1RK9A

Solution structure of human alpha-parvalbumin (minimized average structure)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Parvalbumin alpha
publication title Paramagnetism-based refinement strategy for the solution structure of human alpha-parvalbumin
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rk9A00
2EC6B 3BUOB 4YGAA 3CZTX 2H61A 2AMIA 2KAXA 3JVTC 3TDIA 2OS8C 3PM8A 1N0YA 1SW8A 3F45A 2JULA 1TIZA 1IWQA 1N65A 4I5KA 2MA2A 2L4HA 1QVIZ 1YRTB 4YGEB 4BY4A 2BCXA 1M31A 2L4IA 1DGVA 4XYNA 1QATA 1JBAA 2K7DA 1SL7A 2PALA 2SASA 4PHNA 1DTLA 1NX0A 1CFCA 4PE1A 4HRGA 1KFUS 1S5GZ 1TNPA 3TDZA 5B8IB 5JJGA 2IS9A 3GK1A 3TUYC 3VROA 3DD4A 1FI6A 1NP8A 2OPOA 3IF7A 2GGMA 2F33A 2BBMA 5J3XA 1A4PA 1S26D 1U5IA 4MRYA 4NDBA 2KFFA 1PVAA 1SL9A 2I18A 3JTDB 5ER4X 1KFXL 4QJ5B 1XFWO 1OZSA 2EGDA 3SJSA 4AQIA 5I2QA 2JQ6A 2F3YA 2KQ6A 1J7OA 1ODBA 1CFPA 1AJ4A 3SG4A 4YBHB 2M9GA 2DOQA 3DF0A 5IBWA 1CLMA 3ZNIA 1LVCD 1UHKA 1YUSA 1MXLC 1RROA 2WC8A 2RGIA 1YR5A 2LCPA 1PK0D 4JQ0D 4A4BA 1UURA 3BXKA 5HKWA 2KAVA 3NSOA 2LLSA 1CM4A 2L98A 5DKQA 1QVIY 3GK2A 3PLFB 1QTXA 4MEWA 3I5FC 3SG3A 1OZOA 1DMOA 2BE6A 1AP4A 2L2EA 4DUQA 3I5HC 4GGNA 1BLQA 1JWDA 1FBVA 4HRHA 1AK8A 1PSRA 1QV0A 2HQWA 2KNEA 1LA0A 2KBMA 2LHLA 3SIAA 5AANA 1BU3A 1L2OB 5I8NA 1CMGA 4FTGA 3FWBA 2LE9B 2B1UA 1G33A 1KK7Y 4ICBA 4P5OE 2JTZA 1CDNA 1Y1XA 3EVUA 1TNQA 1CB1A 2LUXA 1X02A 3KEVA 3O2PA 1G8IA 3PFVA 5PALA 1OOJA 4C0LA 1RTP1 1EL4A 1QX2A 3O4YA 3PN7B 4GGFA 4HSZA 4U8DA 1BG1A 2WCEA 3BQ3A 2JOJA 4QJ3B 4MSPA 4PCWA 2Q91A 3KO0A 4OV2A 1PULA 1Y1UA 2WORA 4USLA 1K9KA 4OVNF 1JF0A 2PASA 2JU0A 2I7AA 1F54A 3NXAA 3A8RA 3LL8B 1DJGA 1XVJA 1HQVA 2KSPA 1GGWA 4MN0A 2WOSA 1BJFA 4YRUA 4PHMA 1AUIB 1U5IB 2HQ8A 1NPQA 3VRRA 1DJYA 3NSKA 1MXEA 3NSIA 1XK4C 5AFPA 2VRGA 1S6JA 1UHNA 4GNKB 3LK0A 2FJUB 4OKHA 1DJHA 3EK7A 2K8MB 2QPTA 2WCBA 4GAOA 4AOMA 1QASA 1J1EA 2KI4B 3I5IB 3VGOA 1NWDA 2BCBA 3PATA 3PSRA 3VRQA 3CR4X 4I5JA 2LM5A 1D1OA 1DF0B 1GGZA 4WRIA 1XFZO 3CR2A 1CDPA 2BECA 2FCDA 2P6BB 4AQJA 1MR8A 1B8LA 2NLNA 4ORCB 4I5LB 3GOFA 4FQOA 2MBXA 1A2XA 2JTTA 3HX4A 2MLEC 4M2PA 2KDHA 4PHKA 3O78A 2M29A 1BR1B 1SYMA 1XFYO 1CFDA 1KSOA 3TS5C 1K8UA 4YI9A 3I5FB 1ZMZA 5JOLA 1FF1A 2WCFA 1KSMA 2NCPA 4PE0A 1SPYA 3KPXA 2M1KB 2ZN8A 4HREE 1EJ3A 2LLUA 1IGVA 2HETA 1IKUA 2K2FA 1YUTA 1UHIA 2CCMA 2O5GA 3DVKA 4A4CA 2HF5A 2Y1NA 1K94A 1MF8B 1XO5A 3NSLA 2M0RA 3WHTB 1QX5B 4M2OA 1RJVA 3EVVA 2JNXA 2OTGC 2KFGA 5KSZA 4N1FA 1ZACA 1A03A 2BKIB 1KCYA 5G08A 2AUCA 1S3PA 1TCOB 2L0PA 2MJWB 3I5GC 2GV5A 2FCEA 4MZJA 3OX5A 1BOCA 1RECA 1SCVA 1TOPA 2K7CA 1IQ3A 1WRZA 2BE4A 1SR6C 1BT6A 1KFUL 5FYXA 1H4BA 1S6IA 1C07A 4CFRA 1CLBA 2V53A 3CTNA 2M8UA 1QIWA 3ICBA 3OX6A 2ZFDA 1TN4A 3RM1A 1QS7A 1F70A 2CBLA 2KQYA 2Y4QA 1NSHA 4JPZB 3D0YA 3SG5A 1F55A 2CTNA 1DF0A 3BYAA 1YVHA 1NCXA 4N5XA 4PDZA 1B47A 4ZCVA 1QLSA 1CNPA 1JSAA 3BUWB 2AAOA 5CSNA 2NXQA 2K7OA 1IJ6A 2EC6C 4NQGA 2LAPA 1M39A 3OB1B 5AEQA 1ZUZA 2PVBA 3AAKA 1J7QA 3E3RA 1YTZC 1SNLA 1S5GY 1E8AA 4GBAA 2LHIA 4YI8A 5DKRA 1KWOB 1NX1A 1DJXA 4R1EA 3CGAA 1DJZA 2BL0B 5KTYA 4NDDA 2ZN9A 1SBJA 1KK8B 1K95A 1Y1AA 3A4UB 3ZWHA 1LXFC 1JF2A 1F4OA 1M46A 2KFHA 4L9MA 1ZFSA 1A75A 1SCMB 4NDCA 1FPWA 2D8NA 1BF5A 1A29A 2L50A 2Q4UA 3JVTB 4GUKA 4XJKA 4MVFA 2OS8B 4DIRA 2QACA 1QLKA 4C0KA 2LANA 3OB2B 1BMOA 2K61A 2A4JA 3KHEA 1RK9A 4PE4A 1Y6WA 3D10A 4DCKA 2JXCA 3H4SE 5HKZA 2JRFA 4N1GA 3WXAA 3SIBA 2F2OA 1NX3A 1Y0VH 2COLB 1IJ5A 5DKNA 1DVIA 2LLTA 1B7TZ 2MAZA 4YGDB 3TS5B 3LK1A 1QXPA 1QJTA 2MRDA 1W7JB 2F8PA 1SY9A 2G2BA 4PALA 4GFTA 4C0JA 3M0WA 1B4CA 1AHRA 1EG3A 2HPSA 4Q04A 3SG7A 5CPVA 4ETOA 3TUYB 4PHJA 1TNXA 2KYFA 1ZOTB 3QRXA 3LLEA 1MUXA 1MWNA 1SRAA 1J7PA 1TCFA 1J7RA 1R6PA 1QV1A 2KI6D 1K2HA 3BUXB 1XK4A 1F71A 1EH2A 1K93D 1LINA 3VRNA 2G9BA 2JT8A 1IQ5A 4CPVA 1C7WA 1BR4B 2JT0A 3D0YB 2E6WA 5CSIA 4CLNA 2LNKA 2BKHB 2JNFA 1WLZA 1JFKA 1UUSA 2JXLA 2NCOA 1YX8A 1QX7A 3CR5X 2ZRSA 3FWCA 1M63B 1F4QA 3DVMA 2JPTA 1OMVA 2LP2A 1B8RA 3OHMB 4E68A 3DVJA 3AKBA 3MSEB 2M7NA 1SMGA 1L2OC 1IH0A 2H61C 1GJYA 1WLMA 2M1UA 2LVKA 2MLFC 4D1EA 2M97A 4DRWA 1VRKA 2F2PA 1UP5A 3BOWA 1K96A 1TTXA 2F3ZA 1LA3A 2SCPA 1M45A 1NX2A 2O60A 1B7TY 4YGBB 2M3WA 3EK4A 4ORAB 3I5HB 4OR9B 1PRWA 3AAJA 3BUMB 4MLWA 1YURA 5KU1A 1S1EA 3PN7C 1CKKA 2EHBA 3PALA 1XFUO 1A75B 2KBIA 2CXJA 1DGUA 1YUUA 1PSBA 5D69A 1J55A 5TNCA 2WNDA 1UHJA 1UWOA 4XJKB 3LCPC 1KFXS 2JC2A 1MQ1A 2LMTA 3TDUA 1V1GA 2KHNA 1EXRA 3EK8A 1RWYA 3C1VA 1JC2A 2K7BA 4M2QA 1JUOA 4CIDA 1YX7A 4MZKA 3IQQA 5HKYA 1WDCC 1OMRA 4MBEA 2KGBC 1HT9A 2LP3A 1KQMC 1XYDA 3WNXB 2LVVA 3K21A 2ZNDA 1OE9B 5F6TA 1XFXO 1G4YR 1CDMA 1KK7Z 3AKAA 4P2YB 3FIAA 1YVLA 5AERA 3EKHA 1CMFA 3VRPA 5HLVA 4CFQA 2M49B 2KI4C 3I5IC 1ALVA 5I2OA 2Y5IA 2LC5A 2ISDA 1UHHA 2JT3A 4QJ4B 3CWGA 1FW4A 4WQ2A 3KF9A 4GPLB 3BUNB 2PSRA 5HLOA 5AXIA 3HCMA 2JWWA 2LVIA 2L5XB 1JFJA 1ALWA 4ZCUA 1RFJA 5I2LA 1PALA 1S6CA 2H2KA 2NZ0A 5D7FA 5ER5A 3RLZA 1TRFA 1S36A 4MZLA 3IQOA 1QIVA 2CT9A 4DS7A 2BCAA 3OP0A 1CM1A 5BPJA 1DT7B 1WRLA 1MHOA 3SG2A 2LMUA 1NCYA 1CTRA 3EVRA 1KQVA 1CLLA 5GQQC 3GK4X 4MRXA 2K2AA 2MHHA 1WRKA 4F0ZB 3DVEA 3BOWB 1XFVO 1L7ZA 1AVSA 2FOTA 2ZKMX 2E30A 2GGZA 4IL1A 3O6BA 1SL8A 4YGCB 1NYAA 1W7IB 4PE7A 1NIWA 2Y1MA 1NUBA 1DJIA 1EG4A 2I94A 3EKJA 2TN4A 3FS7A 4GGFC 3SG6A 4JWQA 2PRUA 3JTDC 3CLNA 1J1DA 2L51A 1WY9A 2PMYA 5HYDA 2ZNEA 1OSAA 3CS1A 4ORBB 1IRJA 1K9UA 4OCIA 3WHUB 1GQMA 1SK6D 1V1FA 2I2RE 1F8HA 2KAYA 4I5NB 2ZRTA 1DJWA 5CSJA 2BBNA 1H8BA 2OTGB 4TNCA 2R2IA 4BY5A 5CSFA 3I5GB 2CNPA 1SKTA 5K89A 1K90D 4WQ3A 1WDCB 1SR6B 1B9AA 1KQMB 2K0JA 4UPGA 3TZ1A 2LUCA 1YRUB 1AJ5A 2KYCA 2KI6C 2LV7A 1B8CA 1B1GA 1IG5A 1OMDA 1LKJA 1Q80A 1K9PA 1KWOC 1BODA 3DF0B 2KGRA 2M7LA 2BL0C 1CFFA 2LVJA 1N2DA 1CDLA 1NCZA 1KK8C 2KOTA 2JZIA 2LMVA 1C7VA 1TNWA 1XA5A 1FI5A 1OQPA 1R2UA 1SCMC 1PVBA
