4JPZB

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
EPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Fibroblast growth factor 13
total genus 43
structure length 142
sequence length 142
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jpzB01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jpzB02
2KI6D 1TRFA 2JT0A 1A75A 3BUNB 5TNCA 2ZKMX 2MLEC 1VRKA 1QV1A 1KQVA 3SG6A 2KBIA 1S36A 2L4HA 4OV2A 2KQYA 4GBAA 4GUKA 4DS7A 2F2PA 2AMIA 1TN4A 2F8PA 1TNQA 2K61A 1F55A 4C0LA 1TOPA 4NDDA 1UHKA 1DGUA 1N2DA 4M2PA 4ETOA 1K93D 2KBMA 1H4BA 2KI6C 2PMYA 1F8HA 1K94A 1B7TY 2ZRSA 3HCMA 3O2PA 2K2AA 2L5XB 1EXRA 1MUXA 2ZRTA 2PRUA 2KHNA 5IBWA 3BUMB 4ZCVA 1BF5A 4MZJA 2MAZA 4MBEA 1JWDA 3TS5B 3ZNIA 1QATA 4MZKA 2JULA 2LVIA 3I5FB 1F54A 3JTDC 1AJ4A 3VRQA 1QLKA 1BMOA 2FJUB 1FW4A 4JQ0D 3DVJA 1B4CA 3TDZA 2I2RE 1NYAA 3PSRA 1XA5A 1K2HA 4HRGA 4MSPA 4OCIA 1IG5A 2COLB 2G2BA 1EG3A 2MA2A 3EKHA 4MN0A 3IF7A 1DJXA 1A75B 4PDZA 4QJ4B 1Y6WA 2CNPA 4XJKB 4L9MA 2JNFA 2K7OA 1CFCA 1S6JA 5G08A 5CPVA 1G4YR 1J1DA 1CLMA 1NUBA 1CDLA 1UHJA 2NZ0A 2LAPA 5CSNA 1DJGA 1YX7A 1SL8A 3DVKA 1XFWO 3VRNA 4GGNA 5GQQC 1TCFA 3CR4X 3MSEB 1CLLA 1B8LA 3OB1B 3WXAA 2ZN8A 1SPYA 3FWCA 4MVFA 2SASA 4YBHB 1LA3A 2KAVA 4R1EA 1MWNA 1WRZA 2JPTA 2WCEA 3VROA 3D10A 1K96A 1EL4A 1CM1A 1V1FA 1IJ6A 1KK8B 1XFXO 1CMGA 1FI6A 1KFUL 2ZN9A 1LKJA 3WHUB 4M2QA 2ZNDA 2B1UA 4WQ3A 2NCPA 5ER5A 1SW8A 1CKKA 2H61A 4C0JA 1DJYA 4UPGA 5PALA 2AUCA 1SBJA 1Y1UA 2F2OA 3EK4A 4AQIA 1CM4A 1C7WA 1NX0A 4DIRA 2K8MB 3DD4A 2M49B 1M45A 1MXLC 2K7CA 3CR5X 5HKYA 4QJ3B 1JBAA 3D0YB 3CTNA 1QV0A 1PVBA 1QX2A 1YX8A 1C7VA 3CR2A 5I2LA 1TNXA 1YRUB 2MJWB 2F3YA 1ZACA 2LUXA 2JXCA 1CDPA 1SRAA 1RFJA 2CCMA 2F33A 3I5IB 5I2OA 1IKUA 2WCFA 2NXQA 1NP8A 2K7DA 2E6WA 2I94A 4E68A 2CBLA 3IQOA 1IQ5A 1QVIY 1R6PA 1NX2A 1S5GZ 1YURA 1A2XA 1XFYO 2JT8A 3I5GB 1PULA 2LMUA 2K0JA 1U5IA 1XFVO 5D7FA 4GNKB 1ZUZA 2M29A 4YGAA 1V1GA 1WRKA 2L50A 4IL1A 4PHNA 1NCZA 2BE4A 2JTZA 3PLFB 4OKHA 4PE7A 3KHEA 1RTP1 1OMVA 3KF9A 3DVMA 1QVIZ 1JFJA 3SG2A 3SG3A 4DCKA 3KEVA 1BT6A 1W7JB 3NSOA 4YGDB 2ZNEA 2PSRA 2KYCA 4CFRA 3GK1A 2M8UA 4I5NB 2ISDA 1F70A 1QIVA 3EK7A 1K95A 5HLOA 3BUOB 5AEQA 1CNPA 1CLBA 1WDCB 1PRWA 2M97A 2KFHA 2PASA 3SJSA 1MQ1A 4DUQA 2SCPA 1DJHA 2MBXA 1B9AA 1D1OA 1IH0A 1YUTA 1R2UA 5KSZA 2JC2A 4U8DA 2M0RA 1BOCA 1BR1B 1KQMB 1L2OC 5HYDA 1LVCD 1CFDA 4N5XA 1TNWA 2DOQA 2LMVA 3GK2A 3WNXB 4HRHA 4YGBB 2JXLA 4HREE 4JWQA 2MHHA 4XYNA 1ODBA 1XVJA 4PCWA 2Y9ZA 1B8CA 1SR6C 1Y0VH 3PATA 1PALA 3IQQA 1OMRA 2L4IA 3I5FC 1K8UA 5AANA 1B7TZ 1GGWA 1AHRA 2OPOA 5I8NA 2OTGC 1KSMA 3AAJA 4P5OE 1DMOA 1YR5A 1J55A 2HPSA 2VRGA 1IGVA 1DTLA 1E8AA 3EKJA 1OFCX 5DKRA 1L2OB 5K89A 5FYXA 1SR6B 1UWOA 2BL0C 1XO5A 2JNXA 4ZCUA 1OOJA 4OR9B 1UHNA 3O6BA 3AAKA 2LANA 1NPQA 3KO0A 3VRRA 1JF2A 1MXEA 2OTGB 3BUWB 1CDMA 3QRXA 3TZ1A 1YUUA 3DF0A 1DF0B 3BOWA 1NX1A 5DKQA 3GK4X 3NXAA 1IWQA 1LA0A 2KAXA 5AERA 2LV7A 1B1GA 2I7AA 1OMDA 2Q4UA 1JSAA 1UUSA 3BUXB 2LHIA 2BL0B 1G8IA 2KYFA 3EVUA 2PVBA 3LL8B 3PN7C 2F3ZA 1GGZA 3OB2B 4WQ2A 4MZLA 4F0ZB 1HQVA 4CLNA 3DF0B 4Q04A 2D8NA 1FF1A 4ORBB 1AP4A 2LLUA 1TIZA 3H4SE 1QASA 1Y1AA 2MRDA 3F45A 1S6IA 1RWYA 1BJFA 3OX5A 1YUSA 4JPZB 4PHKA 2HF5A 2BBMA 2LP2A 3K21A 1NWDA 2Q91A 2M1UA 2KSPA 4AOMA 5B8IB 1M31A 3CLNA 2NLNA 1AK8A 3TDUA 2L98A 1SNLA 1OZSA 1QTXA 5ER4X 5JOLA 2LC5A 1XFZO 2RGIA 1QX5B 1UP5A 1QLSA 1QIWA 2EC6C 2CXJA 2L51A 3KPXA 4PALA 4D1EA 4CPVA 2KAYA 1KK7Y 5KTYA 1M63B 2IS9A 2LVVA 2LLTA 1ZFSA 3AKBA 3NSLA 3LK1A 1RK9A 2KFGA 1DVIA 3I5HB 3PFVA 1PSBA 3D0YA 1B47A 1KWOC 2KDHA 2MLFC 3I5IC 1KFXL 5AFPA 1DGVA 2JZIA 4WRIA 4MRXA 1ALVA 4ORCB 2K7BA 3OX6A 2QPTA 1KK8C 4NDCA 3HX4A 1DJZA 3VGOA 3BYAA 1ZMZA 1XK4A 2JOJA 1UHIA 2HQWA 4GFTA 1BG1A 2EC6B 1N0YA 3CWGA 3OHMB 2M1KB 2R2IA 3ICBA 3I5GC 1X02A 3E3RA 1NSHA 1ALWA 4GGFC 1QX7A 1WY9A 4BY4A 3I5HC 4CFQA 4GGFA 2LUCA 5JJGA 3TS5C 2KGBC 1HT9A 5CSIA 2LM5A 2I18A 2Y9YA 1AVSA 2EGDA 4PE1A 2TN4A 1DJWA 2O5GA 1OE9B 4FQOA 3TUYC 1WLZA 2BCAA 1K9UA 1OSAA 3JVTB 4YI8A 4NDBA 1BR4B 5DKNA 1CDNA 1WRLA 5HKZA 1J7RA 2GGMA 1H8BA 4PHMA 2KGRA 1J7PA 2GV5A 2KI4B 1KK7Z 1RJVA 1JC2A 5AXIA 4BY5A 1K9KA 4GAOA 2LNKA 1SYMA 4AQJA 2LMTA 1L7ZA 1B8RA 4YRUA 1CB1A 1KQMC 1XFUO 2BBNA 2BECA 3JVTC 3TUYB 4PHJA 1CMFA 1YRTB 2NCOA 2LVJA 2BE6A 1IQ3A 3ZWHA 2KNEA 1BODA 2KI4C 1MF8B 2LP3A 2Y1NA 2V53A 1MR8A 2EHBA 1NCYA 1ZOTB 3CS1A 1BU3A 3JTDB 1QJTA 1EG4A 3AKAA 1S5GY 2LLSA 1A03A 1KFXS 2WORA 2Y1MA 3SIAA 2L0PA 1KSOA 3O4YA 1MHOA 1NCXA 3NSIA 2KFFA 1UURA 2JT3A 3A4UB 1KCYA 1XYDA 4FTGA 1WDCC 1JFKA 2CTNA 1F4OA 1EH2A 1UHHA 1SK6D 1SL9A 1TNPA 1SY9A 2GGZA 4YGCB 1S26D 3WHTB 2M9GA 1KFUS 3DVEA 1C07A 3LLEA 1FI5A 1JF0A 1Q80A 5CSJA 4C0KA 1F4QA 2OS8B 5I2QA 3BXKA 4ICBA 1RECA 4NQGA 1S3PA 2E30A 3SIBA 1DF0A 3BOWB 1AJ5A 2JU0A 4YGEB 2LE9B 2WOSA 1J1EA 3CZTX 2G9BA 2BKIB 3FIAA 1PVAA 2PALA 2Y4QA 3PN7B 2FCEA 1DT7B 1WLMA 1CFFA 2BCXA 3LCPC 1NX3A 4DRWA 1TTXA 3CGAA 3FS7A 1JUOA 3PALA 2FCDA 2ZFDA 3PM8A 2K2FA 2OS8C 3SG7A 2JWWA 2BKHB 2O60A 1OZOA 5CSFA 1SCMC 2Y5IA 4HSZA 5D69A 5F6TA 1YVHA 3A8RA 2BCBA 1A4PA 1K9PA 3EK8A 1U5IB 3EVRA 3SG5A 4MLWA 4GPLB 2JRFA 2LVKA 2HETA 2M7LA 1RROA 1J7OA 1K90D 3GOFA 4ORAB 4PE4A 2HQ8A 1TCOB 1S1EA 4A4BA 2LCPA 2M7NA 3NSKA 4N1GA 1GJYA 1M46A 1NIWA 5HLVA 2KQ6A 5HKWA 2A4JA 1FBVA 1DJIA 1A29A 1N65A 2WCBA 1SCMB 3FWBA 4XJKA 1PSRA 4TNCA 4PE0A 4A4CA 1W7IB 1IJ5A 3TDIA 1S6CA 1SCVA 1OQPA 1IRJA 1SMGA 2H2KA 3EVVA 2CT9A 1XK4C 3RLZA 2P6BB 1J7QA 4M2OA 2AAOA 4MRYA 1PK0D 1KWOB 2KOTA 1QS7A 1LXFC 2L2EA 3M0WA 1FPWA 1QXPA 1EJ3A 1SL7A 2LHLA 3RM1A 3VRPA 1AUIB 4P2YB 5BPJA 3SG4A 5KU1A 4YI9A 1CTRA 2WC8A 1GQMA 4I5LB 4CIDA 1BLQA 1G33A 2H61C 4OVNF 4QJ5B 1F71A 2JTTA 3LK0A 2WNDA 3C1VA 1Y1XA 4MEWA 4USLA 1SKTA 1YTZC 2QACA 3BQ3A 3O78A 5J3XA 1YVLA 2FOTA 4I5KA 1M39A 1LINA 4I5JA 3OP0A 4N1FA 2M3WA 2JQ6A 1CFPA
chains in the Genus database with same CATH superfamily
2WSEH 2ZYGA 1TRFA 1QLED 3OJAB 2MLEC 2K9JB 1QV1A 3CCRP 2KBIA 4TT3H 4OV2A 1VQPP 4K35A 4DS7A 2F2PA 2CPSA 3AEEC 2HG5D 1TN4A 3NGVA 3EG5B 2ZVNB 2K61A 3D77A 3GHGA 4HB1A 1BE3G 2A06G 4LLHA 1UHKA 2OYIA 1K93D 2KI6C 1VQKP 1LGHB 1ZXGA 3JCUH 1YQ3C 4ZCVA 4MZJA 2MAZA 4MBEA 2B89A 4GOFA 3TS5B 3L71E 2LVIA 3I5FB 1EDKA 1JMMA 3L75E 3K1EA 2E43A 1OMIA 1P84I 1N73C 1JTHA 5AW8B 3PSRA 5AW5B 4MSPA 1IG5A 2G2BA 1OW4A 2QSIA 3IF7A 4HKZH 1SQQD 1ZRTD 1A75B 2CNPA 1PGOA 2CPBA 2QM8A 1KYOE 3LW5J 1IJDB 3E1RA 1S6JA 2V7QH 1KZUB 2M5AA 1J1DA 1M1JA 4I6MC 1NUBA 1DJGA 3UO9A 3DVKA 1XFWO 3VRNA 2C9LY 1TCFA 3MSEB 3GLMA 2O01N 1B8LA 5AVVB 2B9BA 1VQNP 1E5WA 1SPYA 3N7HA 1TUJA 2YGUA 4MVFA 2FYUG 1RE4A 1FDMA 4DJGA 1CM1A 3K5BA 1NGMB 1KK8B 3L74E 2R32A 3RK2C 2WCJA 2QEHA 5GTHH 2P70A 4WQ3A 1KQSO 4O9BA 5ER5A 3DZTA 1SQVJ 4C0JA 3TGUG 4UPGA 1SBJA 2F2OA 1L0NG 2KZIA 1SFCB 2RMZA 3DD4A 1T14A 1IFNA 1L4AC 3L73J 1VQLP 2M49B 2K7CA 1L0LG 3ZDMA 1HF9A 4QJ3B 1JBAA 3D0YB 2KLUA 4GT1A 2FYUK 1QX2A 1YX8A 3CR2A 5I2LA 2QEXP 1YRUB 3CCVP 3Q8IA 1OW6A 1SFCC 2MJWB 3CABA 1CDPA 1RFJA 5I2OA 1IKUA 3GHGC 2QIWA 3BVHA 1VDFA 4WVZA 1PFIA 5AW9B 2I94A 2CBLA 1KILC 1IQ5A 3B87A 2HODB 1XFYO 2LMUA 4JYCA 2K0JA 2B87A 1L0LK 1KMIZ 3GHGB 1Y47A 1NCZA 3FE6A 3KHEA 2KLVA 1VQ5P 1KV4A 4DCKA 3KEVA 1BT6A 1W7JB 3NSOA 1S9KE 2K1AA 2K88A 2W6AA 3L73E 2WMMA 2WC6A 3M0DC 1KB9E 1K95A 5AEQA 5APYA 2JEEA 1WDCB 2PASA 3SJSA 4DUQA 2SCPA 1IH0A 1CW5A 1KQMB 1DD4A 1LVCD 2LKMA 2IBZI 3WNXB 4HRHA 1S2EA 3FE9A 3H1HG 3NFQA 3H25A 1XVJA 1OVVA 1BGYE 2KNCB 3PATA 4TLFA 3CDNA 2N1TC 3IQQA 3I5FC 1K8UA 1N7SD 3HE4A 1NOHA 2OPOA 1YIJP 4P5OE 1LNQA 2VRGA 1L2OB 1TUZA 1DD3A 5K89A 1S72P 1U7MA 1PGJA 1SQBG 1UWOA 2G3AA 2O01H 1A02J 2A45G 1LTBC 2JNXA 2HFED 3AE3C 1OOJA 2XKMA 4HJGH 2O01J 1UHNA 5AVRB 1RF1A 3VRRA 3KO0A 1R5LA 1JF2A 1RE3A 4I7ZC 1Z56A 3QRXA 1TU3F 1YUUA 3CX5D 3M9QA 1D7MA 5DKQA 3BASA 1RF0A 3NXAA 1LA0A 3M0AA 2KAXA 5AERA 1VPCA 2KYVA 2NPSA 1JSAA 1NU1D 2LHIA 2OARA 1L4AD 2P1JA 2PVBA 3LL8B 4OWFA 4EDFA 1AVYA 2VRSA 2H43A 1MFZA 3L4LA 1GW4A 4AQRD 4ORBB 2LLUA 1TIZA 2KXPB 2ZXXA 3P8CD 1KILA 2MRDA 3TNUA 3F45A 1X0TA 1M7LA 2E74D 1YUSA 2IFNA 4JPZB 2JWDA 1NTKG 2XV5A 2KI7B 3M9BA 4YTPC 1X79B 2OTLP 3FWNA 3E7KA 1AQ5A 1NWDA 1UIXA 