4ZCVA

Structure of calcium-bound regulatory domain of the human atp-mg/pi carrier in the p212121 form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
154
structure length
154
Chain Sequence
PTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
publication title Calcium-induced conformational changes in the regulatory domain of the human mitochondrial ATP-Mg/Pi carrier.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 47
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcvA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcvA02
5KSZA 3CTNA 5I2LA 1SK6D 3AKAA 4PHJA 1NYAA 1QVIY 4XYNA 4OCIA 4A4BA 2JT3A 3JVTC 3D0YA 1PVBA 1L2OC 1XO5A 1SL7A 3C1VA 2KBMA 3VRRA 2OS8C 3TDUA 2L0PA 1MXLC 3BOWB 2Y5IA 3KPXA 4CLNA 1TN4A 2DOQA 2LVJA 4NDBA 1J1EA 3EK4A 4PE4A 2KAYA 1TNXA 2NCOA 3KHEA 3TUYC 1IG5A 2OTGC 1U5IA 3OB2B 1YVLA 1LKJA 4YI9A 1CLBA 1IQ5A 4F0ZB 2BCAA 2F3ZA 4E68A 1QLSA 2BKHB 1QVIZ 1CFDA 4N1GA 4AQIA 1DJGA 3PN7C 1NSHA 4OKHA 2MA2A 3WXAA 1KCYA 1SCMC 2I7AA 3I5IC 1DVIA 1SRAA 2GV5A 1YUUA 1ALVA 2BL0C 5I8NA 4PHMA 4C0JA 2F2OA 2KOTA 2O5GA 2LMTA 4YGCB 1IJ6A 1YX7A 4BY5A 1RJVA 2JXCA 4R1EA 1PSRA 4WQ3A 3SG6A 2IS9A 1S6CA 2JU0A 3CS1A 3TS5C 2M8UA 4PDZA 1K93D 1K95A 1RROA 2BCXA 1UHNA 3BUNB 1BODA 1RTP1 3BQ3A 2I94A 2LVIA 1IWQA 1SR6B 3KO0A 1IGVA 1LINA 4HREE 4BY4A 1F71A 5FYXA 1UHIA 1UUSA 2KI4C 1F8HA 3BOWA 2CTNA 1FPWA 2ZRSA 4M2PA 1PVAA 1NPQA 4ZCUA 2K7CA 5TNCA 1XYDA 5DKQA 1ALWA 3JTDC 3EK7A 1E8AA 1NP8A 4PCWA 1CDNA 5AEQA 2M97A 3HX4A 1S6IA 1SCVA 1DT7B 1TNQA 1MHOA 1AHRA 4DCKA 1BR1B 2LHLA 2LUCA 1J1DA 5DKRA 2ZN8A 2JTTA 3IQQA 3NXAA 2PVBA 1G33A 1NCYA 1A75A 1JFJA 1TNPA 3SG3A 2CBLA 1J55A 2M7NA 1DGUA 1YX8A 2LHIA 2BKIB 3I5GB 1CB1A 2SCPA 2M0RA 3SG5A 1CDLA 1GGZA 1HQVA 5CSNA 2BBMA 4YBHB 1F4QA 5JOLA 5AFPA 4I5JA 1Y1AA 2JNXA 1S5GZ 1YTZC 2JT0A 1DJWA 3DVEA 1QASA 3GK2A 1UHKA 3VRPA 1D1OA 2M9GA 1MQ1A 2KSPA 2Y4QA 1TOPA 1BG1A 1QIWA 3K21A 1AUIB 1G8IA 1U5IB 3KEVA 4JQ0D 4FQOA 2LNKA 1BLQA 1DGVA 2FJUB 2JZIA 1IJ5A 4I5NB 