C;  1GGW A;  3AE7 C;  3PFV A;  1TTX A;  2BBM A;  4IL1 A;  4JWQ A;  1RE3 C;  3PP5 A;  3VB1 A;  4PD4 I;  1BCC J;  1B7T Z;  2MJW B;  1NU1 G;  2A06 D;  1YTZ I;  3FGA D;  1B8R A;  4GGF C;  4ASW A;  2HOD B;  4U3F E;  2R44 A;  2WOS A;  4P5O E;  2DOQ A;  3SWF A;  1S6I A;  2WZ7 A;  2ZVN B;  2FXM A;  2YKP A;  1OX3 A;  4JD9 A;  3BAT A;  3AE5 C;  3HD7 B;  3JVT C;  3F89 A;  1CM1 A;  1JEK A;  1KYO H;  2YO2 A;  1KSM A;  1OMD A;  2CK3 H;  5KAF E;  2CT9 A;  3CDN A;  3OJA B;  2FJU B;  2N1T D;  3AE6 C;  4GKG A;  1ZN5 A;  2JTZ A;  4YI8 A;  2FYU G;  2ZNE A;  2GV5 A;  1JC2 A;  3DY9 A;  3PLN A;  3A0H H;  4L76 A;  3RM1 A;  3SFD C;  5AVX B;  1ZOT B;  3D0Y B;  1NU1 J;  2R2I A;  4H44 B;  4PD4 E;  2RKL A;  1XTG B;  3VOP A;  4YRU A;  3QME A;  2E76 B;  4MBE A;  5DJU B;  2VRS A;  2QJY C;  1N0Y A;  1TNW A;  3FWN A;  3H1K E;  1CW5 A;  3L74 D;  1M56 D;  2KYV A;  2H89 C;  2N9B A;  1IZN B;  2A06 G;  1DJG A;  1LTT C;  1L4A A;  1YYC A;  1J1E C;  1E8A A;  2LKM A;  2ZXE B;  3L75 D;  2FYU J;  2KI7 B;  1IQ5 A;  1U7J A;  5H2F E;  1A03 A;  2V7Q H;  1M1J A;  3CX5 H;  2M0R A;  3O6B A;  2GUV A;  2K61 A;  2KFF A;  2ZKM X;  1SQQ K;  1Q86 Q;  3BUN B;  3HCM A;  1IWQ A;  2O01 H;  1YJW P;  2B89 A;  3A0H E;  1UUS A;  4FTG A;  3RK3 E;  4I2L C;  3O6Q A;  3L36 A;  1YQ4 C;  3I55 P;  3TYY A;  2K7O A;  3AE2 C;  1TUJ A;  4FQO A;  1RFJ A;  5AW8 B;  4QJ5 B;  1JTH B;  1OW7 A;  1OW6 A;  3KO0 A;  1YTZ T;  5KJ7 C;  3D74 A;  2M8R A;  1JTH A;  3MP7 B;  3H1L E;  1T2K D;  3WNX B;  2HYN A;  3L74 G;  1PRW A;  3SG4 A;  1TCF A;  1SQV G;  2ZYG A;  1OOI X;  4PHM A;  1BR1 B;  3B86 A;  1MWN A;  2LR2 A;  3IF4 A;  1IK9 A;  4W80 A;  3L75 G;  2PSR A;  2QSI A;  3L4F A;  1KWO B;  1LTG C;  3CXH D;  4RJT A;  1QX7 A;  2K2F A;  5AVQ B;  1FI6 A;  1QVG O;  1FBM A;  1NHL A;  3KQG A;  5GTI H;  1YIT P;  3DYE A;  2VRG A;  1A75 B;  1F55 A;  3WU2 H;  2H2K A;  1AP4 A;  1HGZ A;  4PE4 A;  3MD0 A;  1A75 A;  1IQ3 A;  3CWG A;  1CLB A;  2WC8 A;  3CZ0 A;  2RN0 A;  3L74 J;  2FXO A;  1L2P A;  1CKK A;  2E76 D;  1VQM P;  1SQV J;  1Y0V H;  1VQ7 P;  1WRK A;  2RMZ A;  2JWD