chains in the Genus database with same CATH superfamily
2EC6B 3BUOB 4YGAA 3CZTX 2H61A 2AMIA 2KAXA 3JVTC 3TDIA 2OS8C 3PM8A 3B87A 1N0YA 1SW8A 3F45A 2JULA 1TIZA 1IWQA 3UO9A 4F7FA 1N65A 4I5KA 2MA2A 3B88A 2L4HA 1QVIZ 1YRTB 4YGEB 4BY4A 2BCXA 4PT1A 1M31A 2L4IA 1DGVA 4XYNA 1QATA 1JBAA 2K7DA 1SL7A 2PALA 2SASA 4PHNA 1DTLA 1QWVA 1NX0A 5HL1A 1CFCA 4PE1A 4HRGA 1KFUS 1S5GZ 1TNPA 3TDZA 5B8IB 5JJGA 2IS9A 3GK1A 3TUYC 3VROA 3DD4A 3S0FA 1FI6A 1NP8A 2OPOA 3IF7A 2GGMA 2F33A 1DC1A 2BBMA 5J3XA 1A4PA 1S26D 1U5IA 4MRYA 4NDBA 2KFFA 1PVAA 1SL9A 2I18A 3JTDB 5ER4X 1KFXL 4QJ5B 1XFWO 1OZSA 2EGDA 3SJSA 3BFBA 4AQIA 3NHIA 5I2QA 2JQ6A 2F3YA 2KQ6A 1J7OA 1ODBA 1CFPA 1AJ4A 1C3YA 3SG4A 4YBHB 2M9GA 2DOQA 3DF0A 5IBWA 1CLMA 3ZNIA 1LVCD 1UHKA 1YUSA 1MXLC 1RROA 2WC8A 2RGIA 1YR5A 2LCPA 2WC6A 3DYEA 2L5YA 1PK0D 4JQ0D 4A4BA 1GM0A 1UURA 3BXKA 5HKWA 2KAVA 3NSOA 2LLSA 1CM4A 2L98A 5DKQA 1QVIY 3GK2A 3PLFB 1QTXA 4MEWA 3I5FC 3SG3A 1OZOA 1DMOA 2BE6A 1AP4A 2L2EA 4DUQA 3I5HC 4GGNA 1BLQA 3B6XA 1JWDA 1FBVA 4HRHA 1AK8A 1PSRA 1QV0A 2HQWA 1XFRA 1LA0A 2KNEA 2KBMA 2LHLA 5D3OA 3SIAA 5AANA 1BU3A 1L2OB 5I8NA 1CMGA 4FTGA 3BFAA 3FWBA 2LE9B 1G33A 1KK7Y 2B1UA 4ICBA 4P5OE 1Z4HA 2JTZA 3FE8A 1CDNA 1Y1XA 3EVUA 1TNQA 4JKTA 1CB1A 2LUXA 1X02A 3KEVA 3O2PA 1G8IA 3PFVA 5PALA 1C3ZA 1OOJA 4C0LA 1RTP1 1EL4A 1QX2A 4KYNA 3O4YA 3PN7B 4GGFA 4HSZA 4U8DA 1BG1A 1SSEB 2WCEA 3S0AA 5FI7A 3BQ3A 3D73A 2JOJA 4QJ3B 4MSPA 2WCJA 2Q91A 3NGVA 4PCWA 3KO0A 4OV2A 1PULA 1Y1UA 2WORA 3EG5B 4USLA 1K9KA 4OVNF 1JF0A 2PASA 2JU0A 2I7AA 1F54A 3CZ2A 2YGUA 1LS8A 3NXAA 3A8RA 3LL8B 1DJGA 1XVJA 1HQVA 2KSPA 1GGWA 4MN0A 2WOSA 1BJFA 4YRUA 4PHMA 1AUIB 1U5IB 2HQ8A 1NPQA 3VRRA 1DJYA 3NSKA 1MXEA 3NSIA 1XK4C 5AFPA 3OBVA 2VRGA 1S6JA 1UHNA 4GNKB 3R1PA 3LK0A 2FJUB 4OKHA 1DJHA 3EK7A 2K8MB 2QPTA 2WCBA 4GAOA 4AOMA 1QASA 1J1EA 2KI4B 3I5IB 3VGOA 3BJHA 1NWDA 2BCBA 2QEHA 3PATA 3PSRA 3D78A 3VRQA 3CR4X 4I5JA 2KLEA 2LM5A 3L4AA 1D1OA 4INWA 1DF0B 1GGZA 4WRIA 1XFZO 3CR2A 1CDPA 2BECA 2FCDA 2P6BB 4INXA 1MR8A 1B8LA 3SS5A 4AQJA 2NLNA 4ORCB 4I5LB 3GOFA 1W9ZA 4FQOA 2MBXA 1A2XA 2JTTA 3HX4A 2MLEC 4M2PA 2KDHA 4PHKA 3O78A 2M29A 1BR1B 1SYMA 1XFYO 1CFDA 3CABA 1KSOA 3TS5C 3D74A 1K8UA 4YI9A 3I5FB 1ZMZA 5JOLA 1FF1A 2WCFA 1KSMA 2NCPA 4PE0A 1SPYA 2WCLA 1OOFA 3KPXA 2M1KB 2ZN8A 4HREE 1EJ3A 2LLUA 1IGVA 2HETA 1IKUA 2K2FA 1P28A 3FE6A 1YUTA 1UHIA 2CCMA 2O5GA 3DVKA 4A4CA 2HF5A 2Y1NA 1K94A 1MF8B 1XO5A 3NSLA 2M0RA 3WHTB 1QX5B 3O4XA 4M2OA 1RJVA 3EVVA 2JNXA 2OTGC 3L4LA 2KFGA 5KSZA 4N1FA 1ZACA 1A03A 3FE9A 5FI2A 2BKIB 1KCYA 5G08A 3R1VA 2AUCA 1S3PA 1TCOB 2JPOA 2L0PA 2MJWB 3I5GC 2GV5A 2FCEA 4MZJA 3OX5A 1BOCA 1RECA 1SCVA 1TOPA 2K7CA 5FI6A 1IQ3A 1WRZA 2BE4A 1SR6C 2PQLA 1BT6A 1KFUL 5FYXA 1H4BA 2WCKA 2WCHA 1S6IA 1C07A 4CFRA 1CLBA 2V53A 3CTNA 2M8UA 2P71A 1QIWA 3ICBA 3OX6A 2ZFDA 1TN4A 3RM1A 1QS7A 1F70A 2CBLA 2KQYA 2Y4QA 1NSHA 4JPZB 3D0YA 3SG5A 1F55A 2CTNA 1DF0A 2KPHA 1YVHA 1ORGA 3BYAA 1NCXA 4N5XA 4PDZA 1B47A 4ZCVA 1QLSA 1CNPA 1JSAA 3BUWB 1OOIX 2AAOA 5CSNA 2NXQA 2K7OA 1IJ6A 2EC6C 4NQGA 2LAPA 1M39A 3OB1B 5AEQA 1ZUZA 2PVBA 3AAKA 1OOGA 1J7QA 3E3RA 1YTZC 1SNLA 4IJ7A 1S5GY 1E8AA 4GBAA 2LHIA 4YI8A 5DKRA 1KWOB 1NX1A 1DJXA 4R1EA 3SS3A 3CGAA 1DJZA 2BL0B 3S0BA 5KTYA 4NDDA 2ZN9A 2H8VA 1SBJA 1KK8B 5DICA 3RZSA 1K95A 1Y1AA 3A4UB 3ZWHA 1LXFC 1JF2A 1F4OA 1M46A 2KFHA 4L9MA 1ZFSA 3D77A 1A75A 1SCMB 4NDCA 1OW4A 3IVTA 1FPWA 2D8NA 1BF5A 1A29A 2L50A 2Q4UA 3JVTB 4GUKA 4XJKA 4MVFA 2OS8B 4DIRA 2QACA 1QLKA 4C0KA 2LANA 3OB2B 1BMOA 2K61A 2A4JA 3KHEA 1RK9A 4PE4A 3SS4A 1Y6WA 3D10A 4DCKA 2JXCA 3H4SE 3CYZA 2JRFA 4N1GA 5HKZA 2BAPA 3SIBA 2F2OA 3WXAA 1NX3A 2WC5A 1Y0VH 2COLB 1IJ5A 5DKNA 1DVIA 3NHTA 1DELA 2LLTA 1B7TZ 2MAZA 4YGDB 3TS5B 3LK1A 1QXPA 1QJTA 3CDNA 2MRDA 1W7JB 2F8PA 1SY9A 2G2BA 4PALA 4GFTA 4C0JA 3M0WA 1B4CA 1AHRA 1TWOA 1EG3A 2P70A 2HPSA 4Q04A 3SG7A 5CPVA 4ETOA 2ERBA 3TUYB 2BNXA 4PHJA 1T14A 1TNXA 2KYFA 1TUJA 1ZOTB 1OOHA 3QRXA 3LLEA 1MUXA 1MWNA 1SRAA 1J7PA 1TCFA 1J7RA 1R6PA 1QV1A 2KI6D 1K2HA 5I94A 3BUXB 1XK4A 1Z2CB 1F71A 1EH2A 1K93D 1LINA 3VRNA 2G9BA 4FQTA 2JT8A 1IQ5A 4CPVA 1C7WA 1BR4B 2JT0A 3D0YB 2E6WA 5CSIA 3DY9A 4CLNA 2LNKA 2BKHB 2JNFA 2WCMA 1IIOA 1WLZA 1JFKA 1UUSA 2JXLA 2NCOA 1YX8A 1QX7A 3K1EA 3CR5X 2ZRSA 3FWCA 1M63B 1F4QA 2GTEA 3DVMA 2JPTA 1OMVA 2LP2A 1B8RA 3OHMB 4E68A 3DVJA 3AKBA 3MSEB 3N7HA 2M7NA 1SMGA 1L2OC 1IH0A 2H61C 1GJYA 1WLMA 2M1UA 2LVKA 2MLFC 3Q8IA 4D1EA 2M97A 4DRWA 1VRKA 3D75A 3PM2A 2F2PA 1UP5A 3BOWA 1K96A 1TTXA 2F3ZA 1LA3A 2SCPA 1M45A 1NX2A 2O60A 1B7TY 4YGBB 2M3WA 3EK4A 4ORAB 3I5HB 4OR9B 1PRWA 3AAJA 3R1OA 3BUMB 4MLWA 1YURA 5KU1A 1S1EA 3PN7C 1CKKA 2EHBA 3PALA 1XFUO 1A75B 1DEKA 2KBIA 2CXJA 1DGUA 1YUUA 1PSBA 2L2CA 5D69A 1J55A 5TNCA 2WNDA 1UHJA 1UWOA 4XJKB 3LCPC 1KFXS 2JC2A 1MQ1A 3UNWA 2LMTA 3TDUA 1V1GA 2KHNA 1EXRA 3EK8A 1RWYA 3C1VA 1JC2A 2K7BA 4M2QA 1JUOA 4CIDA 1YX7A 3L47A 4MZKA 3IQQA 5HKYA 1WDCC 1OMRA 3PJIA 2KGBC 4MBEA 1HT9A 2LP3A 1KQMC 1XYDA 3WNXB 2LVVA 3K21A 2ZNDA 1OE9B 5F6TA 1XFXO 1G4YR 1CDMA 1KK7Z 3AKAA 4P2YB 3FIAA 1YVLA 5AERA 3EKHA 1CMFA 3VRPA 2FJYA 5HLVA 3D76A 4CFQA 2M49B 1TUZA 2KI4C 3I5IC 1ALVA 5I2OA 2K60A 