2OPOA 4MEWA 4GUKA 3ICBA 2LVVA 3CLNA 4CPVA 2COLB 1XVJA 4PHKA 5HLVA 4AOMA 3BUOB 1OMRA 3FWBA 2LVKA 4FTGA 3TDZA 1ODBA 1PK0D 2NLNA 1QATA 1L2OB 1WY9A 3OP0A 3VRNA 1J7QA 3I5FC 1WLMA 3CR5X 1Q80A 2LE9B 3TZ1A 2OS8B 2K7OA 2K8MB 1FI5A 1CFPA 3CGAA 5J3XA 1W7IB 1OZSA 1BF5A 1RWYA 5PALA 1YR5A 2K2AA 2V53A 1DJHA 1NWDA 1SW8A 1A4PA 4AQJA 3TUYB 1TTXA 1DJXA 2OTGB 3EVUA 5B8IB 1WRZA 2AAOA 2KHNA 1Y1UA 1KK8B 1QV1A 2E30A 1K9UA 1KQMC 1OSAA 3SG2A 3EKJA 1DJYA 1JSAA 3PN7B 3PFVA 1QTXA 1KFXS 1A29A 1NCXA 3I5IB 2A4JA 2K61A 3WNXB 2JC2A 5HKWA 4MSPA 2NZ0A 2F8PA 1QXPA 1KQVA 3O6BA 2G9BA 4MZKA 4OV2A 1OZOA 1S3PA 2HQWA 2QACA 4DUQA 2CCMA 1NX0A 2L51A 3KF9A 3TS5B 4ORAB 1A75B 1QIVA 3FS7A 2PASA 2EC6B 1CM4A 5BPJA 3M0WA 3PM8A 4MLWA 1BJFA 2KI4B 3EKHA 2BCBA 2SASA 1XFUO 1KWOC 1YVHA 1EXRA 4XJKA 2HQ8A 2EGDA 1B4CA 4TNCA 4GNKB 1MXEA 2MLEC 2M3WA 3O2PA 1DTLA 1WDCC 4QJ5B 1EL4A 1S36A 1KFXL 3GK1A 3JTDB 3O78A 1C7VA 2KQYA 4PE0A 2JOJA 3NSOA 1H8BA 3WHTB 3FIAA 5ER5A 3QRXA 1KFUS 1SNLA 1UWOA 5IBWA 5K89A 4PHNA 1J7RA 1AP4A 5D7FA 5DKNA 1TNWA 4YGBB 2B1UA 1CKKA 2BBNA 1UP5A 2FCEA 2PMYA 2G2BA 2H2KA 5CSIA 1V1FA 1NX2A 4UPGA 2WORA 1ZUZA 2ISDA 1B1GA 2WCBA 2L4IA 5CPVA 4OR9B 1QLKA 2KDHA 2ZNEA 2L50A 2NXQA 2Y1MA 3EK8A 3OB1B 1S5GY 2M1UA 1FBVA 2KBIA 3HCMA 2JPTA 1WRLA 1K9KA 1B9AA 4YGEB 1CMFA 1B8LA 1CLMA 1SR6C 1VRKA 2KI6D 3RM1A 2MLFC 3D10A 2WC8A 3DVJA 3I5HB 4U8DA 2M1KB 4HSZA 3BUMB 4QJ4B 2K7DA 5AXIA 3VROA 1DMOA 1AK8A 2NCPA 4ETOA 4PALA 2FOTA 1V1GA 1YURA 2H61C 1KFUL 1LVCD 1YUTA 1JFKA 4QJ3B 5HKZA 3RLZA 4IL1A 5JJGA 3AAKA 5AERA 1F55A 2WCFA 3OX5A 4P2YB 1SY9A 4YGAA 2JQ6A 1R2UA 1EG4A 4YI8A 1OMVA 1IKUA 4A4CA 4DRWA 4GGFC 4NQGA 2MJWB 4YGDB 3DF0B 1ZFSA 4NDDA 1M31A 1RFJA 2PALA 1CDMA 1DJIA 2WNDA 3ZNIA 3SJSA 4CIDA 2PSRA 1IRJA 1MF8B 2JULA 2KFFA 2VRGA 4L9MA 1CNPA 2I2RE 2Q91A 1NUBA 3CWGA 3I5FB 3F45A 3GOFA 5KU1A 3LCPC 1M46A 2MHHA 3PATA 1AVSA 5G08A 3NSIA 2LP2A 1ZACA 1SL8A 2GGMA 2JNFA 1RK9A 2GGZA 3JVTB 4JWQA 1K94A 2LMVA 5AANA 3SIAA 1F54A 2JRFA 3IF7A 2K2FA 4WQ2A 1K96A 1UURA 