2M1UA 2M8RA 1LWUB 3KDPB 1ORGA 2HPCB 1M31A 1AK8A 3UIAA 1BGYJ 1PPJG 1GL2A 3PH0A 5D3OA 1XFZO 1QX5B 2L51A 1P84H 4PALA 2CXJA 4CPVA 5AW2B 3H32B 2LLTA 1GW3A 2YMYA 2OYHB 3NSLA 4F7FA 3WMM0 2OYIC 1RK9A 3PFVA 4PV1C 2E75B 1VF5B 3TK1A 1KFXL 5AFPA 2Z5HA 1FZCB 4MRXA 1ALVA 1T2KC 2K7BA 5DJTB 4Y99C 2O3JA 2N9YB 3VGOA 2I1KA 2WQYC 1NTKK 3C1LA 4GFTA 5BU8B 1ZP0C 2PQLA 1FJKA 1Y9BA 2OYHC 1X02A 1TWOA 1NSHA 3AEFC 1WY9A 1FZCC 1QVGO 3TS5C 1HT9A 5CSIA 1AVSA 2AEFA 3CCUP 2HODA 4FQOA 3FXDA 2FFDC 4OZDA 5KLVG 1A02F 5DKNA 1WRLA 1H8BA 4PHMA 1RJVA 5AXIA 2LNKA 1SYMA 1T2KD 2OTKE 4YRUA 1KQMC 1XFUO 2AXTH 2WPQA 5CCGD 2NCOA 1ZV8A 1SP4A 2LVJA 3Q5RA 1OWAA 1IQ3A 2JO1A 1HBWA 3BATA 1SQQJ 1NCYA 3SS4A 1ZOTB 1GM0A 3CS1A 1BU3A 3JTDB 1QJTA 1EG4A 1NO4A 2LXCB 3KZIH 3L74J 1A03A 5H2FH 1EDJA 2L0PA 4IL6E 2KNCA 2V7QJ 1UURA 1K9MQ 5KAIE 4FTGA 1SQQG 1E79H 2N1TD 1EH2A 3SWFA 1SK6D 1TNPA 2YMKA 3WHTB 1NTKJ 2E76D 2QEBA 4H13D 5I94A 5TISE 3LLEA 1SFCA 1JF0A 1Q80A 5CSJA 5B5EE 3AEDC 5I2QA 3GF3A 1G2CA 3P8CE 1KD1Q 1BE3J 2KP8A 2KB7P 1N8RQ 3CC2P 5CJ4A 1KYOD 1J1EA 1RHZB 1T6AA 1SS1A 1YQ4C 1LT9A 1PP9G 2ZVOB 2PYQA 3L36A 3HD7D 5CSFA 3L75J 1RQUA 3PJSK 5AW0B 4PT1A 3L70G 3L75D 4MLWA 4GPLB 2LVKA 3SS5A 1FZCA 3Q5PA 1TCOB 1LWUC 1OX3A 2BAPA 3NSKA 3S0GA 2A4JA 1N65A 1FE6A 3FWBA 4XJKA 2YO2A 4TNCA 3H32A 1NTKE 3H1IE 1IFPA 1SMGA 1SQBE 2CT9A 3VB1A 3HD7A 1J7QA 2Y0EA 2IX7C 1FPWA 3RM1A 4H44D 1AUIB 3B5NA 4LGDE 1CTRA 2GM4A 1KQGB 3CCQP 2PGDA 2ZT9B 1GQMA 4I5LB 1W2EA 3BRTB 2WT7B 1SQPE 3MTUE 2JTTA 2E5YA 3C1VA 5KAFE 1Y1XA 4MEWA 2QACA 3O78A 2MJZA 4D6TE 3BCCJ 3OP0A 4N1FA 2WSEJ 3S4RA 3B71A 3BUNB 5TNCA 2R5BA 3R72A 1VQ8P 2FFDB 1VRKA 4NPDA 1LTGC 3TYYA 3SG6A 1S3JA 2W90A 3H1IG 2K9YA 2AMIA 3CXHI 1F55A 1VQ4P 1DQEA 1FZAA 3KYQA 4I7ZB 1K94A 3O2PA 5APWA 3AEAC 5CCGC 3SWYA 3CX5H 2K2AA 2L5XB 1EXRA 2ZRTA 1YYCA 4U3FD 2W27A 4CPGA 3BUMB 2Y0CA 1L0LE 1DH3A 2JULA 1VF5D 1JY3O 3JTDC 1PV3A 1FJPA 1N7SA 3TDZA 1NYAA 1XA5A 1K2HA 4HRGA 3KPEA 3DXLA 5APXA 3EKHA 3L70D 1DJXA 1IZNB 1L0LJ 1WRGA 4QJ4B 2KS1A 3HE5A 3NMDA 4C7NB 2K7OA 2L2CA 1J1DC 1M1JC 5G08A 2C0WA 2AXTE 1G4YR 1CDLA 1UHJA 1KFMA 3L71G 2LAPA 1KB9D 1VQOP 1NTZD 4L75A 1VQMP 3T97A 1OOGA 4GGNA 1JY2P 1HTLC 2W6BA 2K60A 2WCMA 3FWCA 1J1DB 1M1JB 4YBHB 2E75C 2KAVA 1VF5C 3H1LE 2WCEA 4K3AA 1L4AB 3VROA 1K96A 1EL4A 2OYHA 1AQTA 1IJ6A 1FI6A 2P10A 5CBOA 3R1VA 3CPWO 2HLOA 3R2PA 3NHTA 1PPJD 1DJYA 1WT6A 1SQBD 1U57A 3EK4A 4AQIA 1PGPA 1NX0A 3FX0A 1YTZI 3S0AA 4DIRA 1JY3N 1OOHA 3CR5X 1KILB 2M0BA 2BEQD 3CTNA 1PVBA 4ZMDA 4B86A 1NWQA 4C7RA 1JY2N 4Z1MH 4UB8H 4NPFX 2JXCA 1SRAA 2F33A 3CWBE 4KJMA 2FYNC 5AVQB 1NP8A 2K7DA 1GK4A 2WWWA 4E68A 3IQOA 2E76B 1L0NK 3IFMA 1QVIY 3S0DA 1Q90D 1ZR4A 1PULA 3I56P 2FXMA 4H0LB 1DEKA 1XFVO 2BCCJ 1V1GA 2JTZA 3U1CA 4PE7A 3KF9A 4C7NA 1YBKA 3FE8A 1AJYA 1SQXJ 2PSRA 4CFRA 2ISDA 1F70A 4H0LC 1M57D 2HR3A 2Q7CA 4GOEA 1FOSF 2KFHA 1YUTA 1QEXA 1URQB 1BR1B 1H88A 1L2OC 5HYDA 1PIXA 4M3LA 1K73Q 5BU5A 1J1EC 1QVFO 4YGBB 3C8VA 4HREE 4JWQA 1ODBA 1OOIX 1B8CA 1SR6C 1FDIA 4KHXA 1LS8A 2L4IA 4ASWA 1S5LX 1IFJA 3CMAP 1ZMEC 3AAJA 1YR5A 1J55A 2HPSA 1MV8A 1NTKD 1IGVA 1DTLA 2ZT9D 3DY9A 2C9NY 1Y8AA 1SR6B 3CXHH 1KYOH 1Q81Q 4ZCUA 2KK7A 3VP9A 5CJ0A 1P28A 3AAKA 2LANA 1NPQA 3PP5A 1CDMA 3B88A 3TZ1A 3CCLP 1VQ9P 5AW1B 1Z4HA 2ZFCA 3VYIA 1G2CB 3BFBA 5AVXB 2E42A 2LV7A 1B1GA 3IF4A 3H1KE 4U7JA 2KOGA 3AEGC 3OB2B 1GGZA 4WQ2A 1QL1A 2LR2A 2D2CB 3VP8A 1QWVA 4CLNA 2QJYB 4Q04A 1SQBK 1K04A 2YKOA 3RBZA 5CBNA 3H4SE 1FS0E 3H1HD 1RWYA 3OX5A 1N73A 4PV1B 3GG2A 3PRJA 3K21A 5EL2A 2W8ZA 2KSPA 2NLNA 5CCHD 1RY3A 2QJYC 1SNLA 1OZSA 5ER4X 3KPXA 1QLSA 1NTZK 2KAYA 4MN4C 2IS9A 2LVVA 3P8MC 1N2DC 3LK1A 2KFGA 1DVIA 1KB9I 2P7JA 2G8YA 1PSBA 1T3UA 2MLFC 1L0ND 2Y0DA 2JWAA 4NDCA 2FYNB 1YI2P 1SQPJ 3CMEP 3BYAA 2PP6A 4IFFA 4WBAA 2JOJA 2ZYDA 3RL0C 2WPSA 5APVA 2EC6B 1N0YA 3CWGA 4L73A 3A2AA 3B5NC 1MUUA 2WTYA 3L47A 3P7KA 4GGFA 1WMKA 3B7AA 2JR8A 2NRGA 4PE1A 2TN4A 1DJWA 4GODA 2O5GA 1WLZA 4HH2A 1M56D 1K9UA 1OSAA 4YI8A 5AW6B 3P32A 4IL6H 3RGUA 1BR4B 2GGMA 1S1CX 1HH0A 4JF7A 4EI2A 1KK7Z 1RQVA 4GAOA 2IBZD 4AQJA 2LMTA 2MKVA 5KKZC 1B8RA 1NU1J 3RL0D 2N1TA 2BECA 3HE5B 1CZQA 5CCHA 4PHJA 1PPJE 1Q82Q 1YRTB 3WU2E 4I2LC 3L72E 2KNEA 5AVTB 1M8OB 1H8AA 3KXDA 2Y1NA 4N78D 1MR8A 5KLVK 1N7SB 3BCCE 5KKZB 3TSIA 1L2PA 3G71P 1HGVA 1EDLA 5KLIB 3AKAA 3W68A 1LTJC 4OGQC 2LLSA 2WORA 3BFAA 2Y1MA 1RE3C 1KSOA 1MHOA 1NCXA 1KCYA 3QH9A 1AV1A 1ZN5A 2GUVA 3H1KG 4JKTA 1QGKB 1N7SC 3HTKA 2CTNA 1HWTC 5KJ7C 1F4OA 1NHLA 2GGZA 1S26D 2M9GA 1CI6B 1SQBJ 3PTZA 1FI5A 2FXOA 3G3ZA 4W7ZA 4U3FG 4NQGA 1BCCJ 2QG4A 1DF0A 1KFNA 2LE9B 4IJ7A 3B4SA 3CZTX 2G9BA 2BKIB 3FIAA 1PVAA 5KTBA 1FZBA 2ZAEB 1DT7B 1WLMA 1X8YA 2BCXA 2P2UA 1P84E 3FS7A 3PALA 3SG7A 4FQTA 4JYBA 1SCMC 5D69A 3L37A 1GL2C 5F6TA 3A8RA 1SQQK 3SS3A 3RK3D 1A4PA 3EK8A 3EVRA 3AE5C 5KAFH 1J7OA 1LJ2A 3VMXA 3GOFA 4PE4A 2HQ8A 3V4QA 3EFFK 1S1EA 1EC5A 2KUBA 3U59A 1LWUA 3L70E 1NIWA 2NZ2A 2ZT9C 1FBVA 2WCBA 1SCMB 1PSRA 1IJ5A 2KIKA 1EZVD 2P6BB 4M2OA 3B86A 3OA7A 1PK0D 1SQXD 1QS7A 1LXFC 2L2EA 1JY3P 1MZ9A 5AVWB 1SL7A 2LHLA 3JC22 3SG4A 3PJIA 1URQC 2Q3IA 3CWBG 2WC8A 2A45H 4CIDA 4QJ5B 1KILE 1J1EB 2YNYA 3T97B 1OW8A 5GTIE 2BEZF 3PLNA 1YVLA 3L74D 4I5KA 3Q1MA 2Q3EA 2JDIH 4I5JA 1PL5A 1YITP 2Z4EA 1G1IA 3A0HH 2JT0A 2IBZE 1K8AQ 2Q1KA 2ZKMX 4INXA 4WB4A 1KQVA 1S36A 2M3BA 2WZ7A 3TF5A 3LW5H 2QJPB 4C0LA 1SQVD 4M2PA 2BCCE 3KQGA 3HRNA 2BCCG 1NU1G 1H4BA 4N3YB 1ZW0A 3LIEA 1F8HA 4KYNA 1B7TY 2ZRSA 1FOSE 1R8EA 3W67A 5CCGA 1L0LD 2KHNA 1BF5A 3S9OA 3OBVA 3I55P 3H1JG 1W9ZA 4KT0J 3ZNIA 4N6JA 5H2FE 3A5TA 3CXHD 3VRQA 4Y28J 2FJUB 2WSSH 4HYTB 1B4CA 2I2RE 1EZVI 3EFGA 4OCIA 2COLB 1NTME 1EG3A 2FFDA 1JY2O 2E75D 4PDZA 1C3ZA 2JNFA 1CFCA 1GK6A 5GTHE 3AECC 5CPVA 1CLMA 5AW4B 1K05A 3AE8C 5CSNA 3AE1C 3MHVA 4EYYQ 1SL8A 1JUNA 3OB1B 3L35A 2QDIA 3WXAA 2ZN8A 3PM2A 4UB8E 4IFMA 2SASA 4R1EA 1MWNA 1WRZA 2JPTA 2QM7A 3CZ0A 5KLVJ 2PRRA 2ZXEB 1V1FA 1CMGA 3V2NA 1KFUL 2ZN9A 5FI6A 3RL0B 2B1UA 2WITA 1GL2B 3PHLA 1SW8A 1CKKA 2FKWB 2H61A 1EQ7A 3F89A 1Y1UA 1BDCA 2HYNA 2FY8A 4PV1D 2WSFJ 1C7WA 2B87B 2K8MB 4OGQD 2AEJA 1YJNP 1Q7YQ 1L0NJ 1RF0C 2E76C 2B88A 2JPOA 1VQ6P 1C7VA 1TNXA 1FBMA 4WWIA 3CCJP 1OVUA 3D78A 2CCMA 3G4SP 5CCHC 3L74G 2NXQA 1Q2NA 4ASVA 1R6PA 3MIWA 1LT1A 1S5GZ 1JM0A 2H89C 3I5GB 3CWBJ 1LT9C 2R5DA 4GNKB 1ZUZA 2M29A 4YGAA 2WSCH 1RTP1 1C3YA 1OMVA 1QVIZ 2KLDA 1JFJA 5KLIC 1DX7A 2IFMA 4YGDB 1X9VA 3H1JD 3RK2D 1MFTA 3GK1A 2M8UA 3Q5SA 4I5NB 2QRXA 2KLEA 3OGNA 5HLOA 3RK3B 3BUOB 1LTSC 3LIDA 2E5TA 1KN7A 1PRWA 2M97A 3D70A 1KYOI 4D6TJ 1DELA 1DEEG 1B9AA 2FYUD 1OZHA 1JO5A 4U8DA 1BOCA 2IYPA 3S0EA 1NTZJ 4R4MA 2DOQA 3V2LA 4RKUJ 2AEMA 3RK3C 2JXLA 2IZ1A 4XYNA 4DZOA 2KZJA 2R3SA 4IOIH 5AVSB 1IFDA 4PD4D 1ZOYC 1GGWA 3O4XA 1KSMA 1DMOA 2XU6A 3MUDC 5APQA 2HPCA 1KTMA 3BFHA 3WUUA 3N4XA 1H0TB 5FYXA 4L74A 3II6A 3I5CA 4IL6X 3G9RA 2JJLA 2J58A 4OR9B 3SSUA 2ERBA 4ZKPA 1MXEA 3RZSA 2D2CC 3IAOA 1YHQP 4DT0A 3R1OA 3BOWA 3GK4X 4D6TG 2CK3H 2IDBA 1OMDA 2W83C 5KJ7A 2A06E 3BUXB 5M1BA 2BL0B 1G8IA 3EVUA 1GU5A 5AVUB 4C46A 2WC5A 2IZ0A 3H1HE 1JMBA 3UNWA 3EWKA 3H1IJ 4A7PA 3CLQA 1IK9A 1IO4A 1CI6A 3BCCD 3RBXA 5AVYB 1EXJA 3A7OA 2WCHA 2FBWC 2BBMA 1T8ZA 2LP2A 2BCCD 2Q91A 2POHA 3B8EB 3VTPC 1QTXA 5JOLA 2WSFH 2LC5A 2RGIA 2ZFDA 1OOFA 2EC6C 1QIWA 4D1EA 5KTYA 1NAYA 5FI2A 1ZFSA 3AKBA 3B5NB 1DC1A 4GKGA 3D0YA 1B47A 2KDHA 4PD4I 1DGVA 2JZIA 4WRIA 2GA1A 2R3CA 3NHIA 4ORCB 1SQXG 2RH0A 2QPTA 1IFIA 2QEVA 3HX4A 2YKQA 3KHUA 3HUSC 1ZMZA 3L71J 3L72J 2OGUA 4U3FJ 5AVZB 2M1KB 5B5EH 3I5GC 3CX5I 3E3RA 3MD0A 4H0LD 4GGFC 1QX7A 3I5HC 2I8DA 3TGUJ 3V5BA 1URQA 2LM5A 1NTZG 3IR9A 2Z5IA 3TGUD 1NTZE 3CCSP 5E79E 2FYUE 4UB6E 3ABVC 3L70J 3BRVB 4XA4A 1JTHB 2FJYA 2QA4P 1EZVG 4L76A 1SSEB 4NDBA 5HKZA 3H1LD 2E74C 3QMEA 1J7PA 2P67A 2KI4B 1G1JA 4BY5A 1SFCD 3SFEC 2IYOA 3H1LJ 1LTJB 4OGQB 1KC8Q 1L7ZA 1CB1A 3TUYB 2JQ6A 2P58A 3O8ZA 3S0FA 5B66H 1BODA 2NPSC 2KPHA 2KI4C 2LP3A 1SQVE 1USDA 2V53A 3MZWB 2EHBA 1BCCE 1KILD 5GTIH 3IN6A 1S5GY 1BDDA 1KFXS 4RESB 2JP3A 3D6YA 3NSIA 3BCCG 1L4AA 2JT3A 1M90Q 1NVOA 1JNMA 1XYDA 5KJ7D 1JFKA 2XDJA 2I1JA 3G6EP 1Z2CB 4YGCB 3CYZA 3BJHA 3D74A 3DVEA 2O1KA 2ZYAA 