2Y5IA 3B86A 2LC5A 2ISDA 2QEBA 1UHHA 2JT3A 4QJ4B 3CWGA 1FW4A 4WQ2A 3KF9A 4GPLB 3BUNB 2PSRA 4OZDA 5HLOA 5AXIA 3HCMA 2JWWA 2LVIA 2L5XB 1JFJA 1ALWA 4ZCUA 1RFJA 5I2LA 1PALA 1S6CA 2H2KA 2NZ0A 5D7FA 5ER5A 3RLZA 1TRFA 1S36A 4MZLA 3IQOA 1QIVA 2CT9A 4DS7A 2BCAA 3OP0A 1CM1A 5BPJA 1DT7B 1WRLA 1MHOA 3SG2A 2LMUA 1NCYA 1CTRA 3EVRA 3B7AA 1KQVA 1CLLA 5GQQC 2QDIA 3GK4X 4MRXA 2K2AA 2MHHA 1WRKA 4F0ZB 2PYQA 3DVEA 3BOWB 1XFVO 1L7ZA 1AVSA 2FOTA 2ZKMX 2E30A 2GGZA 4IL1A 3O6BA 1DQEA 1SL8A 4YGCB 1NYAA 1W7IB 3S0EA 4PE7A 1NIWA 2Y1MA 1NUBA 1DJIA 1EG4A 2I94A 3CZ1A 2TN4A 3EKJA 3FS7A 4GGFC 3DXLA 4JWQA 3SG6A 2QEOA 2PRUA 3R72A 3JTDC 3VB1A 3CLNA 2KLDA 1J1DA 2L51A 1WY9A 2PMYA 5HYDA 2ZNEA 1OSAA 3CS1A 4ORBB 1IRJA 1K9UA 4OCIA 3WHUB 1GQMA 1SK6D 1V1FA 2I2RE 1F8HA 2KAYA 4I5NB 2ZRTA 1DJWA 5CSJA 3BFHA 2BBNA 1H8BA 5EL2A 2OTGB 4TNCA 2R2IA 4BY5A 5CSFA 3S0DA 3I5GB 2CNPA 1SKTA 5K89A 1K90D 4WQ3A 1WDCB 3V2LA 1SR6B 1B9AA 1KQMB 2K0JA 4UPGA 3TZ1A 2LUCA 1YRUB 1AJ5A 4JD9A 2KYCA 2KI6C 2LV7A 3OGNA 1B8CA 1B1GA 3DZTA 1IG5A 1OMDA 1LKJA 1Q80A 1K9PA 1KWOC 1BODA 3DF0B 2KGRA 2M7LA 2BL0C 1CFFA 2LVJA 3QMEA 1N2DA 1CDLA 1NCZA 1KK8C 2KOTA 2QEVA 3CZ0A 2JZIA 2LMVA 1C7VA 1TNWA 1XA5A 1FI5A 1OQPA 1R2UA 3S0GA 1SCMC 1PVBA
chains in the Genus database with same CATH topology
2EC6B 3BUOB 4YGAA 3CZTX 2H61A 2AMIA 2KAXA 3JVTC 3TDIA 2OS8C 3PM8A 1N0YA 1SW8A 3F45A 2JULA 1TIZA 1IWQA 1N65A 4I5KA 2MA2A 2L4HA 1QVIZ 1YRTB 4YGEB 4BY4A 2BCXA 1M31A 2L4IA 1DGVA 4XYNA 1QATA 1JBAA 2K7DA 1SL7A 2PALA 2SASA 4PHNA 1DTLA 1NX0A 1CFCA 4PE1A 4HRGA 1KFUS 1S5GZ 1TNPA 3TDZA 5B8IB 5JJGA 2IS9A 3GK1A 3TUYC 3VROA 3DD4A 1FI6A 1NP8A 2OPOA 3IF7A 2GGMA 2F33A 2BBMA 5J3XA 1A4PA 1S26D 1U5IA 4MRYA 4NDBA 2KFFA 1PVAA 1SL9A 2I18A 3JTDB 5ER4X 1KFXL 4QJ5B 1XFWO 1OZSA 2EGDA 3SJSA 4AQIA 5I2QA 2JQ6A 2F3YA 2KQ6A 1J7OA 1ODBA 1CFPA 1AJ4A 3SG4A 4YBHB 2M9GA 2DOQA 3DF0A 5IBWA 1CLMA 3ZNIA 1LVCD 1UHKA 1YUSA 1MXLC 1RROA 2WC8A 2RGIA 1YR5A 2LCPA 1PK0D 4JQ0D 4A4BA 1UURA 3BXKA 5HKWA 2KAVA 3NSOA 2LLSA 1CM4A 2L98A 5DKQA 1QVIY 3GK2A 3PLFB 1QTXA 4MEWA 3I5FC 3SG3A 1OZOA 1DMOA 2BE6A 1AP4A 2L2EA 4DUQA 3I5HC 4GGNA 1BLQA 1JWDA 1FBVA 4HRHA 1AK8A 1PSRA 1QV0A 2HQWA 2KNEA 1LA0A 2KBMA 2LHLA 3SIAA 5AANA 1BU3A 1L2OB 5I8NA 1CMGA 4FTGA 3FWBA 2LE9B 2B1UA 1G33A 1KK7Y 4ICBA 4P5OE 2JTZA 1CDNA 1Y1XA 3EVUA 1TNQA 1CB1A 2LUXA 1X02A 3KEVA 3O2PA 1G8IA 3PFVA 5PALA 1OOJA 4C0LA 1RTP1 1EL4A 1QX2A 3O4YA 3PN7B 4GGFA 4HSZA 4U8DA 1BG1A 2WCEA 3BQ3A 2JOJA 4QJ3B 4MSPA 4PCWA 2Q91A 3KO0A 4OV2A 1PULA 1Y1UA 2WORA 4USLA 1K9KA 4OVNF 1JF0A 2PASA 2JU0A 2I7AA 1F54A 3NXAA 3A8RA 3LL8B 1DJGA 1XVJA 1HQVA 2KSPA 1GGWA 4MN0A 2WOSA 1BJFA 4YRUA 4PHMA 1AUIB 1U5IB 2HQ8A 1NPQA 3VRRA 1DJYA 3NSKA 1MXEA 3NSIA 1XK4C 5AFPA 2VRGA 1S6JA 1UHNA 4GNKB 3LK0A 2FJUB 4OKHA 1DJHA 3EK7A 2K8MB 2QPTA 2WCBA 4GAOA 4AOMA 1QASA 1J1EA 2KI4B 3I5IB 3VGOA 1NWDA 2BCBA 3PATA 3PSRA 3VRQA 3CR4X 4I5JA 2LM5A 1D1OA 1DF0B 1GGZA 4WRIA 1XFZO 3CR2A 1CDPA 2BECA 2FCDA 2P6BB 4AQJA 1MR8A 1B8LA 2NLNA 4ORCB 4I5LB 3GOFA 4FQOA 2MBXA 1A2XA 2JTTA 3HX4A 2MLEC 4M2PA 2KDHA 4PHKA 3O78A 2M29A 1BR1B 1SYMA 1XFYO 1CFDA 1KSOA 3TS5C 1K8UA 4YI9A 3I5FB 1ZMZA 5JOLA 1FF1A 2WCFA 1KSMA 2NCPA 4PE0A 1SPYA 3KPXA 2M1KB 2ZN8A 4HREE 1EJ3A 2LLUA 1IGVA 2HETA 1IKUA 2K2FA 1YUTA 1UHIA 2CCMA 2O5GA 3DVKA 4A4CA 2HF5A 2Y1NA 1K94A 1MF8B 1XO5A 3NSLA 2M0RA 3WHTB 1QX5B 4M2OA 1RJVA 3EVVA 2JNXA 2OTGC 2KFGA 5KSZA 4N1FA 1ZACA 1A03A 2BKIB 1KCYA 5G08A 2AUCA 1S3PA 1TCOB 2L0PA 2MJWB 3I5GC 2GV5A 2FCEA 4MZJA 3OX5A 1BOCA 1RECA 1SCVA 1TOPA 2K7CA 1IQ3A 1WRZA 2BE4A 1SR6C 1BT6A 1KFUL 5FYXA 1H4BA 1S6IA 1C07A 4CFRA 1CLBA 2V53A 3CTNA 2M8UA 1QIWA 3ICBA 3OX6A 2ZFDA 1TN4A 3RM1A 1QS7A 1F70A 2CBLA 2KQYA 2Y4QA 1NSHA 4JPZB 3D0YA 3SG5A 1F55A 2CTNA 1DF0A 3BYAA 1YVHA 1NCXA 4N5XA 4PDZA 1B47A 4ZCVA 1QLSA 1CNPA 1JSAA 3BUWB 2AAOA 5CSNA 2NXQA 2K7OA 1IJ6A 2EC6C 4NQGA 2LAPA 1M39A 3OB1B 5AEQA 1ZUZA 2PVBA 3AAKA 1J7QA 3E3RA 1YTZC 1SNLA 1S5GY 1E8AA 4GBAA 2LHIA 4YI8A 5DKRA 1KWOB 1NX1A 1DJXA 4R1EA 3CGAA 1DJZA 2BL0B 5KTYA 4NDDA 2ZN9A 1SBJA 1KK8B 1K95A 1Y1AA 3A4UB 3ZWHA 1LXFC 1JF2A 1F4OA 1M46A 2KFHA 4L9MA 1ZFSA 1A75A 1SCMB 4NDCA 1FPWA 2D8NA 1BF5A 1A29A 2L50A 2Q4UA 3JVTB 4GUKA 4XJKA 4MVFA 2OS8B 4DIRA 2QACA 1QLKA 4C0KA 2LANA 3OB2B 1BMOA 2K61A 2A4JA 3KHEA 1RK9A 4PE4A 1Y6WA 3D10A 4DCKA 2JXCA 3H4SE 5HKZA 2JRFA 4N1GA 3WXAA 3SIBA 2F2OA 1NX3A 1Y0VH 2COLB 1IJ5A 5DKNA 1DVIA 2LLTA 1B7TZ 2MAZA 4YGDB 3TS5B 3LK1A 1QXPA 1QJTA 2MRDA 1W7JB 2F8PA 1SY9A 2G2BA 4PALA 4GFTA 4C0JA 3M0WA 1B4CA 1AHRA 1EG3A 2HPSA 4Q04A 3SG7A 5CPVA 4ETOA 3TUYB 4PHJA 1TNXA 2KYFA 1ZOTB 3QRXA 3LLEA 1MUXA 1MWNA 1SRAA 1J7PA 1TCFA 1J7RA 1R6PA 1QV1A 2KI6D 1K2HA 3BUXB 1XK4A 1F71A 1EH2A 1K93D 1LINA 3VRNA 2G9BA 2JT8A 1IQ5A 4CPVA 1C7WA 1BR4B 2JT0A 3D0YB 2E6WA 5CSIA 4CLNA 2LNKA 2BKHB 2JNFA 1WLZA 1JFKA 1UUSA 2JXLA 2NCOA 1YX8A 1QX7A 3CR5X 2ZRSA 3FWCA 1M63B 1F4QA 3DVMA 2JPTA 1OMVA 2LP2A 1B8RA 3OHMB 4E68A 3DVJA 3AKBA 3MSEB 2M7NA 1SMGA 1L2OC 1IH0A 2H61C 1GJYA 1WLMA 2M1UA 2LVKA 2MLFC 4D1EA 2M97A 4DRWA 1VRKA 2F2PA 1UP5A 3BOWA 1K96A 1TTXA 2F3ZA 1LA3A 2SCPA 1M45A 1NX2A 2O60A 1B7TY 4YGBB 2M3WA 3EK4A 4ORAB 3I5HB 4OR9B 1PRWA 3AAJA 3BUMB 4MLWA 1YURA 5KU1A 1S1EA 3PN7C 1CKKA 2EHBA 3PALA 1XFUO 1A75B 2KBIA 2CXJA 1DGUA 1YUUA 1PSBA 5D69A 1J55A 5TNCA 2WNDA 1UHJA 1UWOA 4XJKB 3LCPC 1KFXS 2JC2A 1MQ1A 2LMTA 3TDUA 1V1GA 2KHNA 1EXRA 3EK8A 1RWYA 3C1VA 1JC2A 2K7BA 4M2QA 1JUOA 4CIDA 1YX7A 4MZKA 3IQQA 5HKYA 1WDCC 1OMRA 