A;  2H8V A;  5AVS B;  4C7N B;  2WWW A;  3BJH A;  2NRG A;  1L7Z A;  3L72 E;  3L75 J;  2JKV A;  1SQB E;  2WSE H;  4H0L B;  1L4A D;  2KI6 C;  1Y1X A;  1CTR A;  1S3J A;  5AVW B;  3ITK A;  5AVY B;  3CME P;  2IBZ D;  2R5B A;  1HTL C;  1IJ5 A;  1PSR A;  2MA2 A;  3AEE C;  1XTC C;  4HKZ H;  3M9H A;  3VMA A;  3D6Y A;  4PE7 A;  3KZI H;  2KAX A;  1YJN P;  1ORG A;  3TK1 A;  1ALV A;  1S26 D;  5AER A;  4KYN A;  1J1D A;  2SPZ A;  3GW6 A;  3SJS A;  3H32 B;  4NPF X;  3FWL A;  1OFC X;  2Y0C A;  2KS1 B;  4UB8 H;  1P84 D;  1AK8 A;  3CWB D;  2HPC A;  4PHN A;  1JMM A;  4I7Z C;  3N7H A;  2OYH B;  1SBJ A;  3G3Z A;  1RH5 B;  1X22 A;  5HLO A;  3UIA A;  1OQP A;  2BL0 C;  1GW4 A;  4PJ0 H;  2QJK B;  2Q3E A;  4IFF A;  3ZNI A;  3F45 A;  3FS7 A;  1PIX A;  1LTJ B;  2B87 A;  3M0D A;  1PFI A;  1K2H A;  2YKQ A;  2MHH A;  4F7F A;  1VQK P;  5B5E E;  3PAL A;  2AEJ A;  1HJB A;  2QVA A;  3E1R A;  2OYI A;  2WND A;  2WTY A;  5HKZ A;  3P8C D;  2H61 A;  2ISD A;  3V4Q A;  1SQP K;  2WSE J;  1IIO A;  1GK4 A;  1NTK K;  3P8M C;  3TSI A;  1KQS O;  1DGV A;  1A02 J;  2GGZ A;  1LTA C;  3PN7 C;  3R1V A;  3C9I A;  5HKW A;  5F6T A;  1NTM E;  3KZI E;  5CHX A;  2KQ6 A;  3KF9 A;  1DEB A;  3NSK A;  3D6Z A;  1TNQ A;  3NFQ A;  2KSP A;  1F8H A;  1QL1 A;  3IR9 A;  3EVR A;  3FXE A;  1PGJ A;  1SQQ D;  1OE9 B;  2FYN C;  3I5G B;  5CCH C;  3TS5 C;  2ZT9 C;  1UHK A;  4UB8 E;  1NKN A;  1N73 A;  1XK4 C;  1BLQ A;  3C1V A;  4OZD A;  2FJY A;  1SK6 D;  1KQM C;  5DKR A;  2WOR A;  1DD4 A;  2CXJ A;  3GK4 X;  3IN6 A;  1QVI Y;  1DF0 A;  2COL B;  2Y4Q A;  4PJ0 E;  1REC A;  1Q80 A;  3CCV P;  3NXA A;  4DIR A;  1JWD A;  4ETO A;  1VQ6 P;  3PSR A;  5AW9 B;  2XDJ A;  1X0T A;  5CBO A;  3CCS P;  2FCD A;  1PVA A;  1NGM B;  4GDO A;  2QJP B;  3A5T A;  5FI2 A;  2G2B A;  3A4U B;  4WQ3 A;  2QM8 A;  2O3J A;  1GM0 A;  2ZN9 A;  3OB1 B;  5J3X A;  1Z4H A;  1K90 D;  4DJG A;  1LT1 A;  2KNC B;  5AW0 B;  1BOC A;  3O78 A;  4BY5 A;  1VF5 D;  5KLV D;  3O2P A;  3EG5 B;  3MZW B;  1RE4 C;  2JT0 A;  1L0N E;  1SQQ G;  3TNU B;  1PK0 D;  3VMX A;  1AVO A;  1OWA A;  2HG5 D;  