4JPZB

Voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
EPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Fibroblast growth factor 13
total genus 43
structure length 142
sequence length 142
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jpzB01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4jpzB02
2LAPA 2HQ8A 2JT8A 5CPVA 1JFJA 1SYMA 3GK4X 2JXLA 4AQIA 3CZTX 3RM1A 1QASA 4PE7A 1D1OA 4M2PA 4PHKA 1IH0A 1KQMC 1K2HA 2M1UA 1AVSA 3DF0B 2NZ0A 1G4YR 4CFQA 1B1GA 3VRNA 3BOWA 3CR4X 1BMOA 4YGEB 2L98A 2BL0C 3OX6A 1DGUA 4QJ4B 1L7ZA 1XFVO 4MLWA 2ZNEA 4CPVA 1NUBA 1ALWA 4BY5A 4NDCA 3I5FB 1SCVA 2OTGB 2CNPA 4YGDB 4JQ0D 1A4PA 1N65A 4MZLA 1XK4A 2ZRSA 1KSOA 1XFXO 3JTDB 4YGCB 1SMGA 2O5GA 2G9BA 1RK9A 1KSMA 1UP5A 1H4BA 1UWOA 1WDCC 2F2PA 1KFXL 2KGBC 4DCKA 1OQPA 1KQMB 1BOCA 4I5JA 1CLMA 1EL4A 1PSBA 3LK0A 2CTNA 2LLSA 4I5LB 3CLNA 1CFDA 1UHHA 3EVUA 1ODBA 5AEQA 4XJKB 1NX3A 3KHEA 4A4BA 2GV5A 1S1EA 2LP2A 2K7OA 1UUSA 3ZNIA 3IQOA 1PULA 2KI4C 1MR8A 1MUXA 2LNKA 2OPOA 4USLA 2KFGA 3VRPA 1CMFA 1DJHA 1XYDA 2Q91A 3DD4A 3TUYC 2ZRTA 2QPTA 1QXPA 4MRXA 1A03A 1FPWA 1S6JA 1XFZO 3O6BA 3ICBA 1EH2A 1IRJA 1HQVA 1BJFA 1SCMB 1WY9A 1KK8C 3HCMA 1SR6C 2E30A 1NYAA 1TRFA 1X02A 1YRUB 1YUSA 1VRKA 3I5FC 5HYDA 3BUOB 1JFKA 2BCAA 1FI6A 1MXEA 3SG5A 2IS9A 2NCPA 4YGBB 1DF0A 3TDUA 1OSAA 2M0RA 5I2OA 2BL0B 1PVBA 2P6BB 2M49B 1CDNA 1CDMA 1KQVA 1TOPA 1HT9A 1YUTA 2M3WA 2KAVA 2KI6C 2A4JA 3CTNA 4CLNA 1BT6A 1N0YA 3OB1B 3PN7B 2JWWA 1PK0D 1RWYA 1B7TZ 4GGFC 2I94A 2KGRA 2LCPA 3NSIA 1IWQA 4MZJA 1ZMZA 1C7VA 1AJ4A 1WLMA 1J1DA 2M8UA 2CCMA 1K94A 2BE4A 1DVIA 4DS7A 1FW4A 1BODA 2R2IA 2Y9ZA 5HKZA 1G33A 4MN0A 2L5XB 1J1EA 2OS8B 2ISDA 3BUXB 3PLFB 4MRYA 1F71A 1S26D 3JVTB 1YX7A 2KOTA 1TNQA 1LINA 2WC8A 2KNEA 1J7PA 1Y6WA 1SL8A 2F3ZA 2JC2A 4WQ3A 1OOJA 1ZUZA 4FQOA 1R6PA 2PVBA 3EK7A 2Q4UA 4GBAA 1SRAA 1MXLC 4C0LA 4AOMA 1CB1A 1YVLA 2QACA 4GAOA 2GGZA 2Y4QA 2EGDA 2MLFC 2KQ6A 2SASA 4MZKA 1CM4A 1S36A 2L2EA 1QVIY 2L51A 2LHLA 3LLEA 5AFPA 1DJZA 4C0KA 1BU3A 4PHNA 2FJUB 2JU0A 2JZIA 2JPTA 4C0JA 1NIWA 1K96A 1K8UA 5G08A 1M39A 1U5IB 1A2XA 2MHHA 3CWGA 1CKKA 2Y9YA 3ZWHA 2L4IA 4D1EA 2I2RE 2PMYA 4P5OE 1A75B 3VRRA 2M7NA 2EHBA 5DKQA 3QRXA 2F8PA 3SIAA 1WRZA 2BE6A 3GK2A 1TN4A 2B1UA 4ORBB 3O2PA 1AK8A 5AANA 1F55A 1JF2A 3KPXA 3DVEA 1DT7B 1CDPA 1LVCD 1QLSA 1YUUA 2H2KA 1KK7Y 2JOJA 1QJTA 1GJYA 2F3YA 4OR9B 2ZKMX 3NSLA 4GPLB 1CDLA 4CFRA 1ZFSA 2K2AA 4YI9A 2AMIA 1TCOB 1L2OB 1RFJA 2FCDA 1NP8A 3D0YB 4N1FA 5F6TA 1RJVA 2LVVA 2PALA 3BUWB 1M45A 2K7BA 5PALA 1RECA 4IL1A 2KFHA 2K7CA 3A8RA 2WCFA 4QJ5B 2K7DA 1V1FA 4GUKA 3LCPC 3O78A 2JQ6A 2JT3A 2D8NA 2COLB 1B8RA 1UHKA 5AERA 5CSFA 4FTGA 3F45A 1F4QA 2KBIA 2L4HA 1ALVA 1GGZA 2PSRA 1K95A 2VRGA 3PATA 4UPGA 1BF5A 5DKNA 2KHNA 1LXFC 1SR6B 1KK8B 2KYFA 2LE9B 2KDHA 1J7OA 3I5GC 1JC2A 1BR4B 5ER4X 1B8LA 1J55A 1RROA 2MJWB 5KSZA 2LLUA 1EJ3A 1WRLA 1WLZA 4MSPA 1CFPA 2OS8C 1SPYA 4I5KA 1F54A 3C1VA 5ER5A 2Y5IA 3DVKA 1UHNA 3PM8A 2K61A 1LA0A 1R2UA 1B47A 4MEWA 4L9MA 2BCBA 2WORA 1OMVA 3BYAA 4ORAB 1IJ6A 2LMUA 1IJ5A 4WRIA 4PDZA 2WCBA 3PN7C 3VRQA 1QTXA 2HETA 1QV0A 3BUNB 2AAOA 4OVNF 5JJGA 4YGAA 1QS7A 1NCZA 1JUOA 2FOTA 4MBEA 1GGWA 1PSRA 1QVIZ 2EC6B 1DF0B 2KBMA 3OB2B 4XYNA 5FYXA 2M7LA 4E68A 2KFFA 4A4CA 3I5IC 3WXAA 1NWDA 2LUXA 1PVAA 1AJ5A 1LA3A 1YR5A 2OTGC 2I7AA 2WNDA 2LVKA 4GNKB 1IG5A 1K93D 1S6CA 4PHJA 1CFCA 2M9GA 2JNFA 2BECA 1MF8B 4PE1A 2LANA 2ZN9A 1KWOC 3I5IB 3OX5A 5BPJA 2LUCA 4GGNA 2BBMA 1LKJA 2G2BA 5J3XA 5I2QA 3O4YA 4HRGA 1SL7A 4TNCA 5HLVA 2I18A 1DJWA 4ICBA 4DIRA 1DJIA 5DKRA 1OZSA 1EG3A 2H61C 1PRWA 1W7JB 1SK6D 2M29A 3CGAA 1IQ3A 4DRWA 1M31A 2F33A 5TNCA 4HRHA 3OP0A 4NDDA 3TS5B 4OV2A 4N1GA 1SL9A 2MAZA 3PFVA 4HSZA 3NSOA 1E8AA 4R1EA 5I8NA 1YVHA 3LK1A 2MA2A 1QIVA 1WRKA 1CM1A 1EG4A 1WDCB 1UHJA 3I5GB 1B9AA 1GQMA 2KYCA 1CFFA 4YBHB 1XK4C 4F0ZB 3JTDC 2H61A 3SG3A 3WHUB 1OZOA 1KWOB 3AKAA 1NX2A 5D69A 5KU1A 2LVIA 3AAKA 4BY4A 2CBLA 1XVJA 1C7WA 4NQGA 3DVJA 1KCYA 3I5HB 2PASA 4PCWA 3DF0A 4MVFA 3SG7A 3WNXB 1JSAA 1A29A 2SCPA 1OMRA 4N5XA 3BXKA 5CSIA 5HKYA 2LM5A 5AXIA 1N2DA 1XFWO 2BKHB 2EC6C 1JWDA 3EKJA 2KAYA 1A75A 2MBXA 1Y0VH 5IBWA 1CLBA 1QIWA 1S5GY 1J7QA 1SY9A 1SKTA 2Y1MA 3FS7A 3MSEB 3H4SE 3SG4A 1TCFA 1U5IA 2F2OA 1JF0A 1NX0A 1SW8A 4PE4A 4YRUA 2BCXA 3KO0A 1CTRA 1TIZA 2RGIA 1IGVA 2HQWA 1UURA 5JOLA 1FF1A 1YTZC 1FI5A 1H8BA 1CLLA 1S3PA 1K90D 1S6IA 1QX5B 1DJGA 1F70A 2LHIA 2LMTA 4AQJA 3AAJA 1TNWA 1G8IA 1B8CA 2TN4A 1AP4A 3SG2A 4Q04A 1J7RA 5CSNA 5CSJA 2JTTA 1UHIA 2JTZA 2L50A 1DTLA 3VROA 4U8DA 1M46A 1XFYO 3FWBA 3EK4A 4ORCB 1Y1XA 2ZFDA 3D0YA 3HX4A 3K21A 2KI6D 3PSRA 4DUQA 2NCOA 3CR2A 3RLZA 1NPQA 2KSPA 1XO5A 2M1KB 3SIBA 1MWNA 3IF7A 1XA5A 1DJYA 1NCYA 2E6WA 4WQ2A 2LMVA 1V1GA 3CS1A 4M2QA 2L0PA 3M0WA 4P2YB 3KF9A 1K9UA 1K9PA 4QJ3B 1PALA 2DOQA 2K0JA 2M97A 1B7TY 4PE0A 1CMGA 2KQYA 1KFXS 1W7IB 5GQQC 3GK1A 1F8HA 3WHTB 1TNPA 1C07A 2ZN8A 3TDIA 2LP3A 3EK8A 3BOWB 1B4CA 2K8MB 2NLNA 3VGOA 1BR1B 2CT9A 1L2OC 2LVJA 3CR5X 3KEVA 1SBJA 2MLEC 2O60A 2NXQA 1AUIB 4OCIA 4GGFA 2CXJA 4YI8A 3AKBA 1S5GZ 1DMOA 1RTP1 2LLTA 3EVRA 1MHOA 2JT0A 3EVVA 3IQQA 4I5NB 4JWQA 4JPZB 3LL8B 3SG6A 2JXCA 1K9KA 4OKHA 2ZNDA 1OE9B 1Y1AA 2GGMA 5D7FA 1QX7A 1NSHA 1Y1UA 2BKIB 1QATA 4GFTA 1TTXA 2FCEA 4ZCVA 2PRUA 1CNPA 1OFCX 2JULA 1Q80A 4M2OA 4NDBA 1AHRA 3BUMB 1NX1A 3FIAA 1DGVA 4XJKA 3GOFA 2K2FA 5K89A 2KAXA 1FBVA 1NCXA 3DVMA 2BBNA 1SNLA 1QV1A 2WOSA 1YURA 1IQ5A 3EKHA 2V53A 3OHMB 3TDZA 3E3RA 5I2LA 1DJXA 3BQ3A 1YRTB 1QLKA 3PALA 2MRDA 3NSKA 3I5HC 2JNXA 1EXRA 3TZ1A 5B8IB 3NXAA 1ZOTB 3D10A 1SCMC 2JRFA 1KFUS 2LV7A 3FWCA 1ZACA 1F4OA 1KK7Z 1TNXA 2WCEA 3SJSA 1YX8A 5HLOA 1BG1A 2HF5A 4ZCUA 1OMDA 2LC5A 1KFUL 3JVTC 3TUYB 2HPSA 1BLQA 1QX2A 2Y1NA 1M63B 5HKWA 1MQ1A 4HREE 5KTYA 2AUCA 1XFUO 2KI4B 3A4UB 1IKUA 1JBAA 4PHMA 3TS5C 4CIDA 4ETOA 4PALA
chains in the Genus database with same CATH superfamily
2KXPB 2LAPA 3SWYA 4H13B 2W6BA 3CDNA 4IFMA 3L72E 4PE7A 1IH0A 3S0GA 2IX7C 3WMM0 4MN4C 1BSNA 1G4YR 1FZBA 4MLWA 2KLVA 1GL2A 3I5FB 2OTGB 3BRTB 1KILB 3V2RA 5CBOA 1N65A 1XK4A 2K9JB 2ZRSA 1KSOA 5FI2A 2O5GA 1KSMA 1UP5A 2W83C 1WDCC 2F2PA 3BCCJ 1CLMA 3P7KA 3RK2C 1VQNP 2FFDB 2D2CD 4PT1A 2KK7A 1NX3A 4QMAA 1HGZA 2GM4A 1S1EA 3M06A 1T3JA 3V4WA 2YKOA 2KFGA 3VRPA 3VOPA 1XYDA 2Q91A 2ZT9C 3FE8A 1FAVA 1LWUB 1QXPA 3CL3D 4JYCA 1MZ9A 3CXHE 4ZKPA 1EH2A 3CMEP 1SSEB 1WY9A 1M1JB 1N7LA 1GL2C 1SR6C 1NYAA 1YUSA 1VRKA 2XU6A 1JFKA 1MXEA 1QX8A 2E42A 2IS9A 1SQBE 4TLFA 3TDUA 5I2OA 2B89A 1JM0A 2P6BB 2Z5IA 1BGYG 1T6AA 1KB9E 2NZ2A 1N73B 2XV5A 2KI6C 4DT0A 1EZVE 3TDKA 3PN7B 1AV1A 4I6MC 1AJYA 3TK1A 1H0TA 1N7SC 2LCPA 3GHGC 4L73A 1JO5A 3MHVA 3RK3B 1C7VA 5CCHC 1YJ9P 2ZYAA 1JCCA 2QJYC 4H0LB 1K94A 3D76A 1LJ2A 1J1EA 2ISDA 2IZ0A 1PIXA 3LIDA 2KOTA 1LINA 4WQ3A 1ZUZA 3HE4A 1FDOA 4YTPC 1SQVG 2AXTE 1SRAA 2Q5UA 4AOMA 1CB1A 1YVLA 1PP9J 3MD0A 2GGZA 1BCCJ 2EGDA 1L0NE 4MZKA 2ZXXA 2L51A 5AFPA 1Q82Q 1DJZA 3R4YA 4H44D 3L73G 4KJMA 1JY2N 1FDMA 2AEJA 1IZNB 3D75A 4HJGH 1K8UA 3TGUE 1A2XA 2MHHA 3ZWHA 2NPSD 2EHBA 5DKQA 4K35A 3QMEA 5TISH 2N1TA 1IFJA 2OGUA 1LTTC 1NGMB 4JYBA 2W8ZA 4U3FJ 1AK8A 1CDPA 1KQSO 2YIUB 1GJYA 1P84H 2ZKMX 1ZFSA 2K2AA 2E76B 2AMIA 4K3AA 4N1FA 3A3YB 3H1IJ 2KLUA 3AEFC 5C39A 1ORGA 3L47A 2FY8A 1GMJA 2K7BA 1Y9BA 1AA0A 5GTHE 2WCFA 1V1FA 1YYCA 3H25A 4WY4C 1H0TB 3D74A 4FTGA 3FE9A 2KBIA 4UB6E 3E1RA 1ZLLA 4GOEA 2WPQA 3VMAA 1LXFC 2QEOA 1SFCC 1KK8B 3JCUE 2QG4A 5H2FE 2LE9B 1EZVG 3I5GC 3AE1C 1B8LA 5KSZA 2MJWB 3CCSP 1CFPA 4MSPA 3N4XA 5AVZB 5AW5B 3C1VA 1R8EA 4PJ0E 3DVKA 1LWUA 1UHNA 3PM8A 5KAFE 4IL6E 1LA0A 1R2UA 1B47A 2PYQA 4MEWA 2BCBA 1OMVA 3Q2YA 3NHIA 5L8RJ 2LMUA 3KHUA 2P58A 4WRIA 3VRQA 2K37A 2AAOA 1GD2E 4YGAA 3G71P 1NCZA 2WC6A 3HD7C 4MBEA 2EC6B 1W5CE 2V7QJ 1FZFA 4A4CA 3PJSK 3I5IC 2LUXA 1PVAA 1R5LA 4OGQB 1WT6A 1NTKE 2FFDA 2JNFA 1USDA 2BECA 1MF8B 1KYOH 3L73E 4GT1A 2BBMA 1BE3J 5AVSB 1L4AD 3O4YA 4TNCA 3L70E 1UIIA 1GM0A 5DICA 2KS1A 1NU1J 2H61C 1W7JB 2MJZA 3CGAA 3R2PA 1ZR4A 1IQ3A 2F33A 3TS5B 3NMDA 4N78E 4R1EA 2CK3H 4BXLA 3O8ZA 1ZN5A 3P32A 3LK1A 5KJ7D 1OOIX 1NAFA 3CC2P 4LLHA 4GODA 2YXRB 1X79B 2PRRA 1AVOA 1OZOA 2WMMA 2ZYDA 