4MBEA 2KGBC 1HT9A 2LP3A 1KQMC 1XYDA 3WNXB 2LVVA 3K21A 2ZNDA 1OE9B 5F6TA 1XFXO 1G4YR 1CDMA 1KK7Z 3AKAA 4P2YB 3FIAA 1YVLA 5AERA 3EKHA 1CMFA 3VRPA 5HLVA 4CFQA 2M49B 2KI4C 3I5IC 1ALVA 5I2OA 2Y5IA 2LC5A 2ISDA 1UHHA 2JT3A 4QJ4B 3CWGA 1FW4A 4WQ2A 3KF9A 4GPLB 3BUNB 2PSRA 5HLOA 5AXIA 3HCMA 2JWWA 2LVIA 2L5XB 1JFJA 1ALWA 4ZCUA 1RFJA 5I2LA 1PALA 1S6CA 2H2KA 2NZ0A 5D7FA 5ER5A 3RLZA 1TRFA 1S36A 4MZLA 3IQOA 1QIVA 2CT9A 4DS7A 2BCAA 3OP0A 1CM1A 5BPJA 1DT7B 1WRLA 1MHOA 3SG2A 2LMUA 1NCYA 1CTRA 3EVRA 1KQVA 1CLLA 5GQQC 3GK4X 4MRXA 2K2AA 2MHHA 1WRKA 4F0ZB 3DVEA 3BOWB 1XFVO 1L7ZA 1AVSA 2FOTA 2ZKMX 2E30A 2GGZA 4IL1A 3O6BA 1SL8A 4YGCB 1NYAA 1W7IB 4PE7A 1NIWA 2Y1MA 1NUBA 1DJIA 1EG4A 2I94A 3EKJA 2TN4A 3FS7A 4GGFC 3SG6A 4JWQA 2PRUA 3JTDC 3CLNA 1J1DA 2L51A 1WY9A 2PMYA 5HYDA 2ZNEA 1OSAA 3CS1A 4ORBB 1IRJA 1K9UA 4OCIA 3WHUB 1GQMA 1SK6D 1V1FA 2I2RE 1F8HA 2KAYA 4I5NB 2ZRTA 1DJWA 5CSJA 2BBNA 1H8BA 2OTGB 4TNCA 2R2IA 4BY5A 5CSFA 3I5GB 2CNPA 1SKTA 5K89A 1K90D 4WQ3A 1WDCB 1SR6B 1B9AA 1KQMB 2K0JA 4UPGA 3TZ1A 2LUCA 1YRUB 1AJ5A 2KYCA 2KI6C 2LV7A 1B8CA 1B1GA 1IG5A 1OMDA 1LKJA 1Q80A 1K9PA 1KWOC 1BODA 3DF0B 2KGRA 2M7LA 2BL0C 1CFFA 2LVJA 1N2DA 1CDLA 1NCZA 1KK8C 2KOTA 2JZIA 2LMVA 1C7VA 1TNWA 1XA5A 1FI5A 1OQPA 1R2UA 1SCMC 1PVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 B;  3BUO B;  4YGA A;  3CZT X;  2H61 A;  2AMI A;  2KAX A;  3JVT C;  3TDI A;  2OS8 C;  3PM8 A;  1N0Y A;  1SW8 A;  3F45 A;  2JUL A;  1TIZ A;  1IWQ A;  1N65 A;  4I5K A;  2MA2 A;  2L4H A;  1QVI Z;  1YRT B;  4YGE B;  4BY4 A;  2BCX A;  1M31 A;  2L4I A;  1DGV A;  4XYN A;  1QAT A;  1JBA A;  2K7D A;  1SL7 A;  2PAL A;  2SAS A;  4PHN A;  1DTL A;  1NX0 A;  1CFC A;  4PE1 A;  4HRG A;  1KFU S;  1S5G Z;  1TNP A;  3TDZ A;  5B8I B;  5JJG A;  2IS9 A;  3GK1 A;  3TUY C;  3VRO A;  3DD4 A;  1FI6 A;  1NP8 A;  2OPO A;  3IF7 A;  2GGM A;  2F33 A;  2BBM A;  5J3X A;  1A4P A;  1S26 D;  1U5I A;  4MRY A;  4NDB A;  2KFF A;  1PVA A;  1SL9 A;  2I18 A;  3JTD B;  5ER4 X;  1KFX L;  4QJ5 B;  1XFW O;  1OZS A;  2EGD A;  3SJS A;  4AQI A;  5I2Q A;  2JQ6 A;  2F3Y A;  2KQ6 A;  1J7O A;  1ODB A;  1CFP A;  1AJ4 A;  3SG4 A;  4YBH B;  2M9G A;  2DOQ A;  3DF0 A;  5IBW A;  1CLM A;  3ZNI A;  1LVC D;  1UHK A;  1YUS A;  1MXL C;  1RRO A;  2WC8 A;  2RGI A;  1YR5 A;  2LCP A;  1PK0 D;  4JQ0 D;  4A4B A;  1UUR A;  3BXK A;  5HKW A;  2KAV A;  3NSO A;  2LLS A;  1CM4 A;  2L98 A;  5DKQ A;  1QVI Y;  3GK2 A;  3PLF B;  1QTX A;  4MEW A;  3I5F C;  3SG3 A;  1OZO A;  1DMO A;  2BE6 A;  1AP4 A;  2L2E A;  4DUQ A;  3I5H C;  4GGN A;  1BLQ A;  1JWD A;  1FBV A;  4HRH A;  1AK8 A;  1PSR A;  1QV0 A;  2HQW A;  2KNE A;  1LA0 A;  2KBM A;  2LHL A;  3SIA A;  5AAN A;  1BU3 A;  1L2O B;  5I8N A;  1CMG A;  4FTG A;  3FWB A;  2LE9 B;  2B1U A;  1G33 A;  1KK7 Y;  4ICB A;  4P5O E;  2JTZ A;  1CDN A;  1Y1X A;  3EVU A;  1TNQ A;  1CB1 A;  2LUX A;  1X02 A;  3KEV A;  3O2P A;  1G8I A;  3PFV A;  5PAL A;  1OOJ A;  4C0L A;  1RTP 1;  1EL4 A;  1QX2 A;  3O4Y A;  3PN7 B;  4GGF A;  4HSZ A;  4U8D A;  1BG1 A;  2WCE A;  3BQ3 A;  2JOJ A;  4QJ3 B;  4MSP A;  4PCW A;  2Q91 A;  3KO0 A;  4OV2 A;  1PUL A;  1Y1U A;  2WOR A;  4USL A;  1K9K A;  4OVN F;  1JF0 A;  2PAS A;  2JU0 A;  2I7A A;  1F54 A;  3NXA A;  3A8R A;  3LL8 B;  1DJG A;  1XVJ A;  1HQV A;  2KSP A;  1GGW A;  4MN0 A;  2WOS A;  1BJF A;  4YRU A;  4PHM A;  1AUI B;  1U5I B;  2HQ8 A;  1NPQ A;  3VRR A;  1DJY A;  3NSK A;  1MXE A;  3NSI A;  1XK4 C;  5AFP A;  2VRG A;  1S6J A;  1UHN A;  4GNK B;  3LK0 A;  2FJU B;  4OKH A;  1DJH A;  3EK7 A;  2K8M B;  2QPT A;  2WCB A;  4GAO A;  4AOM A;  1QAS A;  1J1E A;  2KI4 B;  3I5I B;  3VGO A;  1NWD A;  2BCB A;  3PAT A;  3PSR A;  3VRQ A;  3CR4 X;  4I5J A;  2LM5 A;  1D1O A;  1DF0 B;  1GGZ A;  4WRI A;  1XFZ O;  3CR2 A;  1CDP A;  2BEC A;  2FCD A;  2P6B B;  4AQJ A;  1MR8 A;  1B8L A;  2NLN A;  4ORC B;  4I5L B;  3GOF A;  4FQO A;  2MBX A;  1A2X A;  2JTT A;  3HX4 A;  2MLE C;  4M2P A;  2KDH A;  4PHK A;  3O78 A;  2M29 A;  1BR1 B;  1SYM A;  1XFY O;  1CFD A;  1KSO A;  3TS5 C;  1K8U A;  4YI9 A;  3I5F B;  1ZMZ A;  5JOL A;  1FF1 A;  2WCF A;  1KSM A;  2NCP A;  4PE0 A;  1SPY A;  3KPX A;  2M1K B;  2ZN8 A;  4HRE E;  1EJ3 A;  2LLU A;  1IGV A;  2HET A;  1IKU A;  2K2F A;  1YUT A;  1UHI A;  2CCM A;  2O5G A;  3DVK A;  4A4C A;  2HF5 A;  2Y1N A;  1K94 A;  1MF8 B;  1XO5 A;  3NSL A;  2M0R A;  3WHT B;  1QX5 B;  4M2O A;  1RJV A;  3EVV A;  2JNX A;  2OTG C;  2KFG A;  5KSZ A;  4N1F A;  1ZAC A;  1A03 A;  2BKI B;  1KCY A;  5G08 A;  2AUC A;  1S3P A;  1TCO B;  2L0P A;  2MJW B;  3I5G C;  2GV5 A;  2FCE A;  4MZJ A;  3OX5 A;  1BOC A;  1REC A;  1SCV A;  1TOP A;  2K7C A;  1IQ3 A;  1WRZ A;  2BE4 A;  1SR6 C;  1BT6 A;  1KFU L;  5FYX A;  1H4B A;  1S6I A;  1C07 A;  4CFR A;  1CLB A;  2V53 A;  3CTN A;  2M8U A;  1QIW A;  3ICB A;  3OX6 A;  2ZFD A;  1TN4 A;  3RM1 A;  1QS7 A;  1F70 A;  2CBL A;  2KQY A;  2Y4Q A;  1NSH A;  4JPZ B;  3D0Y A;  3SG5 A;  1F55 A;  2CTN A;  1DF0 A;  3BYA A;  1YVH A;  1NCX A;  4N5X A;  4PDZ A;  1B47 A;  4ZCV A;  1QLS A;  1CNP A;  1JSA A;  3BUW B;  2AAO A;  5CSN A;  2NXQ A;  2K7O A;  1IJ6 A;  2EC6 C;  4NQG A;  2LAP A;  1M39 A;  3OB1 B;  5AEQ A;  1ZUZ A;  2PVB A;  3AAK A;  1J7Q A;  3E3R A;  1YTZ C;  1SNL A;  1S5G Y;  1E8A A;  4GBA A;  2LHI A;  4YI8 A;  5DKR A;  1KWO B;  1NX1 A;  1DJX A;  4R1E A;  3CGA A;  1DJZ A;  2BL0 B;  5KTY A;  4NDD A;  2ZN9 A;  1SBJ A;  1KK8 