2WCB A;  2JQ6 A;  3EKJ A;  1PVB A;  4WRI A;  1S5L H;  1KB9 H;  1LTI C;  2F33 A;  5KAI H;  3VYI A;  1YUT A;  3GF7 A;  2YMK A;  1EXJ A;  1OW8 A;  3MIW A;  5APY A;  2FYZ A;  1CZQ A;  1MQ1 A;  1KIL B;  4YI9 A;  4ZCU A;  3Q1M A;  1KB9 I;  2IYP A;  3I5F B;  1NAF A;  2WCL A;  1OZS A;  1RJV A;  2WSF H;  5I2L A;  2KQY A;  3HE5 A;  3LIE A;  1SL7 A;  5AW5 B;  1LTB C;  2LVJ A;  2I8D A;  3V2N A;  2WCF A;  1Y1A A;  2F3Y A;  4MEW A;  3L71 E;  3DVE A;  2LHI A;  4MRX A;  1SQQ J;  4P2Y B;  1SS1 A;  1UHI A;  4KT0 J;  2EC6 C;  2R3S A;  1NWQ A;  5TIS H;  2K9Y A;  2SAS A;  3KHE A;  2E75 B;  2AMI A;  1VQ5 P;  2ZYD A;  1YUR A;  5AVZ B;  3BFB A;  4RES B;  2PRR A;  2FFD C;  3L70 D;  4R1E A;  3EFF K;  2M8U A;  1Z2C B;  1MF8 B;  3BUW B;  2JR8 A;  1BE3 E;  2LE9 B;  4TLF A;  3SG6 A;  1S5L E;  1KB9 E;  1OMR A;  3R2P A;  1GMJ A;  2K37 A;  1PGP A;  3FXD A;  3QRX A;  4C0K A;  1S9K E;  3PN7 B;  3OHM B;  5KKZ B;  4YPC A;  1PP9 D;  1H8A A;  3E1I A;  2H43 A;  1OZH A;  3AEF C;  2FYN B;  4DZO A;  4ZKP A;  4H13 D;  1N8R Q;  3TS5 B;  1EXI A;  4GOF A;  3ICB A;  2KYF A;  3SFE C;  2M9G A;  1MKM A;  2QRX A;  3BVH A;  1NTK D;  4I5L B;  2N9Y B;  1IO4 A;  1M63 B;  1SQX E;  1FW4 A;  4C0J A;  3Q3D A;  4AQJ A;  2P71 A;  4PHJ A;  2K9J B;  2K2A A;  2V4H A;  1DC1 A;  3DZT A;  1N7L A;  4YXW H;  1KK7 Y;  1QIW A;  1T2K C;  1RY3 A;  4L74 A;  3WUV A;  3UO9 A;  3AE4 C;  3BFH A;  1EG4 A;  1IFI A;  5KLI B;  1RHZ B;  3TDZ A;  1HT9 A;  3L73 G;  1PUL A;  2FCE A;  1ZRT D;  5AVR B;  3RBZ A;  1GJY A;  2BCC D;  2BEZ F;  2Q5U A;  3HD7 C;  2L2C A;  3BUM B;  1NOH A;  4HRH A;  3O4X A;  1GU4 A;  1BSN A;  3L4L A;  3GHG A;  4DUQ A;  3AED C;  2C0X A;  1YRU B;  2KB7 P;  3SG5 A;  1LNQ A;  3HTK B;  1K93 D;  2GUS A;  1QEX A;  3H1I E;  1G2C A;  3CC7 P;  2JU0 A;  4OKH A;  4ZMD A;  2MAZ A;  3TDI A;  1EDK A;  1FPW A;  1NH4 A;  4BWN A;  2AXT H;  4H44 C;  3B6X A;  1TU3 F;  1QX2 A;  1FZA A;  2E76 C;  2LAN A;  3L73 J;  1SQP G;  1X8Y A;  4XA4 A;  1LT9 A;  1JB0 J;  1HH0 A;  1NTK G;  2Y0E A;  2A45 G;  1FS0 E;  1LWU B;  1DT7 B;  1ZUZ A;  1SP4 A;  3I5H B;  