2WPRA 4C0KA 3VMAA 3D71A 1F4QA 3BXKA 1XFRA 4ICBA 1RECA 3HTKB 4AYCA 2P71A 1S3PA 3SIBA 3BOWB 3DYEA 1AJ5A 1HUCA 3OAKA 2IBZG 1JEKA 2OQQA 2Y4QA 2PALA 5FI7A 1JB0J 2D2CD 1CFFA 3LCPC 4DRWA 1FZEA 4U3FE 1TTXA 3CGAA 1JUOA 3PM8A 2FCDA 3H1JE 2K2FA 4GDOA 2BKHB 2M5AB 1OZOA 3QWOC 1H0TA 2Y5IA 4WY4D 2BCBA 1U5IB 3IVTA 3A3YB 2M7LA 1K90D 4ZNCA 2V4HA 2GTEA 2M7NA 1PP9J 4N1GA 1BE3E 2KQ6A 2R44A 4H13C 1DJIA 1A29A 2KS1B 1M1KQ 3CC7P 4PE0A 4A4CA 1PP9D 1S6CA 2OTJP 2QJKC 1SQXE 2BASA 3EVVA 2GUSA 1AFOA 1XK4C 5CMZA 3RLZA 4W7YA 4BWNA 4MRYA 2KOTA 3CD6P 2WCKA 4YI9A 1JOCA 1IFMA 3AE9C 4XFJA 3V6IA 4EIJA 4OH8B 1W2BO 4OVNF 5K5GB 3AEBC 3LK0A 5APSA 3H1JJ 5AW7B 1RH5B 3S1KA 2WNDA 4EOTA 4USLA 5J3XA 2QJPC 1BGYG 1M39A 1LINA 2H8PD 3WUTA 3GW6A 2KI6D 1X22A 4D6TD 1A75A 2UWJE 3SWKA 2L4HA 2KQYA 4GBAA 4GUKA 3ITKA 2A06D 1LP1B 4INWA 2F8PA 1TNQA 2E74B 2WCLA 2K37A 3GMAA 1TOPA 4NDDA 1DGUA 1N2DA 5E79H 2K3RA 4ETOA 1BCCD 3VOPA 1BSNA 2KBMA 2M3EA 2PMYA 1YJ9P 3CZ2A 3HCMA 3N7NA 4DOJA 1LTJA 3FXEA 1MUXA 2Q5UA 2PRUA 5IBWA 1OXZA 3B5ND 4GIFA 1FZFA 1BSHA 1JWDA 1KB9H 5C39A 1QATA 4MZKA 2AXCA 1YJWP 4UB6H 1F54A 3VN0A 1AJ4A 1NTMD 4H44C 1NJIQ 1QLKA 1BMOA 1NKZB 1FW4A 4JQ0D 3DVJA 2J59M 2YIUB 5APTA 2DW3A 3TDKA 3AE4C 2MA2A 3USSA 4MN0A 1GZLA 3L73G 1Y6WA 1NU1K 3WU2H 4XJKB 4L9MA 3H1ID 5KLVD 1QX8A 1ZRTE 2NZ0A 2YIUC 1YX7A 4WY4A 3CCMP 5GQQC 4ZKUA 3CR4X 1CLLA 2Q6QA 1RE4C 1J2JB 1LA3A 3M06A 3TGUE 3D10A 3V4WA 3O6QA 1XFXO 1FZGA 1LKJA 3HUSB 3WHUB 4M2QA 2ZNDA 3FGAD 2JKVA 2NCPA 2KSEA 4YPCA 1OIPA 4PD4E 2OYOA 5PALA 2AUCA 5KAIH 1CM4A 3R1PA 2WSCJ 2W6JH 2XNXA 1NH4A 3D75A 1M45A 1MXLC 5HKYA 1VL2A 4BRYB 1W5CE 4PJ0E 5TISH 3MGNA 1QV0A 3L72D 2RN0A 2QJKB 3CWBD 1LT9B 4BRYA 4N78E 3Q3DA 2F3YA 1ZACA 2LUXA 3I5IB 3NTNA 2WCFA 3O6QB 3Q2YA 2E6WA 3CZ1A 1H89A 1NX2A 2PAJA 1YURA 1A2XA 2JT8A 4RJTA 1U5IA 2NPSB 1N7LA 2WT7A 1WRKA 2L50A 4IL1A 4PHNA 1VQ7P 2BE4A 3PLFB 4OKHA 3VMYA 5BVZA 2FYZA 1IC2A 3DVMA 5AW3B 3SG2A 3SG3A 1SQVG 1QL2A 3L4AA 2ZNEA 1RF1B 5DICA 2KYCA 3M0DA 3HD7B 2QVAA 2WVRA 3F5HA 4IFDK 4WY4B 2QE7H 3EQ2A 1QIVA 3EK7A 1CNPA 4AUWA 1GDTA 3H1HJ 1CLBA 1OW7A 4I1LA 1MQ1A 1DJHA 2MBXA 1D1OA 1R2UA 5KSZA 2JC2A 4NPEA 2M0RA 2XNDH 3A0HE 1CFDA 4N5XA 1TNWA 2YO3A 2LMVA 3GK2A 1OVRA 3R4YA 1PGQA 1XTCC 4WY4C 2MHHA 2Y9ZA 4PCWA 2XZRA 2O1JA 3AE7C 5DJUB 1Y0VH 1SQVK 1PALA 1YTZT 1GD2E 3A0BH 1OMRA 5AANA 1B7TZ 3TNUB 1AHRA 5I8NA 1SQPG 4H44B 2OTGC 1PP9E 3EKJA 1E8AA 1OFCX 5DKRA 3KZIE 1SQPD 1FAVA 2BL0C 1XO5A 2RKLA 3O6BA 3S0BA 2N1TB 2OTGB 3BUWB 3JSVC 2QEOA 3DF0A 1DF0B 1NX1A 4H13B 2PFXA 1DEBA 1GU4A 5APUA 1IWQA 1HVVA 2I7AA 3CX5E 2Q4UA 1UUSA 1SQPK 2KYFA 4BXLA 1LTIC 3CCEP 3PN7C 2F3ZA 4JD9A 4MZLA 4F0ZB 1HQVA 3DF0B 2IPPA 2D8NA 1IIOA 1FF1A 1AP4A 2A45I 3CC4P 1QASA 1Y1AA 3D73A 1AVOA 3HE4B 1S6IA 3A0BE 1NYHA 1BJFA 4PHKA 2HF5A 1NKNA 4AOMA 5B8IB 1PZQA 1GMJA 3CLNA 5TJHA 3TDUA 2L98A 1SLQA 3L71D 3NXSA 1UP5A 1AA0A 3D76A 1KK7Y 1M63B 1LTAC 2FYUJ 3I5HB 4YXDC 1KWOC 3I5IC 1JCCA 1BE3D 4PJ0H 3OX6A 1KK8C 3HUSA 3L75G 1DJZA 1BGYD 3V2PA 1XK4A 1L0NE 1UHIA 2HQWA 1BG1A 2YKPA 1S9KD 3OHMB 4R4LA 2R2IA 3L73D 3ICBA 1FC2C 3L72G 1P84D 1ALWA 5KLVE 1ZLLA 2OYIB 4CFQA 2ZJSE 4BY4A 2LUCA 5JJGA 2KGBC 1S5LH 2I18A 3CL3D 2Y9YA 2EGDA 2H7HA 1OE9B 4Y99B 2L5YA 3TUYC 3MP7B 2BCAA 1HJ0A 2WPVB 1KORA 3JVTB 1CDNA 1J7RA 1SQXK 1N86A 1UIIA 2KGRA 3V2RA 2GV5A 3FWLA 1JC2A 1KQFB 1K9KA 3E1IA 2L91A 1EZVE 1XTGB 2Q9IA 3AE6C 1BCCG 2BBNA 1NTMJ 3JVTC 1GL2D 1CMFA 1JCDA 1EDIA 2BNXA 2SPZA 4RO0A 3D6ZA 3MUDA 2BE6A 3ZWHA 1MF8B 3H1LG 3H6PA 1R5SA 2H8VA 2YXQB 1N73B 5B66E 1NAFA 1GTWA 3SIAA 1USEA 1FU1A 3O4YA 4LC1A 1S5LE 2C0XA 2KFFA 3A4UB 1NU1E 1WDCC 1U7JA 2NPSD 1HJBA 1UHHA 1SL9A 1SY9A 1T3JA 1KFUS 3AE2C 1C07A 1EXIA 3JCUE 2OS8B 1FDOA 1NTMG 1LP1A 3WUVA 2E30A 1SQQE 2JU0A 4YGEB 3GF7A 5L8RJ 1CSBA 2WOSA 4XE5B 4JBZA 3V2QA 3PN7B 2KSJA 2LXBA 2FCEA 3B6XA 1NX3A 2H88C 3RK3E 5CHXA 1ZR2A 3RK2B 3C9IA 2OS8C 2JWWA 2O60A 1URQD 3M91A 4HSZA 4W80A 1YVHA 4PD4H 1K9PA 2ITAA 3SG5A 3CXHE 3M9HA 3L4FA 2JRFA 2HETA 5EFWB 1RROA 1DIPA 2L5GB 1IK7A 4ORAB 2N9BA 3CI9A 4A4BA 2LCPA 1GJYA 3U1AA 1M46A 5HLVA 1NTMK 2FXPA 5HKWA 5D7FA 4YXWH 1W7IB 3RL0g 1RF1C 3TDIA 1SCVA 4QMAA 1OQPA 1IRJA 3HD7C 2H2KA 3OW2O 2AAOA 1KWOB 3M0WA 1KQLA 1QXPA 1EJ3A 1LTTC 5BPJA 3VRPA 4P2YB 1MKMA 5KU1A 3VMZA 1Q86Q 2K9JA 1BLQA 1G33A 2H61C 1F71A 5HL1A 2YXRB 1SKTA 1YTZC 3BQ3A 3H1KJ 2J5UA 3SFDC 2FOTA 1S4XA 2M3WA 1SVFA 1HGZA 3H1KD 1CFPA
chains in the Genus database with same CATH topology
2KI6D 1TRFA 2JT0A 1A75A 3BUNB 5TNCA 2ZKMX 2MLEC 1VRKA 1QV1A 1KQVA 3SG6A 2KBIA 1S36A 2L4HA 4OV2A 2KQYA 4GBAA 4GUKA 4DS7A 2F2PA 2AMIA 1TN4A 2F8PA 1TNQA 2K61A 1F55A 4C0LA 1TOPA 4NDDA 1UHKA 1DGUA 1N2DA 4M2PA 4ETOA 1K93D 2KBMA 1H4BA 2KI6C 2PMYA 1F8HA 1K94A 1B7TY 2ZRSA 3HCMA 3O2PA 2K2AA 2L5XB 1EXRA 1MUXA 2ZRTA 2PRUA 2KHNA 5IBWA 3BUMB 4ZCVA 1BF5A 4MZJA 2MAZA 4MBEA 1JWDA 3TS5B 3ZNIA 1QATA 4MZKA 2JULA 2LVIA 3I5FB 1F54A 3JTDC 1AJ4A 3VRQA 1QLKA 1BMOA 2FJUB 1FW4A 4JQ0D 3DVJA 1B4CA 3TDZA 2I2RE 1NYAA 3PSRA 1XA5A 1K2HA 4HRGA 4MSPA 4OCIA 1IG5A 2COLB 2G2BA 1EG3A 2MA2A 3EKHA 4MN0A 3IF7A 1DJXA 1A75B 4PDZA 4QJ4B 1Y6WA 2CNPA 4XJKB 4L9MA 2JNFA 2K7OA 1CFCA 1S6JA 5G08A 5CPVA 1G4YR 1J1DA 1CLMA 1NUBA 1CDLA 1UHJA 2NZ0A 2LAPA 5CSNA 1DJGA 1YX7A 1SL8A 3DVKA 1XFWO 3VRNA 4GGNA 5GQQC 1TCFA 3CR4X 3MSEB 1CLLA 1B8LA 3OB1B 3WXAA 2ZN8A 1SPYA 3FWCA 4MVFA 2SASA 4YBHB 1LA3A 2KAVA 4R1EA 1MWNA 1WRZA 2JPTA 2WCEA 3VROA 3D10A 1K96A 1EL4A 1CM1A 1V1FA 1IJ6A 1KK8B 1XFXO 1CMGA 1FI6A 1KFUL 2ZN9A 1LKJA 3WHUB 4M2QA 2ZNDA 2B1UA 4WQ3A 2NCPA 5ER5A 1SW8A 1CKKA 2H61A 4C0JA 1DJYA 4UPGA 5PALA 2AUCA 1SBJA 1Y1UA 2F2OA 3EK4A 4AQIA 1CM4A 1C7WA 1NX0A 4DIRA 2K8MB 3DD4A 2M49B 1M45A 1MXLC 2K7CA 3CR5X 5HKYA 4QJ3B 1JBAA 3D0YB 3CTNA 1QV0A 1PVBA 1QX2A 1YX8A 1C7VA 3CR2A 5I2LA 1TNXA 1YRUB 2MJWB 2F3YA 1ZACA 2LUXA 2JXCA 1CDPA 1SRAA 1RFJA 2CCMA 2F33A 3I5IB 5I2OA 1IKUA 2WCFA 2NXQA 1NP8A 2K7DA 2E6WA 2I94A 4E68A 2CBLA 3IQOA 1IQ5A 1QVIY 1R6PA 1NX2A 1S5GZ 1YURA 1A2XA 1XFYO 2JT8A 3I5GB 1PULA 2LMUA 2K0JA 1U5IA 1XFVO 5D7FA 4GNKB 1ZUZA 2M29A 4YGAA 1V1GA 1WRKA 2L50A 4IL1A 4PHNA 1NCZA 2BE4A 2JTZA 3PLFB 4OKHA 4PE7A 3KHEA 1RTP1 1OMVA 3KF9A 3DVMA 1QVIZ 1JFJA 3SG2A 3SG3A 4DCKA 3KEVA 1BT6A 1W7JB 3NSOA 4YGDB 2ZNEA 2PSRA 2KYCA 4CFRA 3GK1A 2M8UA 4I5NB 2ISDA 1F70A 1QIVA 3EK7A 1K95A 5HLOA 3BUOB 5AEQA 1CNPA 1CLBA 1WDCB 1PRWA 2M97A 2KFHA 2PASA 3SJSA 1MQ1A 4DUQA 2SCPA 1DJHA 2MBXA 1B9AA 1D1OA 1IH0A 1YUTA 1R2UA 5KSZA 2JC2A 4U8DA 2M0RA 1BOCA 1BR1B 1KQMB 1L2OC 5HYDA 1LVCD 1CFDA 4N5XA 1TNWA 2DOQA 2LMVA 3GK2A 3WNXB 4HRHA 4YGBB 2JXLA 4HREE 4JWQA 2MHHA 4XYNA 1ODBA 1XVJA 4PCWA 2Y9ZA 1B8CA 1SR6C 1Y0VH 3PATA 1PALA 3IQQA 1OMRA 2L4IA 3I5FC 1K8UA 5AANA 1B7TZ 1GGWA 1AHRA 2OPOA 5I8NA 2OTGC 1KSMA 3AAJA 4P5OE 1DMOA 1YR5A 1J55A 2HPSA 2VRGA 1IGVA 1DTLA 1E8AA 3EKJA 1OFCX 5DKRA 1L2OB 5K89A 5FYXA 1SR6B 1UWOA 2BL0C 1XO5A 2JNXA 4ZCUA 1OOJA 4OR9B 1UHNA 3O6BA 3AAKA 2LANA 1NPQA 3KO0A 3VRRA 1JF2A 1MXEA 2OTGB 3BUWB 1CDMA 3QRXA 3TZ1A 1YUUA 3DF0A 1DF0B 3BOWA 1NX1A 5DKQA 3GK4X 3NXAA 1IWQA 1LA0A 2KAXA 5AERA 2LV7A 1B1GA 2I7AA 1OMDA 2Q4UA 1JSAA 1UUSA 3BUXB 2LHIA 2BL0B 1G8IA 2KYFA 3EVUA 2PVBA 3LL8B 3PN7C 2F3ZA 1GGZA 3OB2B 4WQ2A 4MZLA 4F0ZB 1HQVA 4CLNA 3DF0B 4Q04A 2D8NA 1FF1A 4ORBB 1AP4A 2LLUA 1TIZA 3H4SE 1QASA 1Y1AA 2MRDA 3F45A 1S6IA 1RWYA 1BJFA 3OX5A 1YUSA 4JPZB 4PHKA 2HF5A 2BBMA 2LP2A 3K21A 1NWDA 2Q91A 2M1UA 2KSPA 4AOMA 5B8IB 1M31A 3CLNA 2NLNA 1AK8A 3TDUA 2L98A 1SNLA 1OZSA 1QTXA 5ER4X 5JOLA 2LC5A 1XFZO 2RGIA 1QX5B 1UP5A 1QLSA 1QIWA 2EC6C 2CXJA 2L51A 3KPXA 4PALA 4D1EA 4CPVA 2KAYA 1KK7Y 5KTYA 1M63B 2IS9A 2LVVA 2LLTA 1ZFSA 3AKBA 3NSLA 3LK1A 1RK9A 2KFGA 1DVIA 3I5HB 3PFVA 1PSBA 3D0YA 1B47A 1KWOC 2KDHA 2MLFC 3I5IC 1KFXL 5AFPA 1DGVA 2JZIA 4WRIA 4MRXA 1ALVA 4ORCB 2K7BA 3OX6A 2QPTA 1KK8C 4NDCA 3HX4A 1DJZA 3VGOA 3BYAA 1ZMZA 1XK4A 2JOJA 1UHIA 2HQWA 4GFTA 1BG1A 2EC6B 1N0YA 3CWGA 3OHMB 2M1KB 2R2IA 3ICBA 3I5GC 1X02A 3E3RA 1NSHA 1ALWA 4GGFC 1QX7A 1WY9A 4BY4A 3I5HC 4CFQA 4GGFA 2LUCA 5JJGA 3TS5C 2KGBC 1HT9A 5CSIA 2LM5A 2I18A 2Y9YA 1AVSA 2EGDA 4PE1A 2TN4A 1DJWA 2O5GA 1OE9B 4FQOA 3TUYC 1WLZA 2BCAA 1K9UA 1OSAA 3JVTB 4YI8A 4NDBA 1BR4B 5DKNA 1CDNA 1WRLA 5HKZA 1J7RA 2GGMA 1H8BA 4PHMA 2KGRA 1J7PA 2GV5A 2KI4B 1KK7Z 1RJVA 1JC2A 5AXIA 4BY5A 1K9KA 4GAOA 2LNKA 1SYMA 4AQJA 2LMTA 1L7ZA 1B8RA 4YRUA 1CB1A 1KQMC 1XFUO 2BBNA 2BECA 3JVTC 3TUYB 4PHJA 1CMFA 1YRTB 2NCOA 2LVJA 2BE6A 1IQ3A 3ZWHA 2KNEA 1BODA 2KI4C 1MF8B 2LP3A 2Y1NA 2V53A 1MR8A 2EHBA 1NCYA 1ZOTB 3CS1A 1BU3A 3JTDB 1QJTA 1EG4A 3AKAA 1S5GY 2LLSA 1A03A 1KFXS 2WORA 2Y1MA 3SIAA 2L0PA 1KSOA 3O4YA 1MHOA 1NCXA 3NSIA 2KFFA 1UURA 2JT3A 3A4UB 1KCYA 1XYDA 4FTGA 1WDCC 1JFKA 2CTNA 1F4OA 1EH2A 1UHHA 1SK6D 1SL9A 1TNPA 1SY9A 2GGZA 4YGCB 1S26D 3WHTB 2M9GA 1KFUS 3DVEA 1C07A 3LLEA 1FI5A 1JF0A 1Q80A 5CSJA 4C0KA 1F4QA 2OS8B 5I2QA 3BXKA 4ICBA 1RECA 4NQGA 1S3PA 2E30A 3SIBA 1DF0A 3BOWB 1AJ5A 2JU0A 4YGEB 2LE9B 2WOSA 1J1EA 3CZTX 2G9BA 2BKIB 3FIAA 1PVAA 2PALA 2Y4QA 3PN7B 2FCEA 1DT7B 1WLMA 1CFFA 2BCXA 3LCPC 1NX3A 4DRWA 1TTXA 3CGAA 3FS7A 1JUOA 3PALA 2FCDA 2ZFDA 3PM8A 2K2FA 2OS8C 3SG7A 2JWWA 2BKHB 2O60A 1OZOA 5CSFA 1SCMC 2Y5IA 4HSZA 5D69A 5F6TA 1YVHA 3A8RA 2BCBA 1A4PA 1K9PA 3EK8A 1U5IB 3EVRA 3SG5A 4MLWA 4GPLB 2JRFA 2LVKA 2HETA 2M7LA 1RROA 1J7OA 1K90D 3GOFA 4ORAB 4PE4A 2HQ8A 1TCOB 1S1EA 4A4BA 2LCPA 2M7NA 3NSKA 4N1GA 1GJYA 1M46A 1NIWA 5HLVA 2KQ6A 5HKWA 2A4JA 1FBVA 1DJIA 1A29A 1N65A 2WCBA 1SCMB 3FWBA 4XJKA 1PSRA 4TNCA 4PE0A 4A4CA 1W7IB 1IJ5A 3TDIA 1S6CA 1SCVA 1OQPA 1IRJA 1SMGA 2H2KA 3EVVA 2CT9A 1XK4C 3RLZA 2P6BB 1J7QA 4M2OA 2AAOA 4MRYA 1PK0D 1KWOB 2KOTA 1QS7A 1LXFC 2L2EA 3M0WA 1FPWA 1QXPA 1EJ3A 1SL7A 2LHLA 3RM1A 3VRPA 1AUIB 4P2YB 5BPJA 3SG4A 5KU1A 4YI9A 1CTRA 2WC8A 1GQMA 4I5LB 4CIDA 1BLQA 1G33A 2H61C 4OVNF 4QJ5B 1F71A 2JTTA 3LK0A 2WNDA 3C1VA 1Y1XA 4MEWA 4USLA 1SKTA 1YTZC 2QACA 3BQ3A 3O78A 5J3XA 1YVLA 2FOTA 4I5KA 1M39A 1LINA 4I5JA 3OP0A 4N1FA 2M3WA 2JQ6A 1CFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  1TRF A;  2JT0 A;  1A75 A;  3BUN B;  5TNC A;  2ZKM X;  2MLE C;  1VRK A;  1QV1 A;  1KQV A;  3SG6 A;  2KBI A;  1S36 A;  2L4H A;  4OV2 A;  2KQY A;  4GBA A;  4GUK A;  4DS7 A;  2F2P A;  2AMI A;  1TN4 A;  2F8P A;  1TNQ A;  2K61 A;  1F55 A;  4C0L A;  1TOP A;  4NDD A;  1UHK A;  1DGU A;  1N2D A;  4M2P A;  4ETO A;  1K93 D;  2KBM A;  1H4B A;  2KI6 C;  2PMY A;  1F8H A;  1K94 A;  1B7T Y;  2ZRS A;  3HCM A;  3O2P A;  2K2A A;  2L5X B;  1EXR A;  1MUX A;  2ZRT A;  2PRU A;  2KHN A;  5IBW A;  3BUM B;  4ZCV A;  1BF5 A;  4MZJ A;  2MAZ A;  4MBE A;  1JWD A;  3TS5 B;  3ZNI A;  1QAT A;  4MZK A;  2JUL A;  2LVI A;  3I5F B;  1F54 A;  3JTD C;  1AJ4 A;  3VRQ A;  1QLK A;  1BMO A;  2FJU B;  1FW4 A;  4JQ0 D;  3DVJ A;  1B4C A;  3TDZ A;  2I2R E;  1NYA A;  3PSR A;  1XA5 A;  1K2H A;  4HRG A;  4MSP A;  4OCI A;  1IG5 A;  2COL B;  2G2B A;  1EG3 A;  2MA2 A;  3EKH A;  4MN0 A;  3IF7 A;  1DJX A;  1A75 B;  4PDZ A;  4QJ4 B;  1Y6W A;  2CNP A;  4XJK B;  4L9M A;  2JNF A;  2K7O A;  1CFC A;  1S6J A;  5G08 A;  5CPV A;  1G4Y R;  1J1D A;  1CLM A;  1NUB A;  1CDL A;  1UHJ A;  2NZ0 A;  2LAP A;  5CSN A;  1DJG A;  1YX7 A;  1SL8 A;  3DVK A;  1XFW O;  3VRN A;  4GGN A;  5GQQ C;  1TCF A;  3CR4 X;  3MSE B;  1CLL A;  1B8L A;  3OB1 B;  3WXA A;  2ZN8 A;  1SPY A;  3FWC A;  4MVF A;  2SAS A;  4YBH B;  1LA3 A;  2KAV A;  4R1E A;  1MWN A;  1WRZ A;  2JPT A;  2WCE A;  3VRO A;  3D10 A;  1K96 A;  1EL4 A;  1CM1 A;  1V1F A;  1IJ6 A;  1KK8 B;  1XFX O;  1CMG A;  1FI6 A;  1KFU L;  2ZN9 A;  1LKJ A;  3WHU B;  4M2Q A;  2ZND A;  2B1U A;  4WQ3 A;  2NCP A;  5ER5 A;  1SW8 A;  1CKK A;  2H61 A;  4C0J A;  1DJY A;  4UPG A;  5PAL A;  2AUC A;  1SBJ A;  1Y1U A;  2F2O A;  3EK4 A;  4AQI A;  1CM4 A;  1C7W A;  1NX0 A;  4DIR A;  2K8M B;  3DD4 A;  2M49 B;  1M45 A;  1MXL C;  2K7C A;  3CR5 X;  5HKY A;  4QJ3 B;  1JBA A;  3D0Y B;  3CTN A;  1QV0 A;  1PVB A;  1QX2 A;  1YX8 A;  1C7V A;  3CR2 A;  5I2L A;  1TNX A;  1YRU B;  2MJW B;  2F3Y A;  1ZAC A;  2LUX A;  2JXC A;  1CDP A;  1SRA A;  1RFJ A;  2CCM A;  2F33 A;  3I5I B;  5I2O A;  1IKU A;  2WCF A;  2NXQ A;  1NP8 A;  2K7D A;  2E6W A;  2I94 A;  4E68 A;  2CBL A;  3IQO A;  1IQ5 A;  1QVI Y;  1R6P A;  1NX2 A;  1S5G Z;  1YUR A;  1A2X A;  1XFY O;  2JT8 A;  3I5G B;  1PUL A;  2LMU A;  2K0J A;  1U5I A;  1XFV O;  5D7F A;  4GNK B;  1ZUZ A;  2M29 A;  4YGA A;  1V1G A;  1WRK A;  2L50 A;  4IL1 A;  4PHN A;  1NCZ A;  2BE4 A;  2JTZ A;  3PLF B;  4OKH A;  4PE7 A;  3KHE A;  1RTP 1;  1OMV A;  3KF9 A;  3DVM A;  1QVI Z;  1JFJ A;  3SG2 A;  3SG3 A;  4DCK A;  3KEV A;  1BT6 A;  1W7J B;  3NSO A;  4YGD B;  2ZNE A;  2PSR A;  2KYC A;  4CFR A;  3GK1 A;  2M8U A;  4I5N B;  2ISD A;  1F70 A;  1QIV A;  3EK7 A;  1K95 A;  5HLO A;  3BUO B;  5AEQ A;  1CNP A;  1CLB A;  1WDC B;  1PRW A;  2M97 A;  2KFH A;  2PAS A;  3SJS A;  1MQ1 A;  4DUQ A;  2SCP A;  1DJH A;  2MBX A;  1B9A A;  1D1O A;  1IH0 A;  1YUT A;  1R2U A;  5KSZ A;  2JC2 A;  4U8D A;  2M0R A;  1BOC A;  1BR1 B;  1KQM B;  1L2O C;  5HYD A;  1LVC D;  1CFD A;  4N5X A;  1TNW A;  2DOQ A;  2LMV A;  3GK2 A;  3WNX B;  4HRH A;  4YGB B;  2JXL A;  4HRE E;  4JWQ A;  2MHH A;  4XYN A;  1ODB A;  1XVJ A;  4PCW A;  2Y9Z A;  1B8C A;  1SR6 C;  1Y0V H;  3PAT A;  1PAL A;  3IQQ A;  1OMR A;  2L4I A;  3I5F C;  1K8U A;  5AAN A;  1B7T Z;  1GGW A;  1AHR A;  2OPO A;  5I8N A;  2OTG C;  1KSM A;  3AAJ A;  4P5O E;  1DMO A;  1YR5 A;  1J55 A;  2HPS A;  2VRG A;  1IGV A;  1DTL A;  1E8A A;  3EKJ A;  1OFC X;  5DKR A;  1L2O B;  5K89 A;  5FYX A;  1SR6 B;  1UWO A;  2BL0 C;  1XO5 A;  2JNX A;  4ZCU A;  1OOJ A;  4OR9 B;  1UHN A;  3O6B A;  3AAK A;  2LAN A;  1NPQ A;  3KO0 A;  3VRR A;  1JF2 A;  1MXE A;  2OTG B;  3BUW B;  1CDM A;  3QRX A;  3TZ1 A;  1YUU A;  3DF0 A;  1DF0 B;  3BOW A;  1NX1 A;  5DKQ A;  3GK4 X;  3NXA A;  1IWQ A;  1LA0 A;  2KAX A;  5AER A;  2LV7 A;  1B1G A;  2I7A A;  1OMD A;  2Q4U A;  1JSA A;  1UUS A;  3BUX B;  2LHI A;  2BL0 B;  1G8I A;  2KYF A;  3EVU A;  2PVB A;  3LL8 B;  3PN7 C;  2F3Z A;  1GGZ A;  3OB2 B;  4WQ2 A;  4MZL A;  4F0Z B;  1HQV A;  4CLN A;  3DF0 B;  4Q04 A;  2D8N A;  1FF1 A;  4ORB B;  1AP4 A;  2LLU A;  1TIZ A;  3H4S E;  1QAS A;  1Y1A A;  2MRD A;  3F45 A;  1S6I A;  1RWY A;  1BJF A;  3OX5 A;  1YUS A;  4JPZ B;  4PHK A;  2HF5 A;  2BBM A;  2LP2 A;  3K21 A;  1NWD A;  2Q91 A;  2M1U A;  2KSP A;  4AOM A;  5B8I B;  1M31 A;  3CLN A;  2NLN A;  1AK8 A;  3TDU A;  2L98 A;  1SNL A;  1OZS A;  1QTX A;  5ER4 X;  5JOL A;  2LC5 A;  1XFZ O;  2RGI A;  1QX5 B;  1UP5 A;  1QLS A;  1QIW A;  2EC6 C;  2CXJ A;  2L51 A;  3KPX A;  4PAL A;  4D1E A;  4CPV A;  2KAY A;  1KK7 Y;  5KTY A;  1M63 B;  2IS9 A;  2LVV A;  2LLT A;  1ZFS A;  3AKB A;  3NSL A;  3LK1 A;  1RK9 A;  2KFG A;  1DVI A;  3I5H B;  3PFV A;  1PSB A;  3D0Y A;  1B47 A;  1KWO C;  2KDH A;  2MLF C;  3I5I C;  1KFX L;  5AFP A;  1DGV A;  2JZI A;  4WRI A;  4MRX A;  1ALV A;  4ORC B;  2K7B A;  3OX6 A;  2QPT A;  1KK8 C;  4NDC A;  3HX4 A;  1DJZ A;  3VGO A;  3BYA A;  1ZMZ A;  1XK4 A;  2JOJ A;  1UHI A;  2HQW A;  4GFT A;  1BG1 A;  2EC6 B;  1N0Y A;  3CWG A;  3OHM B;  2M1K B;  2R2I A;  3ICB A;  3I5G C;  1X02 A;  3E3R A;  1NSH A;  1ALW A;  4GGF C;  1QX7 A;  1WY9 A;  4BY4 A;  3I5H C;  4CFQ A;  4GGF A;  2LUC A;  5JJG A;  3TS5 C;  2KGB C;  1HT9 A;  5CSI A;  2LM5 A;  2I18 A;  2Y9Y A;  1AVS A;  2EGD A;  4PE1 A;  2TN4 A;  1DJW A;  2O5G A;  1OE9 B;  4FQO A;  3TUY C;  1WLZ A;  2BCA A;  1K9U A;  1OSA A;  3JVT B;  4YI8 A;  4NDB A;  1BR4 B;  5DKN A;  1CDN A;  1WRL A;  5HKZ A;  1J7R A;  2GGM A;  1H8B A;  4PHM A;  2KGR A;  1J7P A;  2GV5 A;  2KI4 B;  1KK7 Z;  1RJV A;  1JC2 A;  5AXI A;  4BY5 A;  1K9K A;  4GAO A;  2LNK A;  1SYM A;  4AQJ A;  2LMT A;  1L7Z A;  1B8R A;  4YRU A;  1CB1 A;  1KQM C;  1XFU O;  2BBN A;  2BEC A;  3JVT C;  3TUY B;  4PHJ A;  1CMF A;  1YRT B;  2NCO A;  2LVJ A;  2BE6 A;  1IQ3 A;  3ZWH A;  2KNE A;  1BOD A;  2KI4 C;  1MF8 B;  2LP3 A;  2Y1N A;  2V53 A;  1MR8 A;  2EHB A;  1NCY A;  1ZOT B;  3CS1 A;  1BU3 A;  3JTD B;  1QJT A;  1EG4 A;  3AKA A;  1S5G Y;  2LLS A;  1A03 A;  1KFX S;  2WOR A;  2Y1M A;  3SIA A;  2L0P A;  1KSO A;  3O4Y A;  1MHO A;  1NCX A;  3NSI A;  2KFF A;  1UUR A;  2JT3 A;  3A4U B;  