1KWOB 2HYNA 3AKAA 1NX2A 5KU1A 2BCCD 2KOGA 2LVIA 2CBLA 1J1EC 2M3EA 3TGUJ 4TT3H 2M0BA 5TISE 1RQUA 3H1KE 5AXIA 5KLVK 1XFWO 1AQ5A 4ASVA 3L72J 2E74D 1Y0VH 1QIWA 2GA1A 1KILE 4D6TG 1YIJP 4ZKUA 1SY9A 1SKTA 2FYNC 2OYIA 3SG4A 3F89A 1TCFA 2KYVA 4XA4A 1LGHB 1NX0A 1SW8A 3D71A 2WC5A 1CTRA 2YO2A 1FI5A 3HRNA 4WWIA 1H8BA 3TSIA 3VTPC 1S6IA 1PGJA 1F70A 3CCJP 2LMTA 4AQJA 2W27A 3A7OA 1FJPA 1KQLA 1B8CA 2WSCH 4H13D 3SG2A 1J7RA 1W2EA 1U57A 2O1KA 3BCCE 3FWBA 3EK4A 1GDTA 3HX4A 2ZFDA 3D0YA 3K21A 4W7ZA 2KSPA 3SIBA 1P84D 3AECC 3MTUE 2FBWC 1DC1A 1MFZA 1DJYA 2E75C 2E6WA 4WQ2A 3CS1A 2MKVA 4QJ3B 3L71G 2IBZD 3EWKA 2KQYA 1SQXJ 5GQQC 1URQB 1YITP 4XE5B 2C9LY 2M3BA 3PLNA 1B4CA 2K8MB 1J1DB 3VGOA 2QSIA 2WSFH 3NTNA 3L74G 4I7ZC 3A5TA 4GGFA 2D2CB 1DEKA 1S5GZ 1DMOA 4JPZB 5AW4B 2BASA 2RN0A 3VP8A 5M1BA 1DIPA 1Y1UA 1SQQE 2KLDA 2OTJP 4NDBA 3BUMB 4XJKA 2FYNB 4IFFA 3WUTA 5K89A 1SNLA 3RK3E 1QV1A 2WOSA 3EKHA 1IQ5A 2IFNA 1S4XA 2N9YB 3BQ3A 1QLKA 3IF4A 2ERBA 3FGAD 1TU3F 5AVTB 2WPSA 3ITKA 1RQVA 1QGKB 1ZACA 2QM8A 1KK7Z 1TNXA 1BG1A 1M57D 2OARA 5APTA 4OWFA 4ZCUA 2LC5A 3RK3D 3JVTC 5AVVB 3TUYB 3CX5E 1QX2A 2W90A 3HE5B 5KKZB 1MQ1A 3M0AA 3A4UB 1JMBA 3TS5C 4CIDA 2E43A 3CCMP 2HQ8A 2JT8A 1Q90D 3CWBD 2JXLA 3S0BA 1KYOI 3CZTX 3RM1A 1CW5A 1LTBC 3L74J 3P8MC 3L35A 1AVSA 1OVUA 1OW4A 2R32A 3BFBA 3BOWA 3CR4X 1BMOA 3M9BA 1T2KC 2BCCE 2L98A 2BL0C 1DGUA 3L71J 1L7ZA 1XFVO 4H44B 2ZNEA 1ALWA 5EL2A 4BY5A 1A4PA 2OYHA 4R4MA 1MFTA 1XFXO 3JTDB 1SMGA 1VL2A 2NPSB 2KGBC 3FWLA 4DCKA 1KQMB 1BOCA 4I5JA 4FQTA 4O9BA 3TNUB 1VQ7P 1EL4A 3CMAP 1BSHA 3BASA 2CTNA 1FC2C 3CLNA 5BVZA 3B87A 1LP1A 2WCLA 5AEQA 2OQQA 3KHEA 4A4BA 1QEXA 2K7OA 1EQ7A 3ZNIA 1VQLP 3RBXA 1ZOYC 1PULA 2L5YA 3CXHI 1MR8A 1MUXA 2OPOA 2E76D 1TUZA 1L0LK 3F5HA 2ZRTA 3H32B 2QPTA 3BRVB 1H88A 1KYOD 3V4QA 3B88A 1IRJA 1TWOA 1SQQG 2JO1A 1SCMB 3HUSC 1KK8C 2AXTH 1TRFA 1X02A 4D6TJ 3BUOB 2BCAA 4EOTA 2NCPA 2DW3A 2SPZA 1S5LX 2KLEA 2BL0B 1PVBA 2M49B 1CDNA 3VMYA 1VQ8P 1TOPA 1HJBA 1HT9A 3D6YA 2IZ1A 2KAVA 2B87B 3H1LJ 2A4JA 3CTNA 3DYEA 4CLNA 5TJHA 5B66H 3OB1B 3H1HD 1PK0D 2LXCB 1RWYA 1KB9I 4GGFC 3P8CE 1G1JA 1ZMZA 2R3CA 2YMYA 2M8UA 1KC8Q 1LTAC 2E76C 1A02J 1G33A 2LKMA 1HF9A 3NXSA 2OS8B 2YIUC 2ZYGA 1IK7A 1F71A 3JVTB 3C1LA 3CXHH 3GF3A 3VYIA 1M1KQ 2QIWA 3EK7A 4GBAA 1RHZB 1N86A 2QA4P 4C0LA 3B8EB 3MGNA 1BE3G 3H1LD 5APXA 4IFDK 1VF5C 1DD4A 1CM4A 1S36A 2L2EA 2O01H 3VMXA 1NHLA 4C0KA 3H1KJ 1KB9H 3L4LA 1NH4A 4C0JA 2QVAA 4Y99C 3Q5PA 1T2KD 1NTZK 1NTME 3T97B 3RGUA 2I2RE 2PMYA 2ZXEB 1A75B 3VRRA 1OW8A 3SS4A 1NAYA 3UNWA 3OA7A 4I2LC 5AANA 1F55A 1JF2A 1DT7B 1LVCD 2H2KA 3H1HE 5FI7A 3NSLA 1OX3A 3HE5A 1NVOA 3CCRP 1KTMA 1OXZA 3TGUD 1RFJA 4I7ZB 1NP8A 3GG2A 3RK3C 1NO4A 3H1KD 5GTIE 3GHGB 1N7SB 4HKZH 3BUWB 1VQ9P 1URQC 3M91A 2WT7B 1JB0J 1FS0E 2KFHA 2K7CA 1PGPA 5E79E 3A8RA 2K7DA 1VDFA 2GTEA 2D8NA 3W67A 3A0BH 1W9ZA 5AERA 5CSFA 4M3LA 3AE7C 2PSRA 4W7YA 3H1JG 2VRGA 1CI6A 3N7NA 3QWOC 3WU2H 1SR6B 1GL2B 2H7HA 1M1JC 3M9QA 1NU1D 3FWNA 3EG5B 2H88C 4ASWA 3NFQA 1J7OA 2L91A 1BR4B 1J55A 1RROA 2LLUA 2ZT9B 2JWAA 1IFNA 3CWBJ 1SPYA 2H8VA 4I5KA 2K9YA 1LP1B 3EFGA 4U3FE 4CPGA 2OTKE 1HH0A 2K61A 3L4FA 2JEEA 4WB4A 1NOHA 4AYCA 1IJ6A 1AQTA 3Q5RA 2FFDC 1NU1K 4PDZA 2WCBA 3RK2B 1QTXA 1QV0A 1BDCA 1QS7A 1JUOA 3GLMA 1QVIZ 3OB2B 2IDBA 2KZIA 1P28A 1S9KE 1GK4A 1AJ5A 1LA3A 1E79H 4XFJA 2OTGC 1SQQK 1Y8AA 2I7AA 4PHJA 1S6CA 3L73J 3AEGC 2Q7CA 2ZN9A 4RO0A 1KWOC 5H2FH 2FYUE 2LUCA 1VQPP 1URQD 3EQ2A 1PP9G 2WSFJ 1SL7A 4ICBA 1HVVA 1FZGA 2QEVA 2R5BA 5DKRA 1OZSA 4H13C 2M29A 4DRWA 1IFIA 2B88A 4IOIH 2CPSA 4NDDA 4N1GA 3PFVA 3CX5H 3A0BE 3ZDMA 1RF0C 2QEXP 2MA2A 1JTHB 1WRKA 2Z4EA 1GQMA 4YBHB 2QE7H 1OWAA 1SQXG 2PFXA 5D69A 3AAKA 4BY4A 1SQBG 4NQGA 3DVJA 1KCYA 1JSAA 3CXHD 1JMMA 1G2CB 4JBZA 2QRXA 5CSIA 1VF5D 5HKYA 3CZ2A 2EC6C 2K60A 2KAYA 1A75A 5BU8B 1S5GY 3AE9C 1J7QA 1PFIA 1ZRTD 3H1JE 1KQFB 4EIJA 5HL1A 3H4SE 4BRYB 1SQQJ 1JF0A 1BE3D 2BCXA 2RGIA 1UURA 1SFCA 1OW7A 5KJ7C 1QX5B 3R1PA 1TNWA 1S1CX 1LTSC 1IIOA 1AP4A 2RMZA 1KQGB 4Q04A 4PD4E 1LTJB 5CSJA 2JTTA 3CD6P 3PRJA 2L50A 5APWA 1SQBK 1M46A 2XNDH 1JOCA 3OJAB 4IJ7A 1Y1XA 4DUQA 5KJ7A 3BCCG 3L72G 1P84E 1SQPK 1XTCC 1XA5A 1A02F 4M2QA 3L70D 3HD7A 3KF9A 3TGUG 1K9PA 1SQBJ 4GKGA 2M97A 4PE0A 1F8HA 2R5DA 3WHTB 4C7RA 3EK8A 1KN7A 3Q8IA 2CXJA 2P10A 2WT7A 3Q3DA 2H43A 1MHOA 3EFFK 2VRSA 4OKHA 2WSCJ 1JUNA 1HJ0A 1Y1AA 1QX7A 1NSHA 1ZP0C 4GFTA 1TTXA 2LXBA 2FCEA 1CNPA 2PRUA 3R1VA 2O01N 3I56P 1AHRA 5GTIH 1NX1A 3FIAA 1DGVA 3S0FA 3GOFA 2K2FA 2KAXA 1FBVA 1NCXA 3SFDC 1OOFA 3PP5A 4RKUJ 3OHMB 3TDZA 5I2LA 1ZMEC 1PPJD 2IYPA 3H32A 1YRTB 2WCKA 2MRDA 2BNXA 4NPEA 3I5HC 2JNXA 1FJKA 2JKVA 3D10A 1SCMC 2WCMA 3CX5I 2JRFA 1KFUS 3HUSA 3K5BA 1LTJC 3D77A 3O6QA 2WCEA 5HLOA 2HF5A 1KFUL 2V7QH 2WSSH 1NWQA 3CZ1A 2M8RA 4HREE 1N73A 3CWBG 1FZEA 2JPOA 4PHMA 1KYOE 2QJYB 2Y0EA 1NTMD 2YO3A 5CPVA 1JFJA 2JR8A 1SYMA 4AQIA 1QASA 1D1OA 2A06G 1KQMC 1K2HA 2BAPA 1SQVE 5AW0B 3DF0B 2NZ0A 4CFQA 4N6JA 3H1JJ 3WU2E 1Y47A 1N73C 3VRNA 3KZIE 1EDKA 3B5NA 4CPVA 1NUBA 1ZW0A 1LTIC 1OVVA 4NDCA 4H44C 1SCVA 4YGDB 2CNPA 4PD4D 5CHXA 2AEFA 3KYQA 4MZLA 2HODB 4YXDC 3C9IA 4YGCB 2G9BA 4HH2A 4WBAA 4YPCA 2JDIH 1ZR2A 4INWA 3L37A 1LWUC 3G6EP 1KFMA 2LLSA 1NKNA 2G8YA 4PD4H 1UHHA 1VQKP 3EVUA 5FI6A 1IJDB 4XJKB 2LP2A 1HUCA 1FZAA 2P1JA 4USLA 1CMFA 3TF5A 3HTKA 2P71A 3TUYC 4AUWA 4MRXA 1A03A 1S6JA 1XFZO 3O6BA 1KV4A 1N7SD 1EXIA 1PPJE 1BJFA 2HPCA 2Q1KA 4NPDA 3OBVA 2E30A 2FXMA 1YRUB 3I5FC 1Z4HA 1D7MA 5HYDA 1FI6A 1SP4A 3H1KG 1ZXGA 3U1AA 3AEDC 2E75D 1OSAA 2M0RA 3CCVP 1JTHA 2IBZG 4KT0J 2HFED 3D78A 3GHGA 4HYTB 5KAIE 1BCCG 3Q5SA 1H8AA 2M3WA 1GL2D 3CABA 1VQOP 1N0YA 2JWWA 1IFDA 1Q81Q 1B7TZ 2O3JA 3NSIA 4MZJA 3TYYA 1QVGO 1AJ4A 1WLMA 2Q6QA 3A0HE 1YQ4C 1J1DA 2ZT9D 2RH0A 4UB6H 1FW4A 3ABVC 2R2IA 5HKZA 1AFOA 3AE6C 2L5XB 4MRYA 1S26D 2XKMA 3CWBE 1TNQA 3AE4C 2WC8A 1J7PA 1Y6WA 1SL8A 2JC2A 2D2CC 5CJ4A 4FQOA 1R6PA 3RK2D 2Q4UA 3CYZA 1MXLC 3H1LG 1J1DC 3IR9A 1DEEG 2E74C 3V2LA 2A06E 4PD4I 2Y4QA 4DZOA 2KQ6A 2L2CA 4IL6H 3LLEA 2OYIC 5CBNA 3L71E 2E5YA 2N9BA 3S0DA 1NIWA 1JY3P 1RH5B 1K96A 1U5IB 1G2CA 4RJTA 1T8ZA 2H8PD 1S5LE 1ZV8A 1CKKA 2IPPA 2L4IA 4D1EA 1PGQA 4IL6X 2M7NA 2KNCA 2OYHC 1NTKK 4WVZA 1PV3A 3QRXA 2F8PA 3SIAA 1WRZA 2BE6A 3GK2A 1TN4A 3AE8C 3O2PA 5AW7B 3BFAA 3DVEA 2KP8A 1QLSA 1YUUA 2F3YA 1SQVK 2IYOA 3JC22 3BCCD 2J5UA 5AW6B 4GDOA 4GPLB 2M5AB 3RL0C 4EI2A 1CDLA 4YI9A 3L75D 1TCOB 1L2OB 5F6TA 3D0YB 4C7NB 1FZCC 2Z5HA 1L4AC 2JP3A 2PALA 2R44A 2P67A 1M45A 3UIAA 4IL1A 4Y99B 2GUSA 4GUKA 2O01J 3LCPC 3AE3C 2JQ6A 2JT3A 2COLB 1UHKA 4A7PA 3SWFA 1BGYE 2ZAEB 1F4QA 1QL1A 2K9JA 1FZCA 1VF5B 2L4HA 2RKLA 1ALVA 2WVRA 1L4AA 1K95A 4I1LA 4UPGA 1YBKA 3HD7D 2BEZF 5DKNA 2IBZE 1J1EB 2QJPC 1FOSE 2QM7A 5CCGC 4HB1A 2HODA 1L0NK 2KDHA 1KD1Q 5ER4X 3H1IG 3JSVC 1EJ3A 1WRLA 1YTZT 2XZRA 1WLZA 1U7JA 4DJGA 2OS8C 3N7HA 2KZJA 1S2EA 1C3YA 3A0HH 5ER5A 4PV1B 2YKQA 1VQMP 2WORA 3BYAA 3B4SA 3FX0A 4ORAB 1NTZD 3CLQA 2J59M 4U3FG 3IN6A 4U7JA 4INXA 2HETA 3OGNA 3BUNB 4OVNF 5JJGA 1SFCD 1X9VA 3MP7B 3CCEP 1X0TA 1YTZI 5KAIH 2BCCG 3CCUP 1S9KD 2XNXA 1DF0B 5FYXA 1GW4A 4ZNCA 3WXAA 1NWDA 2YXQB 1RE4C 1YR5A 3IAOA 3MUDC 1CFCA 1IG5A 1K93D 3L72D 4WY4D 4OH8B 3AEEC 4PE1A 2LANA 1EC5A 3HUSB 5AW9B 3I5IB 5BPJA 2E5TA 2G2BA 5DJTB 5I2QA 1DJWA 4C46A 4DIRA 1DJIA 2P70A 1GU5A 2Q9IA 1PRWA 1SK6D 1XFRA 2AXCA 2WWWA 1QVFO 2I1JA 1M31A 5TNCA 2A45I 2POHA 1NU1E 4OV2A 1SL9A 2MAZA 1E8AA 2FJYA 1YVHA 3SS3A 1M8OB 3TNUA 5B66E 1EG4A 1UHJA 2NPSC 3I5GB 1CFFA 2KYCA 1IFMA 3JTDC 5AVRB 3SG3A 3M0DA 3CX5D 3SSUA 1RF1C 3V2QA 4L76A 3B5ND 1XVJA 1HGVA 1C7WA 1IFPA 4PCWA 3DF0A 1SQPD 4MVFA 3WNXB 3R72A 3D6ZA 1A29A 4D6TD 2FYUK 1KORA 5AVWB 3KZIH 1JY3N 1N2DA 2BKHB 2NPSA 5BU5A 2B9BA 1LT9A 5APSA 1CLBA 1L0LD 5AW8B 2HPCB 1DEBA 1TUJA 3D70A 1NTKD 3FS7A 3MSEB 3AE5C 1VQ4P 1JNMA 3L74D 3K1EA 1XTGB 1YTZC 1FDIA 3VB1A 1MV8A 1SQVD 1K90D 3H1IE 1LT9C 3HTKB 1DJGA 1GZLA 2LHIA 5KKZC 3AAJA 5CCHD 3L75E 1PP9D 5CMZA 5AW2B 3O6QB 3PTZA 1P84I 2ZJSE 2LR2A 3FXEA 2KI6D 1YI2P 3L36A 3CR2A 3RLZA 1XO5A 2M1KB 1MWNA 2FXOA 3IF7A 2KS1B 3R1OA 1V1GA 1L0NG 4P2YB 1K9UA 3MIWA 1NTMK 2XDJA 1BCCD 1PALA 2DOQA 2K0JA 1SLQA 