2N1T B;  3OB2 B;  3RK3 B;  4CID A;  4HRE E;  2O1J A;  5BPJ A;  3BOW A;  1NX0 A;  2KNE A;  4UB6 H;  1XFW O;  3O4Y A;  2OGU A;  2G3A A;  3H1J E;  1BJF A;  5AW4 B;  2WC6 A;  1OOJ A;  1SQB K;  2BCC G;  2L50 A;  2ZVO B;  1EG3 A;  1YX7 A;  4HSZ A;  1W9Z A;  3K21 A;  2J5U A;  4U3F D;  3PM8 A;  4OCI A;  2BCX A;  2EC6 B;  3HUS A;  2QAC A;  1FU1 A;  3AAK A;  2M49 B;  1BU3 A;  2AAO A;  2FFD B;  1SQP J;  1LS8 A;  3WHU B;  1NTK J;  5BVZ A;  3K1E A;  2KK7 A;  1KV4 A;  5HLV A;  2HLO A;  3A2A A;  1K9K A;  3IVT A;  2I2R E;  2FY8 A;  2RH0 A;  5APV A;  2XND H;  4JF7 A;  1SKT A;  1MHO A;  2HFE D;  1AFO A;  1M57 D;  4AQI A;  4MN0 A;  1C7V A;  1H89 A;  1NO4 A;  2I1K A;  1S36 A;  1QJT A;  2LVI A;  1URQ A;  1ZOY C;  2BCC J;  2BCB A;  3VRR A;  1M8O B;  3D73 A;  1S4X A;  2NPS A;  2QM7 A;  1IFM A;  4PD4 D;  3Q2Y A;  2LMU A;  2PRU A;  3A7O A;  2KXP B;  1VRK A;  4INW A;  2E5T A;  1RRO A;  1WRZ A;  4IL6 H;  2Q6Q A;  2CNP A;  4MZL A;  1JFJ A;  4ZNC A;  1KQV A;  3GG2 A;  4ORB B;  2ZN8 A;  1F4O A;  2GTE A;  1S3P A;  3H1K D;  1JUO A;  2QIW A;  1FOS F;  1J7R A;  3QH9 A;  1KWO C;  1BCC E;  4WBA A;  3SG7 A;  2FXP A;  3CCM P;  5APU A;  1OOH A;  3RLZ A;  2WCJ A;  4U3F G;  2KUB A;  1C07 A;  1SVF A;  3CR4 X;  1UHJ A;  1IFD A;  2P58 A;  2UWJ E;  4RKU J;  5KTB A;  1SPY A;  5TNC A;  2I18 A;  3OGN A;  1NTM K;  1JY2 N;  1AA0 A;  4I5N B;  3KXD A;  4D6T J;  4WY4 A;  3OAK A;  3VTP C;  1GQM A;  2KSJ A;  5AW3 B;  1YUS A;  1NX1 A;  3RK3 D;  5B66 H;  4H0L C;  1KYO I;  1PV3 A;  1L2O B;  4OVN F;  2B88 A;  4U3F J;  2E42 A;  4R4L A;  4Q04 A;  1DJH A;  1Q82 Q;  3H1L D;  3S4R A;  4GOD A;  1DGU A;  3WUU A;  1NYH A;  1HWT C;  1OVR A;  4MN4 C;  1J1D C;  1VL2 A;  1J7Q A;  5APW A;  1LXF C;  1FDI A;  1N2D C;  1VF5 C;  2P10 A;  3LW5 J;  4MLW A;  3H4S E;  1L4A B;  2JWW A;  3RZS A;  5G08 A;  3I56 P;  1LKJ A;  1KTM A;  1TIZ A;  3GOF A;  1YRT B;  1K95 A;  3AE1 C;  3NSI A;  5I94 A;  2OYH C;  4M2O A;  1M1J B;  4CPV A;  3OA7 A;  1KYO E;  2PMY A;  2AEM A;  2KAV A;  3B5N A;  2CPS A;  5K5G B;  5I8N A;  1URQ D;  3MUD A;  4YGE B;  2QJK C;  2NPS D;  3DD4 A;  1B8C A;  3M0D C;  1AQ5 A;  2Y0D A;  5ER4 X;  3SG3 A;  1TN4 A;  1LTJ C;  1NUB A;  3ZDM A;  5FI6 A;  1S5L X;  1BDD A;  3CX5 I;  3A0B H;  3CCL P;  1NTZ K;  1MZ9 A;  2WIT A;  3II6 A;  3O6Q B; 