B;  1K95 A;  1Y1A A;  3A4U B;  3ZWH A;  1LXF C;  1JF2 A;  1F4O A;  1M46 A;  2KFH A;  4L9M A;  1ZFS A;  1A75 A;  1SCM B;  4NDC A;  1FPW A;  2D8N A;  1BF5 A;  1A29 A;  2L50 A;  2Q4U A;  3JVT B;  4GUK A;  4XJK A;  4MVF A;  2OS8 B;  4DIR A;  2QAC A;  1QLK A;  4C0K A;  2LAN A;  3OB2 B;  1BMO A;  2K61 A;  2A4J A;  3KHE A;  1RK9 A;  4PE4 A;  1Y6W A;  3D10 A;  4DCK A;  2JXC A;  3H4S E;  5HKZ A;  2JRF A;  4N1G A;  3WXA A;  3SIB A;  2F2O A;  1NX3 A;  1Y0V H;  2COL B;  1IJ5 A;  5DKN A;  1DVI A;  2LLT A;  1B7T Z;  2MAZ A;  4YGD B;  3TS5 B;  3LK1 A;  1QXP A;  1QJT A;  2MRD A;  1W7J B;  2F8P A;  1SY9 A;  2G2B A;  4PAL A;  4GFT A;  4C0J A;  3M0W A;  1B4C A;  1AHR A;  1EG3 A;  2HPS A;  4Q04 A;  3SG7 A;  5CPV A;  4ETO A;  3TUY B;  4PHJ A;  1TNX A;  2KYF A;  1ZOT B;  3QRX A;  3LLE A;  1MUX A;  1MWN A;  1SRA A;  1J7P A;  1TCF A;  1J7R A;  1R6P A;  1QV1 A;  2KI6 D;  1K2H A;  3BUX B;  1XK4 A;  1F71 A;  1EH2 A;  1K93 D;  1LIN A;  3VRN A;  2G9B A;  2JT8 A;  1IQ5 A;  4CPV A;  1C7W A;  1BR4 B;  2JT0 A;  3D0Y B;  2E6W A;  5CSI A;  4CLN A;  2LNK A;  2BKH B;  2JNF A;  1WLZ A;  1JFK A;  1UUS A;  2JXL A;  2NCO A;  1YX8 A;  1QX7 A;  3CR5 X;  2ZRS A;  3FWC A;  1M63 B;  1F4Q A;  3DVM A;  2JPT A;  1OMV A;  2LP2 A;  1B8R A;  3OHM B;  4E68 A;  3DVJ A;  3AKB A;  3MSE B;  2M7N A;  1SMG A;  1L2O C;  1IH0 A;  2H61 C;  1GJY A;  1WLM A;  2M1U A;  2LVK A;  2MLF C;  4D1E A;  2M97 A;  4DRW A;  1VRK A;  2F2P A;  1UP5 A;  3BOW A;  1K96 A;  1TTX A;  2F3Z A;  1LA3 A;  2SCP A;  1M45 A;  1NX2 A;  2O60 A;  1B7T Y;  4YGB B;  2M3W A;  3EK4 A;  4ORA B;  3I5H B;  4OR9 B;  1PRW A;  3AAJ A;  3BUM B;  4MLW A;  1YUR A;  5KU1 A;  1S1E A;  3PN7 C;  1CKK A;  2EHB A;  3PAL A;  1XFU O;  1A75 B;  2KBI A;  2CXJ A;  1DGU A;  1YUU A;  1PSB A;  5D69 A;  1J55 A;  5TNC A;  2WND A;  1UHJ A;  1UWO A;  4XJK B;  3LCP C;  1KFX S;  2JC2 A;  1MQ1 A;  2LMT A;  3TDU A;  1V1G A;  2KHN A;  1EXR A;  3EK8 A;  1RWY A;  3C1V A;  1JC2 A;  2K7B A;  4M2Q A;  1JUO A;  4CID A;  1YX7 A;  4MZK A;  3IQQ A;  5HKY A;  1WDC C;  1OMR A;  4MBE A;  2KGB C;  1HT9 A;  2LP3 A;  1KQM C;  1XYD A;  3WNX B;  2LVV A;  3K21 A;  2ZND A;  1OE9 B;  5F6T A;  1XFX O;  1G4Y R;  1CDM A;  1KK7 Z;  3AKA A;  4P2Y B;  3FIA A;  1YVL A;  5AER A;  3EKH A;  1CMF A;  3VRP A;  5HLV A;  4CFQ A;  2M49 B;  2KI4 C;  3I5I C;  1ALV A;  5I2O A;  2Y5I A;  2LC5 A;  2ISD A;  1UHH A;  2JT3 A;  4QJ4 B;  3CWG A;  1FW4 A;  4WQ2 A;  3KF9 A;  4GPL B;  3BUN B;  2PSR A;  5HLO A;  5AXI A;  3HCM A;  2JWW A;  2LVI A;  2L5X B;  1JFJ A;  1ALW A;  4ZCU A;  1RFJ A;  5I2L A;  1PAL A;  1S6C A;  2H2K A;  2NZ0 A;  5D7F A;  5ER5 A;  3RLZ A;  1TRF A;  1S36 A;  4MZL A;  3IQO A;  1QIV A;  2CT9 A;  4DS7 A;  2BCA A;  3OP0 A;  1CM1 A;  5BPJ A;  1DT7 B;  1WRL A;  1MHO A;  3SG2 A;  2LMU A;  1NCY A;  1CTR A;  3EVR A;  1KQV A;  1CLL A;  5GQQ C;  3GK4 X;  4MRX A;  2K2A A;  2MHH A;  1WRK A;  4F0Z B;  3DVE A;  3BOW B;  1XFV O;  1L7Z A;  1AVS A;  2FOT A;  2ZKM X;  2E30 A;  2GGZ A;  4IL1 A;  3O6B A;  1SL8 A;  4YGC B;  1NYA A;  1W7I B;  4PE7 A;  1NIW A;  2Y1M A;  1NUB A;  1DJI A;  1EG4 A;  2I94 A;  3EKJ A;  2TN4 A;  3FS7 A;  4GGF C;  3SG6 A;  4JWQ A;  2PRU A;  3JTD C;  3CLN A;  1J1D A;  2L51 A;  1WY9 A;  2PMY A;  5HYD A;  2ZNE A;  1OSA A;  3CS1 A;  4ORB B;  1IRJ A;  1K9U A;  4OCI A;  3WHU B;  1GQM A;  1SK6 D;  1V1F A;  2I2R E;  1F8H A;  2KAY A;  4I5N B;  2ZRT A;  1DJW A;  5CSJ A;  2BBN A;  1H8B A;  2OTG B;  4TNC A;  2R2I A;  4BY5 A;  5CSF A;  3I5G B;  2CNP A;  1SKT A;  5K89 A;  1K90 D;  4WQ3 A;  1WDC B;  1SR6 B;  1B9A A;  1KQM B;  2K0J A;  4UPG A;  3TZ1 A;  2LUC A;  1YRU B;  1AJ5 A;  2KYC A;  2KI6 C;  2LV7 A;  1B8C A;  1B1G A;  1IG5 A;  1OMD A;  1LKJ A;  1Q80 A;  1K9P A;  1KWO C;  1BOD A;  3DF0 B;  2KGR A;  2M7L A;  2BL0 C;  1CFF A;  2LVJ A;  1N2D A;  1CDL A;  1NCZ A;  1KK8 C;  2KOT A;  2JZI A;  2LMV A;  1C7V A;  1TNW A;  1XA5 A;  1FI5 A;  1OQP A;  1R2U A;  1SCM C;  1PVB A; 
#chains in the Genus database with same CATH topology
 2EC6 B;  3BUO B;  4YGA A;  3CZT X;  2H61 A;  2AMI A;  2KAX A;  3JVT C;  3TDI A;  2OS8 C;  3PM8 A;  3B87 A;  1N0Y A;  1SW8 A;  3F45 A;  2JUL A;  1TIZ A;  1IWQ A;  3UO9 A;  4F7F A;  1N65 A;  4I5K A;  2MA2 A;  3B88 A;  2L4H A;  1QVI Z;  1YRT B;  4YGE B;  4BY4 A;  2BCX A;  4PT1 A;  1M31 A;  2L4I A;  1DGV A;  4XYN A;  1QAT A;  1JBA A;  2K7D A;  1SL7 A;  2PAL A;  2SAS A;  4PHN A;  1DTL A;  1QWV A;  1NX0 A;  5HL1 A;  1CFC A;  4PE1 A;  4HRG A;  1KFU S;  1S5G Z;  1TNP A;  3TDZ A;  5B8I B;  5JJG A;  2IS9 A;  3GK1 A;  3TUY C;  3VRO A;  3DD4 A;  3S0F A;  1FI6 A;  1NP8 A;  2OPO A;  3IF7 A;  2GGM A;  2F33 A;  1DC1 A;  2BBM A;  5J3X A;  1A4P A;  1S26 D;  1U5I A;  4MRY A;  4NDB A;  2KFF A;  1PVA A;  1SL9 A;  2I18 A;  3JTD B;  5ER4 X;  1KFX L;  4QJ5 B;  1XFW O;  1OZS A;  2EGD A;  3SJS A;  3BFB A;  4AQI A;  3NHI A;  5I2Q A;  2JQ6 A;  2F3Y A;  2KQ6 A;  1J7O A;  1ODB A;  1CFP A;  1AJ4 A;  1C3Y A;  3SG4 A;  4YBH B;  2M9G A;  2DOQ A;  3DF0 A;  5IBW A;  1CLM A;  3ZNI A;  1LVC D;  1UHK A;  1YUS A;  1MXL C;  1RRO A;  2WC8 A;  2RGI A;  1YR5 A;  2LCP A;  2WC6 A;  3DYE A;  2L5Y A;  1PK0 D;  4JQ0 D;  4A4B A;  1GM0 A;  1UUR A;  3BXK A;  5HKW A;  2KAV A;  3NSO A;  2LLS A;  1CM4 A;  2L98 A;  5DKQ A;  1QVI Y;  3GK2 A;  3PLF B;  1QTX A;  4MEW A;  3I5F C;  3SG3 A;  1OZO A;  1DMO A;  2BE6 A;  1AP4 