1CMGA 3KPEA 1W7IB 1RE4A 1EDJA 1TNPA 1C07A 3TDIA 2LP3A 1DQEA 3BOWB 2I1KA 2NLNA 5CJ0A 1JY2O 1SS1A 5APVA 2CT9A 3B7AA 2LVJA 3KEVA 1SBJA 2O60A 5APUA 2WCHA 4JF7A 3AKBA 2NRGA 1DELA 2UWJE 1RTP1 2Q3IA 5D3OA 4QJ5B 2LLTA 3EVRA 2JT0A 3EVVA 4I5NB 4JWQA 3SG6A 3LL8B 2R3SA 2JXCA 1ZRTE 2JWDA 1UIXA 5D7FA 1NU1G 4H0LC 1HBWA 4F7FA 3L73D 3LIEA 2BKIB 1SQPG 5KLVJ 1LS8A 1HTLC 1Q80A 1OOGA 3H1ID 1AVYA 4OZDA 3DVMA 2BBNA 2O1JA 4WY4A 2CPBA 2V53A 4N3YB 3E3RA 5AVUB 3M0DC 2E75B 1DJXA 2QJKC 3SWKA 5AW1B 1OVRA 2OYOA 3CZ0A 2W6AA 3O4XA 1DD3A 1EXRA 3TZ1A 3G4SP 3NXAA 3V6IA 2LV7A 3FWCA 1OOHA 3T97A 3MUDA 1L0ND 3CC4P 2Y1NA 5KLIB 1M63B 5HKWA 1RE3A 2AUCA 3BJHA 1K05A 3RBZA 1IKUA 5B5EH 1OZHA 2N1TD 1L0LE 3B86A 3KDPB 2I8DA 3GK4X 1EDLA 4M2PA 4PHKA 1RF1A 2YGUA 3B6XA 1G1IA 3JCUH 2M1UA 1K04A 1NTZJ 1B1GA 4YGEB 3OX6A 5CCHA 1GU4A 2K1AA 4QJ4B 5APQA 4GOFA 1X22A 2FYUG 2WZ7A 1K73Q 4JQ0D 1PP9E 1NTKG 1GK6A 3S0EA 5E79H 3FXDA 4L74A 1RK9A 1H4BA 3CCQP 1UWOA 1LT1A 1KFXL 1RE3C 1OQPA 1CI6B 2WITA 1PSBA 3LK0A 4I5LB 1CFDA 3L4AA 1ODBA 4ETOA 1VPCA 2IFMA 2GV5A 2YNYA 4PV1C 1K8AQ 1UUSA 3IQOA 3I55P 2KI4C 2LNKA 4EDFA 3H1HG 1DJHA 3DD4A 1RF0A 1FPWA 1SVFA 2ITAA 1K9MQ 1U7MA 3L71D 3ICBA 1SQPE 1HQVA 2P2UA 2WSEH 3B71A 4DOJA 4EYYQ 2H89C 3HCMA 2QJPB 4BRYA 1VQ5P 2WQYC 3SG5A 4YGBB 3USSA 3LW5H 3Q1MA 1DF0A 4OGQC 1SQQD 2FKWB 1CDMA 1KQVA 3AEBC 3HD7B 1YUTA 1WMKA 1YQ3C 1BT6A 2QEBA 3IVTA 1SQVJ 4D6TE 1QWVA 2KB7P 3BVHA 1OW6A 1S5LH 2I94A 2KGRA 3BFHA 1IWQA 1EDIA 1FZCB 4Y28J 2KPHA 2PAJA 2CCMA 2BE4A 1DVIA 3RL0g 4DS7A 1BODA 2Y9ZA 4KYNA 4MN0A 3RL0B 5KLIC 2FYZA 3BUXB 3PLFB 4PV1D 1YX7A 1NKZB 2KNEA 3NHTA 2P7JA 2F3ZA 1OOJA 1PL5A 4JD9A 5CCGA 1L0LG 2ZVOB 4YXWH 5AVYB 2PVBA 1SFCB 2OYHB 1WRGA 3MZWB 3LW5J 4GAOA 2QACA 1X8YA 3H1LE 2MLFC 1SQXK 1BGYJ 2SASA 1R5SA 2QJKB 3D73A 2LHLA 1FE6A 1QVIY 4ZMDA 1NTMJ 1YJWP 5EFWB 1BU3A 4PHNA 2OTLP 3H6PA 2FJUB 4WY4B 2JU0A 1QL2A 3VMZA 2JZIA 2JPTA 2OYIB 1KILD 5G08A 5AW3B 1M39A 3CWGA 2Y9YA 3PM2A 2BCCJ 1SQBD 4P5OE 2WSEJ 3L74E 2B1UA 2A06D 5DJUB 4ORBB 1PGOA 3KPXA 2JOJA 1KK7Y 1QJTA 4OR9B 1URQA 4KHXA 2WTYA 1PZQA 4CFRA 3G3ZA 3AE2C 2FCDA 1RJVA 1RY3A 4N78D 3BATA 2AEMA 2LVVA 2HG5D 2A45G 5PALA 1RECA 5AVXB 3B5NB 3V5BA 2HR3A 3O78A 1SQXE 2Q3EA 5KTBA 1B8RA 3DY9A 1Z2CB 2IBZI 4AQRD 3F45A 3VP9A 1N2DC 1GGZA 2KIKA 3PATA 4B86A 1BF5A 3S0AA 2W6JH 2KHNA 1HWTC 2KYFA 3RZSA 3C8VA 1J2JB 3KQGA 1MUUA 3KXDA 1JC2A 3CCLP 1BDDA 3A2AA 4H0LD 1LT9B 1F54A 4JKTA 2K3RA 2Y5IA 1EZVD 3NGVA 2YKPA 4L9MA 3OW2O 4UB8E 1IJ5A 3V2PA 3PN7C 2KI7B 1JY2P 2KSJA 2FOTA 1GTWA 1MKMA 1GGWA 1PSRA 2KBMA 4XYNA 4E68A 2M7LA 2KFFA 3P8CD 2WNDA 2PQLA 2LVKA 4GNKB 2HLOA 3WUUA 1DX7A 1LTJA 3H1JD 2M9GA 1GW3A 1NTMG 3U1CA 1IO4A 3CI9A 1RF1B 1NTZE 3OX5A 4GGNA 3L70G 1LKJA 4W80A 5J3XA 4Z1MH 1OMIA 4HRGA 5HLVA 2I18A 2K88A 1M56D 2J58A 1S3JA 4LGDE 3II6A 1FU1A 1L0LJ 1EG3A 3G9RA 3V2NA 2ZVNB 4HRHA 3OP0A 2V4HA 4HSZA 3NSOA 4RESB 5I8NA 1LNQA 1QIVA 2FXPA 1PPJG 1CM1A 1WDCB 4U3FD 1B9AA 4F0ZB 1XK4C 5I94A 2H61A 3WHUB 2B87A 3HE4B 1M90Q 3UO9A 1KILC 4LC1A 3I5CA 5AVQB 3GW6A 3I5HB 1W2BO 2PASA 1L0NJ 3SG7A 1EZVI 2SCPA 4N5XA 1OMRA 3BXKA 3GF7A 1C3ZA 2LM5A 1JWDA 3EKJA 2MBXA 5IBWA 3VN0A 2YMKA 3B5NC 2Y1MA 1IK9A 1KILA 1M7LA 2Y0DA 3E7KA 3L75J 4UB8H 5KLVE 1U5IA 2F2OA 3GMAA 3SFEC 4PE4A 4YRUA 3KO0A 1SQXD 1FBMA 1TIZA 1IGVA 2HQWA 5JOLA 1FF1A 1KFNA 1CLLA 1S3PA 3H1HJ 1CSBA 2N1TB 1G8IA 2TN4A 1KZUB 1Q86Q 5CSNA 1UHIA 2Y0CA 5GTHH 2JTZA 1DTLA 3VROA 3L75G 4U8DA 1XFYO 1T14A 4ORCB 3FE6A 2ZFCA 3PSRA 3QH9A 2NCOA 1JY3O 2PP6A 1N8RQ 1NPQA 2C0WA 1NYHA 1L2PA 1NTKJ 1BE3E 1NCYA 4OGQD 3E1IA 2LMVA 1JCDA 5KLVD 2L0PA 3M0WA 2FYUJ 2WPVB 1S72P 3PJIA 1JEKA 2C0XA 1B7TY 1CZQA 1KFXS 3S9OA 3GK1A 3CC7P 1LTGC 1Z56A 2ZN8A 1YHQP 1NTZG 2G3AA 1L4AB 1OIPA 5K5GB 1H89A 2KUBA 2QDIA 4C7NA 3OAKA 1BR1B 3CR5X 1L2OC 1IC2A 2MLEC 1QLED 2NXQA 1AUIB 4OCIA 1N7SA 3PHLA 1Q2NA 4YI8A 5KAFH 2PGDA 3IQQA 3DZTA 1YJNP 1K9KA 1USEA 2ZNDA 3SS5A 3U59A 5B5EE 1OE9B 2GGMA 4R4LA 1KB9D 2KSEA 2KNCB 4L75A 1QATA 2C9NY 1OFCX 4ZCVA 2JULA 4M2OA 3DXLA 2QEHA 3L70J 2A45H 4NPFX 2BEQD 5CCGD 3M9HA 1DH3A 1KMIZ 4BWNA 1YURA 3CPWO 1VQ6P 3W68A 1E5WA 2JJLA 3WUVA 3PALA 2FYUD 3NSKA 3IFMA 2E74B 5B8IB 1Q7YQ 1ZOTB 1BCCE 1M1JA 2GUVA 3S1KA 1F4OA 1BGYD 1FOSF 5APYA 3SJSA 1YX8A 1EXJA 1SQPJ 3AEAC 1OMDA 5KLVG 2WCJA 2HPSA 1BLQA 2M5AA 4GIFA 2N1TC 4PJ0H 2L5GB 5KTYA 2WPRA 1XFUO 3PH0A 2KI4B 3S4RA 1JBAA 3RL0D 1NJIQ 1T3UA 4PALA
chains in the Genus database with same CATH topology
2LAPA 2HQ8A 2JT8A 5CPVA 1JFJA 1SYMA 3GK4X 2JXLA 4AQIA 3CZTX 3RM1A 1QASA 4PE7A 1D1OA 4M2PA 4PHKA 1IH0A 1KQMC 1K2HA 2M1UA 1AVSA 3DF0B 2NZ0A 1G4YR 4CFQA 1B1GA 3VRNA 3BOWA 3CR4X 1BMOA 4YGEB 2L98A 2BL0C 3OX6A 1DGUA 4QJ4B 1L7ZA 1XFVO 4MLWA 2ZNEA 4CPVA 1NUBA 1ALWA 4BY5A 4NDCA 3I5FB 1SCVA 2OTGB 2CNPA 4YGDB 4JQ0D 1A4PA 1N65A 4MZLA 1XK4A 2ZRSA 1KSOA 1XFXO 3JTDB 4YGCB 1SMGA 2O5GA 2G9BA 1RK9A 1KSMA 1UP5A 1H4BA 1UWOA 1WDCC 2F2PA 1KFXL 2KGBC 4DCKA 1OQPA 1KQMB 1BOCA 4I5JA 1CLMA 1EL4A 1PSBA 3LK0A 2CTNA 2LLSA 4I5LB 3CLNA 1CFDA 1UHHA 3EVUA 1ODBA 5AEQA 4XJKB 1NX3A 3KHEA 4A4BA 2GV5A 1S1EA 2LP2A 2K7OA 1UUSA 3ZNIA 3IQOA 1PULA 2KI4C 1MR8A 1MUXA 2LNKA 2OPOA 4USLA 2KFGA 3VRPA 1CMFA 1DJHA 1XYDA 2Q91A 3DD4A 3TUYC 2ZRTA 2QPTA 1QXPA 4MRXA 1A03A 1FPWA 1S6JA 1XFZO 3O6BA 3ICBA 1EH2A 1IRJA 1HQVA 1BJFA 1SCMB 1WY9A 1KK8C 3HCMA 1SR6C 2E30A 1NYAA 1TRFA 1X02A 1YRUB 1YUSA 1VRKA 3I5FC 5HYDA 3BUOB 1JFKA 2BCAA 1FI6A 1MXEA 3SG5A 2IS9A 2NCPA 4YGBB 1DF0A 3TDUA 1OSAA 2M0RA 5I2OA 2BL0B 1PVBA 2P6BB 2M49B 1CDNA 1CDMA 1KQVA 1TOPA 1HT9A 1YUTA 2M3WA 2KAVA 2KI6C 2A4JA 3CTNA 4CLNA 1BT6A 1N0YA 3OB1B 3PN7B 2JWWA 1PK0D 1RWYA 1B7TZ 4GGFC 2I94A 2KGRA 2LCPA 3NSIA 1IWQA 4MZJA 1ZMZA 1C7VA 1AJ4A 1WLMA 1J1DA 2M8UA 2CCMA 1K94A 2BE4A 1DVIA 4DS7A 1FW4A 1BODA 2R2IA 2Y9ZA 5HKZA 1G33A 4MN0A 2L5XB 1J1EA 2OS8B 2ISDA 3BUXB 3PLFB 4MRYA 1F71A 1S26D 3JVTB 1YX7A 2KOTA 1TNQA 1LINA 2WC8A 2KNEA 1J7PA 1Y6WA 1SL8A 2F3ZA 2JC2A 4WQ3A 1OOJA 1ZUZA 4FQOA 1R6PA 2PVBA 3EK7A 2Q4UA 4GBAA 1SRAA 1MXLC 4C0LA 4AOMA 1CB1A 1YVLA 2QACA 4GAOA 2GGZA 2Y4QA 2EGDA 2MLFC 2KQ6A 2SASA 4MZKA 1CM4A 1S36A 2L2EA 1QVIY 2L51A 2LHLA 3LLEA 5AFPA 1DJZA 4C0KA 1BU3A 4PHNA 2FJUB 2JU0A 2JZIA 2JPTA 4C0JA 1NIWA 1K96A 1K8UA 5G08A 1M39A 1U5IB 1A2XA 2MHHA 3CWGA 1CKKA 2Y9YA 3ZWHA 2L4IA 4D1EA 2I2RE 2PMYA 4P5OE 1A75B 3VRRA 2M7NA 2EHBA 5DKQA 3QRXA 2F8PA 3SIAA 1WRZA 2BE6A 3GK2A 1TN4A 2B1UA 4ORBB 3O2PA 1AK8A 5AANA 1F55A 1JF2A 3KPXA 3DVEA 1DT7B 1CDPA 1LVCD 1QLSA 1YUUA 2H2KA 1KK7Y 2JOJA 1QJTA 1GJYA 2F3YA 4OR9B 2ZKMX 3NSLA 4GPLB 1CDLA 4CFRA 1ZFSA 2K2AA 4YI9A 2AMIA 1TCOB 1L2OB 1RFJA 2FCDA 1NP8A 3D0YB 4N1FA 5F6TA 1RJVA 2LVVA 2PALA 3BUWB 1M45A 2K7BA 5PALA 1RECA 4IL1A 2KFHA 2K7CA 3A8RA 2WCFA 4QJ5B 2K7DA 1V1FA 4GUKA 3LCPC 3O78A 2JQ6A 2JT3A 2D8NA 2COLB 1B8RA 1UHKA 5AERA 5CSFA 4FTGA 3F45A 1F4QA 2KBIA 2L4HA 1ALVA 1GGZA 2PSRA 1K95A 2VRGA 3PATA 4UPGA 1BF5A 5DKNA 2KHNA 1LXFC 1SR6B 1KK8B 2KYFA 2LE9B 2KDHA 1J7OA 3I5GC 1JC2A 1BR4B 5ER4X 1B8LA 1J55A 1RROA 2MJWB 5KSZA 2LLUA 1EJ3A 1WRLA 1WLZA 4MSPA 1CFPA 2OS8C 1SPYA 4I5KA 1F54A 3C1VA 5ER5A 2Y5IA 3DVKA 1UHNA 3PM8A 2K61A 1LA0A 1R2UA 1B47A 4MEWA 4L9MA 2BCBA 2WORA 1OMVA 3BYAA 4ORAB 1IJ6A 2LMUA 1IJ5A 4WRIA 4PDZA 2WCBA 3PN7C 3VRQA 1QTXA 2HETA 1QV0A 3BUNB 2AAOA 4OVNF 5JJGA 4YGAA 1QS7A 1NCZA 1JUOA 2FOTA 4MBEA 1GGWA 1PSRA 1QVIZ 2EC6B 1DF0B 2KBMA 3OB2B 4XYNA 5FYXA 2M7LA 4E68A 2KFFA 4A4CA 3I5IC 3WXAA 1NWDA 2LUXA 1PVAA 1AJ5A 1LA3A 1YR5A 2OTGC 2I7AA 2WNDA 2LVKA 4GNKB 1IG5A 1K93D 1S6CA 4PHJA 1CFCA 2M9GA 2JNFA 2BECA 1MF8B 4PE1A 2LANA 2ZN9A 1KWOC 3I5IB 3OX5A 5BPJA 2LUCA 4GGNA 2BBMA 1LKJA 2G2BA 5J3XA 5I2QA 3O4YA 4HRGA 1SL7A 4TNCA 5HLVA 2I18A 1DJWA 4ICBA 4DIRA 1DJIA 5DKRA 1OZSA 1EG3A 2H61C 1PRWA 1W7JB 1SK6D 2M29A 3CGAA 1IQ3A 4DRWA 1M31A 2F33A 5TNCA 4HRHA 3OP0A 4NDDA 3TS5B 4OV2A 4N1GA 1SL9A 2MAZA 3PFVA 4HSZA 3NSOA 1E8AA 4R1EA 5I8NA 1YVHA 3LK1A 2MA2A 1QIVA 1WRKA 1CM1A 1EG4A 1WDCB 1UHJA 3I5GB 1B9AA 1GQMA 2KYCA 1CFFA 4YBHB 1XK4C 4F0ZB 3JTDC 2H61A 3SG3A 3WHUB 1OZOA 1KWOB 3AKAA 1NX2A 5D69A 5KU1A 2LVIA 3AAKA 4BY4A 2CBLA 1XVJA 1C7WA 4NQGA 3DVJA 1KCYA 3I5HB 2PASA 4PCWA 3DF0A 4MVFA 