#chains in the Genus database with same CATH homology
 2E30 A;  3PAL A;  2KYC A;  1NPQ A;  1A4P A;  1JFK A;  2WND A;  3EK7 A;  5HKZ A;  2H61 A;  2OPO A;  2ISD A;  2JT8 A;  3HX4 A;  1JF0 A;  2HPS A;  2HQW A;  4L9M A;  1NCZ A;  4QJ4 B;  1DGV A;  2GGZ A;  3EKH A;  3PN7 C;  3PLF B;  5B8I B;  1HQV A;  5HKW A;  5F6T A;  3KEV A;  1BOD A;  2KQ6 A;  3KF9 A;  3NSK A;  1TNQ A;  5IBW A;  1QVI Z;  2KSP A;  3I5G C;  1F8H A;  2EHB A;  3EVR A;  1M39 A;  2P6B B;  3CS1 A;  2K7B A;  1IJ6 A;  1OE9 B;  2CCM A;  3I5G B;  3TS5 C;  1NYA A;  4MVF A;  1KFU L;  1UHK A;  2LNK A;  1J55 A;  4D1E A;  1XK4 C;  3EVU A;  1BLQ A;  2EGD A;  3C1V A;  1SK6 D;  1TRF A;  1KQM C;  3D10 A;  5KTY A;  2K7C A;  3BUX B;  1WDC C;  3CLN A;  5DKR A;  2WOR A;  1G33 A;  5CSI A;  2CXJ A;  4PCW A;  4HRG A;  3GK4 X;  1KQM B;  4F0Z B;  5KSZ A;  1QVI Y;  1XK4 A;  1DF0 A;  2COL B;  1WDC B;  2Y4Q A;  2I94 A;  1JBA A;  1F54 A;  1CLM A;  2LAP A;  1KK8 B;  3IQO A;  1REC A;  1Q80 A;  1SY9 A;  1H8B A;  2E6W A;  4MZK A;  5CSF A;  3NXA A;  2F2O A;  4DIR A;  3EVV A;  1UHN A;  1DVI A;  4ETO A;  1JWD A;  3PSR A;  2L4I A;  2FCD A;  1CDL A;  2HET A;  2MLE C;  1AUI B;  1PVA A;  3CR5 X;  1BG1 A;  1B4C A;  1F4Q A;  1FBV A;  1IG5 A;  1RTP 1;  1ZMZ A;  2LVV A;  1OZO A;  1UUR A;  2JZI A;  3JTD C;  1KFX S;  2G2B A;  3A4U B;  4WQ3 A;  1CMG A;  1TCO B;  4MZJ A;  1CNP A;  2D8N A;  2ZN9 A;  3NSO A;  4QJ3 B;  4BY4 A;  3OB1 B;  5J3X A;  1SR6 C;  1K90 D;  2JUL A;  4NDD A;  3JTD B;  3OX5 A;  4GGF A;  5JJG A;  4GBA A;  2F2P A;  1BOC A;  1AJ4 A;  3O78 A;  4BY5 A;  1SR6 B;  1B1G A;  4GPL B;  3O2P A;  4A4C A;  3SIA A;  3LK0 A;  2KHN A;  2JT0 A;  2Y1M A;  2M3W A;  1B7T Y;  2K0J A;  1PK0 D;  5CSN A;  2G9B A;  2JTT A;  2WCB A;  2JQ6 A;  2I7A A;  2JOJ A;  1PVB A;  3EKJ A;  1X02 A;  2LMV A;  4WRI A;  2NZ0 A;  2KBI A;  1MUX A;  2F33 A;  1M45 A;  2TN4 