1KCY A;  1XYD A;  4FTG A;  1WDC C;  1JFK A;  2CTN A;  1F4O A;  1EH2 A;  1UHH A;  1SK6 D;  1SL9 A;  1TNP A;  1SY9 A;  2GGZ A;  4YGC B;  1S26 D;  3WHT B;  2M9G A;  1KFU S;  3DVE A;  1C07 A;  3LLE A;  1FI5 A;  1JF0 A;  1Q80 A;  5CSJ A;  4C0K A;  1F4Q A;  2OS8 B;  5I2Q A;  3BXK A;  4ICB A;  1REC A;  4NQG A;  1S3P A;  2E30 A;  3SIB A;  1DF0 A;  3BOW B;  1AJ5 A;  2JU0 A;  4YGE B;  2LE9 B;  2WOS A;  1J1E A;  3CZT X;  2G9B A;  2BKI B;  3FIA A;  1PVA A;  2PAL A;  2Y4Q A;  3PN7 B;  2FCE A;  1DT7 B;  1WLM A;  1CFF A;  2BCX A;  3LCP C;  1NX3 A;  4DRW A;  1TTX A;  3CGA A;  3FS7 A;  1JUO A;  3PAL A;  2FCD A;  2ZFD A;  3PM8 A;  2K2F A;  2OS8 C;  3SG7 A;  2JWW A;  2BKH B;  2O60 A;  1OZO A;  5CSF A;  1SCM C;  2Y5I A;  4HSZ A;  5D69 A;  5F6T A;  1YVH A;  3A8R A;  2BCB A;  1A4P A;  1K9P A;  3EK8 A;  1U5I B;  3EVR A;  3SG5 A;  4MLW A;  4GPL B;  2JRF A;  2LVK A;  2HET A;  2M7L A;  1RRO A;  1J7O A;  1K90 D;  3GOF A;  4ORA B;  4PE4 A;  2HQ8 A;  1TCO B;  1S1E A;  4A4B A;  2LCP A;  2M7N A;  3NSK A;  4N1G A;  1GJY A;  1M46 A;  1NIW A;  5HLV A;  2KQ6 A;  5HKW A;  2A4J A;  1FBV A;  1DJI A;  1A29 A;  1N65 A;  2WCB A;  1SCM B;  3FWB A;  4XJK A;  1PSR A;  4TNC A;  4PE0 A;  4A4C A;  1W7I B;  1IJ5 A;  3TDI A;  1S6C A;  1SCV A;  1OQP A;  1IRJ A;  1SMG A;  2H2K A;  3EVV A;  2CT9 A;  1XK4 C;  3RLZ A;  2P6B B;  1J7Q A;  4M2O A;  2AAO A;  4MRY A;  1PK0 D;  1KWO B;  2KOT A;  1QS7 A;  1LXF C;  2L2E A;  3M0W A;  1FPW A;  1QXP A;  1EJ3 A;  1SL7 A;  2LHL A;  3RM1 A;  3VRP A;  1AUI B;  4P2Y B;  5BPJ A;  3SG4 A;  5KU1 A;  4YI9 A;  1CTR A;  2WC8 A;  1GQM A;  4I5L B;  4CID A;  1BLQ A;  1G33 A;  2H61 C;  4OVN F;  4QJ5 B;  1F71 A;  2JTT A;  3LK0 A;  2WND A;  3C1V A;  1Y1X A;  4MEW A;  4USL A;  1SKT A;  1YTZ C;  2QAC A;  3BQ3 A;  3O78 A;  5J3X A;  1YVL A;  2FOT A;  4I5K A;  1M39 A;  1LIN A;  4I5J A;  3OP0 A;  4N1F A;  2M3W A;  2JQ6 A;  1CFP A; 
#chains in the Genus database with same CATH topology
 2WSE H;  2ZYG A;  1TRF A;  1QLE D;  3OJA B;  2MLE C;  2K9J B;  1QV1 A;  3CCR P;  2KBI A;  4TT3 H;  4OV2 A;  1VQP P;  4K35 A;  4DS7 A;  2F2P A;  2CPS A;  3AEE C;  2HG5 D;  1TN4 A;  3NGV A;  3EG5 B;  2ZVN B;  2K61 A;  3D77 A;  3GHG A;  4HB1 A;  1BE3 G;  2A06 G;  4LLH A;  1UHK A;  2OYI A;  1K93 D;  2KI6 C;  1VQK P;  1LGH B;  1ZXG A;  3JCU H;  1YQ3 C;  4ZCV A;  4MZJ A;  2MAZ A;  4MBE A;  2B89 A;  4GOF A;  3TS5 B;  3L71 E;  2LVI A;  3I5F B;  1EDK A;  1JMM A;  3L75 E;  3K1E A;  2E43 A;  1OMI A;  1P84 I;  1N73 C;  1JTH A;  5AW8 B;  3PSR A;  5AW5 B;  4MSP A;  1IG5 A;  2G2B A;  1OW4 A;  2QSI A;  3IF7 A;  4HKZ H;  1SQQ D;  1ZRT D;  1A75 B;  2CNP A;  1PGO A;  2CPB A;  2QM8 A;  1KYO E;  3LW5 J;  1IJD B;  3E1R A;  1S6J A;  2V7Q H;  1KZU B;  2M5A A;  1J1D A;  1M1J A;  4I6M C;  1NUB A;  1DJG A;  3UO9 A;  3DVK A;  1XFW O;  3VRN A;  2C9L Y;  1TCF A;  3MSE B;  3GLM A;  2O01 N;  1B8L A;  5AVV B;  2B9B A;  1VQN P;  1E5W A;  1SPY A;  3N7H A;  1TUJ A;  2YGU A;  4MVF A;  2FYU G;  1RE4 A;  1FDM A;  4DJG A;  1CM1 A;  3K5B A;  1NGM B;  1KK8 B;  3L74 E;  2R32 A;  3RK2 C;  2WCJ A;  2QEH A;  5GTH H;  2P70 A;  4WQ3 A;  1KQS O;  4O9B A;  5ER5 A;  3DZT A;  1SQV J;  4C0J A;  3TGU G;  4UPG A;  1SBJ A;  2F2O A;  1L0N G;  2KZI A;  1SFC B;  2RMZ A;  3DD4 A;  1T14 A;  1IFN A;  1L4A C;  3L73 J;  1VQL P;  2M49 B;  2K7C A;  1L0L G;  3ZDM A;  1HF9 A;  4QJ3 B;  1JBA A;  3D0Y B;  2KLU A;  4GT1 A;  2FYU K;  1QX2 A;  1YX8 A;  3CR2 A;  5I2L A;  2QEX P;  1YRU B;  3CCV P;  3Q8I A;  1OW6 A;  1SFC C;  2MJW B;  3CAB A;  1CDP A;  1RFJ A;  5I2O A;  1IKU A;  3GHG C;  2QIW A;  3BVH A;  1VDF A;  4WVZ A;  1PFI A;  5AW9 B;  2I94 A;  2CBL A;  1KIL C;  1IQ5 A;  3B87 A;  2HOD B;  1XFY O;  2LMU A;  4JYC A;  2K0J A;  2B87 A;  1L0L K;  1KMI Z;  3GHG B;  1Y47 A;  1NCZ A;  3FE6 A;  3KHE A;  2KLV A;  1VQ5 P;  1KV4 A;  4DCK A;  3KEV A;  1BT6 A;  1W7J B;  3NSO A;  1S9K E;  2K1A A;  2K88 A;  2W6A A;  3L73 E;  2WMM A;  2WC6 A;  3M0D C;  1KB9 E;  1K95 A;  5AEQ A;  5APY A;  2JEE A;  1WDC B;  2PAS A;  3SJS A;  4DUQ A;  2SCP A;  1IH0 A;  1CW5 A;  1KQM B;  1DD4 A;  1LVC D;  2LKM A;  2IBZ I;  3WNX B;  4HRH A;  1S2E A;  3FE9 A;  3H1H G;  3NFQ A;  3H25 A;  1XVJ A;  1OVV A;  1BGY E;  2KNC B;  3PAT A;  4TLF A;  3CDN A;  2N1T C;  3IQQ A;  3I5F C;  1K8U A;  1N7S D;  3HE4 A;  1NOH A;  2OPO A;  1YIJ P;  4P5O E;  1LNQ A;  2VRG A;  1L2O B;  1TUZ A;  1DD3 A;  5K89 A;  1S72 P;  1U7M A;  1PGJ A;  1SQB G;  1UWO A;  2G3A A;  2O01 H;  1A02 J;  2A45 G;  1LTB C;  2JNX A;  2HFE D;  3AE3 C;  1OOJ A;  2XKM A;  4HJG H;  2O01 J;  1UHN A;  5AVR B;  1RF1 A;  3VRR A;  3KO0 A;  1R5L A;  1JF2 A;  1RE3 A;  4I7Z C;  1Z56 A;  3QRX A;  1TU3 F;  1YUU A;  3CX5 D;  3M9Q A;  1D7M A;  5DKQ A;  3BAS A;  1RF0 A;  3NXA A;  1LA0 A;  3M0A A;  2KAX A;  5AER A;  1VPC A;  2KYV A;  2NPS A;  1JSA A;  1NU1 D;  2LHI A;  2OAR A;  1L4A D;  2P1J A;  2PVB A;  3LL8 B;  4OWF A;  4EDF A;  1AVY A;  2VRS A;  2H43 A;  1MFZ A;  3L4L A;  1GW4 A;  4AQR D;  4ORB B;  2LLU A;  1TIZ A;  2KXP B;  2ZXX A;  3P8C D;  1KIL A;  2MRD A;  3TNU A;  3F45 A;  1X0T A;  1M7L A;  2E74 D;  1YUS A;  2IFN A;  4JPZ B;  2JWD A;  1NTK G;  2XV5 A;  2KI7 B;  3M9B A;  4YTP C;  1X79 B;  2OTL P;  3FWN A;  3E7K A;  1AQ5 A;  1NWD A;  1UIX A;  2M1U A;  2M8R A;  1LWU B;  3KDP B;  1ORG A;  2HPC B;  1M31 A;  1AK8 A;  3UIA A;  1BGY J;  1PPJ G;  1GL2 A;  3PH0 A;  5D3O A;  1XFZ O;  1QX5 B;  2L51 A;  1P84 H;  4PAL A;  2CXJ A;  4CPV A;  5AW2 B;  3H32 B;  2LLT A;  1GW3 A;  2YMY A;  2OYH B;  3NSL A;  4F7F A;  3WMM 0;  2OYI C;  1RK9 A;  3PFV A;  4PV1 C;  2E75 B;  1VF5 B;  3TK1 A;  1KFX L;  5AFP A;  2Z5H A;  1FZC B;  4MRX A;  1ALV A;  1T2K C;  2K7B A;  5DJT B;  4Y99 C;  2O3J A;  2N9Y B;  3VGO A;  2I1K A;  2WQY C;  1NTK K;  3C1L A;  4GFT A;  5BU8 B;  1ZP0 C;  2PQL A;  1FJK A;  1Y9B A;  2OYH C;  1X02 A;  1TWO A;  1NSH A;  3AEF C;  1WY9 A;  1FZC C;  1QVG O;  3TS5 C;  1HT9 A;  5CSI A;  1AVS A;  2AEF A;  3CCU P;  2HOD A;  4FQO A;  3FXD A;  2FFD C;  4OZD A;  5KLV G;  1A02 F;  5DKN A;  1WRL A;  1H8B A;  4PHM A;  1RJV A;  5AXI A;  2LNK A;  1SYM A;  1T2K D;  2OTK E;  4YRU A;  1KQM C;  1XFU O;  2AXT H;  2WPQ A;  5CCG D;  2NCO A;  1ZV8 A;  1SP4 A;  2LVJ A;  3Q5R A;  1OWA A;  1IQ3 A;  2JO1 A;  1HBW A;  3BAT A;  1SQQ J;  1NCY A;  3SS4 A;  1ZOT B;  1GM0 A;  3CS1 A;  1BU3 A;  3JTD B;  1QJT A;  1EG4 A;  1NO4 A;  2LXC B;  3KZI H;  3L74 J;  1A03 A;  5H2F H;  1EDJ A;  2L0P A;  4IL6 E;  2KNC A;  2V7Q J;  1UUR A;  1K9M Q;  5KAI E;  4FTG A;  1SQQ G;  1E79 H;  2N1T D;  1EH2 A;  3SWF A;  1SK6 D;  1TNP A;  2YMK A;  3WHT B;  1NTK J;  2E76 D;  2QEB A;  4H13 D;  5I94 A;  5TIS E;  3LLE A;  1SFC A;  1JF0 A;  1Q80 A;  5CSJ A;  5B5E E;  3AED C;  5I2Q A;  3GF3 A;  1G2C A;  3P8C E;  1KD1 Q;  1BE3 J;  2KP8 A;  2KB7 P;  1N8R Q;  3CC2 P;  5CJ4 A;  1KYO D;  1J1E A;  1RHZ B;  1T6A A;  1SS1 A;  1YQ4 C;  1LT9 A;  1PP9 G;  2ZVO B;  2PYQ A;  3L36 A;  3HD7 D;  5CSF A;  3L75 J;  1RQU A;  3PJS K;  5AW0 B;  4PT1 A;  3L70 G;  3L75 D;  4MLW A;  4GPL B;  2LVK A;  3SS5 A;  1FZC A;  3Q5P A;  1TCO B;  1LWU C;  1OX3 A;  2BAP A;  3NSK A;  3S0G A;  2A4J A;  1N65 A;  1FE6 A;  3FWB A;  4XJK A;  2YO2 A;  4TNC A;  3H32 A;  1NTK E;  3H1I E;  1IFP A;  1SMG A;  1SQB E;  2CT9 A;  3VB1 A;  3HD7 A;  1J7Q A;  2Y0E A;  2IX7 C;  1FPW A;  3RM1 A;  4H44 D;  1AUI B;  3B5N A;  4LGD E;  1CTR A;  2GM4 A;  1KQG B;  3CCQ P;  2PGD A;  2ZT9 B;  1GQM A;  4I5L B;  1W2E A;  3BRT B;  2WT7 B;  1SQP E;  3MTU E;  2JTT A;  2E5Y A;  3C1V A;  5KAF E;  1Y1X A;  4MEW A;  2QAC A;  3O78 A;  2MJZ A;  4D6T E;  3BCC J;  3OP0 A;  4N1F A;  2WSE J;  3S4R A;  3B71 A;  3BUN B;  5TNC A;  2R5B A;  3R72 A;  1VQ8 P;  2FFD B;  1VRK A;  4NPD A;  1LTG C;  3TYY A;  3SG6 A;  1S3J A;  2W90 A;  3H1I G;  2K9Y A;  2AMI A;  3CXH I;  1F55 A;  1VQ4 P;  1DQE A;  1FZA A;  3KYQ A;  4I7Z B;  1K94 A;  3O2P A;  5APW A;  3AEA C;  5CCG C;  3SWY A;  3CX5 H;  2K2A A;  2L5X B;  1EXR A;  2ZRT A;  