3SG7A 3WNXB 1JSAA 1A29A 2SCPA 1OMRA 4N5XA 3BXKA 5CSIA 5HKYA 2LM5A 5AXIA 1N2DA 1XFWO 2BKHB 2EC6C 1JWDA 3EKJA 2KAYA 1A75A 2MBXA 1Y0VH 5IBWA 1CLBA 1QIWA 1S5GY 1J7QA 1SY9A 1SKTA 2Y1MA 3FS7A 3MSEB 3H4SE 3SG4A 1TCFA 1U5IA 2F2OA 1JF0A 1NX0A 1SW8A 4PE4A 4YRUA 2BCXA 3KO0A 1CTRA 1TIZA 2RGIA 1IGVA 2HQWA 1UURA 5JOLA 1FF1A 1YTZC 1FI5A 1H8BA 1CLLA 1S3PA 1K90D 1S6IA 1QX5B 1DJGA 1F70A 2LHIA 2LMTA 4AQJA 3AAJA 1TNWA 1G8IA 1B8CA 2TN4A 1AP4A 3SG2A 4Q04A 1J7RA 5CSNA 5CSJA 2JTTA 1UHIA 2JTZA 2L50A 1DTLA 3VROA 4U8DA 1M46A 1XFYO 3FWBA 3EK4A 4ORCB 1Y1XA 2ZFDA 3D0YA 3HX4A 3K21A 2KI6D 3PSRA 4DUQA 2NCOA 3CR2A 3RLZA 1NPQA 2KSPA 1XO5A 2M1KB 3SIBA 1MWNA 3IF7A 1XA5A 1DJYA 1NCYA 2E6WA 4WQ2A 2LMVA 1V1GA 3CS1A 4M2QA 2L0PA 3M0WA 4P2YB 3KF9A 1K9UA 1K9PA 4QJ3B 1PALA 2DOQA 2K0JA 2M97A 1B7TY 4PE0A 1CMGA 2KQYA 1KFXS 1W7IB 5GQQC 3GK1A 1F8HA 3WHTB 1TNPA 1C07A 2ZN8A 3TDIA 2LP3A 3EK8A 3BOWB 1B4CA 2K8MB 2NLNA 3VGOA 1BR1B 2CT9A 1L2OC 2LVJA 3CR5X 3KEVA 1SBJA 2MLEC 2O60A 2NXQA 1AUIB 4OCIA 4GGFA 2CXJA 4YI8A 3AKBA 1S5GZ 1DMOA 1RTP1 2LLTA 3EVRA 1MHOA 2JT0A 3EVVA 3IQQA 4I5NB 4JWQA 4JPZB 3LL8B 3SG6A 2JXCA 1K9KA 4OKHA 2ZNDA 1OE9B 1Y1AA 2GGMA 5D7FA 1QX7A 1NSHA 1Y1UA 2BKIB 1QATA 4GFTA 1TTXA 2FCEA 4ZCVA 2PRUA 1CNPA 1OFCX 2JULA 1Q80A 4M2OA 4NDBA 1AHRA 3BUMB 1NX1A 3FIAA 1DGVA 4XJKA 3GOFA 2K2FA 5K89A 2KAXA 1FBVA 1NCXA 3DVMA 2BBNA 1SNLA 1QV1A 2WOSA 1YURA 1IQ5A 3EKHA 2V53A 3OHMB 3TDZA 3E3RA 5I2LA 1DJXA 3BQ3A 1YRTB 1QLKA 3PALA 2MRDA 3NSKA 3I5HC 2JNXA 1EXRA 3TZ1A 5B8IB 3NXAA 1ZOTB 3D10A 1SCMC 2JRFA 1KFUS 2LV7A 3FWCA 1ZACA 1F4OA 1KK7Z 1TNXA 2WCEA 3SJSA 1YX8A 5HLOA 1BG1A 2HF5A 4ZCUA 1OMDA 2LC5A 1KFUL 3JVTC 3TUYB 2HPSA 1BLQA 1QX2A 2Y1NA 1M63B 5HKWA 1MQ1A 4HREE 5KTYA 2AUCA 1XFUO 2KI4B 3A4UB 1IKUA 1JBAA 4PHMA 3TS5C 4CIDA 4ETOA 4PALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAP A;  2HQ8 A;  2JT8 A;  5CPV A;  1JFJ A;  1SYM A;  3GK4 X;  2JXL A;  4AQI A;  3CZT X;  3RM1 A;  1QAS A;  4PE7 A;  1D1O A;  4M2P A;  4PHK A;  1IH0 A;  1KQM C;  1K2H A;  2M1U A;  1AVS A;  3DF0 B;  2NZ0 A;  1G4Y R;  4CFQ A;  1B1G A;  3VRN A;  3BOW A;  3CR4 X;  1BMO A;  4YGE B;  2L98 A;  2BL0 C;  3OX6 A;  1DGU A;  4QJ4 B;  1L7Z A;  1XFV O;  4MLW A;  2ZNE A;  4CPV A;  1NUB A;  1ALW A;  4BY5 A;  4NDC A;  3I5F B;  1SCV A;  2OTG B;  2CNP A;  4YGD B;  4JQ0 D;  1A4P A;  1N65 A;  4MZL A;  1XK4 A;  2ZRS A;  1KSO A;  1XFX O;  3JTD B;  4YGC B;  1SMG A;  2O5G A;  2G9B A;  1RK9 A;  1KSM A;  1UP5 A;  1H4B A;  1UWO A;  1WDC C;  2F2P A;  1KFX L;  2KGB C;  4DCK A;  1OQP A;  1KQM B;  1BOC A;  4I5J A;  1CLM A;  1EL4 A;  1PSB A;  3LK0 A;  2CTN A;  2LLS A;  4I5L B;  3CLN A;  1CFD A;  1UHH A;  3EVU A;  1ODB A;  5AEQ A;  4XJK B;  1NX3 A;  3KHE A;  4A4B A;  2GV5 A;  1S1E A;  2LP2 A;  2K7O A;  1UUS A;  3ZNI A;  3IQO A;  1PUL A;  2KI4 C;  1MR8 A;  1MUX A;  2LNK A;  2OPO A;  4USL A;  2KFG A;  3VRP A;  1CMF A;  1DJH A;  1XYD A;  2Q91 A;  3DD4 A;  3TUY C;  2ZRT A;  2QPT A;  1QXP A;  4MRX A;  1A03 A;  1FPW A;  1S6J A;  1XFZ O;  3O6B A;  3ICB A;  1EH2 A;  1IRJ A;  1HQV A;  1BJF A;  1SCM B;  1WY9 A;  1KK8 C;  3HCM A;  1SR6 C;  2E30 A;  1NYA A;  1TRF A;  1X02 A;  1YRU B;  1YUS A;  1VRK A;  3I5F C;  5HYD A;  3BUO B;  1JFK A;  2BCA A;  1FI6 A;  1MXE A;  3SG5 A;  2IS9 A;  2NCP A;  4YGB B;  1DF0 A;  3TDU A;  1OSA A;  2M0R A;  5I2O A;  2BL0 B;  1PVB A;  2P6B B;  2M49 B;  1CDN A;  1CDM A;  1KQV A;  1TOP A;  1HT9 A;  1YUT A;  2M3W A;  2KAV A;  2KI6 C;  2A4J A;  3CTN A;  4CLN A;  1BT6 A;  1N0Y A;  3OB1 B;  3PN7 B;  2JWW A;  1PK0 D;  1RWY A;  1B7T Z;  4GGF C;  2I94 A;  2KGR A;  2LCP A;  3NSI A;  1IWQ A;  4MZJ A;  1ZMZ A;  1C7V A;  1AJ4 A;  1WLM A;  1J1D A;  2M8U A;  2CCM A;  1K94 A;  2BE4 A;  1DVI A;  4DS7 A;  1FW4 A;  1BOD A;  2R2I A;  2Y9Z A;  5HKZ A;  1G33 A;  4MN0 A;  2L5X B;  1J1E A;  2OS8 B;  2ISD A;  3BUX B;  3PLF B;  4MRY A;  1F71 A;  1S26 D;  3JVT B;  1YX7 A;  2KOT A;  1TNQ A;  1LIN A;  2WC8 A;  2KNE A;  1J7P A;  1Y6W A;  1SL8 A;  2F3Z A;  2JC2 A;  4WQ3 A;  1OOJ A;  1ZUZ A;  4FQO A;  1R6P A;  2PVB A;  3EK7 A;  2Q4U A;  4GBA A;  1SRA A;  1MXL C;  4C0L A;  4AOM A;  1CB1 A;  1YVL A;  2QAC A;  4GAO A;  2GGZ A;  2Y4Q A;  2EGD A;  2MLF C;  2KQ6 A;  2SAS A;  4MZK A;  1CM4 A;  1S36 A;  2L2E A;  1QVI Y;  2L51 A;  2LHL A;  3LLE A;  5AFP A;  1DJZ A;  4C0K A;  1BU3 A;  4PHN A;  2FJU B;  2JU0 A;  2JZI A;  2JPT A;  4C0J A;  1NIW A;  1K96 A;  1K8U A;  5G08 A;  1M39 A;  1U5I B;  1A2X A;  2MHH A;  3CWG A;  1CKK A;  2Y9Y A;  3ZWH A;  2L4I A;  4D1E A;  2I2R E;  2PMY A;  4P5O E;  1A75 B;  3VRR A;  2M7N A;  2EHB A;  5DKQ A;  3QRX A;  2F8P A;  3SIA A;  1WRZ A;  2BE6 A;  3GK2 A;  1TN4 A;  2B1U A;  4ORB B;  3O2P A;  1AK8 A;  5AAN A;  1F55 A;  1JF2 A;  3KPX A;  3DVE A;  1DT7 B;  1CDP A;  1LVC D;  1QLS A;  1YUU A;  2H2K A;  1KK7 Y;  2JOJ A;  1QJT A;  1GJY A;  2F3Y A;  4OR9 B;  2ZKM X;  3NSL A;  4GPL B;  1CDL A;  4CFR A;  1ZFS A;  2K2A A;  4YI9 A;  2AMI A;  1TCO B;  1L2O B;  1RFJ A;  2FCD A;  1NP8 A;  3D0Y B;  4N1F A;  5F6T A;  1RJV A;  2LVV A;  2PAL A;  3BUW B;  1M45 A;  2K7B A;  5PAL A;  1REC A;  4IL1 A;  2KFH A;  2K7C A;  3A8R A;  2WCF A;  4QJ5 B;  2K7D A;  1V1F A;  4GUK A;  3LCP C;  3O78 A;  2JQ6 A;  2JT3 A;  2D8N A;  2COL B;  1B8R A;  1UHK A;  5AER A;  5CSF A;  4FTG A;  3F45 A;  1F4Q A;  2KBI A;  2L4H A;  1ALV A;  1GGZ A;  2PSR A;  1K95 A;  2VRG A;  3PAT A;  4UPG A;  1BF5 A;  5DKN A;  2KHN A;  1LXF C;  1SR6 B;  1KK8 B;  2KYF A;  2LE9 B;  2KDH A;  1J7O A;  3I5G C;  1JC2 A;  1BR4 B;  5ER4 X;  1B8L A;  1J55 A;  1RRO A;  2MJW B;  5KSZ A;  2LLU A;  1EJ3 A;  1WRL A;  1WLZ A;  4MSP A;  1CFP A;  2OS8 C;  1SPY A;  4I5K A;  1F54 A;  3C1V A;  5ER5 A;  2Y5I A;  3DVK A;  1UHN A;  3PM8 A;  2K61 A;  1LA0 A;  1R2U A;  1B47 A;  4MEW A;  4L9M A;  2BCB A;  2WOR A;  1OMV A;  3BYA A;  4ORA B;  1IJ6 A;  2LMU A;  1IJ5 A;  4WRI A;  4PDZ A;  2WCB A;  3PN7 C;  3VRQ A;  1QTX A;  2HET A;  1QV0 A;  3BUN B;  2AAO A;  4OVN F;  5JJG A;  4YGA A;  1QS7 A;  1NCZ A;  1JUO A;  2FOT A;  4MBE A;  1GGW A;  1PSR A;  1QVI Z;  2EC6 B;  1DF0 B;  2KBM A;  3OB2 B;  4XYN A;  5FYX A;  2M7L A;  4E68 A;  2KFF A;  4A4C A;  3I5I C;  3WXA A;  1NWD A;  2LUX A;  1PVA A;  1AJ5 A;  1LA3 A;  1YR5 A;  2OTG C;  2I7A A;  2WND A;  2LVK A;  4GNK B;  1IG5 A;  1K93 D;  1S6C A;  4PHJ A;  1CFC A;  2M9G A;  2JNF A;  2BEC A;  1MF8 B;  4PE1 A;  2LAN A;  2ZN9 A;  1KWO C;  3I5I B;  3OX5 A;  5BPJ A;  2LUC A;  4GGN A;  2BBM A;  1LKJ A;  2G2B A;  5J3X A;  5I2Q A;  3O4Y A;  4HRG A;  1SL7 A;  4TNC A;  5HLV A;  2I18 A;  1DJW A;  4ICB A;  4DIR A;  1DJI A;  5DKR A;  1OZS A;  1EG3 A;  2H61 C;  1PRW A;  1W7J B;  1SK6 D;  2M29 A;  3CGA A;  1IQ3 A;  4DRW A;  1M31 A;  2F33 A;  5TNC A;  4HRH A;  3OP0 A;  4NDD A;  3TS5 B;  4OV2 A;  4N1G A;  1SL9 A;  2MAZ A;  3PFV A;  4HSZ A;  3NSO A;  1E8A A;  4R1E A;  5I8N A;  1YVH A;  3LK1 A;  2MA2 A;  1QIV A;  1WRK A;  1CM1 A;  1EG4 A;  1WDC B;  1UHJ A;  3I5G B;  1B9A A;  1GQM A;  2KYC A;  1CFF A;  4YBH B;  1XK4 C;  4F0Z B;  3JTD C;  2H61 A;  3SG3 A;  3WHU B;  1OZO A;  1KWO B;  3AKA A;  1NX2 A;  5D69 A;  5KU1 A;  2LVI A;  3AAK A;  4BY4 A;  2CBL A;  1XVJ A;  1C7W A;  4NQG A;  3DVJ A;  1KCY A;  3I5H B;  2PAS A;  4PCW A;  3DF0 A;  4MVF A;  3SG7 A;  3WNX B;  1JSA A;  1A29 A;  2SCP A;  1OMR A;  4N5X A;  3BXK A;  5CSI A;  5HKY A;  2LM5 A;  5AXI A;  1N2D A;  1XFW O;  2BKH B;  2EC6 C;  1JWD A;  3EKJ A;  2KAY A;  1A75 A;  2MBX A;  1Y0V H;  5IBW A;  1CLB A;  1QIW A;  1S5G Y;  1J7Q A;  1SY9 A;  1SKT A;  2Y1M A;  3FS7 A;  3MSE B;  3H4S E;  3SG4 A;  1TCF A;  1U5I A;  2F2O A;  1JF0 A;  1NX0 A;  1SW8 A;  4PE4 A;  4YRU A;  2BCX A;  3KO0 A;  1CTR A;  1TIZ A;  2RGI A;  1IGV A;  2HQW A;  1UUR A;  5JOL A;  1FF1 A;  1YTZ C;  1FI5 A;  1H8B A;  1CLL A;  1S3P A;  1K90 D;  1S6I A;  1QX5 B;  1DJG A;  1F70 A;  2LHI A;  2LMT A;  4AQJ A;  3AAJ A;  1TNW A;  1G8I A;  1B8C A;  2TN4 A;  1AP4 A;  3SG2 A;  4Q04 A;  1J7R A;  5CSN A;  5CSJ A;  2JTT A;  1UHI A;  2JTZ A;  2L50 A;  1DTL A;  3VRO A;  4U8D A;  1M46 A;  1XFY O;  3FWB A;  3EK4 A;  4ORC B;  1Y1X A;  2ZFD A;  3D0Y A;  3HX4 A;  3K21 A;  2KI6 D;  3PSR A;  4DUQ A;  2NCO A;  3CR2 A;  3RLZ A;  1NPQ A;  2KSP A;  1XO5 A;  2M1K B;  3SIB A;  1MWN A;  3IF7 A;  1XA5 A;  1DJY A;  1NCY A;  2E6W A;  4WQ2 A;  2LMV A;  1V1G A;  3CS1 A;  4M2Q A;  2L0P A;  3M0W A;  4P2Y B;  3KF9 A;  1K9U A;  1K9P A;  4QJ3 B;  1PAL A;  2DOQ A;  2K0J A;  2M97 A;  1B7T Y;  4PE0 A;  1CMG A;  2KQY A;  1KFX S;  1W7I B;  5GQQ C;  3GK1 A;  1F8H A;  3WHT B;  1TNP A;  1C07 A;  2ZN8 A;  3TDI A;  2LP3 A;  3EK8 A;  3BOW B;  1B4C A;  2K8M B;  2NLN A;  3VGO A;  1BR1 B;  2CT9 A;  1L2O C;  2LVJ A;  3CR5 X;  3KEV A;  1SBJ A;  2MLE C;  2O60 A;  2NXQ A;  1AUI B;  4OCI A;  4GGF A;  2CXJ A;  4YI8 A;  3AKB A;  1S5G Z;  1DMO A;  1RTP 1;  2LLT A;  3EVR A;  1MHO A;  2JT0 A;  3EVV A;  3IQQ A;  4I5N B;  4JWQ A;  4JPZ B;  3LL8 B;  3SG6 A;  2JXC A;  1K9K A;  4OKH A;  2ZND A;  1OE9 B;  1Y1A A;  2GGM A;  5D7F A;  1QX7 A;  1NSH A;  1Y1U A;  2BKI B;  1QAT A;  4GFT A;  1TTX A;  2FCE A;  4ZCV A;  2PRU A;  1CNP A;  1OFC X;  2JUL A;  1Q80 A;  4M2O A;  4NDB A;  1AHR A;  3BUM B;  1NX1 A;  3FIA A;  1DGV A;  4XJK A;  3GOF A;  2K2F A;  5K89 A;  2KAX A;  1FBV A;  1NCX A;  3DVM A;  2BBN A;  1SNL A;  1QV1 A;  2WOS A;  1YUR A;  1IQ5 A;  3EKH A;  2V53 A;  3OHM B;  3TDZ A;  3E3R A;  5I2L A;  1DJX A;  3BQ3 A;  1YRT B;  1QLK A;  3PAL A;  2MRD A;  3NSK A;  3I5H C;  2JNX A;  1EXR A;  3TZ1 A;  5B8I B;  3NXA A;  1ZOT B;  3D10 A;  1SCM C;  2JRF A;  1KFU S;  2LV7 A;  3FWC A;  1ZAC A;  1F4O A;  1KK7 Z;  1TNX A;  2WCE A;  3SJS A;  1YX8 A;  5HLO A;  1BG1 A;  2HF5 A;  4ZCU A;  1OMD A;  2LC5 A;  1KFU L;  3JVT C;  3TUY B;  2HPS A;  1BLQ A;  1QX2 A;  2Y1N A;  1M63 B;  5HKW A;  1MQ1 A;  4HRE E;  5KTY A;  2AUC A;  1XFU O;  2KI4 B;  3A4U B;  1IKU A;  1JBA A;  4PHM A;  3TS5 C;  4CID A;  4ETO A;  4PAL A; 
#chains in the Genus database with same CATH topology
 2KXP B;  2LAP A;  3SWY A;  4H13 B;  2W6B A;  3CDN A;  4IFM A;  3L72 E;  4PE7 A;  1IH0 A;  3S0G A;  2IX7 C;  3WMM 0;  4MN4 C;  1BSN A;  1G4Y R;  1FZB A;  4MLW A;  2KLV A;  1GL2 A;  3I5F B;  2OTG B;  3BRT B;  1KIL B;  3V2R A;  5CBO A;  1N65 A;  1XK4 A;  2K9J B;  2ZRS A;  1KSO A;  5FI2 A;  2O5G A;  1KSM A;  1UP5 A;  2W83 C;  1WDC C;  2F2P A;  3BCC J;  1CLM A;  3P7K A;  3RK2 C;  1VQN P;  2FFD B;  2D2C D;  4PT1 A;  2KK7 A;  1NX3 A;  4QMA A;  1HGZ A;  2GM4 A;  1S1E A;  3M06 A;  1T3J A;  3V4W A;  2YKO A;  2KFG A;  3VRP A;  3VOP A;  1XYD A;  2Q91 A;  2ZT9 C;  3FE8 A;  1FAV A;  1LWU B;  1QXP A;  3CL3 D;  4JYC A;  1MZ9 A;  3CXH E;  4ZKP A;  1EH2 A;  3CME P;  1SSE B;  1WY9 A;  1M1J B;  1N7L A;  1GL2 C;  1SR6 C;  1NYA A;  1YUS A;  1VRK A;  2XU6 A;  1JFK A;  1MXE A;  1QX8 A;  2E42 A;  2IS9 A;  1SQB E;  4TLF A;  3TDU A;  5I2O A;  2B89 A;  1JM0 A;  2P6B B;  2Z5I A;  1BGY G;  1T6A A;  1KB9 E;  2NZ2 A;  1N73 B;  2XV5 A;  2KI6 C;  4DT0 A;  1EZV E;  3TDK A;  3PN7 B;  1AV1 A;  4I6M C;  1AJY A;  3TK1 A;  1H0T A;  1N7S C;  2LCP A;  3GHG C;  4L73 A;  1JO5 A;  3MHV A;  3RK3 B;  1C7V A;  5CCH C;  1YJ9 P;  2ZYA A;  1JCC A;  2QJY C;  4H0L B;  1K94 A;  3D76 A;  1LJ2 A;  1J1E A;  2ISD A;  2IZ0 A;  1PIX A;  3LID A;  2KOT A;  1LIN A;  4WQ3 A;  1ZUZ A;  3HE4 A;  1FDO A;  4YTP C;  1SQV G;  2AXT E;  1SRA A;  2Q5U A;  4AOM A;  1CB1 A;  1YVL A;  1PP9 J;  3MD0 A;  2GGZ A;  1BCC J;  2EGD A;  1L0N E;  4MZK A;  2ZXX A;  2L51 A;  5AFP A;  1Q82 Q;  1DJZ A;  3R4Y A;  4H44 D;  3L73 G;  4KJM A;  1JY2 N;  1FDM A;  2AEJ A;  1IZN B;  3D75 A;  4HJG H;  1K8U A;  3TGU E;  1A2X A;  2MHH A;  3ZWH A;  2NPS D;  2EHB A;  5DKQ A;  4K35 A;  3QME A;  5TIS H;  2N1T A;  1IFJ A;  2OGU A;  1LTT C;  1NGM B;  4JYB A;  2W8Z A;  4U3F J;  1AK8 A;  1CDP A;  1KQS O;  2YIU B;  1GJY A;  1P84 H;  2ZKM X;  1ZFS A;  2K2A A;  2E76 B;  2AMI A;  4K3A A;  4N1F A;  3A3Y B;  3H1I J;  2KLU A;  3AEF C;  5C39 A;  1ORG A;  3L47 A;  2FY8 A;  1GMJ A;  2K7B A;  1Y9B A;  1AA0 A;  5GTH E;  2WCF A;  1V1F A;  1YYC A;  3H25 A;  4WY4 C;  1H0T B;  3D74 A;  4FTG A;  3FE9 A;  2KBI A;  4UB6 E;  3E1R A;  1ZLL A;  4GOE A;  2WPQ A;  3VMA A;  1LXF C;  2QEO A;  1SFC C;  1KK8 B;  3JCU E;  2QG4 A;  5H2F E;  2LE9 B;  1EZV G;  3I5G C;  3AE1 C;  1B8L A;  5KSZ A;  2MJW B;  3CCS P;  1CFP A;  4MSP A;  3N4X A;  5AVZ B;  5AW5 B;  3C1V A;  1R8E A;  4PJ0 E;  3DVK A;  1LWU A;  1UHN A;  3PM8 A;  5KAF E;  4IL6 E;  1LA0 A;  1R2U A;  1B47 A;  2PYQ A;  4MEW A;  2BCB A;  1OMV A;  3Q2Y A;  3NHI A;  5L8R J;  2LMU A;  3KHU A;  2P58 A;  4WRI A;  3VRQ A;  2K37 A;  2AAO A;  1GD2 E;  4YGA A;  3G71 P;  1NCZ A;  2WC6 A;  3HD7 C;  4MBE A;  2EC6 B;  1W5C E;  2V7Q J;  1FZF A;  4A4C A;  3PJS K;  3I5I C;  2LUX A;  1PVA A;  1R5L A;  4OGQ B;  1WT6 A;  1NTK E;  2FFD A;  2JNF A;  1USD A;  2BEC A;  1MF8 B;  1KYO H;  3L73 E;  4GT1 A;  2BBM A;  1BE3 J;  5AVS B;  1L4A D;  3O4Y A;  4TNC A;  3L70 E;  1UII A;  1GM0 A;  5DIC A;  2KS1 A;  1NU1 J;  2H61 C;  1W7J B;  2MJZ A;  3CGA A;  3R2P A;  1ZR4 A;  1IQ3 A;  2F33 A;  3TS5 B;  3NMD A;  4N78 E;  4R1E A;  2CK3 H;  4BXL A;  3O8Z A;  1ZN5 A;  3P32 A;  3LK1 A;  5KJ7 D;  1OOI X;  1NAF A;  3CC2 P;  4LLH A;  4GOD A;  2YXR B;  1X79 B;  2PRR A;  1AVO A;  1OZO A;  2WMM A;  2ZYD A;  1KWO B;  2HYN A;  3AKA A;  1NX2 A;  5KU1 A;  2BCC D;  2KOG A;  2LVI A;  2CBL A;  1J1E C;  2M3E A;  3TGU J;  4TT3 H;  2M0B A;  5TIS E;  1RQU A;  3H1K E;  5AXI A;  5KLV K;  1XFW O;  1AQ5 A;  4ASV A;  3L72 J;  2E74 D;  1Y0V H;  1QIW A;  2GA1 A;  1KIL E;  4D6T G;  1YIJ P;  4ZKU A;  1SY9 A;  1SKT A;  2FYN C;  2OYI A;  3SG4 A;  3F89 A;  1TCF A;  2KYV A;  4XA4 A;  1LGH B;  1NX0 A;  1SW8 A;  3D71 A;  2WC5 A;  1CTR A;  2YO2 A;  1FI5 A;  3HRN A;  4WWI A;  1H8B A;  3TSI A;  3VTP C;  1S6I A;  1PGJ A;  1F70 A;  3CCJ P;  2LMT A;  4AQJ A;  2W27 A;  3A7O A;  1FJP A;  1KQL A;  1B8C A;  2WSC H;  4H13 D;  3SG2 A;  1J7R A;  1W2E A;  1U57 A;  2O1K A;  3BCC E;  3FWB A;  3EK4 A;  1GDT A;  3HX4 A;  2ZFD A;  3D0Y A;  3K21 A;  4W7Z A;  2KSP A;  3SIB A;  1P84 D;  3AEC C;  3MTU E;  2FBW C;  1DC1 A;  1MFZ A;  1DJY A;  2E75 C;  2E6W A;  4WQ2 A;  3CS1 A;  2MKV A;  4QJ3 B;  3L71 G;  2IBZ D;  3EWK A;  2KQY A;  1SQX J;  5GQQ C;  1URQ B;  1YIT P;  4XE5 B;  2C9L Y;  2M3B A;  3PLN A;  1B4C A;  2K8M B;  1J1D B;  3VGO A;  2QSI A;  2WSF H;  3NTN A;  3L74 G;  4I7Z C;  3A5T A;  4GGF A;  2D2C B;  1DEK A;  1S5G Z;  1DMO A;  4JPZ B;  5AW4 B;  2BAS A;  2RN0 A;  3VP8 A;  5M1B A;  1DIP A;  1Y1U A;  1SQQ E;  2KLD A;  2OTJ P;  4NDB A;  3BUM B;  4XJK A;  2FYN B;  4IFF A;  3WUT A;  5K89 A;  1SNL A;  3RK3 E;  1QV1 A;  2WOS A;  3EKH A;  1IQ5 A;  2IFN A;  1S4X A;  2N9Y B;  3BQ3 A;  1QLK A;  3IF4 A;  2ERB A;  3FGA D;  1TU3 F;  5AVT B;  2WPS A;  3ITK A;  1RQV A;  1QGK B;  1ZAC A;  2QM8 A;  1KK7 Z;  1TNX A;  1BG1 A;  1M57 D;  2OAR A;  5APT A;  4OWF A;  4ZCU A;  2LC5 A;  3RK3 D;  3JVT C;  5AVV B;  3TUY B;  3CX5 E;  1QX2 A;  2W90 A;  3HE5 B;  5KKZ B;  1MQ1 A;  3M0A A;  3A4U B;  1JMB A;  3TS5 C;  4CID A;  2E43 A;  3CCM P;  2HQ8 A;  2JT8 A;  1Q90 D;  3CWB D;  2JXL A;  3S0B A;  1KYO I;  3CZT X;  3RM1 A;  1CW5 A;  1LTB C;  3L74 J;  3P8M C;  3L35 A;  1AVS A;  1OVU A;  1OW4 A;  2R32 A;  3BFB A;  3BOW A;  3CR4 X;  1BMO A;  3M9B A;  1T2K C;  2BCC E;  2L98 A;  2BL0 C;  1DGU A;  3L71 J;  1L7Z A;  1XFV O;  4H44 B;  2ZNE A;  1ALW A;  5EL2 A;  4BY5 A;  1A4P A;  2OYH A;  4R4M A;  1MFT A;  1XFX O;  3JTD B;  1SMG A;  1VL2 A;  2NPS B;  2KGB C;  3FWL A;  4DCK A;  1KQM B;  1BOC A;  4I5J A;  4FQT A;  4O9B A;  3TNU B;  1VQ7 P;  1EL4 A;  3CMA P;  1BSH A;  3BAS A;  2CTN A;  1FC2 C;  3CLN A;  5BVZ A;  3B87 A;  1LP1 A;  2WCL A;  5AEQ A;  2OQQ A;  3KHE A;  4A4B A;  1QEX A;  2K7O A;  1EQ7 A;  3ZNI A;  1VQL P;  3RBX A;  1ZOY C;  1PUL A;  2L5Y A;  3CXH I;  1MR8 A;  1MUX A;  2OPO A;  2E76 D;  1TUZ A;  1L0L K;  3F5H A;  2ZRT A;  3H32 B;  2QPT A;  3BRV B;  1H88 A;  1KYO D;  3V4Q A;  3B88 A;  1IRJ A;  1TWO