A;  4N1G A;  2JC2 A;  1YUT A;  3AKA A;  2QPT A;  1IRJ A;  1OMV A;  4TNC A;  1NIW A;  2CTN A;  4I5J A;  2FOT A;  1DJI A;  2JXL A;  1DJW A;  4YGB B;  1MQ1 A;  1XO5 A;  2M97 A;  3BUO B;  4NDB A;  1C7W A;  1QS7 A;  1WRL A;  1CLL A;  1ODB A;  3I5F C;  2A4J A;  4M2Q A;  4YI9 A;  4ZCU A;  3ZWH A;  3D0Y A;  1NCX A;  1S5G Y;  4MSP A;  2LLS A;  3I5F B;  2KGB C;  2L51 A;  3CR2 A;  1OZS A;  1RJV A;  1AJ5 A;  5I2L A;  2OS8 B;  2KQY A;  3GK1 A;  4E68 A;  1QXP A;  2K8M B;  1SL7 A;  4UPG A;  4GGN A;  1SNL A;  1J7O A;  2LVJ A;  1R6P A;  2WCF A;  1Y1A A;  1TNX A;  4OR9 B;  2F3Y A;  2LM5 A;  1CB1 A;  4MEW A;  3DVE A;  4A4B A;  2LHI A;  4N1F A;  1WLM A;  1Y6W A;  4MRX A;  1CFC A;  1H4B A;  1XA5 A;  4P2Y B;  1UHI A;  1MXE A;  1NX3 A;  2L5X B;  2EC6 C;  3LK1 A;  2H61 C;  1EXR A;  1PSB A;  1LVC D;  2SAS A;  2ZRS A;  3KHE A;  3LL8 B;  2AMI A;  2Q91 A;  2NCP A;  1SRA A;  1M31 A;  1YUR A;  5GQQ C;  3I5I C;  2L4H A;  1XFY O;  4R1E A;  1N65 A;  1K8U A;  2M29 A;  2M8U A;  1MF8 B;  3BUW B;  1K94 A;  2LC5 A;  1XFZ O;  1CDP A;  3OX6 A;  4NDC A;  2PVB A;  3TDU A;  5AFP A;  1GGZ A;  1QIV A;  1DMO A;  1YVH A;  2LE9 B;  2B1U A;  3SG6 A;  3IF7 A;  4YGD B;  1M46 A;  1OMR A;  1QAS A;  1SL9 A;  1CDN A;  5CSJ A;  1AHR A;  1S1E A;  5ER5 A;  3FWB A;  2LP2 A;  2NLN A;  2KI4 C;  3QRX A;  4C0K A;  4ICB A;  5FYX A;  1CDM A;  1KFU S;  1SCM C;  3KPX A;  1ZFS A;  3PN7 B;  2Y9Z A;  3OHM B;  2LV7 A;  2LUX A;  2MRD A;  1WLZ A;  2KI4 B;  2OTG C;  3TZ1 A;  1SCM B;  1LA3 A;  1NP8 A;  1TNP A;  2L0P A;  2M7L A;  1IH0 A;  1DJZ A;  1XYD A;  1KK7 Z;  2OTG B;  1F71 A;  5PAL A;  2KOT A;  3NSL A;  3TS5 B;  2KDH A;  2BEC A;  5AAN A;  1DTL A;  2M7N A;  3OP0 A;  3ICB A;  2KYF A;  2Y1N A;  2M9G A;  1QLS A;  5D69 A;  2MBX A;  1DF0 B;  2ZND A;  5HKY A;  2LLT A;  2KFG A;  1R2U A;  4I5L B;  1M63 B;  1RK9 A;  1FW4 A;  2BKI B;  4C0J A;  1CMF A;  1NX2 A;  4AQJ A;  4DRW A;  4PHJ A;  2K2A A;  1GGW A;  2BKH B;  1U5I A;  3PFV A;  1KK7 Y;  1QIW A;  1TTX A;  2BBM A;  2RGI A;  3FIA A;  2JXC A;  4IL1 A;  4JWQ A;  1QLK A;  1IGV A;  2JNX A;  