1YYC A;  4U3F D;  2W27 A;  4CPG A;  3BUM B;  2Y0C A;  1L0L E;  1DH3 A;  2JUL A;  1VF5 D;  1JY3 O;  3JTD C;  1PV3 A;  1FJP A;  1N7S A;  3TDZ A;  1NYA A;  1XA5 A;  1K2H A;  4HRG A;  3KPE A;  3DXL A;  5APX A;  3EKH A;  3L70 D;  1DJX A;  1IZN B;  1L0L J;  1WRG A;  4QJ4 B;  2KS1 A;  3HE5 A;  3NMD A;  4C7N B;  2K7O A;  2L2C A;  1J1D C;  1M1J C;  5G08 A;  2C0W A;  2AXT E;  1G4Y R;  1CDL A;  1UHJ A;  1KFM A;  3L71 G;  2LAP A;  1KB9 D;  1VQO P;  1NTZ D;  4L75 A;  1VQM P;  3T97 A;  1OOG A;  4GGN A;  1JY2 P;  1HTL C;  2W6B A;  2K60 A;  2WCM A;  3FWC A;  1J1D B;  1M1J B;  4YBH B;  2E75 C;  2KAV A;  1VF5 C;  3H1L E;  2WCE A;  4K3A A;  1L4A B;  3VRO A;  1K96 A;  1EL4 A;  2OYH A;  1AQT A;  1IJ6 A;  1FI6 A;  2P10 A;  5CBO A;  3R1V A;  3CPW O;  2HLO A;  3R2P A;  3NHT A;  1PPJ D;  1DJY A;  1WT6 A;  1SQB D;  1U57 A;  3EK4 A;  4AQI A;  1PGP A;  1NX0 A;  3FX0 A;  1YTZ I;  3S0A A;  4DIR A;  1JY3 N;  1OOH A;  3CR5 X;  1KIL B;  2M0B A;  2BEQ D;  3CTN A;  1PVB A;  4ZMD A;  4B86 A;  1NWQ A;  4C7R A;  1JY2 N;  4Z1M H;  4UB8 H;  4NPF X;  2JXC A;  1SRA A;  2F33 A;  3CWB E;  4KJM A;  2FYN C;  5AVQ B;  1NP8 A;  2K7D A;  1GK4 A;  2WWW A;  4E68 A;  3IQO A;  2E76 B;  1L0N K;  3IFM A;  1QVI Y;  3S0D A;  1Q90 D;  1ZR4 A;  1PUL A;  3I56 P;  2FXM A;  4H0L B;  1DEK A;  1XFV O;  2BCC J;  1V1G A;  2JTZ A;  3U1C A;  4PE7 A;  3KF9 A;  4C7N A;  1YBK A;  3FE8 A;  1AJY A;  1SQX J;  2PSR A;  4CFR A;  2ISD A;  1F70 A;  4H0L C;  1M57 D;  2HR3 A;  2Q7C A;  4GOE A;  1FOS F;  2KFH A;  1YUT A;  1QEX A;  1URQ B;  1BR1 B;  1H88 A;  1L2O C;  5HYD A;  1PIX A;  4M3L A;  1K73 Q;  5BU5 A;  1J1E C;  1QVF O;  4YGB B;  3C8V A;  4HRE E;  4JWQ A;  1ODB A;  1OOI X;  1B8C A;  1SR6 C;  1FDI A;  4KHX A;  1LS8 A;  2L4I A;  4ASW A;  1S5L X;  1IFJ A;  3CMA P;  1ZME C;  3AAJ A;  1YR5 A;  1J55 A;  2HPS A;  1MV8 A;  1NTK D;  1IGV A;  1DTL A;  2ZT9 D;  3DY9 A;  2C9N Y;  1Y8A A;  1SR6 B;  3CXH H;  1KYO H;  1Q81 Q;  4ZCU A;  2KK7 A;  3VP9 A;  5CJ0 A;  1P28 A;  3AAK A;  2LAN A;  1NPQ A;  3PP5 A;  1CDM A;  3B88 A;  3TZ1 A;  3CCL P;  1VQ9 P;  5AW1 B;  1Z4H A;  2ZFC A;  3VYI A;  1G2C B;  3BFB A;  5AVX B;  2E42 A;  2LV7 A;  1B1G A;  3IF4 A;  3H1K E;  4U7J A;  2KOG A;  3AEG C;  3OB2 B;  1GGZ A;  4WQ2 A;  1QL1 A;  2LR2 A;  2D2C B;  3VP8 A;  1QWV A;  4CLN A;  2QJY B;  4Q04 A;  1SQB K;  1K04 A;  2YKO A;  3RBZ A;  5CBN A;  3H4S E;  1FS0 E;  3H1H D;  1RWY A;  3OX5 A;  1N73 A;  4PV1 B;  3GG2 A;  3PRJ A;  3K21 A;  5EL2 A;  2W8Z A;  2KSP A;  2NLN A;  5CCH D;  1RY3 A;  2QJY C;  1SNL A;  1OZS A;  5ER4 X;  3KPX A;  1QLS A;  1NTZ K;  2KAY A;  4MN4 C;  2IS9 A;  2LVV A;  3P8M C;  1N2D C;  3LK1 A;  2KFG A;  1DVI A;  1KB9 I;  2P7J A;  2G8Y A;  1PSB A;  1T3U A;  2MLF C;  1L0N D;  2Y0D A;  2JWA A;  4NDC A;  2FYN B;  1YI2 P;  1SQP J;  3CME P;  3BYA A;  2PP6 A;  4IFF A;  4WBA A;  2JOJ A;  2ZYD A;  3RL0 C;  2WPS A;  5APV A;  2EC6 B;  1N0Y A;  3CWG A;  4L73 A;  3A2A A;  3B5N C;  1MUU A;  2WTY A;  3L47 A;  3P7K A;  4GGF A;  1WMK A;  3B7A A;  2JR8 A;  2NRG A;  4PE1 A;  2TN4 A;  1DJW A;  4GOD A;  2O5G A;  1WLZ A;  4HH2 A;  1M56 D;  1K9U A;  1OSA A;  4YI8 A;  5AW6 B;  3P32 A;  4IL6 H;  3RGU A;  1BR4 B;  2GGM A;  1S1C X;  1HH0 A;  4JF7 A;  4EI2 A;  1KK7 Z;  1RQV A;  4GAO A;  2IBZ D;  4AQJ A;  2LMT A;  2MKV A;  5KKZ C;  1B8R A;  1NU1 J;  3RL0 D;  2N1T A;  2BEC A;  3HE5 B;  1CZQ A;  5CCH A;  4PHJ A;  1PPJ E;  1Q82 Q;  1YRT B;  3WU2 E;  4I2L C;  3L72 E;  2KNE A;  5AVT B;  1M8O B;  1H8A A;  3KXD A;  2Y1N A;  4N78 D;  1MR8 A;  5KLV K;  1N7S B;  3BCC E;  5KKZ B;  3TSI A;  1L2P A;  3G71 P;  1HGV A;  1EDL A;  5KLI B;  3AKA A;  3W68 A;  1LTJ C;  4OGQ C;  2LLS A;  2WOR A;  3BFA A;  2Y1M A;  1RE3 C;  1KSO A;  1MHO A;  1NCX A;  1KCY A;  3QH9 A;  1AV1 A;  1ZN5 A;  2GUV A;  3H1K G;  4JKT A;  1QGK B;  1N7S C;  3HTK A;  2CTN A;  1HWT C;  5KJ7 C;  1F4O A;  1NHL A;  2GGZ A;  1S26 D;  2M9G A;  1CI6 B;  1SQB J;  3PTZ A;  1FI5 A;  2FXO A;  3G3Z A;  4W7Z A;  4U3F G;  4NQG A;  1BCC J;  2QG4 A;  1DF0 A;  1KFN A;  2LE9 B;  4IJ7 A;  3B4S A;  3CZT X;  2G9B A;  2BKI B;  3FIA A;  1PVA A;  5KTB A;  1FZB A;  2ZAE B;  1DT7 B;  1WLM A;  1X8Y A;  2BCX A;  2P2U A;  1P84 E;  3FS7 A;  3PAL A;  3SG7 A;  4FQT A;  4JYB A;  1SCM C;  5D69 A;  3L37 A;  1GL2 C;  5F6T A;  3A8R A;  1SQQ K;  3SS3 A;  3RK3 D;  1A4P A;  3EK8 A;  3EVR A;  3AE5 C;  5KAF H;  1J7O A;  1LJ2 A;  3VMX A;  3GOF A;  4PE4 A;  2HQ8 A;  3V4Q A;  3EFF K;  1S1E A;  1EC5 A;  2KUB A;  3U59 A;  1LWU A;  3L70 E;  1NIW A;  2NZ2 A;  2ZT9 C;  1FBV A;  2WCB A;  1SCM B;  1PSR A;  1IJ5 A;  2KIK A;  1EZV D;  2P6B B;  4M2O A;  3B86 A;  3OA7 A;  1PK0 D;  1SQX D;  1QS7 A;  1LXF C;  2L2E A;  1JY3 P;  1MZ9 A;  5AVW B;  1SL7 A;  2LHL A;  3JC2 2;  3SG4 A;  3PJI A;  1URQ C;  2Q3I A;  3CWB G;  2WC8 A;  2A45 H;  4CID A;  4QJ5 B;  1KIL E;  1J1E B;  2YNY A;  3T97 B;  1OW8 A;  5GTI E;  2BEZ F;  3PLN A;  1YVL A;  3L74 D;  4I5K A;  3Q1M A;  2Q3E A;  2JDI H;  4I5J A;  1PL5 A;  1YIT P;  2Z4E A;  1G1I A;  3A0H H;  2JT0 A;  2IBZ E;  1K8A Q;  2Q1K A;  2ZKM X;  4INX A;  4WB4 A;  1KQV A;  1S36 A;  2M3B A;  2WZ7 A;  3TF5 A;  3LW5 H;  2QJP B;  4C0L A;  1SQV D;  4M2P A;  2BCC E;  3KQG A;  3HRN A;  2BCC G;  1NU1 G;  1H4B A;  4N3Y B;  1ZW0 A;  3LIE A;  1F8H A;  4KYN A;  1B7T Y;  2ZRS A;  1FOS E;  1R8E A;  3W67 A;  5CCG A;  1L0L D;  2KHN A;  1BF5 A;  3S9O A;  3OBV A;  3I55 P;  3H1J G;  1W9Z A;  4KT0 J;  3ZNI A;  4N6J A;  5H2F E;  3A5T A;  3CXH D;  3VRQ A;  4Y28 J;  2FJU B;  2WSS H;  4HYT B;  1B4C A;  2I2R E;  1EZV I;  3EFG A;  4OCI A;  2COL B;  1NTM E;  1EG3 A;  2FFD A;  1JY2 O;  2E75 D;  4PDZ A;  1C3Z A;  2JNF A;  1CFC A;  1GK6 A;  5GTH E;  3AEC C;  5CPV A;  1CLM A;  5AW4 B;  1K05 A;  3AE8 C;  5CSN A;  3AE1 C;  3MHV A;  4EYY Q;  1SL8 A;  1JUN A;  3OB1 B;  3L35 A;  2QDI A;  3WXA A;  2ZN8 A;  3PM2 A;  4UB8 E;  4IFM A;  2SAS A;  4R1E A;  1MWN A;  1WRZ A;  2JPT A;  2QM7 A;  3CZ0 A;  5KLV J;  2PRR A;  2ZXE B;  1V1F A;  1CMG A;  3V2N A;  1KFU L;  2ZN9 A;  5FI6 A;  3RL0 B;  2B1U A;  2WIT A;  1GL2 B;  3PHL A;  1SW8 A;  1CKK A;  2FKW B;  2H61 A;  1EQ7 A;  3F89 A;  1Y1U A;  1BDC A;  2HYN A;  2FY8 A;  4PV1 D;  2WSF J;  1C7W A;  2B87 B;  2K8M B;  4OGQ D;  2AEJ A;  1YJN P;  1Q7Y Q;  1L0N J;  1RF0 C;  2E76 C;  2B88 A;  2JPO A;  1VQ6 P;  1C7V A;  1TNX A;  1FBM A;  4WWI A;  3CCJ P;  1OVU A;  3D78 A;  2CCM A;  3G4S P;  5CCH C;  3L74 G;  2NXQ A;  1Q2N A;  4ASV A;  1R6P A;  3MIW A;  1LT1 A;  1S5G Z;  1JM0 A;  2H89 C;  3I5G B;  3CWB J;  1LT9 C;  2R5D A;  4GNK B;  1ZUZ A;  2M29 A;  4YGA A;  2WSC H;  1RTP 1;  1C3Y A;  1OMV A;  1QVI Z;  2KLD A;  1JFJ A;  5KLI C;  1DX7 A;  2IFM A;  4YGD B;  1X9V A;  3H1J D;  3RK2 D;  1MFT A;  3GK1 A;  2M8U A;  3Q5S A;  4I5N B;  2QRX A;  2KLE A;  3OGN A;  5HLO A;  3RK3 B;  3BUO B;  1LTS C;  3LID A;  2E5T A;  1KN7 A;  1PRW A;  2M97 A;  3D70 A;  1KYO I;  4D6T J;  1DEL A;  1DEE G;  1B9A A;  2FYU D;  1OZH A;  1JO5 A;  4U8D A;  1BOC A;  2IYP A;  3S0E A;  1NTZ J;  4R4M A;  2DOQ A;  3V2L A;  4RKU J;  2AEM A;  3RK3 C;  2JXL A;  2IZ1 A;  4XYN A;  4DZO A;  2KZJ A;  2R3S A;  4IOI H;  5AVS B;  1IFD A;  4PD4 D;  1ZOY C;  1GGW A;  3O4X A;  1KSM A;  1DMO A;  2XU6 A;  3MUD C;  5APQ A;  2HPC A;  1KTM A;  3BFH A;  3WUU A;  3N4X A;  1H0T B;  5FYX A;  4L74 A;  3II6 A;  3I5C A;  4IL6 X;  3G9R A;  2JJL A;  2J58 A;  4OR9 B;  3SSU A;  2ERB A;  4ZKP A;  1MXE A;  3RZS A;  2D2C C;  3IAO A;  1YHQ P;  4DT0 A;  3R1O A;  3BOW A;  3GK4 X;  4D6T G;  2CK3 H;  2IDB A;  1OMD A;  2W83 C;  5KJ7 A;  2A06 E;  3BUX B;  5M1B A;  2BL0 B;  1G8I A;  3EVU A;  1GU5 A;  5AVU B;  4C46 A;  2WC5 A;  2IZ0 A;  3H1H E;  1JMB A;  3UNW A;  3EWK A;  3H1I J;  4A7P A;  3CLQ A;  1IK9 A;  1IO4 A;  1CI6 A;  3BCC D;  3RBX A;  5AVY B;  1EXJ A;  3A7O A;  2WCH A;  2FBW C;  2BBM A;  1T8Z A;  2LP2 A;  2BCC D;  2Q91 A;  2POH A;  3B8E B;  3VTP C;  1QTX A;  5JOL A;  2WSF H;  2LC5 A;  2RGI A;  2ZFD A;  1OOF A;  2EC6 C;  