A;  1SQQ G;  2JO1 A;  1SCM B;  3HUS C;  1KK8 C;  2AXT H;  1TRF A;  1X02 A;  4D6T J;  3BUO B;  2BCA A;  4EOT A;  2NCP A;  2DW3 A;  2SPZ A;  1S5L X;  2KLE A;  2BL0 B;  1PVB A;  2M49 B;  1CDN A;  3VMY A;  1VQ8 P;  1TOP A;  1HJB A;  1HT9 A;  3D6Y A;  2IZ1 A;  2KAV A;  2B87 B;  3H1L J;  2A4J A;  3CTN A;  3DYE A;  4CLN A;  5TJH A;  5B66 H;  3OB1 B;  3H1H D;  1PK0 D;  2LXC B;  1RWY A;  1KB9 I;  4GGF C;  3P8C E;  1G1J A;  1ZMZ A;  2R3C A;  2YMY A;  2M8U A;  1KC8 Q;  1LTA C;  2E76 C;  1A02 J;  1G33 A;  2LKM A;  1HF9 A;  3NXS A;  2OS8 B;  2YIU C;  2ZYG A;  1IK7 A;  1F71 A;  3JVT B;  3C1L A;  3CXH H;  3GF3 A;  3VYI A;  1M1K Q;  2QIW A;  3EK7 A;  4GBA A;  1RHZ B;  1N86 A;  2QA4 P;  4C0L A;  3B8E B;  3MGN A;  1BE3 G;  3H1L D;  5APX A;  4IFD K;  1VF5 C;  1DD4 A;  1CM4 A;  1S36 A;  2L2E A;  2O01 H;  3VMX A;  1NHL A;  4C0K A;  3H1K J;  1KB9 H;  3L4L A;  1NH4 A;  4C0J A;  2QVA A;  4Y99 C;  3Q5P A;  1T2K D;  1NTZ K;  1NTM E;  3T97 B;  3RGU A;  2I2R E;  2PMY A;  2ZXE B;  1A75 B;  3VRR A;  1OW8 A;  3SS4 A;  1NAY A;  3UNW A;  3OA7 A;  4I2L C;  5AAN A;  1F55 A;  1JF2 A;  1DT7 B;  1LVC D;  2H2K A;  3H1H E;  5FI7 A;  3NSL A;  1OX3 A;  3HE5 A;  1NVO A;  3CCR P;  1KTM A;  1OXZ A;  3TGU D;  1RFJ A;  4I7Z B;  1NP8 A;  3GG2 A;  3RK3 C;  1NO4 A;  3H1K D;  5GTI E;  3GHG B;  1N7S B;  4HKZ H;  3BUW B;  1VQ9 P;  1URQ C;  3M91 A;  2WT7 B;  1JB0 J;  1FS0 E;  2KFH A;  2K7C A;  1PGP A;  5E79 E;  3A8R A;  2K7D A;  1VDF A;  2GTE A;  2D8N A;  3W67 A;  3A0B H;  1W9Z A;  5AER A;  5CSF A;  4M3L A;  3AE7 C;  2PSR A;  4W7Y A;  3H1J G;  2VRG A;  1CI6 A;  3N7N A;  3QWO C;  3WU2 H;  1SR6 B;  1GL2 B;  2H7H A;  1M1J C;  3M9Q A;  1NU1 D;  3FWN A;  3EG5 B;  2H88 C;  4ASW A;  3NFQ A;  1J7O A;  2L91 A;  1BR4 B;  1J55 A;  1RRO A;  2LLU A;  2ZT9 B;  2JWA A;  1IFN A;  3CWB J;  1SPY A;  2H8V A;  4I5K A;  2K9Y A;  1LP1 B;  3EFG A;  4U3F E;  4CPG A;  2OTK E;  1HH0 A;  2K61 A;  3L4F A;  2JEE A;  4WB4 A;  1NOH A;  4AYC A;  1IJ6 A;  1AQT A;  3Q5R A;  2FFD C;  1NU1 K;  4PDZ A;  2WCB A;  3RK2 B;  1QTX A;  1QV0 A;  1BDC A;  1QS7 A;  1JUO A;  3GLM A;  1QVI Z;  3OB2 B;  2IDB A;  2KZI A;  1P28 A;  1S9K E;  1GK4 A;  1AJ5 A;  1LA3 A;  1E79 H;  4XFJ A;  2OTG C;  1SQQ K;  1Y8A A;  2I7A A;  4PHJ A;  1S6C A;  3L73 J;  3AEG C;  2Q7C A;  2ZN9 A;  4RO0 A;  1KWO C;  5H2F H;  2FYU E;  2LUC A;  1VQP P;  1URQ D;  3EQ2 A;  1PP9 G;  2WSF J;  1SL7 A;  4ICB A;  1HVV A;  1FZG A;  2QEV A;  2R5B A;  5DKR A;  1OZS A;  4H13 C;  2M29 A;  4DRW A;  1IFI A;  2B88 A;  4IOI H;  2CPS A;  4NDD A;  4N1G A;  3PFV A;  3CX5 H;  3A0B E;  3ZDM A;  1RF0 C;  2QEX P;  2MA2 A;  1JTH B;  1WRK A;  2Z4E A;  1GQM A;  4YBH B;  2QE7 H;  1OWA A;  1SQX G;  2PFX A;  5D69 A;  3AAK A;  4BY4 A;  1SQB G;  4NQG A;  3DVJ A;  1KCY A;  1JSA A;  3CXH D;  1JMM A;  1G2C B;  4JBZ A;  2QRX A;  5CSI A;  1VF5 D;  5HKY A;  3CZ2 A;  2EC6 C;  2K60 A;  2KAY A;  1A75 A;  5BU8 B;  1S5G Y;  3AE9 C;  1J7Q A;  1PFI A;  1ZRT D;  3H1J E;  1KQF B;  4EIJ A;  5HL1 A;  3H4S E;  4BRY B;  1SQQ J;  1JF0 A;  1BE3 D;  2BCX A;  2RGI A;  1UUR A;  1SFC A;  1OW7 A;  5KJ7 C;  1QX5 B;  3R1P A;  1TNW A;  1S1C X;  1LTS C;  1IIO A;  1AP4 A;  2RMZ A;  1KQG B;  4Q04 A;  4PD4 E;  1LTJ B;  5CSJ A;  2JTT A;  3CD6 P;  3PRJ A;  2L50 A;  5APW A;  1SQB K;  1M46 A;  2XND H;  1JOC A;  3OJA B;  4IJ7 A;  1Y1X A;  4DUQ A;  5KJ7 A;  3BCC G;  3L72 G;  1P84 E;  1SQP K;  1XTC C;  1XA5 A;  1A02 F;  4M2Q A;  3L70 D;  3HD7 A;  3KF9 A;  3TGU G;  1K9P A;  1SQB J;  4GKG A;  2M97 A;  4PE0 A;  1F8H A;  2R5D A;  3WHT B;  4C7R A;  3EK8 A;  1KN7 A;  3Q8I A;  2CXJ A;  2P10 A;  2WT7 A;  3Q3D A;  2H43 A;  1MHO A;  3EFF K;  2VRS A;  4OKH A;  2WSC J;  1JUN A;  1HJ0 A;  1Y1A A;  1QX7 A;  1NSH A;  1ZP0 C;  4GFT A;  1TTX A;  2LXB A;  2FCE A;  1CNP A;  2PRU A;  3R1V A;  2O01 N;  3I56 P;  1AHR A;  5GTI H;  1NX1 A;  3FIA A;  1DGV A;  3S0F A;  3GOF A;  2K2F A;  2KAX A;  1FBV A;  1NCX A;  3SFD C;  1OOF A;  3PP5 A;  4RKU J;  3OHM B;  3TDZ A;  5I2L A;  1ZME C;  1PPJ D;  2IYP A;  3H32 A;  1YRT B;  2WCK A;  2MRD A;  2BNX A;  4NPE A;  3I5H C;  2JNX A;  1FJK A;  2JKV A;  3D10 A;  1SCM C;  2WCM A;  3CX5 I;  2JRF A;  1KFU S;  3HUS A;  3K5B A;  1LTJ C;  3D77 A;  3O6Q A;  2WCE A;  5HLO A;  2HF5 A;  1KFU L;  2V7Q H;  2WSS H;  1NWQ A;  3CZ1 A;  2M8R A;  4HRE E;  1N73 A;  3CWB G;  1FZE A;  2JPO A;  4PHM A;  1KYO E;  2QJY B;  2Y0E A;  1NTM D;  2YO3 A;  5CPV A;  1JFJ A;  2JR8 A;  1SYM A;  4AQI A;  1QAS A;  1D1O A;  2A06 G;  1KQM C;  1K2H A;  2BAP A;  1SQV E;  5AW0 B;  3DF0 B;  2NZ0 A;  4CFQ A;  4N6J A;  3H1J J;  3WU2 E;  1Y47 A;  1N73 C;  3VRN A;  3KZI E;  1EDK A;  3B5N A;  4CPV A;  1NUB A;  1ZW0 A;  1LTI C;  1OVV A;  4NDC A;  4H44 C;  1SCV A;  4YGD B;  2CNP A;  4PD4 D;  5CHX A;  2AEF A;  3KYQ A;  4MZL A;  2HOD B;  4YXD C;  3C9I A;  4YGC B;  2G9B A;  4HH2 A;  4WBA A;  4YPC A;  2JDI H;  1ZR2 A;  4INW A;  3L37 A;  1LWU C;  3G6E P;  1KFM A;  2LLS A;  1NKN A;  2G8Y A;  4PD4 H;  1UHH A;  1VQK P;  3EVU A;  5FI6 A;  1IJD B;  4XJK B;  2LP2 A;  1HUC A;  1FZA A;  2P1J A;  4USL A;  1CMF A;  3TF5 A;  3HTK A;  2P71 A;  3TUY C;  4AUW A;  4MRX A;  1A03 A;  1S6J A;  1XFZ O;  3O6B A;  1KV4 A;  1N7S D;  1EXI A;  1PPJ E;  1BJF A;  2HPC A;  2Q1K A;  4NPD A;  3OBV A;  2E30 A;  2FXM A;  1YRU B;  3I5F C;  1Z4H A;  1D7M A;  5HYD A;  1FI6 A;  1SP4 A;  3H1K G;  1ZXG A;  3U1A A;  3AED C;  2E75 D;  1OSA A;  2M0R A;  3CCV P;  1JTH A;  2IBZ G;  4KT0 J;  2HFE D;  3D78 A;  3GHG A;  4HYT B;  5KAI E;  1BCC G;  3Q5S A;  1H8A A;  2M3W A;  1GL2 D;  3CAB A;  1VQO P;  1N0Y A;  2JWW A;  1IFD A;  1Q81 Q;  1B7T Z;  2O3J A;  3NSI A;  4MZJ A;  3TYY A;  1QVG O;  1AJ4 A;  1WLM A;  2Q6Q A;  3A0H E;  1YQ4 C;  1J1D A;  2ZT9 D;  2RH0 A;  4UB6 H;  1FW4 A;  3ABV C;  2R2I A;  5HKZ A;  1AFO A;  3AE6 C;  2L5X B;  4MRY A;  1S26 D;  2XKM A;  3CWB E;  1TNQ A;  3AE4 C;  2WC8 A;  1J7P A;  1Y6W A;  1SL8 A;  2JC2 A;  2D2C C;  5CJ4 A;  4FQO A;  1R6P A;  3RK2 D;  2Q4U A;  3CYZ A;  1MXL C;  3H1L G;  1J1D C;  3IR9 A;  1DEE G;  2E74 C;  3V2L A;  2A06 E;  4PD4 I;  2Y4Q A;  4DZO A;  2KQ6 A;  2L2C A;  4IL6 H;  3LLE A;  2OYI C;  5CBN A;  3L71 E;  2E5Y A;  2N9B A;  3S0D A;  1NIW A;  1JY3 P;  1RH5 B;  1K96 A;  1U5I B;  1G2C A;  4RJT A;  1T8Z A;  2H8P D;  1S5L E;  1ZV8 A;  1CKK A;  2IPP A;  2L4I A;  4D1E A;  1PGQ A;  4IL6 X;  2M7N A;  2KNC A;  2OYH C;  1NTK K;  4WVZ A;  1PV3 A;  3QRX A;  2F8P A;  3SIA A;  1WRZ A;  2BE6 A;  3GK2 A;  1TN4 A;  3AE8 C;  3O2P A;  5AW7 B;  3BFA A;  3DVE A;  2KP8 A;  1QLS A;  1YUU A;  2F3Y A;  1SQV K;  2IYO A;  3JC2 2;  3BCC D;  2J5U A;  5AW6 B;  4GDO A;  4GPL B;  2M5A B;  3RL0 C;  4EI2 A;  1CDL A;  4YI9 A;  3L75 D;  1TCO B;  1L2O B;  5F6T A;  3D0Y B;  4C7N B;  1FZC C;  2Z5H A;  1L4A C;  2JP3 A;  2PAL A;  2R44 A;  2P67 A;  1M45 A;  3UIA A;  4IL1 A;  4Y99 B;  2GUS A;  4GUK A;  2O01 J;  3LCP C;  3AE3 C;  2JQ6 A;  2JT3 A;  2COL B;  1UHK A;  4A7P A;  3SWF A;  1BGY E;  2ZAE B;  1F4Q A;  1QL1 A;  2K9J A;  1FZC A;  1VF5 B;  2L4H A;  2RKL A;  1ALV A;  2WVR A;  1L4A A;  1K95 A;  4I1L A;  4UPG A;  1YBK A;  3HD7 D;  2BEZ F;  5DKN A;  2IBZ E;  1J1E B;  2QJP C;  1FOS E;  2QM7 A;  5CCG C;  4HB1 A;  2HOD A;  1L0N K;  2KDH A;  1KD1 Q;  5ER4 X;  3H1I G;  3JSV C;  1EJ3 A;  1WRL A;  1YTZ T;  2XZR A;  1WLZ A;  1U7J A;  4DJG A;  2OS8 C;  3N7H A;  2KZJ A;  1S2E A;  1C3Y A;  3A0H H;  5ER5 A;  4PV1 B;  2YKQ A;  1VQM P;  2WOR A;  3BYA A;  3B4S A;  3FX0 A;  4ORA B;  1NTZ D;  3CLQ A;  2J59 M;  4U3F G;  3IN6 A;  4U7J A;  4INX A;  2HET A;  3OGN A;  3BUN B;  4OVN F;  5JJG A;  1SFC D;  1X9V A;  3MP7 B;  3CCE P;  1X0T A;  1YTZ I;  5KAI H;  2BCC G;  3CCU P;  1S9K D;  2XNX A;  1DF0 B;  5FYX A;  1GW4 A;  4ZNC A;  3WXA A;  1NWD A;  2YXQ B;  1RE4 C;  1YR5 A;  3IAO A;  3MUD C;  1CFC A;  1IG5 A;  1K93 D;  3L72 D;  4WY4 D;  4OH8 B;  3AEE C;  4PE1 A;  2LAN A;  1EC5 A;  3HUS B;  5AW9 B;  3I5I B;  5BPJ A;  2E5T A;  2G2B A;  5DJT B;  5I2Q