2LCP A;  5AXI A;  1G8I A;  1EG4 A;  3E3R A;  4CFQ A;  3TDZ A;  1B7T Z;  2MJW B;  5DKN A;  1HT9 A;  1B8R A;  1PUL A;  1CM4 A;  2KGR A;  4GGF C;  2FCE A;  2LUC A;  3AAJ A;  1V1F A;  2O5G A;  2WOS A;  4P5O E;  2K7D A;  2DOQ A;  1GJY A;  3DF0 A;  1S6I A;  2KBM A;  3BUM B;  4HRH A;  3BYA A;  2LLU A;  4ORC B;  3WHT B;  4DUQ A;  3JVT C;  1YRU B;  1CM1 A;  2LMT A;  3SG5 A;  1KSM A;  1OMD A;  4OV2 A;  2CT9 A;  1K93 D;  1QX5 B;  3TUY C;  1D1O A;  1S5G Z;  3JVT B;  2FJU B;  3PAT A;  1WY9 A;  4USL A;  3SG2 A;  2JU0 A;  4OKH A;  2JTZ A;  4YI8 A;  3CZT X;  2BE6 A;  2MAZ A;  1LA0 A;  3TDI A;  2ZNE A;  1FPW A;  2GV5 A;  1JC2 A;  4JPZ B;  2M1U A;  1K96 A;  3RM1 A;  5CPV A;  3CTN A;  2M1K B;  1YUU A;  1PAL A;  1QX2 A;  1ZOT B;  4GNK B;  3D0Y B;  2LAN A;  2R2I A;  5KU1 A;  3VRQ A;  3I5H C;  2PAL A;  2PAS A;  3DVM A;  4U8D A;  1YVL A;  2SCP A;  4YRU A;  4MBE A;  1DT7 B;  1ZUZ A;  4PAL A;  3I5H B;  1N0Y A;  1TNW A;  3OB2 B;  3DVK A;  4CID A;  1AVS A;  4HRE E;  1QV1 A;  5BPJ A;  4ZCV A;  3BOW A;  1MR8 A;  1NX0 A;  4DS7 A;  2LVK A;  2KNE A;  1XFW O;  2V53 A;  3VGO A;  3O4Y A;  4M2P A;  1B9A A;  3SIB A;  1DJG A;  4GUK A;  3MSE B;  1BJF A;  4NQG A;  1E8A A;  1N2D A;  3AKB A;  1OSA A;  1OOJ A;  2L50 A;  2L2E A;  2ZRT A;  1DJY A;  1EG3 A;  1YX7 A;  1F70 A;  1W7I B;  4HSZ A;  1IQ5 A;  1A2X A;  3K21 A;  1EH2 A;  3PM8 A;  4OCI A;  2BCX A;  1A03 A;  3M0W A;  4YGA A;  2EC6 B;  3WXA A;  2BCA A;  2M0R A;  2KFH A;  1J1E A;  2QAC A;  3EK8 A;  3O6B A;  3AAK A;  2M49 B;  1BU3 A;  1K9U A;  1SCV A;  1QAT A;  2AAO A;  3EK4 A;  1RWY A;  1UHH A;  2K61 A;  2KFF A;  2Q4U A;  1ALW A;  2LHL A;  2ZKM X;  1NSH A;  3I5I B;  2F8P A;  3WHU B;  1FI5 A;  3GK2 A;  2HF5 A;  3BUN B;  3HCM A;  1IWQ A;  1JF2 A;  5HLV A;  1CFF A;  1K9K A;  3FWC A;  2I2R E;  1UUS A;  4FTG A;  1SKT A;  1MHO A;  1UWO A;  1W7J B;  4AQI A;  4MN0 A;  1JSA A;  1C7V A;  3IQQ A;  1BF5 A;  2K7O A;  5D7F A;  1S36 A;  4FQO A;  1QJT A;  1NCY A;  1RFJ A;  1V1G A;  2LVI A;  2ZFD A;  4QJ5 B;  2BCB A;  3VRR A;  3KO0 A;  2NCO A;  1BMO A;  2LMU A;  2PRU A;  