1QIW A;  4D1E A;  5KTY A;  1NAY A;  5FI2 A;  1ZFS A;  3AKB A;  3B5N B;  1DC1 A;  4GKG A;  3D0Y A;  1B47 A;  2KDH A;  4PD4 I;  1DGV A;  2JZI A;  4WRI A;  2GA1 A;  2R3C A;  3NHI A;  4ORC B;  1SQX G;  2RH0 A;  2QPT A;  1IFI A;  2QEV A;  3HX4 A;  2YKQ A;  3KHU A;  3HUS C;  1ZMZ A;  3L71 J;  3L72 J;  2OGU A;  4U3F J;  5AVZ B;  2M1K B;  5B5E H;  3I5G C;  3CX5 I;  3E3R A;  3MD0 A;  4H0L D;  4GGF C;  1QX7 A;  3I5H C;  2I8D A;  3TGU J;  3V5B A;  1URQ A;  2LM5 A;  1NTZ G;  3IR9 A;  2Z5I A;  3TGU D;  1NTZ E;  3CCS P;  5E79 E;  2FYU E;  4UB6 E;  3ABV C;  3L70 J;  3BRV B;  4XA4 A;  1JTH B;  2FJY A;  2QA4 P;  1EZV G;  4L76 A;  1SSE B;  4NDB A;  5HKZ A;  3H1L D;  2E74 C;  3QME A;  1J7P A;  2P67 A;  2KI4 B;  1G1J A;  4BY5 A;  1SFC D;  3SFE C;  2IYO A;  3H1L J;  1LTJ B;  4OGQ B;  1KC8 Q;  1L7Z A;  1CB1 A;  3TUY B;  2JQ6 A;  2P58 A;  3O8Z A;  3S0F A;  5B66 H;  1BOD A;  2NPS C;  2KPH A;  2KI4 C;  2LP3 A;  1SQV E;  1USD A;  2V53 A;  3MZW B;  2EHB A;  1BCC E;  1KIL D;  5GTI H;  3IN6 A;  1S5G Y;  1BDD A;  1KFX S;  4RES B;  2JP3 A;  3D6Y A;  3NSI A;  3BCC G;  1L4A A;  2JT3 A;  1M90 Q;  1NVO A;  1JNM A;  1XYD A;  5KJ7 D;  1JFK A;  2XDJ A;  2I1J A;  3G6E P;  1Z2C B;  4YGC B;  3CYZ A;  3BJH A;  3D74 A;  3DVE A;  2O1K A;  2ZYA A;  2WPR A;  4C0K A;  3VMA A;  3D71 A;  1F4Q A;  3BXK A;  1XFR A;  4ICB A;  1REC A;  3HTK B;  4AYC A;  2P71 A;  1S3P A;  3SIB A;  3BOW B;  3DYE A;  1AJ5 A;  1HUC A;  3OAK A;  2IBZ G;  1JEK A;  2OQQ A;  2Y4Q A;  2PAL A;  5FI7 A;  1JB0 J;  2D2C D;  1CFF A;  3LCP C;  4DRW A;  1FZE A;  4U3F E;  1TTX A;  3CGA A;  1JUO A;  3PM8 A;  2FCD A;  3H1J E;  2K2F A;  4GDO A;  2BKH B;  2M5A B;  1OZO A;  3QWO C;  1H0T A;  2Y5I A;  4WY4 D;  2BCB A;  1U5I B;  3IVT A;  3A3Y B;  2M7L A;  1K90 D;  4ZNC A;  2V4H A;  2GTE A;  2M7N A;  1PP9 J;  4N1G A;  1BE3 E;  2KQ6 A;  2R44 A;  4H13 C;  1DJI A;  1A29 A;  2KS1 B;  1M1K Q;  3CC7 P;  4PE0 A;  4A4C A;  1PP9 D;  1S6C A;  2OTJ P;  2QJK C;  1SQX E;  2BAS A;  3EVV A;  2GUS A;  1AFO A;  1XK4 C;  5CMZ A;  3RLZ A;  4W7Y A;  4BWN A;  4MRY A;  2KOT A;  3CD6 P;  2WCK A;  4YI9 A;  1JOC A;  1IFM A;  3AE9 C;  4XFJ A;  3V6I A;  4EIJ A;  4OH8 B;  1W2B O;  4OVN F;  5K5G B;  3AEB C;  3LK0 A;  5APS A;  3H1J J;  5AW7 B;  1RH5 B;  3S1K A;  2WND A;  4EOT A;  4USL A;  5J3X A;  2QJP C;  1BGY G;  1M39 A;  1LIN A;  2H8P D;  3WUT A;  3GW6 A;  2KI6 D;  1X22 A;  4D6T D;  1A75 A;  2UWJ E;  3SWK A;  2L4H A;  2KQY A;  4GBA A;  4GUK A;  3ITK A;  2A06 D;  1LP1 B;  4INW A;  2F8P A;  1TNQ A;  2E74 B;  2WCL A;  2K37 A;  3GMA A;  1TOP A;  4NDD A;  1DGU A;  1N2D A;  5E79 H;  2K3R A;  4ETO A;  1BCC D;  3VOP A;  1BSN A;  2KBM A;  2M3E A;  2PMY A;  1YJ9 P;  3CZ2 A;  3HCM A;  3N7N A;  4DOJ A;  1LTJ A;  3FXE A;  1MUX A;  2Q5U A;  2PRU A;  5IBW A;  1OXZ A;  3B5N D;  4GIF A;  1FZF A;  1BSH A;  1JWD A;  1KB9 H;  5C39 A;  1QAT A;  4MZK A;  2AXC A;  1YJW P;  4UB6 H;  1F54 A;  3VN0 A;  1AJ4 A;  1NTM D;  4H44 C;  1NJI Q;  1QLK A;  1BMO A;  1NKZ B;  1FW4 A;  4JQ0 D;  3DVJ A;  2J59 M;  2YIU B;  5APT A;  2DW3 A;  3TDK A;  3AE4 C;  2MA2 A;  3USS A;  4MN0 A;  1GZL A;  3L73 G;  1Y6W A;  1NU1 K;  3WU2 H;  4XJK B;  4L9M A;  3H1I D;  5KLV D;  1QX8 A;  1ZRT E;  2NZ0 A;  2YIU C;  1YX7 A;  4WY4 A;  3CCM P;  5GQQ C;  4ZKU A;  3CR4 X;  1CLL A;  2Q6Q A;  1RE4 C;  1J2J B;  1LA3 A;  3M06 A;  3TGU E;  3D10 A;  3V4W A;  3O6Q A;  1XFX O;  1FZG A;  1LKJ A;  3HUS B;  3WHU B;  4M2Q A;  2ZND A;  3FGA D;  2JKV A;  2NCP A;  2KSE A;  4YPC A;  1OIP A;  4PD4 E;  2OYO A;  5PAL A;  2AUC A;  5KAI H;  1CM4 A;  3R1P A;  2WSC J;  2W6J H;  2XNX A;  1NH4 A;  3D75 A;  1M45 A;  1MXL C;  5HKY A;  1VL2 A;  4BRY B;  1W5C E;  4PJ0 E;  5TIS H;  3MGN A;  1QV0 A;  3L72 D;  2RN0 A;  2QJK B;  3CWB D;  1LT9 B;  4BRY A;  4N78 E;  3Q3D A;  2F3Y A;  1ZAC A;  2LUX A;  3I5I B;  3NTN A;  2WCF A;  3O6Q B;  3Q2Y A;  2E6W A;  3CZ1 A;  1H89 A;  1NX2 A;  2PAJ A;  1YUR A;  1A2X A;  2JT8 A;  4RJT A;  1U5I A;  2NPS B;  1N7L A;  2WT7 A;  1WRK A;  2L50 A;  4IL1 A;  4PHN A;  1VQ7 P;  2BE4 A;  3PLF B;  4OKH A;  3VMY A;  5BVZ A;  2FYZ A;  1IC2 A;  3DVM A;  5AW3 B;  3SG2 A;  3SG3 A;  1SQV G;  1QL2 A;  3L4A A;  2ZNE A;  1RF1 B;  5DIC A;  2KYC A;  3M0D A;  3HD7 B;  2QVA A;  2WVR A;  3F5H A;  4IFD K;  4WY4 B;  2QE7 H;  3EQ2 A;  1QIV A;  3EK7 A;  1CNP A;  4AUW A;  1GDT A;  3H1H J;  1CLB A;  1OW7 A;  4I1L A;  1MQ1 A;  1DJH A;  2MBX A;  1D1O A;  1R2U A;  5KSZ A;  2JC2 A;  4NPE A;  2M0R A;  2XND H;  3A0H E;  1CFD A;  4N5X A;  1TNW A;  2YO3 A;  2LMV A;  3GK2 A;  1OVR A;  3R4Y A;  1PGQ A;  1XTC C;  4WY4 C;  2MHH A;  2Y9Z A;  4PCW A;  2XZR A;  2O1J A;  3AE7 C;  5DJU B;  1Y0V H;  1SQV K;  1PAL A;  1YTZ T;  1GD2 E;  3A0B H;  1OMR A;  5AAN A;  1B7T Z;  3TNU B;  1AHR A;  5I8N A;  1SQP G;  4H44 B;  2OTG C;  1PP9 E;  3EKJ A;  1E8A A;  1OFC X;  5DKR A;  3KZI E;  1SQP D;  1FAV A;  2BL0 C;  1XO5 A;  2RKL A;  3O6B A;  3S0B A;  2N1T B;  2OTG B;  3BUW B;  3JSV C;  2QEO A;  3DF0 A;  1DF0 B;  1NX1 A;  4H13 B;  2PFX A;  1DEB A;  1GU4 A;  5APU A;  1IWQ A;  1HVV A;  2I7A A;  3CX5 E;  2Q4U A;  1UUS A;  1SQP K;  2KYF A;  4BXL A;  1LTI C;  3CCE P;  3PN7 C;  2F3Z A;  4JD9 A;  4MZL A;  4F0Z B;  1HQV A;  3DF0 B;  2IPP A;  2D8N A;  1IIO A;  1FF1 A;  1AP4 A;  2A45 I;  3CC4 P;  1QAS A;  1Y1A A;  3D73 A;  1AVO A;  3HE4 B;  1S6I A;  3A0B E;  1NYH A;  1BJF A;  4PHK A;  2HF5 A;  1NKN A;  4AOM A;  5B8I B;  1PZQ A;  1GMJ A;  3CLN A;  5TJH A;  3TDU A;  2L98 A;  1SLQ A;  3L71 D;  3NXS A;  1UP5 A;  1AA0 A;  3D76 A;  1KK7 Y;  1M63 B;  1LTA C;  2FYU J;  3I5H B;  4YXD C;  1KWO C;  3I5I C;  1JCC A;  1BE3 D;  4PJ0 H;  3OX6 A;  1KK8 C;  3HUS A;  3L75 G;  1DJZ A;  1BGY D;  3V2P A;  1XK4 A;  1L0N E;  1UHI A;  2HQW A;  1BG1 A;  2YKP A;  1S9K D;  3OHM B;  4R4L A;  2R2I A;  3L73 D;  3ICB A;  1FC2 C;  3L72 G;  1P84 D;  1ALW A;  5KLV E;  1ZLL A;  2OYI B;  4CFQ A;  2ZJS E;  4BY4 A;  2LUC A;  5JJG A;  2KGB C;  1S5L H;  2I18 A;  3CL3 D;  2Y9Y A;  2EGD A;  2H7H A;  1OE9 B;  4Y99 B;  2L5Y A;  3TUY C;  3MP7 B;  2BCA A;  1HJ0 A;  2WPV B;  1KOR A;  3JVT B;  1CDN A;  1J7R A;  1SQX K;  1N86 A;  1UII A;  2KGR A;  3V2R A;  2GV5 A;  3FWL A;  1JC2 A;  1KQF B;  1K9K A;  3E1I A;  2L91 A;  1EZV E;  1XTG B;  2Q9I A;  3AE6 C;  1BCC G;  2BBN A;  1NTM J;  3JVT C;  1GL2 D;  1CMF A;  1JCD A;  1EDI A;  2BNX A;  2SPZ A;  4RO0 A;  3D6Z A;  3MUD A;  2BE6 A;  3ZWH A;  1MF8 B;  3H1L G;  3H6P A;  1R5S A;  2H8V A;  2YXQ B;  1N73 B;  5B66 E;  1NAF A;  1GTW A;  3SIA A;  1USE A;  1FU1 A;  3O4Y A;  4LC1 A;  1S5L E;  2C0X A;  2KFF A;  3A4U B;  1NU1 E;  1WDC C;  1U7J A;  2NPS D;  1HJB A;  1UHH A;  1SL9 A;  1SY9 A;  1T3J A;  1KFU S;  3AE2 C;  1C07 A;  1EXI A;  3JCU E;  2OS8 B;  1FDO A;  1NTM G;  1LP1 A;  3WUV A;  2E30 A;  1SQQ E;  2JU0 A;  4YGE B;  3GF7 A;  5L8R J;  1CSB A;  2WOS A;  4XE5 B;  4JBZ A;  3V2Q A;  3PN7 B;  2KSJ A;  2LXB A;  2FCE A;  3B6X A;  1NX3 A;  2H88 C;  3RK3 E;  5CHX A;  1ZR2 A;  3RK2 B;  3C9I A;  2OS8 C;  2JWW A;  2O60 A;  1URQ D;  3M91 A;  4HSZ A;  4W80 A;  1YVH A;  4PD4 H;  1K9P A;  2ITA A;  3SG5 A;  3CXH E;  3M9H A;  3L4F A;  2JRF A;  2HET A;  5EFW B;  1RRO A;  1DIP A;  2L5G B;  1IK7 A;  4ORA B;  2N9B A;  3CI9 A;  4A4B A;  2LCP A;  1GJY A;  3U1A A;  1M46 A;  5HLV A;  1NTM K;  2FXP A;  5HKW A;  5D7F A;  4YXW H;  1W7I B;  3RL0 g;  1RF1 C;  3TDI A;  1SCV A;  4QMA A;  1OQP A;  1IRJ A;  3HD7 C;  2H2K A;  3OW2 O;  2AAO A;  1KWO B;  3M0W A;  1KQL A;  1QXP A;  1EJ3 A;  1LTT C;  5BPJ A;  3VRP A;  4P2Y B;  1MKM A;  5KU1 A;  3VMZ A;  1Q86 Q;  2K9J A;  1BLQ A;  1G33 A;  2H61 C;  1F71 A;  5HL1 A;  2YXR B;  1SKT A;  1YTZ C;  3BQ3 A;  3H1K J;  2J5U A;  3SFD C;  2FOT A;  1S4X A;  2M3W A;  1SVF A;  1HGZ A;  3H1K D;  1CFP A; 
#chains in the Genus database with same CATH homology