A;  1DJW A;  4C46 A;  4DIR A;  1DJI A;  2P70 A;  1GU5 A;  2Q9I A;  1PRW A;  1SK6 D;  1XFR A;  2AXC A;  2WWW A;  1QVF O;  2I1J A;  1M31 A;  5TNC A;  2A45 I;  2POH A;  1NU1 E;  4OV2 A;  1SL9 A;  2MAZ A;  1E8A A;  2FJY A;  1YVH A;  3SS3 A;  1M8O B;  3TNU A;  5B66 E;  1EG4 A;  1UHJ A;  2NPS C;  3I5G B;  1CFF A;  2KYC A;  1IFM A;  3JTD C;  5AVR B;  3SG3 A;  3M0D A;  3CX5 D;  3SSU A;  1RF1 C;  3V2Q A;  4L76 A;  3B5N D;  1XVJ A;  1HGV A;  1C7W A;  1IFP A;  4PCW A;  3DF0 A;  1SQP D;  4MVF A;  3WNX B;  3R72 A;  3D6Z A;  1A29 A;  4D6T D;  2FYU K;  1KOR A;  5AVW B;  3KZI H;  1JY3 N;  1N2D A;  2BKH B;  2NPS A;  5BU5 A;  2B9B A;  1LT9 A;  5APS A;  1CLB A;  1L0L D;  5AW8 B;  2HPC B;  1DEB A;  1TUJ A;  3D70 A;  1NTK D;  3FS7 A;  3MSE B;  3AE5 C;  1VQ4 P;  1JNM A;  3L74 D;  3K1E A;  1XTG B;  1YTZ C;  1FDI A;  3VB1 A;  1MV8 A;  1SQV D;  1K90 D;  3H1I E;  1LT9 C;  3HTK B;  1DJG A;  1GZL A;  2LHI A;  5KKZ C;  3AAJ A;  5CCH D;  3L75 E;  1PP9 D;  5CMZ A;  5AW2 B;  3O6Q B;  3PTZ A;  1P84 I;  2ZJS E;  2LR2 A;  3FXE A;  2KI6 D;  1YI2 P;  3L36 A;  3CR2 A;  3RLZ A;  1XO5 A;  2M1K B;  1MWN A;  2FXO A;  3IF7 A;  2KS1 B;  3R1O A;  1V1G A;  1L0N G;  4P2Y B;  1K9U A;  3MIW A;  1NTM K;  2XDJ A;  1BCC D;  1PAL A;  2DOQ A;  2K0J A;  1SLQ A;  1CMG A;  3KPE A;  1W7I B;  1RE4 A;  1EDJ A;  1TNP A;  1C07 A;  3TDI A;  2LP3 A;  1DQE A;  3BOW B;  2I1K A;  2NLN A;  5CJ0 A;  1JY2 O;  1SS1 A;  5APV A;  2CT9 A;  3B7A A;  2LVJ A;  3KEV A;  1SBJ A;  2O60 A;  5APU A;  2WCH A;  4JF7 A;  3AKB A;  2NRG A;  1DEL A;  2UWJ E;  1RTP 1;  2Q3I A;  5D3O A;  4QJ5 B;  2LLT A;  3EVR A;  2JT0 A;  3EVV A;  4I5N B;  4JWQ A;  3SG6 A;  3LL8 B;  2R3S A;  2JXC A;  1ZRT E;  2JWD A;  1UIX A;  5D7F A;  1NU1 G;  4H0L C;  1HBW A;  4F7F A;  3L73 D;  3LIE A;  2BKI B;  1SQP G;  5KLV J;  1LS8 A;  1HTL C;  1Q80 A;  1OOG A;  3H1I D;  1AVY A;  4OZD A;  3DVM A;  2BBN A;  2O1J A;  4WY4 A;  2CPB A;  2V53 A;  4N3Y B;  3E3R A;  5AVU B;  3M0D C;  2E75 B;  1DJX A;  2QJK C;  3SWK A;  5AW1 B;  1OVR A;  2OYO A;  3CZ0 A;  2W6A A;  3O4X A;  1DD3 A;  1EXR A;  3TZ1 A;  3G4S P;  3NXA A;  3V6I A;  2LV7 A;  3FWC A;  1OOH A;  3T97 A;  3MUD A;  1L0N D;  3CC4 P;  2Y1N A;  5KLI B;  1M63 B;  5HKW A;  1RE3 A;  2AUC A;  3BJH A;  1K05 A;  3RBZ A;  1IKU A;  5B5E H;  1OZH A;  2N1T D;  1L0L E;  3B86 A;  3KDP B;  2I8D A;  3GK4 X;  1EDL A;  4M2P A;  4PHK A;  1RF1 A;  2YGU A;  3B6X A;  1G1I A;  3JCU H;  2M1U A;  1K04 A;  1NTZ J;  1B1G A;  4YGE B;  3OX6 A;  5CCH A;  1GU4 A;  2K1A A;  4QJ4 B;  5APQ A;  4GOF A;  1X22 A;  2FYU G;  2WZ7 A;  1K73 Q;  4JQ0 D;  1PP9 E;  1NTK G;  1GK6 A;  3S0E A;  5E79 H;  3FXD A;  4L74 A;  1RK9 A;  1H4B A;  3CCQ P;  1UWO A;  1LT1 A;  1KFX L;  1RE3 C;  1OQP A;  1CI6 B;  2WIT A;  1PSB A;  3LK0 A;  4I5L B;  1CFD A;  3L4A A;  1ODB A;  4ETO A;  1VPC A;  2IFM A;  2GV5 A;  2YNY A;  4PV1 C;  1K8A Q;  1UUS A;  3IQO A;  3I55 P;  2KI4 C;  2LNK A;  4EDF A;  3H1H G;  1DJH A;  3DD4 A;  1RF0 A;  1FPW A;  1SVF A;  2ITA A;  1K9M Q;  1U7M A;  3L71 D;  3ICB A;  1SQP E;  1HQV A;  2P2U A;  2WSE H;  3B71 A;  4DOJ A;  4EYY Q;  2H89 C;  3HCM A;  2QJP B;  4BRY A;  1VQ5 P;  2WQY C;  3SG5 A;  4YGB B;  3USS A;  3LW5 H;  3Q1M A;  1DF0 A;  4OGQ C;  1SQQ D;  2FKW B;  1CDM A;  1KQV A;  3AEB C;  3HD7 B;  1YUT A;  1WMK A;  1YQ3 C;  1BT6 A;  2QEB A;  3IVT A;  1SQV J;  4D6T E;  1QWV A;  2KB7 P;  3BVH A;  1OW6 A;  1S5L H;  2I94 A;  2KGR A;  3BFH A;  1IWQ A;  1EDI A;  1FZC B;  4Y28 J;  2KPH A;  2PAJ A;  2CCM A;  2BE4 A;  1DVI A;  3RL0 g;  4DS7 A;  1BOD A;  2Y9Z A;  4KYN A;  4MN0 A;  3RL0 B;  5KLI C;  2FYZ A;  3BUX B;  3PLF B;  4PV1 D;  1YX7 A;  1NKZ B;  2KNE A;  3NHT A;  2P7J A;  2F3Z A;  1OOJ A;  1PL5 A;  4JD9 A;  5CCG A;  1L0L G;  2ZVO B;  4YXW H;  5AVY B;  2PVB A;  1SFC B;  2OYH B;  1WRG A;  3MZW B;  3LW5 J;  4GAO A;  2QAC A;  1X8Y A;  3H1L E;  2MLF C;  1SQX K;  1BGY J;  2SAS A;  1R5S A;  2QJK B;  3D73 A;  2LHL A;  1FE6 A;  1QVI Y;  4ZMD A;  1NTM J;  1YJW P;  5EFW B;  1BU3 A;  4PHN A;  2OTL P;  3H6P A;  2FJU B;  4WY4 B;  2JU0 A;  1QL2 A;  3VMZ A;  2JZI A;  2JPT A;  2OYI B;  1KIL D;  5G08 A;  5AW3 B;  1M39 A;  3CWG A;  2Y9Y A;  3PM2 A;  2BCC J;  1SQB D;  4P5O E;  2WSE J;  3L74 E;  2B1U A;  2A06 D;  5DJU B;  4ORB B;  1PGO A;  3KPX A;  2JOJ A;  1KK7 Y;  1QJT A;  4OR9 B;  1URQ A;  4KHX A;  2WTY A;  1PZQ A;  4CFR A;  3G3Z A;  3AE2 C;  2FCD A;  1RJV A;  1RY3 A;  4N78 D;  3BAT A;  2AEM A;  2LVV A;  2HG5 D;  2A45 G;  5PAL A;  1REC A;  5AVX B;  3B5N B;  3V5B A;  2HR3 A;  3O78 A;  1SQX E;  2Q3E A;  5KTB A;  1B8R A;  3DY9 A;  1Z2C B;  2IBZ I;  4AQR D;  3F45 A;  3VP9 A;  1N2D C;  1GGZ A;  2KIK A;  3PAT A;  4B86 A;  1BF5 A;  3S0A A;  2W6J H;  2KHN A;  1HWT C;  2KYF A;  3RZS A;  3C8V A;  1J2J B;  3KQG A;  1MUU A;  3KXD A;  1JC2 A;  3CCL P;  1BDD A;  3A2A A;  4H0L D;  1LT9 B;  1F54 A;  4JKT A;  2K3R A;  2Y5I A;  1EZV D;  3NGV A;  2YKP A;  4L9M A;  3OW2 O;  4UB8 E;  1IJ5 A;  3V2P A;  3PN7 C;  2KI7 B;  1JY2 P;  2KSJ A;  2FOT A;  1GTW A;  1MKM A;  1GGW A;  1PSR A;  2KBM A;  4XYN A;  4E68 A;  2M7L A;  2KFF A;  3P8C D;  2WND A;  2PQL A;  2LVK A;  4GNK B;  2HLO A;  3WUU A;  1DX7 A;  1LTJ A;  3H1J D;  2M9G A;  1GW3 A;  1NTM G;  3U1C A;  1IO4 A;  3CI9 A;  1RF1 B;  1NTZ E;  3OX5 A;  4GGN A;  3L70 G;  1LKJ A;  4W80 A;  5J3X A;  4Z1M H;  1OMI A;  4HRG A;  5HLV A;  2I18 A;  2K88 A;  1M56 D;  2J58 A;  1S3J A;  4LGD E;  3II6 A;  1FU1 A;  1L0L J;  1EG3 A;  3G9R A;  3V2N A;  2ZVN B;  4HRH A;  3OP0 A;  2V4H A;  4HSZ A;  3NSO A;  4RES B;  5I8N A;  1LNQ A;  1QIV A;  2FXP A;  1PPJ G;  1CM1 A;  1WDC B;  4U3F D;  1B9A A;  4F0Z B;  1XK4 C;  5I94 A;  2H61 A;  3WHU B;  2B87 A;  3HE4 B;  1M90 Q;  3UO9 A;  1KIL C;  4LC1 A;  3I5C A;  5AVQ B;  3GW6 A;  3I5H B;  1W2B O;  2PAS A;  1L0N J;  3SG7 A;  1EZV I;  2SCP A;  4N5X A;  1OMR A;  3BXK A;  3GF7 A;  1C3Z A;  2LM5 A;  1JWD A;  3EKJ A;  2MBX A;  5IBW A;  3VN0 A;  2YMK A;  3B5N C;  2Y1M A;  1IK9 A;  1KIL A;  1M7L A;  2Y0D A;  3E7K A;  3L75 J;  4UB8 H;  5KLV E;  1U5I A;  2F2O A;  3GMA A;  3SFE C;  4PE4 A;  4YRU A;  3KO0 A;  1SQX D;  1FBM A;  1TIZ A;  1IGV A;  2HQW A;  5JOL A;  1FF1 A;  1KFN A;  1CLL A;  1S3P A;  3H1H J;  1CSB A;  2N1T B;  1G8I A;  2TN4 A;  1KZU B;  1Q86 Q;  5CSN A;  1UHI A;  2Y0C A;  5GTH H;  2JTZ A;  1DTL A;  3VRO A;  3L75 G;  4U8D A;  1XFY O;  1T14 A;  4ORC B;  3FE6 A;  2ZFC A;  3PSR A;  3QH9 A;  2NCO A;  1JY3 O;  2PP6 A;  1N8R Q;  1NPQ A;  2C0W A;  1NYH A;  1L2P A;  1NTK J;  1BE3 E;  1NCY A;  4OGQ D;  3E1I A;  2LMV A;  1JCD A;  5KLV D;  2L0P A;  3M0W A;  2FYU J;  2WPV B;  1S72 P;  3PJI A;  1JEK A;  2C0X A;  1B7T Y;  1CZQ A;  1KFX S;  3S9O A;  3GK1 A;  3CC7 P;  1LTG C;  1Z56 A;  2ZN8 A;  1YHQ P;  1NTZ G;  2G3A A;  1L4A B;  1OIP A;  5K5G B;  1H89 A;  2KUB A;  2QDI A;  4C7N A;  3OAK A;  1BR1 B;  3CR5 X;  1L2O C;  1IC2 A;  2MLE C;  1QLE D;  2NXQ A;  1AUI B;  4OCI A;  1N7S A;  3PHL A;  1Q2N A;  4YI8 A;  5KAF H;  2PGD A;  3IQQ A;  3DZT A;  1YJN P;  1K9K A;  1USE A;  2ZND A;  3SS5 A;  3U59 A;  5B5E E;  1OE9 B;  2GGM A;  4R4L A;  1KB9 D;  2KSE A;  2KNC B;  4L75 A;  1QAT A;  2C9N Y;  1OFC X;  4ZCV A;  2JUL A;  4M2O A;  3DXL A;  2QEH A;  3L70 J;  2A45 H;  4NPF X;  2BEQ D;  5CCG D;  3M9H A;  1DH3 A;  1KMI Z;  4BWN A;  1YUR A;  3CPW O;  1VQ6 P;  3W68 A;  1E5W A;  2JJL A;  3WUV A;  3PAL A;  2FYU D;  3NSK A;  3IFM A;  2E74 B;  5B8I B;  1Q7Y Q;  1ZOT B;  1BCC E;  1M1J A;  2GUV A;  3S1K A;  1F4O A;  1BGY D;  1FOS F;  5APY A;  3SJS A;  1YX8 A;  1EXJ A;  1SQP J;  3AEA C;  1OMD A;  5KLV G;  2WCJ A;  2HPS A;  1BLQ A;  2M5A A;  4GIF A;  2N1T C;  4PJ0 H;  2L5G B;  5KTY A;  2WPR A;  1XFU O;  3PH0 A;  2KI4 B;  3S4R A;  1JBA A;  3RL0 D;  1NJI Q;  1T3U A;  4PAL A; 
#chains in the Genus database with same CATH homology