A;  2L2E A;  4DUQ A;  3I5H C;  4GGN A;  1BLQ A;  3B6X A;  1JWD A;  1FBV A;  4HRH A;  1AK8 A;  1PSR A;  1QV0 A;  2HQW A;  1XFR A;  1LA0 A;  2KNE A;  2KBM A;  2LHL A;  5D3O A;  3SIA A;  5AAN A;  1BU3 A;  1L2O B;  5I8N A;  1CMG A;  4FTG A;  3BFA A;  3FWB A;  2LE9 B;  1G33 A;  1KK7 Y;  2B1U A;  4ICB A;  4P5O E;  1Z4H A;  2JTZ A;  3FE8 A;  1CDN A;  1Y1X A;  3EVU A;  1TNQ A;  4JKT A;  1CB1 A;  2LUX A;  1X02 A;  3KEV A;  3O2P A;  1G8I A;  3PFV A;  5PAL A;  1C3Z A;  1OOJ A;  4C0L A;  1RTP 1;  1EL4 A;  1QX2 A;  4KYN A;  3O4Y A;  3PN7 B;  4GGF A;  4HSZ A;  4U8D A;  1BG1 A;  1SSE B;  2WCE A;  3S0A A;  5FI7 A;  3BQ3 A;  3D73 A;  2JOJ A;  4QJ3 B;  4MSP A;  2WCJ A;  2Q91 A;  3NGV A;  4PCW A;  3KO0 A;  4OV2 A;  1PUL A;  1Y1U A;  2WOR A;  3EG5 B;  4USL A;  1K9K A;  4OVN F;  1JF0 A;  2PAS A;  2JU0 A;  2I7A A;  1F54 A;  3CZ2 A;  2YGU A;  1LS8 A;  3NXA A;  3A8R A;  3LL8 B;  1DJG A;  1XVJ A;  1HQV A;  2KSP A;  1GGW A;  4MN0 A;  2WOS A;  1BJF A;  4YRU A;  4PHM A;  1AUI B;  1U5I B;  2HQ8 A;  1NPQ A;  3VRR A;  1DJY A;  3NSK A;  1MXE A;  3NSI A;  1XK4 C;  5AFP A;  3OBV A;  2VRG A;  1S6J A;  1UHN A;  4GNK B;  3R1P A;  3LK0 A;  2FJU B;  4OKH A;  1DJH A;  3EK7 A;  2K8M B;  2QPT A;  2WCB A;  4GAO A;  4AOM A;  1QAS A;  1J1E A;  2KI4 B;  3I5I B;  3VGO A;  3BJH A;  1NWD A;  2BCB A;  2QEH A;  3PAT A;  3PSR A;  3D78 A;  3VRQ A;  3CR4 X;  4I5J A;  2KLE A;  2LM5 A;  3L4A A;  1D1O A;  4INW A;  1DF0 B;  1GGZ A;  4WRI A;  1XFZ O;  3CR2 A;  1CDP A;  2BEC A;  2FCD A;  2P6B B;  4INX A;  1MR8 A;  1B8L A;  3SS5 A;  4AQJ A;  2NLN A;  4ORC B;  4I5L B;  3GOF A;  1W9Z A;  4FQO A;  2MBX A;  1A2X A;  2JTT A;  3HX4 A;  2MLE C;  4M2P A;  2KDH A;  4PHK A;  3O78 A;  2M29 A;  1BR1 B;  1SYM A;  1XFY O;  1CFD A;  3CAB A;  1KSO A;  3TS5 C;  3D74 A;  1K8U A;  4YI9 A;  3I5F B;  1ZMZ A;  5JOL A;  1FF1 A;  2WCF A;  1KSM A;  2NCP A;  4PE0 A;  1SPY A;  2WCL A;  1OOF A;  3KPX A;  2M1K B;  2ZN8 A;  4HRE E;  1EJ3 A;  2LLU A;  1IGV A;  2HET A;  1IKU A;  2K2F A;  1P28 A;  3FE6 A;  1YUT A;  1UHI A;  2CCM A;  2O5G A;  3DVK A;  4A4C A;  2HF5 A;  2Y1N A;  1K94 A;  1MF8 B;  1XO5 A;  3NSL A;  2M0R A;  3WHT B;  1QX5 B;  3O4X A;  4M2O A;  1RJV A;  3EVV A;  2JNX A;  2OTG C;  3L4L A;  2KFG A;  5KSZ A;  4N1F A;  1ZAC A;  1A03 A;  3FE9 A;  5FI2 A;  2BKI B;  1KCY A;  5G08 A;  3R1V A;  2AUC A;  1S3P A;  1TCO B;  2JPO A;  2L0P A;  2MJW B;  3I5G C;  2GV5 A;  2FCE A;  4MZJ A;  3OX5 A;  1BOC A;  1REC A;  1SCV A;  1TOP A;  2K7C A;  5FI6 A;  1IQ3 A;  1WRZ A;  2BE4 A;  1SR6 C;  2PQL A;  1BT6 A;  1KFU L;  5FYX A;  1H4B A;  2WCK A;  2WCH A;  1S6I A;  1C07 A;  4CFR A;  1CLB A;  2V53 A;  3CTN A;  2M8U A;  2P71 A;  1QIW A;  3ICB A;  3OX6 A;  2ZFD A;  1TN4 A;  3RM1 A;  1QS7 A;  1F70 A;  2CBL A;  2KQY A;  2Y4Q A;  1NSH A;  4JPZ B;  3D0Y A;  3SG5 A;  1F55 A;  2CTN A;  1DF0 A;  2KPH A;  1YVH A;  1ORG A;  3BYA A;  1NCX A;  4N5X A;  4PDZ A;  1B47 A;  4ZCV A;  1QLS A;  1CNP A;  1JSA A;  3BUW B;  1OOI X;  2AAO A;  5CSN A;  2NXQ A;  2K7O A;  1IJ6 A;  2EC6 C;  4NQG A;  2LAP A;  1M39 A;  3OB1 B;  5AEQ A;  1ZUZ A;  2PVB A;  3AAK A;  1OOG A;  1J7Q A;  3E3R A;  1YTZ C;  1SNL A;  4IJ7 A;  1S5G Y;  1E8A A;  4GBA A;  2LHI A;  4YI8 A;  5DKR A;  1KWO B;  1NX1 A;  1DJX A;  4R1E A;  3SS3 A;  3CGA A;  1DJZ A;  2BL0 B;  3S0B A;  5KTY A;  4NDD A;  2ZN9 A;  2H8V A;  1SBJ A;  1KK8 B;  5DIC A;  3RZS A;  1K95 A;  1Y1A A;  3A4U B;  3ZWH A;  1LXF C;  1JF2 A;  1F4O A;  1M46 A;  2KFH A;  4L9M A;  1ZFS A;  3D77 A;  1A75 A;  1SCM B;  4NDC A;  1OW4 A;  3IVT A;  1FPW A;  2D8N A;  1BF5 A;  1A29 A;  2L50 A;  2Q4U A;  3JVT B;  4GUK A;  4XJK A;  4MVF A;  2OS8 B;  4DIR A;  2QAC A;  1QLK A;  4C0K A;  2LAN A;  3OB2 B;  1BMO A;  2K61 A;  2A4J A;  3KHE A;  1RK9 A;  4PE4 A;  3SS4 A;  1Y6W A;  3D10 A;  4DCK A;  2JXC A;  3H4S E;  3CYZ A;  2JRF A;  4N1G A;  5HKZ A;  2BAP A;  3SIB A;  2F2O A;  3WXA A;  1NX3 A;  2WC5 A;  1Y0V H;  2COL B;  1IJ5 A;  5DKN A;  1DVI A;  3NHT A;  1DEL A;  2LLT A;  1B7T Z;  2MAZ A;  4YGD B;  3TS5 B;  3LK1 A;  1QXP A;  1QJT A;  3CDN A;  2MRD A;  1W7J B;  2F8P A;  1SY9 A;  2G2B A;  4PAL A;  4GFT A;  4C0J A;  3M0W A;  1B4C A;  1AHR A;  1TWO A;  1EG3 A;  2P70 A;  2HPS A;  4Q04 A;  3SG7 A;  5CPV A;  4ETO A;  2ERB A;  3TUY B;  2BNX A;  4PHJ A;  1T14 A;  1TNX A;  2KYF A;  1TUJ A;  1ZOT B;  1OOH A;  3QRX A;  3LLE A;  1MUX A;  1MWN A;  1SRA A;  1J7P A;  1TCF A;  1J7R A;  1R6P A;  1QV1 A;  2KI6 D;  1K2H A;  5I94 A;  3BUX B;  1XK4 A;  1Z2C B;  1F71 A;  1EH2 A;  1K93 D;  1LIN A;  3VRN A;  2G9B A;  4FQT A;  2JT8 A;  1IQ5 A;  4CPV A;  1C7W A;  1BR4 B;  2JT0 A;  3D0Y B;  2E6W A;  5CSI A;  3DY9 A;  4CLN A;  2LNK A;  2BKH B;  2JNF A;  2WCM A;  1IIO A;  1WLZ A;  1JFK A;  1UUS A;  2JXL A;  2NCO A;  1YX8 A;  1QX7 A;  3K1E A;  3CR5 X;  2ZRS A;  3FWC A;  1M63 B;  1F4Q A;  2GTE A;  3DVM A;  2JPT A;  1OMV A;  2LP2 A;  1B8R A;  3OHM B;  4E68 A;  3DVJ A;  3AKB A;  3MSE B;  3N7H A;  2M7N A;  1SMG A;  1L2O C;  1IH0 A;  2H61 C;  1GJY A;  1WLM A;  2M1U A;  2LVK A;  2MLF C;  3Q8I A;  4D1E A;  2M97 A;  4DRW A;  1VRK A;  3D75 A;  3PM2 A;  2F2P A;  1UP5 A;  3BOW A;  1K96 A;  1TTX A;  2F3Z A;  1LA3 A;  2SCP A;  1M45 A;  1NX2 A;  2O60 A;  1B7T Y;  4YGB B;  2M3W A;  3EK4 A;  4ORA B;  3I5H B;  4OR9 B;  1PRW A;  3AAJ A;  3R1O A;  3BUM B;  4MLW A;  1YUR A;  5KU1 A;  1S1E