 2KI6 D;  1TRF A;  2JT0 A;  1A75 A;  3BUN B;  5TNC A;  2ZKM X;  2MLE C;  1VRK A;  1QV1 A;  1KQV A;  3SG6 A;  2KBI A;  1S36 A;  2L4H A;  4OV2 A;  2KQY A;  4GBA A;  4GUK A;  4DS7 A;  2F2P A;  2AMI A;  1TN4 A;  2F8P A;  1TNQ A;  2K61 A;  1F55 A;  4C0L A;  1TOP A;  4NDD A;  1UHK A;  1DGU A;  1N2D A;  4M2P A;  4ETO A;  1K93 D;  2KBM A;  1H4B A;  2KI6 C;  2PMY A;  1F8H A;  1K94 A;  1B7T Y;  2ZRS A;  3HCM A;  3O2P A;  2K2A A;  2L5X B;  1EXR A;  1MUX A;  2ZRT A;  2PRU A;  2KHN A;  5IBW A;  3BUM B;  4ZCV A;  1BF5 A;  4MZJ A;  2MAZ A;  4MBE A;  1JWD A;  3TS5 B;  3ZNI A;  1QAT A;  4MZK A;  2JUL A;  2LVI A;  3I5F B;  1F54 A;  3JTD C;  1AJ4 A;  3VRQ A;  1QLK A;  1BMO A;  2FJU B;  1FW4 A;  4JQ0 D;  3DVJ A;  1B4C A;  3TDZ A;  2I2R E;  1NYA A;  3PSR A;  1XA5 A;  1K2H A;  4HRG A;  4MSP A;  4OCI A;  1IG5 A;  2COL B;  2G2B A;  1EG3 A;  2MA2 A;  3EKH A;  4MN0 A;  3IF7 A;  1DJX A;  1A75 B;  4PDZ A;  4QJ4 B;  1Y6W A;  2CNP A;  4XJK B;  4L9M A;  2JNF A;  2K7O A;  1CFC A;  1S6J A;  5G08 A;  5CPV A;  1G4Y R;  1J1D A;  1CLM A;  1NUB A;  1CDL A;  1UHJ A;  2NZ0 A;  2LAP A;  5CSN A;  1DJG A;  1YX7 A;  1SL8 A;  3DVK A;  1XFW O;  3VRN A;  4GGN A;  5GQQ C;  1TCF A;  3CR4 X;  3MSE B;  1CLL A;  1B8L A;  3OB1 B;  3WXA A;  2ZN8 A;  1SPY A;  3FWC A;  4MVF A;  2SAS A;  4YBH B;  1LA3 A;  2KAV A;  4R1E A;  1MWN A;  1WRZ A;  2JPT A;  2WCE A;  3VRO A;  3D10 A;  1K96 A;  1EL4 A;  1CM1 A;  1V1F A;  1IJ6 A;  1KK8 B;  1XFX O;  1CMG A;  1FI6 A;  1KFU L;  2ZN9 A;  1LKJ A;  3WHU B;  4M2Q A;  2ZND A;  2B1U A;  4WQ3 A;  2NCP A;  5ER5 A;  1SW8 A;  1CKK A;  2H61 A;  4C0J A;  1DJY A;  4UPG A;  5PAL A;  2AUC A;  1SBJ A;  1Y1U A;  2F2O A;  3EK4 A;  4AQI A;  1CM4 A;  1C7W A;  1NX0 A;  4DIR A;  2K8M B;  3DD4 A;  2M49 B;  1M45 A;  1MXL C;  2K7C A;  3CR5 X;  5HKY A;  4QJ3 B;  1JBA A;  3D0Y B;  3CTN A;  1QV0 A;  1PVB A;  1QX2 A;  1YX8 A;  1C7V A;  3CR2 A;  5I2L A;  1TNX A;  1YRU B;  2MJW B;  2F3Y A;  1ZAC A;  2LUX A;  2JXC A;  1CDP A;  1SRA A;  1RFJ A;  2CCM A;  2F33 A;  3I5I B;  5I2O A;  1IKU A;  2WCF A;  2NXQ A;  1NP8 A;  2K7D A;  2E6W A;  2I94 A;  4E68 A;  2CBL A;  3IQO A;  1IQ5 A;  1QVI Y;  1R6P A;  1NX2 A;  1S5G Z;  1YUR A;  1A2X A;  1XFY O;  2JT8 A;  3I5G B;  1PUL A;  2LMU A;  2K0J A;  1U5I A;  1XFV O;  5D7F A;  4GNK B;  1ZUZ A;  2M29 A;  4YGA A;  1V1G A;  1WRK A;  2L50 A;  4IL1 A;  4PHN A;  1NCZ A;  2BE4 A;  2JTZ A;  3PLF B;  4OKH A;  4PE7 A;  3KHE A;  1RTP 1;  1OMV A;  3KF9 A;  3DVM A;  1QVI Z;  1JFJ A;  3SG2 A;  3SG3 A;  4DCK A;  3KEV A;  1BT6 A;  1W7J B;  3NSO A;  4YGD B;  2ZNE A;  2PSR A;  2KYC A;  4CFR A;  3GK1 A;  2M8U A;  4I5N B;  2ISD A;  1F70 A;  1QIV A;  3EK7 A;  1K95 A;  5HLO A;  3BUO B;  5AEQ A;  1CNP A;  1CLB A;  1WDC B;  1PRW A;  2M97 A;  2KFH A;  2PAS A;  3SJS A;  1MQ1 A;  4DUQ A;  2SCP A;  1DJH A;  2MBX A;  1B9A A;  1D1O A;  1IH0 A;  1YUT A;  1R2U A;  5KSZ A;  2JC2 A;  4U8D A;  2M0R A;  1BOC A;  1BR1 B;  1KQM B;  1L2O C;  5HYD A;  1LVC D;  1CFD A;  4N5X A;  1TNW A;  2DOQ A;  2LMV A;  3GK2 A;  3WNX B;  4HRH A;  4YGB B;  2JXL A;  4HRE E;  4JWQ A;  2MHH A;  4XYN A;  1ODB A;  1XVJ A;  4PCW A;  2Y9Z A;  1B8C A;  1SR6 C;  1Y0V H;  3PAT A;  1PAL A;  3IQQ A;  1OMR A;  2L4I A;  3I5F C;  1K8U A;  5AAN A;  1B7T Z;  1GGW A;  1AHR A;  2OPO A;  5I8N A;  2OTG C;  1KSM A;  3AAJ A;  4P5O E;  1DMO A;  1YR5 A;  1J55 A;  2HPS A;  2VRG A;  1IGV A;  1DTL A;  1E8A A;  3EKJ A;  1OFC X;  5DKR A;  1L2O B;  5K89 A;  5FYX A;  1SR6 B;  1UWO A;  2BL0 C;  1XO5 A;  2JNX A;  4ZCU A;  1OOJ A;  4OR9 B;  1UHN A;  3O6B A;  3AAK A;  2LAN A;  1NPQ A;  3KO0 A;  3VRR A;  1JF2 A;  1MXE A;  2OTG B;  3BUW B;  1CDM A;  3QRX A;  3TZ1 A;  1YUU A;  3DF0 A;  1DF0 B;  3BOW A;  1NX1 A;  5DKQ A;  3GK4 X;  3NXA A;  1IWQ A;  1LA0 A;  2KAX A;  5AER A;  2LV7 A;  1B1G A;  2I7A A;  1OMD A;  2Q4U A;  1JSA A;  1UUS A;  3BUX B;  2LHI A;  2BL0 B;  1G8I A;  2KYF A;  3EVU A;  2PVB A;  3LL8 B;  3PN7 C;  2F3Z A;  1GGZ A;  3OB2 B;  4WQ2 A;  4MZL A;  4F0Z B;  1HQV A;  4CLN A;  3DF0 B;  4Q04 A;  2D8N A;  1FF1 A;  4ORB B;  1AP4 A;  2LLU A;  1TIZ A;  3H4S E;  1QAS A;  1Y1A A;  2MRD A;  3F45 A;  1S6I A;  1RWY A;  1BJF A;  3OX5 A;  1YUS A;  4JPZ B;  4PHK A;  2HF5 A;  2BBM A;  2LP2 A;  3K21 A;  1NWD A;  2Q91 A;  2M1U A;  2KSP A;  4AOM A;  5B8I B;  1M31 A;  3CLN A;  2NLN A;  1AK8 A;  3TDU A;  2L98 A;  1SNL A;  1OZS A;  1QTX A;  5ER4 X;  5JOL A;  2LC5 A;  1XFZ O;  2RGI A;  1QX5 B;  1UP5 A;  1QLS A;  1QIW A;  2EC6 C;  2CXJ A;  2L51 A;  3KPX A;  4PAL A;  4D1E A;  4CPV A;  2KAY A;  1KK7 Y;  5KTY A;  1M63 B;  2IS9 A;  2LVV A;  2LLT A;  1ZFS A;  3AKB A;  3NSL A;  3LK1 A;  1RK9 A;  2KFG A;  1DVI A;  3I5H B;  3PFV A;  1PSB A;  3D0Y A;  1B47 A;  1KWO C;  2KDH A;  2MLF C;  3I5I C;  1KFX L;  5AFP A;  1DGV A;  2JZI A;  4WRI A;  4MRX A;  1ALV A;  4ORC B;  2K7B A;  3OX6 A;  2QPT A;  1KK8 C;  4NDC A;  3HX4 A;  1DJZ A;  3VGO A;  3BYA A;  1ZMZ A;  1XK4 A;  2JOJ A;  1UHI A;  2HQW A;  4GFT A;  1BG1 A;  2EC6 B;  1N0Y A;  3CWG A;  3OHM B;  2M1K B;  2R2I A;  3ICB A;  3I5G C;  1X02 A;  3E3R A;  1NSH A;  1ALW A;  4GGF C;  1QX7 A;  1WY9 A;  4BY4 A;  3I5H C;  4CFQ A;  4GGF A;  2LUC A;  5JJG A;  3TS5 C;  2KGB C;  1HT9 A;  5CSI A;  2LM5 A;  2I18 A;  2Y9Y A;  1AVS A;  2EGD A;  4PE1 A;  2TN4 A;  1DJW A;  2O5G A;  1OE9 B;  4FQO A;  3TUY C;  1WLZ A;  2BCA A;  1K9U A;  1OSA A;  3JVT B;  4YI8 A;  4NDB A;  1BR4 B;  5DKN A;  1CDN A;  1WRL A;  5HKZ A;  1J7R A;  2GGM A;  1H8B A;  4PHM A;  2KGR A;  1J7P A;  2GV5 A;  2KI4 B;  1KK7 Z;  1RJV A;  1JC2 A;  5AXI A;  4BY5 A;  1K9K A;  4GAO A;  2LNK A;  1SYM A;  4AQJ A;  2LMT A;  1L7Z A;  1B8R A;  4YRU A;  1CB1 A;  1KQM C;  1XFU O;  2BBN A;  2BEC A;  3JVT C;  3TUY B;  4PHJ A;  1CMF A;  1YRT B;  2NCO A;  2LVJ A;  2BE6 A;  1IQ3 A;  3ZWH A;  2KNE A;  1BOD A;  2KI4 C;  1MF8 B;  2LP3 A;  2Y1N A;  2V53 A;  1MR8 A;  2EHB A;  1NCY A;  1ZOT B;  3CS1 A;  1BU3 A;  3JTD B;  1QJT A;  1EG4 A;  3AKA A;  1S5G Y;  2LLS A;  1A03 A;  1KFX S;  2WOR A;  2Y1M A;  3SIA A;  2L0P A;  1KSO A;  3O4Y A;  1MHO A;  1NCX A;  3NSI A;  2KFF A;  1UUR A;  2JT3 A;  3A4U B;  1KCY A;  1XYD A;  4FTG A;  1WDC C;  1JFK A;  2CTN A;  1F4O A;  1EH2 A;  1UHH A;  1SK6 D;  1SL9 A;  1TNP A;  1SY9 A;  2GGZ A;  4YGC B;  1S26 D;  3WHT B;  2M9G A;  1KFU S;  3DVE A;  1C07 A;  3LLE A;  1FI5 A;  1JF0 A;  1Q80 A;  5CSJ A;  4C0K A;  1F4Q A;  2OS8 B;  5I2Q A;  3BXK A;  4ICB A;  1REC A;  4NQG A;  1S3P A;  2E30 A;  3SIB A;  1DF0 A;  3BOW B;  1AJ5 A;  2JU0 A;  4YGE B;  2LE9 B;  2WOS A;  1J1E A;  3CZT X;  2G9B A;  2BKI B;  3FIA A;  1PVA A;  2PAL A;  2Y4Q A;  3PN7 B;  2FCE A;  1DT7 B;  1WLM A;  1CFF A;  2BCX A;  3LCP C;  1NX3 A;  4DRW A;  1TTX A;  3CGA A;  3FS7 A;  1JUO A;  3PAL A;  2FCD A;  2ZFD A;  3PM8 A;  2K2F A;  2OS8 C;  3SG7 A;  2JWW A;  2BKH B;  2O60 A;  1OZO A;  5CSF A;  1SCM C;  2Y5I A;  4HSZ A;  5D69 A;  5F6T A;  1YVH A;  3A8R A;  2BCB A;  1A4P A;  1K9P A;  3EK8 A;  1U5I B;  3EVR A;  3SG5 A;  4MLW A;  4GPL B;  2JRF A;  2LVK A;  2HET A;  2M7L A;  1RRO A;  1J7O A;  1K90 D;  3GOF A;  4ORA B;  4PE4 A;  2HQ8 A;  1TCO B;  1S1E A;  4A4B A;  2LCP A;  2M7N A;  3NSK A;  4N1G A;  1GJY A;  1M46 A;  1NIW A;  5HLV A;  2KQ6 A;  5HKW A;  2A4J A;  1FBV A;  1DJI A;  1A29 A;  1N65 A;  2WCB A;  1SCM B;  3FWB A;  4XJK A;  1PSR A;  4TNC A;  4PE0 A;  4A4C A;  1W7I B;  1IJ5 A;  3TDI A;  1S6C A;  1SCV A;  1OQP A;  1IRJ A;  1SMG A;  2H2K A;  3EVV A;  2CT9 A;  1XK4 C;  3RLZ A;  2P6B B;  1J7Q A;  4M2O A;  2AAO A;  4MRY A;  1PK0 D;  1KWO B;  2KOT A;  1QS7 A;  1LXF C;  2L2E A;  3M0W A;  1FPW A;  1QXP A;  1EJ3 A;  1SL7 A;  2LHL A;  3RM1 A;  3VRP A;  1AUI B;  4P2Y B;  5BPJ A;  3SG4 A;  5KU1 A;  4YI9 A;  1CTR A;  2WC8 A;  1GQM A;  4I5L B;  4CID A;  1BLQ A;  1G33 A;  2H61 C;  4OVN F;  4QJ5 B;  1F71 A;  2JTT A;  3LK0 A;  2WND A;  3C1V A;  1Y1X A;  4MEW A;  4USL A;  1SKT A;  1YTZ C;  2QAC A;  3BQ3 A;  3O78 A;  5J3X A;  1YVL A;  2FOT A;  4I5K A;  1M39 A;  1LIN A;  4I5J A;  3OP0 A;  4N1F A;  2M3W A;  2JQ6 A;  1CFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...