 2LAP A;  2HQ8 A;  2JT8 A;  5CPV A;  1JFJ A;  1SYM A;  3GK4 X;  2JXL A;  4AQI A;  3CZT X;  3RM1 A;  1QAS A;  4PE7 A;  1D1O A;  4M2P A;  4PHK A;  1IH0 A;  1KQM C;  1K2H A;  2M1U A;  1AVS A;  3DF0 B;  2NZ0 A;  1G4Y R;  4CFQ A;  1B1G A;  3VRN A;  3BOW A;  3CR4 X;  1BMO A;  4YGE B;  2L98 A;  2BL0 C;  3OX6 A;  1DGU A;  4QJ4 B;  1L7Z A;  1XFV O;  4MLW A;  2ZNE A;  4CPV A;  1NUB A;  1ALW A;  4BY5 A;  4NDC A;  3I5F B;  1SCV A;  2OTG B;  2CNP A;  4YGD B;  4JQ0 D;  1A4P A;  1N65 A;  4MZL A;  1XK4 A;  2ZRS A;  1KSO A;  1XFX O;  3JTD B;  4YGC B;  1SMG A;  2O5G A;  2G9B A;  1RK9 A;  1KSM A;  1UP5 A;  1H4B A;  1UWO A;  1WDC C;  2F2P A;  1KFX L;  2KGB C;  4DCK A;  1OQP A;  1KQM B;  1BOC A;  4I5J A;  1CLM A;  1EL4 A;  1PSB A;  3LK0 A;  2CTN A;  2LLS A;  4I5L B;  3CLN A;  1CFD A;  1UHH A;  3EVU A;  1ODB A;  5AEQ A;  4XJK B;  1NX3 A;  3KHE A;  4A4B A;  2GV5 A;  1S1E A;  2LP2 A;  2K7O A;  1UUS A;  3ZNI A;  3IQO A;  1PUL A;  2KI4 C;  1MR8 A;  1MUX A;  2LNK A;  2OPO A;  4USL A;  2KFG A;  3VRP A;  1CMF A;  1DJH A;  1XYD A;  2Q91 A;  3DD4 A;  3TUY C;  2ZRT A;  2QPT A;  1QXP A;  4MRX A;  1A03 A;  1FPW A;  1S6J A;  1XFZ O;  3O6B A;  3ICB A;  1EH2 A;  1IRJ A;  1HQV A;  1BJF A;  1SCM B;  1WY9 A;  1KK8 C;  3HCM A;  1SR6 C;  2E30 A;  1NYA A;  1TRF A;  1X02 A;  1YRU B;  1YUS A;  1VRK A;  3I5F C;  5HYD A;  3BUO B;  1JFK A;  2BCA A;  1FI6 A;  1MXE A;  3SG5 A;  2IS9 A;  2NCP A;  4YGB B;  1DF0 A;  3TDU A;  1OSA A;  2M0R A;  5I2O A;  2BL0 B;  1PVB A;  2P6B B;  2M49 B;  1CDN A;  1CDM A;  1KQV A;  1TOP A;  1HT9 A;  1YUT A;  2M3W A;  2KAV A;  2KI6 C;  2A4J A;  3CTN A;  4CLN A;  1BT6 A;  1N0Y A;  3OB1 B;  3PN7 B;  2JWW A;  1PK0 D;  1RWY A;  1B7T Z;  4GGF C;  2I94 A;  2KGR A;  2LCP A;  3NSI A;  1IWQ A;  4MZJ A;  1ZMZ A;  1C7V A;  1AJ4 A;  1WLM A;  1J1D A;  2M8U A;  2CCM A;  1K94 A;  2BE4 A;  1DVI A;  4DS7 A;  1FW4 A;  1BOD A;  2R2I A;  2Y9Z A;  5HKZ A;  1G33 A;  4MN0 A;  2L5X B;  1J1E A;  2OS8 B;  2ISD A;  3BUX B;  3PLF B;  4MRY A;  1F71 A;  1S26 D;  3JVT B;  1YX7 A;  2KOT A;  1TNQ A;  1LIN A;  2WC8 A;  2KNE A;  1J7P A;  1Y6W A;  1SL8 A;  2F3Z A;  2JC2 A;  4WQ3 A;  1OOJ A;  1ZUZ A;  4FQO A;  1R6P A;  2PVB A;  3EK7 A;  2Q4U A;  4GBA A;  1SRA A;  1MXL C;  4C0L A;  4AOM A;  1CB1 A;  1YVL A;  2QAC A;  4GAO A;  2GGZ A;  2Y4Q A;  2EGD A;  2MLF C;  2KQ6 A;  2SAS A;  4MZK A;  1CM4 A;  1S36 A;  2L2E A;  1QVI Y;  2L51 A;  2LHL A;  3LLE A;  5AFP A;  1DJZ A;  4C0K A;  1BU3 A;  4PHN A;  2FJU B;  2JU0 A;  2JZI A;  2JPT A;  4C0J A;  1NIW A;  1K96 A;  1K8U A;  5G08 A;  1M39 A;  1U5I B;  1A2X A;  2MHH A;  3CWG A;  1CKK A;  2Y9Y A;  3ZWH A;  2L4I A;  4D1E A;  2I2R E;  2PMY A;  4P5O E;  1A75 B;  3VRR A;  2M7N A;  2EHB A;  5DKQ A;  3QRX A;  2F8P A;  3SIA A;  1WRZ A;  2BE6 A;  3GK2 A;  1TN4 A;  2B1U A;  4ORB B;  3O2P A;  1AK8 A;  5AAN A;  1F55 A;  1JF2 A;  3KPX A;  3DVE A;  1DT7 B;  1CDP A;  1LVC D;  1QLS A;  1YUU A;  2H2K A;  1KK7 Y;  2JOJ A;  1QJT A;  1GJY A;  2F3Y A;  4OR9 B;  2ZKM X;  3NSL A;  4GPL B;  1CDL A;  4CFR A;  1ZFS A;  2K2A A;  4YI9 A;  2AMI A;  1TCO B;  1L2O B;  1RFJ A;  2FCD A;  1NP8 A;  3D0Y B;  4N1F A;  5F6T A;  1RJV A;  2LVV A;  2PAL A;  3BUW B;  1M45 A;  2K7B A;  5PAL A;  1REC A;  4IL1 A;  2KFH A;  2K7C A;  3A8R A;  2WCF A;  4QJ5 B;  2K7D A;  1V1F A;  4GUK A;  3LCP C;  3O78 A;  2JQ6 A;  2JT3 A;  2D8N A;  2COL B;  1B8R A;  1UHK A;  5AER A;  5CSF A;  4FTG A;  3F45 A;  1F4Q A;  2KBI A;  2L4H A;  1ALV A;  1GGZ A;  2PSR A;  1K95 A;  2VRG A;  3PAT A;  4UPG A;  1BF5 A;  5DKN A;  2KHN A;  1LXF C;  1SR6 B;  1KK8 B;  2KYF A;  2LE9 B;  2KDH A;  1J7O A;  3I5G C;  1JC2 A;  1BR4 B;  5ER4 X;  1B8L A;  1J55 A;  1RRO A;  2MJW B;  5KSZ A;  2LLU A;  1EJ3 A;  1WRL A;  1WLZ A;  4MSP A;  1CFP A;  2OS8 C;  1SPY A;  4I5K A;  1F54 A;  3C1V A;  5ER5 A;  2Y5I A;  3DVK A;  1UHN A;  3PM8 A;  2K61 A;  1LA0 A;  1R2U A;  1B47 A;  4MEW A;  4L9M A;  2BCB A;  2WOR A;  1OMV A;  3BYA A;  4ORA B;  1IJ6 A;  2LMU A;  1IJ5 A;  4WRI A;  4PDZ A;  2WCB A;  3PN7 C;  3VRQ A;  1QTX A;  2HET A;  1QV0 A;  3BUN B;  2AAO A;  4OVN F;  5JJG A;  4YGA A;  1QS7 A;  1NCZ A;  1JUO A;  2FOT A;  4MBE A;  1GGW A;  1PSR A;  1QVI Z;  2EC6 B;  1DF0 B;  2KBM A;  3OB2 B;  4XYN A;  5FYX A;  2M7L A;  4E68 A;  2KFF A;  4A4C A;  3I5I C;  3WXA A;  1NWD A;  2LUX A;  1PVA A;  1AJ5 A;  1LA3 A;  1YR5 A;  2OTG C;  2I7A A;  2WND A;  2LVK A;  4GNK B;  1IG5 A;  1K93 D;  1S6C A;  4PHJ A;  1CFC A;  2M9G A;  2JNF A;  2BEC A;  1MF8 B;  4PE1 A;  2LAN A;  2ZN9 A;  1KWO C;  3I5I B;  3OX5 A;  5BPJ A;  2LUC A;  4GGN A;  2BBM A;  1LKJ A;  2G2B A;  5J3X A;  5I2Q A;  3O4Y A;  4HRG A;  1SL7 A;  4TNC A;  5HLV A;  2I18 A;  1DJW A;  4ICB A;  4DIR A;  1DJI A;  5DKR A;  1OZS A;  1EG3 A;  2H61 C;  1PRW A;  1W7J B;  1SK6 D;  2M29 A;  3CGA A;  1IQ3 A;  4DRW A;  1M31 A;  2F33 A;  5TNC A;  4HRH A;  3OP0 A;  4NDD A;  3TS5 B;  4OV2 A;  4N1G A;  1SL9 A;  2MAZ A;  3PFV A;  4HSZ A;  3NSO A;  1E8A A;  4R1E A;  5I8N A;  1YVH A;  3LK1 A;  2MA2 A;  1QIV A;  1WRK A;  1CM1 A;  1EG4 A;  1WDC B;  1UHJ A;  3I5G B;  1B9A A;  1GQM A;  2KYC A;  1CFF A;  4YBH B;  1XK4 C;  4F0Z B;  3JTD C;  2H61 A;  3SG3 A;  3WHU B;  1OZO A;  1KWO B;  3AKA A;  1NX2 A;  5D69 A;  5KU1 A;  2LVI A;  3AAK A;  4BY4 A;  2CBL A;  1XVJ A;  1C7W A;  4NQG A;  3DVJ A;  1KCY A;  3I5H B;  2PAS A;  4PCW A;  3DF0 A;  4MVF A;  3SG7 A;  3WNX B;  1JSA A;  1A29 A;  2SCP A;  1OMR A;  4N5X A;  3BXK A;  5CSI A;  5HKY A;  2LM5 A;  5AXI A;  1N2D A;  1XFW O;  2BKH B;  2EC6 C;  1JWD A;  3EKJ A;  2KAY A;  1A75 A;  2MBX A;  1Y0V H;  5IBW A;  1CLB A;  1QIW A;  1S5G Y;  1J7Q A;  1SY9 A;  1SKT A;  2Y1M A;  3FS7 A;  3MSE B;  3H4S E;  3SG4 A;  1TCF A;  1U5I A;  2F2O A;  1JF0 A;  1NX0 A;  1SW8 A;  4PE4 A;  4YRU A;  2BCX A;  3KO0 A;  1CTR A;  1TIZ A;  2RGI A;  1IGV A;  2HQW A;  1UUR A;  5JOL A;  1FF1 A;  1YTZ C;  1FI5 A;  1H8B A;  1CLL A;  1S3P A;  1K90 D;  1S6I A;  1QX5 B;  1DJG A;  1F70 A;  2LHI A;  2LMT A;  4AQJ A;  3AAJ A;  1TNW A;  1G8I A;  1B8C A;  2TN4 A;  1AP4 A;  3SG2 A;  4Q04 A;  1J7R A;  5CSN A;  5CSJ A;  2JTT A;  1UHI A;  2JTZ A;  2L50 A;  1DTL A;  3VRO A;  4U8D A;  1M46 A;  1XFY O;  3FWB A;  3EK4 A;  4ORC B;  1Y1X A;  2ZFD A;  3D0Y A;  3HX4 A;  3K21 A;  2KI6 D;  3PSR A;  4DUQ A;  2NCO A;  3CR2 A;  3RLZ A;  1NPQ A;  2KSP A;  1XO5 A;  2M1K B;  3SIB A;  1MWN A;  3IF7 A;  1XA5 A;  1DJY A;  1NCY A;  2E6W A;  4WQ2 A;  2LMV A;  1V1G A;  3CS1 A;  4M2Q A;  2L0P A;  3M0W A;  4P2Y B;  3KF9 A;  1K9U A;  1K9P A;  4QJ3 B;  1PAL A;  2DOQ A;  2K0J A;  2M97 A;  1B7T Y;  4PE0 A;  1CMG A;  2KQY A;  1KFX S;  1W7I B;  5GQQ C;  3GK1 A;  1F8H A;  3WHT B;  1TNP A;  1C07 A;  2ZN8 A;  3TDI A;  2LP3 A;  3EK8 A;  3BOW B;  1B4C A;  2K8M B;  2NLN A;  3VGO A;  1BR1 B;  2CT9 A;  1L2O C;  2LVJ A;  3CR5 X;  3KEV A;  1SBJ A;  2MLE C;  2O60 A;  2NXQ A;  1AUI B;  4OCI A;  4GGF A;  2CXJ A;  4YI8 A;  3AKB A;  1S5G Z;  1DMO A;  1RTP 1;  2LLT A;  3EVR A;  1MHO A;  2JT0 A;  3EVV A;  3IQQ A;  4I5N B;  4JWQ A;  4JPZ B;  3LL8 B;  3SG6 A;  2JXC A;  1K9K A;  4OKH A;  2ZND A;  1OE9 B;  1Y1A A;  2GGM A;  5D7F A;  1QX7 A;  1NSH A;  1Y1U A;  2BKI B;  1QAT A;  4GFT A;  1TTX A;  2FCE A;  4ZCV A;  2PRU A;  1CNP A;  1OFC X;  2JUL A;  1Q80 A;  4M2O A;  4NDB A;  1AHR A;  3BUM B;  1NX1 A;  3FIA A;  1DGV A;  4XJK A;  3GOF A;  2K2F A;  5K89 A;  2KAX A;  1FBV A;  1NCX A;  3DVM A;  2BBN A;  1SNL A;  1QV1 A;  2WOS A;  1YUR A;  1IQ5 A;  3EKH A;  2V53 A;  3OHM B;  3TDZ A;  3E3R A;  5I2L A;  1DJX A;  3BQ3 A;  1YRT B;  1QLK A;  3PAL A;  2MRD A;  3NSK A;  3I5H C;  2JNX A;  1EXR A;  3TZ1 A;  5B8I B;  3NXA A;  1ZOT B;  3D10 A;  1SCM C;  2JRF A;  1KFU S;  2LV7 A;  3FWC A;  1ZAC A;  1F4O A;  1KK7 Z;  1TNX A;  2WCE A;  3SJS A;  1YX8 A;  5HLO A;  1BG1 A;  2HF5 A;  4ZCU A;  1OMD A;  2LC5 A;  1KFU L;  3JVT C;  3TUY B;  2HPS A;  1BLQ A;  1QX2 A;  2Y1N A;  1M63 B;  5HKW A;  1MQ1 A;  4HRE E;  5KTY A;  2AUC A;  1XFU O;  2KI4 B;  3A4U B;  1IKU A;  1JBA A;  4PHM A;  3TS5 C;  4CID A;  4ETO A;  4PAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...