A;  3PN7 C;  1CKK A;  2EHB A;  3PAL A;  1XFU O;  1A75 B;  1DEK A;  2KBI A;  2CXJ A;  1DGU A;  1YUU A;  1PSB A;  2L2C A;  5D69 A;  1J55 A;  5TNC A;  2WND A;  1UHJ A;  1UWO A;  4XJK B;  3LCP C;  1KFX S;  2JC2 A;  1MQ1 A;  3UNW A;  2LMT A;  3TDU A;  1V1G A;  2KHN A;  1EXR A;  3EK8 A;  1RWY A;  3C1V A;  1JC2 A;  2K7B A;  4M2Q A;  1JUO A;  4CID A;  1YX7 A;  3L47 A;  4MZK A;  3IQQ A;  5HKY A;  1WDC C;  1OMR A;  3PJI A;  2KGB C;  4MBE A;  1HT9 A;  2LP3 A;  1KQM C;  1XYD A;  3WNX B;  2LVV A;  3K21 A;  2ZND A;  1OE9 B;  5F6T A;  1XFX O;  1G4Y R;  1CDM A;  1KK7 Z;  3AKA A;  4P2Y B;  3FIA A;  1YVL A;  5AER A;  3EKH A;  1CMF A;  3VRP A;  2FJY A;  5HLV A;  3D76 A;  4CFQ A;  2M49 B;  1TUZ A;  2KI4 C;  3I5I C;  1ALV A;  5I2O A;  2K60 A;  2Y5I A;  3B86 A;  2LC5 A;  2ISD A;  2QEB A;  1UHH A;  2JT3 A;  4QJ4 B;  3CWG A;  1FW4 A;  4WQ2 A;  3KF9 A;  4GPL B;  3BUN B;  2PSR A;  4OZD A;  5HLO A;  5AXI A;  3HCM A;  2JWW A;  2LVI A;  2L5X B;  1JFJ A;  1ALW A;  4ZCU A;  1RFJ A;  5I2L A;  1PAL A;  1S6C A;  2H2K A;  2NZ0 A;  5D7F A;  5ER5 A;  3RLZ A;  1TRF A;  1S36 A;  4MZL A;  3IQO A;  1QIV A;  2CT9 A;  4DS7 A;  2BCA A;  3OP0 A;  1CM1 A;  5BPJ A;  1DT7 B;  1WRL A;  1MHO A;  3SG2 A;  2LMU A;  1NCY A;  1CTR A;  3EVR A;  3B7A A;  1KQV A;  1CLL A;  5GQQ C;  2QDI A;  3GK4 X;  4MRX A;  2K2A A;  2MHH A;  1WRK A;  4F0Z B;  2PYQ A;  3DVE A;  3BOW B;  1XFV O;  1L7Z A;  1AVS A;  2FOT A;  2ZKM X;  2E30 A;  2GGZ A;  4IL1 A;  3O6B A;  1DQE A;  1SL8 A;  4YGC B;  1NYA A;  1W7I B;  3S0E A;  4PE7 A;  1NIW A;  2Y1M A;  1NUB A;  1DJI A;  1EG4 A;  2I94 A;  3CZ1 A;  2TN4 A;  3EKJ A;  3FS7 A;  4GGF C;  3DXL A;  4JWQ A;  3SG6 A;  2QEO A;  2PRU A;  3R72 A;  3JTD C;  3VB1 A;  3CLN A;  2KLD A;  1J1D A;  2L51 A;  1WY9 A;  2PMY A;  5HYD A;  2ZNE A;  1OSA A;  3CS1 A;  4ORB B;  1IRJ A;  1K9U A;  4OCI A;  3WHU B;  1GQM A;  1SK6 D;  1V1F A;  2I2R E;  1F8H A;  2KAY A;  4I5N B;  2ZRT A;  1DJW A;  5CSJ A;  3BFH A;  2BBN A;  1H8B A;  5EL2 A;  2OTG B;  4TNC A;  2R2I A;  4BY5 A;  5CSF A;  3S0D A;  3I5G B;  2CNP A;  1SKT A;  5K89 A;  1K90 D;  4WQ3 A;  1WDC B;  3V2L A;  1SR6 B;  1B9A A;  1KQM B;  2K0J A;  4UPG A;  3TZ1 A;  2LUC A;  1YRU B;  1AJ5 A;  4JD9 A;  2KYC A;  2KI6 C;  2LV7 A;  3OGN A;  1B8C A;  1B1G A;  3DZT A;  1IG5 A;  1OMD A;  1LKJ A;  1Q80 A;  1K9P A;  1KWO C;  1BOD A;  3DF0 B;  2KGR A;  2M7L A;  2BL0 C;  1CFF A;  2LVJ A;  3QME A;  1N2D A;  1CDL A;  1NCZ A;  1KK8 C;  2KOT A;  2QEV A;  3CZ0 A;  2JZI A;  2LMV A;  1C7V A;  1TNW A;  1XA5 A;  1FI5 A;  1OQP A;  1R2U A;  3S0G A;  1SCM C;  1PVB A; 
#chains in the Genus database with same CATH homology
 2EC6 B;  3BUO B;  4YGA A;  3CZT X;  2H61 A;  2AMI A;  2KAX A;  3JVT C;  3TDI A;  2OS8 C;  3PM8 A;  1N0Y A;  1SW8 A;  3F45 A;  2JUL A;  1TIZ A;  1IWQ A;  1N65 A;  4I5K A;  2MA2 A;  2L4H A;  1QVI Z;  1YRT B;  4YGE B;  4BY4 A;  2BCX A;  1M31 A;  2L4I A;  1DGV A;  4XYN A;  1QAT A;  1JBA A;  2K7D A;  1SL7 A;  2PAL A;  2SAS A;  4PHN A;  1DTL A;  1NX0 A;  1CFC A;  4PE1 A;  4HRG A;  1KFU S;  1S5G Z;  1TNP A;  3TDZ A;  5B8I B;  5JJG A;  2IS9 A;  3GK1 A;  3TUY C;  3VRO A;  3DD4 A;  1FI6 A;  1NP8 A;  2OPO A;  3IF7 A;  2GGM A;  2F33 A;  2BBM A;  5J3X A;  1A4P A;  1S26 D;  1U5I A;  4MRY A;  4NDB A;  2KFF A;  1PVA A;  1SL9 A;  2I18 A;  3JTD B;  5ER4 X;  1KFX L;  4QJ5 B;  1XFW O;  1OZS A;  2EGD A;  3SJS A;  4AQI A;  5I2Q A;  2JQ6 A;  2F3Y A;  2KQ6 A;  1J7O A;  1ODB A;  1CFP A;  1AJ4 A;  3SG4 A;  4YBH B;  2M9G A;  2DOQ A;  3DF0 A;  5IBW A;  1CLM A;  3ZNI A;  1LVC D;  1UHK A;  1YUS A;  1MXL C;  1RRO A;  2WC8 A;  2RGI A;  1YR5 A;  2LCP A;  1PK0 D;  4JQ0 D;  4A4B A;  1UUR A;  3BXK A;  5HKW A;  2KAV A;  3NSO A;  2LLS A;  1CM4 A;  2L98 A;  5DKQ A;  1QVI Y;  3GK2 A;  3PLF B;  1QTX A;  4MEW A;  3I5F C;  3SG3 A;  1OZO A;  1DMO A;  2BE6 A;  1AP4 A;  2L2E A;  4DUQ A;  3I5H C;  4GGN A;  1BLQ A;  1JWD A;  1FBV A;  4HRH A;  1AK8 A;  1PSR A;  1QV0 A;  2HQW A;  2KNE A;  1LA0 A;  2KBM A;  2LHL A;  3SIA A;  5AAN A;  1BU3 A;  1L2O B;  5I8N A;  1CMG A;  4FTG A;  3FWB A;  2LE9 B;  2B1U A;  1G33 A;  1KK7 Y;  4ICB A;  4P5O E;  2JTZ A;  1CDN A;  1Y1X A;  3EVU A;  1TNQ A;  1CB1 A;  2LUX A;  1X02 A;  3KEV A;  3O2P A;  1G8I A;  3PFV A;  5PAL A;  1OOJ A;  4C0L A;  1RTP 1;  1EL4 A;  1QX2 A;  3O4Y A;  3PN7 B;  4GGF A;  4HSZ A;  4U8D A;  1BG1 A;  2WCE A;  3BQ3 A;  2JOJ A;  4QJ3 B;  4MSP A;  4PCW A;  2Q91 A;  3KO0 A;  4OV2 A;  1PUL A;  1Y1U A;  2WOR A;  4USL A;  1K9K A;  4OVN F;  1JF0 A;  2PAS A;  2JU0 A;  2I7A A;  1F54 A;  3NXA A;  3A8R A;  3LL8 B;  1DJG A;  1XVJ A;  1HQV A;  2KSP A;  1GGW A;  4MN0 A;  2WOS A;  1BJF A;  4YRU A;  4PHM A;  1AUI B;  1U5I B;  2HQ8 A;  1NPQ A;  3VRR A;  1DJY A;  3NSK A;  1MXE A;  3NSI A;  1XK4 C;  5AFP A;  2VRG A;  1S6J A;  1UHN A;  4GNK B;  3LK0 A;  2FJU B;  4OKH A;  1DJH A;  3EK7 A;  2K8M B;  2QPT A;  2WCB A;  4GAO A;  4AOM A;  1QAS A;  1J1E A;  2KI4 B;  3I5I B;  3VGO A;  1NWD A;  2BCB A;  3PAT A;  3PSR A;  3VRQ A;  3CR4 X;  4I5J A;  2LM5 A;  1D1O A;  1DF0 B;  1GGZ A;  4WRI A;  1XFZ O;  3CR2 A;  1CDP A;  2BEC A;  2FCD A;  2P6B B;  4AQJ A;  1MR8 A;  1B8L A;  2NLN A;  4ORC B;  4I5L B;  3GOF A;  4FQO A;  2MBX A;  1A2X A;  2JTT A;  3HX4 A;  2MLE C;  4M2P A;  2KDH A;  4PHK A;  3O78 A;  2M29 A;  1BR1 B;  1SYM A;  1XFY O;  1CFD A;  1KSO A;  3TS5 C;  1K8U