1YRUB 1XFYO 4MRYA 1G4YR 1QX5B 4WRIA 3SIBA 1M63B 1KQMB 4XJKB 3SG4A 3LK0A 1JWDA 1AJ4A 4Q04A 4MVFA 3CR2A 1C7WA 1QX7A 1DF0B 1X02A 2LLSA 1SBJA 2Q4UA 2LLUA 1UHHA 1N65A 2MRDA 3BYAA 4ICBA 1B7TY 4ORBB 2ZFDA 3H4SE 3PALA 1MUXA 1OQPA 1SCMB 3DF0A 1SKTA 1RECA 1SYMA 2BECA 1DJZA 1XK4C 3VGOA 1S1EA 2BL0B 1WLZA 1S26D 3PLFB 4GAOA 1BOCA 1BR4B 2F33A 1CTRA 2KAVA 3BUXB 2FCDA 4MRXA 1YRTB 2CNPA 3DD4A 2K0JA 2JWWA 2MAZA 3A4UB 1MR8A 1N2DA 3WHUB 1B47A 1Y6WA 1OMDA 1CMGA 3VRQA 1KK7Y 3E3RA 4GPLB 1KWOB 1NX3A 2BE6A 3AKBA 1GGWA 2L98A 1NIWA 1B7TZ 1M39A 2JT8A 2K7BA 1K90D 2R2IA 5HLOA 1F70A 2Y1NA 1TCOB 2KAXA 3FWCA 2BE4A 2HF5A 1WDCB 1NX1A 2LMUA 4HRHA 4C0KA 1JC2A 2AUCA 1OE9B 1AJ5A 3CZTX 3OX6A 3DVKA 1KK8C 3EVRA 2I18A 1J7OA 2E6WA 2ZRTA 3ZWHA 1W7JB 4D1EA 5GQQC 4MBEA 4N5XA 4CFQA 1DF0A 1GQMA 2ZKMX 1PSBA 1SMGA 2LLTA 1XK4A 3PSRA 1NCZA 1XA5A 1OOJA 3NSKA 2F3YA 1ZOTB 4ZCVA 1XFZO 3BUWB 3LLEA 1KK7Z 1PALA 3GK4X 3LK1A 2M7LA 1TIZA 2LC5A 1N0YA 2KFHA 1FF1A 1K9PA 2LP3A 3AAJA 1L7ZA 5ER4X 2KNEA 1MWNA 4CFRA 3MSEB 2MBXA 2LANA 1KSMA 2LCPA 2ZN9A 4GGNA 2EC6C 4JPZB 2JTZA 1TRFA 4GFTA 5F6TA 1HT9A 1SPYA 1JF2A 1PULA 2PRUA 1QS7A 4MN0A 1A03A 2TN4A 3NSLA 4DS7A 2O60A 4NDCA 4MZJA 2KFGA 3DVMA 1K8UA 1CM1A 2KYFA 5I2OA 1F4OA 5I2QA 2RGIA 4C0LA 1CFFA 4YRUA 2EHBA 1EG3A 1XFVO 4MZLA 1IQ3A 2HETA 5KTYA 3O4YA 2LV7A 1BMOA 2ZNDA 5HYDA 1GJYA 1JF0A 2WCEA 2LAPA 1XFXO 4M2QA 3TDIA 1QV0A 1BT6A 2D8NA 2AMIA 5D69A 4DIRA 4GBAA 4USLA 1K2HA 4I5LB 4P5OE 2CXJA 4I5KA 3A8RA 2JXLA 2KYCA 3BXKA 1TCFA 4PE7A 1QX2A 4N1FA 2L4HA 1IH0A 2LM5A 1CDPA 2WOSA 3CR4X 3D0YB 1FW4A 3I5GC 1H4BA 2CT9A 2KI6C 1LXFC 1PRWA 2M29A 1B8RA 2M49B 4M2OA 3I5HC 2LUXA 1B8CA 2L2EA 5CSJA 1UHJA 2KQ6A 1EH2A 1A2XA 2F2PA 2P6BB 1C07A 3LL8B 1J7PA 1M45A 1ZMZA 2H61A 3SG7A 1R6PA 2KGRA 1CLLA 5HKYA 1LA0A 3IQOA 1EJ3A 5CSFA 1S6JA 2L5XB 2HPSA 1KSOA 1JBAA 1XFWO 3OHMB 4HRGA 4GGFA 2KGBC 2QPTA 1YUSA 1LA3A 4ORCB 1Y0VH 1SL9A 1JUOA 1FI6A 1CFCA 4PE1A 4OVNF 1Y1XA 3EVVA 1BU3A 1QJTA 1WRKA
chains in the Genus database with same CATH superfamily