3DVJ A;  1VRK A;  4MRY A;  4GFT A;  1RRO A;  1WRZ A;  2L98 A;  2CNP A;  4MZL A;  3WNX B;  1JFJ A;  1NWD A;  1PRW A;  3SG4 A;  1KQV A;  1TCF A;  4ORB B;  2ZN8 A;  1BR4 B;  1F4O A;  4PHK A;  1S3P A;  1XFX O;  4GAO A;  1JUO A;  1J7R A;  1QTX A;  1U5I B;  1KWO C;  1K9P A;  1BR1 B;  1SYM A;  2JT3 A;  4PHM A;  5HYD A;  1MWN A;  3SG7 A;  1XVJ A;  1S6C A;  1YTZ C;  2PSR A;  3RLZ A;  1FF1 A;  2HQ8 A;  1KWO B;  1C07 A;  4JQ0 D;  3CR4 X;  1QX7 A;  2K2F A;  2F3Z A;  2LP3 A;  1FI6 A;  1UHJ A;  1S6J A;  4XYN A;  1KK8 C;  3DF0 B;  2Y9Y A;  1SPY A;  5TNC A;  1J7P A;  2I18 A;  3LCP C;  2VRG A;  1A75 B;  1F55 A;  2H2K A;  1AP4 A;  4PE4 A;  1A75 A;  4I5N B;  1SW8 A;  4XJK B;  1IQ3 A;  4N5X A;  3CWG A;  1CLB A;  2WC8 A;  3VRO A;  4XJK A;  5DKQ A;  4ORA B;  1GQM A;  2KI6 D;  4CFR A;  1CKK A;  3BXK A;  2NXQ A;  3CGA A;  1YUS A;  1L2O C;  4I5K A;  1NX1 A;  1Y0V H;  4YGC B;  3VRP A;  1WRK A;  1ZAC A;  3TUY B;  2CBL A;  2JNF A;  1XFV O;  2JRF A;  1EL4 A;  3A8R A;  1L2O B;  1L7Z A;  4OVN F;  1UP5 A;  2KAY A;  1Y1U A;  4Q04 A;  1KFX L;  2BE4 A;  2KI6 C;  1Y1X A;  1CTR A;  4PE1 A;  4DCK A;  1DJH A;  1B47 A;  1B8L A;  1DGU A;  1QV0 A;  1SMG A;  1KCY A;  4CLN A;  5I2Q A;  1YR5 A;  3BQ3 A;  1IJ5 A;  1PSR A;  2MA2 A;  1A29 A;  3BOW B;  1J7Q A;  1LXF C;  1KSO A;  4PE7 A;  2KAX A;  1CFD A;  5JOL A;  2Y5I A;  1ALV A;  4PE0 A;  2BBN A;  4MLW A;  1S26 D;  5AER A;  5AEQ A;  4YBH B;  3H4S E;  1J1D A;  2JWW A;  4WQ2 A;  5G08 A;  1LKJ A;  1DJX A;  3SJS A;  1TIZ A;  3GOF A;  2OS8 C;  1YRT B;  1K95 A;  3NSI A;  1OFC X;  2IS9 A;  4M2O A;  1XFU O;  2O60 A;  2JPT A;  4PDZ A;  4CPV A;  2GGM A;  1AK8 A;  1SL8 A;  2PMY A;  2KAV A;  3VRN A;  4PHN A;  3LLE A;  1SBJ A;  2MLF C;  2AUC A;  5I8N A;  4AOM A;  1BT6 A;  4YGE B;  3DD4 A;  1B8C A;  1TOP A;  1LIN A;  5HLO A;  2WCE A;  1OQP A;  5K89 A;  5ER4 X;  2BL0 C;  3SG3 A;  1TN4 A;  1G4Y R;  1NUB A;  4C0L A;  1CFP A;  1EJ3 A;  3ZNI A;  3F45 A;  3FS7 A;  1YX8 A;  5I2O A;  2BL0 B;  1IKU A;  1K2H A;  2MHH A;  1MXL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...