A;  4YI9 A;  3I5F B;  1ZMZ A;  5JOL A;  1FF1 A;  2WCF A;  1KSM A;  2NCP A;  4PE0 A;  1SPY A;  3KPX A;  2M1K B;  2ZN8 A;  4HRE E;  1EJ3 A;  2LLU A;  1IGV A;  2HET A;  1IKU A;  2K2F A;  1YUT A;  1UHI A;  2CCM A;  2O5G A;  3DVK A;  4A4C A;  2HF5 A;  2Y1N A;  1K94 A;  1MF8 B;  1XO5 A;  3NSL A;  2M0R A;  3WHT B;  1QX5 B;  4M2O A;  1RJV A;  3EVV A;  2JNX A;  2OTG C;  2KFG A;  5KSZ A;  4N1F A;  1ZAC A;  1A03 A;  2BKI B;  1KCY A;  5G08 A;  2AUC A;  1S3P A;  1TCO B;  2L0P A;  2MJW B;  3I5G C;  2GV5 A;  2FCE A;  4MZJ A;  3OX5 A;  1BOC A;  1REC A;  1SCV A;  1TOP A;  2K7C A;  1IQ3 A;  1WRZ A;  2BE4 A;  1SR6 C;  1BT6 A;  1KFU L;  5FYX A;  1H4B A;  1S6I A;  1C07 A;  4CFR A;  1CLB A;  2V53 A;  3CTN A;  2M8U A;  1QIW A;  3ICB A;  3OX6 A;  2ZFD A;  1TN4 A;  3RM1 A;  1QS7 A;  1F70 A;  2CBL A;  2KQY A;  2Y4Q A;  1NSH A;  4JPZ B;  3D0Y A;  3SG5 A;  1F55 A;  2CTN A;  1DF0 A;  3BYA A;  1YVH A;  1NCX A;  4N5X A;  4PDZ A;  1B47 A;  4ZCV A;  1QLS A;  1CNP A;  1JSA A;  3BUW B;  2AAO A;  5CSN A;  2NXQ A;  2K7O A;  1IJ6 A;  2EC6 C;  4NQG A;  2LAP A;  1M39 A;  3OB1 B;  5AEQ A;  1ZUZ A;  2PVB A;  3AAK A;  1J7Q A;  3E3R A;  1YTZ C;  1SNL A;  1S5G Y;  1E8A A;  4GBA A;  2LHI A;  4YI8 A;  5DKR A;  1KWO B;  1NX1 A;  1DJX A;  4R1E A;  3CGA A;  1DJZ A;  2BL0 B;  5KTY A;  4NDD A;  2ZN9 A;  1SBJ A;  1KK8 B;  1K95 A;  1Y1A A;  3A4U B;  3ZWH A;  1LXF C;  1JF2 A;  1F4O A;  1M46 A;  2KFH A;  4L9M A;  1ZFS A;  1A75 A;  1SCM B;  4NDC A;  1FPW A;  2D8N A;  1BF5 A;  1A29 A;  2L50 A;  2Q4U A;  3JVT B;  4GUK A;  4XJK A;  4MVF A;  2OS8 B;  4DIR A;  2QAC A;  1QLK A;  4C0K A;  2LAN A;  3OB2 B;  1BMO A;  2K61 A;  2A4J A;  3KHE A;  1RK9 A;  4PE4 A;  1Y6W A;  3D10 A;  4DCK A;  2JXC A;  3H4S E;  5HKZ A;  2JRF A;  4N1G A;  3WXA A;  3SIB A;  2F2O A;  1NX3 A;  1Y0V H;  2COL B;  1IJ5 A;  5DKN A;  1DVI A;  2LLT A;  1B7T Z;  2MAZ A;  4YGD B;  3TS5 B;  3LK1 A;  1QXP A;  1QJT A;  2MRD A;  1W7J B;  2F8P A;  1SY9 A;  2G2B A;  4PAL A;  4GFT A;  4C0J A;  3M0W A;  1B4C A;  1AHR A;  1EG3 A;  2HPS A;  4Q04 A;  3SG7 A;  5CPV A;  4ETO A;  3TUY B;  4PHJ A;  1TNX A;  2KYF A;  1ZOT B;  3QRX A;  3LLE A;  1MUX A;  1MWN A;  1SRA A;  1J7P A;  1TCF A;  1J7R A;  1R6P A;  1QV1 A;  2KI6 D;  1K2H A;  3BUX B;  1XK4 A;  1F71 A;  1EH2 A;  1K93 D;  1LIN A;  3VRN A;  2G9B A;  2JT8 A;  1IQ5 A;  4CPV A;  1C7W A;  1BR4 B;  2JT0 A;  3D0Y B;  2E6W A;  5CSI A;  4CLN A;  2LNK A;  2BKH B;  2JNF A;  1WLZ A;  1JFK A;  1UUS A;  2JXL A;  2NCO A;  1YX8 A;  1QX7 A;  3CR5 X;  2ZRS A;  3FWC A;  1M63 B;  1F4Q A;  3DVM A;  2JPT A;  1OMV A;  2LP2 A;  1B8R A;  3OHM B;  4E68 A;  3DVJ A;  3AKB A;  3MSE B;  2M7N A;  1SMG A;  1L2O C;  1IH0 A;  2H61 C;  1GJY A;  1WLM A;  2M1U A;  2LVK A;  2MLF C;  4D1E A;  2M97 A;  4DRW A;  1VRK A;  2F2P A;  1UP5 A;  3BOW A;  1K96 A;  1TTX A;  2F3Z A;  1LA3 A;  2SCP A;  1M45 A;  1NX2 A;  2O60 A;  1B7T Y;  4YGB B;  2M3W A;  3EK4 A;  4ORA B;  3I5H B;  4OR9 B;  1PRW A;  3AAJ A;  3BUM B;  4MLW A;  1YUR A;  5KU1 A;  1S1E A;  3PN7 C;  1CKK A;  2EHB A;  3PAL A;  1XFU O;  1A75 B;  2KBI A;  2CXJ A;  1DGU A;  1YUU A;  1PSB A;  5D69 A;  1J55 A;  5TNC A;  2WND A;  1UHJ A;  1UWO A;  4XJK B;  3LCP C;  1KFX S;  2JC2 A;  1MQ1 A;  2LMT A;  3TDU A;  1V1G A;  2KHN A;  1EXR A;  3EK8 A;  1RWY A;  3C1V A;  1JC2 A;  2K7B A;  4M2Q A;  1JUO A;  4CID A;  1YX7 A;  4MZK A;  3IQQ A;  5HKY A;  1WDC C;  1OMR A;  4MBE A;  2KGB C;  1HT9 A;  2LP3 A;  1KQM C;  1XYD A;  3WNX B;  2LVV A;  3K21 A;  2ZND A;  1OE9 B;  5F6T A;  1XFX O;  1G4Y R;  1CDM A;  1KK7 Z;  3AKA A;  4P2Y B;  3FIA A;  1YVL A;  5AER A;  3EKH A;  1CMF A;  3VRP A;  5HLV A;  4CFQ A;  2M49 B;  2KI4 C;  3I5I C;  1ALV A;  5I2O A;  2Y5I A;  2LC5 A;  2ISD A;  1UHH A;  2JT3 A;  4QJ4 B;  3CWG A;  1FW4 A;  4WQ2 A;  3KF9 A;  4GPL B;  3BUN B;  2PSR A;  5HLO A;  5AXI A;  3HCM A;  2JWW A;  2LVI A;  2L5X B;  1JFJ A;  1ALW A;  4ZCU A;  1RFJ A;  5I2L A;  1PAL A;  1S6C A;  2H2K A;  2NZ0 A;  5D7F A;  5ER5 A;  3RLZ A;  1TRF A;  1S36 A;  4MZL A;  3IQO A;  1QIV A;  2CT9 A;  4DS7 A;  2BCA A;  3OP0 A;  1CM1 A;  5BPJ A;  1DT7 B;  1WRL A;  1MHO A;  3SG2 A;  2LMU A;  1NCY A;  1CTR A;  3EVR A;  1KQV A;  1CLL A;  5GQQ C;  3GK4 X;  4MRX A;  2K2A A;  2MHH A;  1WRK A;  4F0Z B;  3DVE A;  3BOW B;  1XFV O;  1L7Z A;  1AVS A;  2FOT A;  2ZKM X;  2E30 A;  2GGZ A;  4IL1 A;  3O6B A;  1SL8 A;  4YGC B;  1NYA A;  1W7I B;  4PE7 A;  1NIW A;  2Y1M A;  1NUB A;  1DJI A;  1EG4 A;  2I94 A;  3EKJ A;  2TN4 A;  3FS7 A;  4GGF C;  3SG6 A;  4JWQ A;  2PRU A;  3JTD C;  3CLN A;  1J1D A;  2L51 A;  1WY9 A;  2PMY A;  5HYD A;  2ZNE A;  1OSA A;  3CS1 A;  4ORB B;  1IRJ A;  1K9U A;  4OCI A;  3WHU B;  1GQM A;  1SK6 D;  1V1F A;  2I2R E;  1F8H A;  2KAY A;  4I5N B;  2ZRT A;  1DJW A;  5CSJ A;  2BBN A;  1H8B A;  2OTG B;  4TNC A;  2R2I A;  4BY5 A;  5CSF A;  3I5G B;  2CNP A;  1SKT A;  5K89 A;  1K90 D;  4WQ3 A;  1WDC B;  1SR6 B;  1B9A A;  1KQM B;  2K0J A;  4UPG A;  3TZ1 A;  2LUC A;  1YRU B;  1AJ5 A;  2KYC A;  2KI6 C;  2LV7 A;  1B8C A;  1B1G A;  1IG5 A;  1OMD A;  1LKJ A;  1Q80 A;  1K9P A;  1KWO C;  1BOD A;  3DF0 B;  2KGR A;  2M7L A;  2BL0 C;  1CFF A;  2LVJ A;  1N2D A;  1CDL A;  1NCZ A;  1KK8 C;  2KOT A;  2JZI A;  2LMV A;  1C7V A;  1TNW A;  1XA5 A;  1FI5 A;  1OQP A;  1R2U A;  1SCM C;  1PVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...