5KSZA 3CTNA 5I2LA 1SK6D 2WCJA 3NGVA 3AKAA 4PHJA 1NYAA 1QVIY 4XYNA 4OCIA 4A4BA 2JT3A 1Z4HA 3JVTC 3D0YA 1PVBA 1L2OC 1XO5A 1SL7A 3C1VA 2KBMA 3VRRA 3S0AA 4FQTA 2OS8C 3L47A 3TDUA 2L0PA 1MXLC 2WCLA 3BOWB 2Y5IA 3KPXA 4CLNA 1TN4A 2DOQA 2LVJA 4NDBA 1J1EA 3EK4A 4PE4A 1GM0A 2KAYA 1TNXA 2NCOA 3KHEA 5HL1A 4INXA 1IG5A 2OTGC 1U5IA 3OB2B 1OOGA 1LKJA 1YVLA 4YI9A 1IQ5A 1CLBA 4F0ZB 2BCAA 2F3ZA 4E68A 1QLSA 2BKHB 1QVIZ 1CFDA 1OOIX 4N1GA 3CZ2A 4AQIA 1DJGA 3PN7C 1NSHA 4OKHA 2KLDA 2P71A 2MA2A 3WXAA 1KCYA 1SCMC 2I7AA 3I5IC 1DVIA 1SRAA 2GV5A 1YUUA 1ALVA 2BL0C 5I8NA 4PHMA 2KPHA 3UO9A 4C0JA 3PJIA 2F2OA 2KOTA 2O5GA 2LMTA 4YGCB 1IJ6A 1YX7A 4BY5A 1RJVA 2JXCA 3R1VA 1PSRA 4R1EA 4WQ3A 2IS9A 3SG6A 1S6CA 2JU0A 1P28A 3CS1A 3TS5C 2M8UA 4PDZA 1K93D 1K95A 3S0EA 3SS5A 1RROA 2BCXA 1UHNA 3BUNB 2QEBA 4OZDA 1DELA 1RTP1 3BQ3A 1BODA 2I94A 2LVIA 1IWQA 1SR6B 3KO0A 1IGVA 1LINA 4HREE 4BY4A 1F71A 5FYXA 1UHIA 1UUSA 2KI4C 1F8HA 3BOWA 2CTNA 1FPWA 2ZRSA 4M2PA 3DY9A 1PVAA 1NPQA 4ZCUA 2K7CA 5TNCA 1XYDA 5DKQA 1ALWA 3S0GA 3JTDC 3EK7A 1E8AA 1NP8A 4PCWA 1CDNA 5AEQA 2M97A 3HX4A 1S6IA 2H8VA 1SCVA 1DT7B 3BJHA 1TNQA 1MHOA 3NHTA 1AHRA 3CYZA 4DCKA 1BR1B 2LHLA 2LUCA 1J1DA 5DKRA 2ZN8A 3L4LA 2JTTA 3IQQA 3NXAA 2PVBA 1G33A 1NCYA 1A75A 1JFJA 1TNPA 3SG3A 2CBLA 1J55A 2M7NA 1DGUA 1YX8A 2LHIA 2BKIB 3I5GB 1CB1A 3OBVA 3DZTA 2SCPA 4JKTA 2M0RA 3SG5A 1CDLA 1GGZA 1HQVA 5CSNA 2BBMA 4YBHB 1F4QA 5JOLA 5AFPA 4I5JA 2PQLA 1Y1AA 2JNXA 1S5GZ 1YTZC 2JT0A 1DJWA 3DVEA 3S0DA 1QASA 3GK2A 1UHKA 3VRPA 1D1OA 2M9GA 1MQ1A 2KSPA 2Y4QA 1TOPA 1BG1A 1QIWA 3K21A 5FI7A 1AUIB 1G8IA 1U5IB 3KEVA 3BFBA 1OW4A 4JQ0D 4FQOA 2LNKA 1BLQA 1DGVA 2FJUB 2JZIA 3CABA 1IJ5A 4I5NB 4IJ7A 1SSEB 2OPOA 4MEWA 4GUKA 3ICBA 2LVVA 3CLNA 4CPVA 2COLB 1XVJA 4PHKA 5HLVA 4AOMA 3BUOB 1OMRA 3FWBA 2LVKA 4FTGA 3TDZA 1ODBA 1PK0D 1XFRA 2NLNA 1QATA 1L2OB 1WY9A 3OP0A 3VRNA 3CDNA 1J7QA 3FE6A 3I5FC 1WLMA 2BAPA 1W9ZA 1Q80A 2LE9B 3CR5X 3TZ1A 2OS8B 2K7OA 2K8MB 1FI5A 3SS3A 3CGAA 5J3XA 1W7IB 1OZSA 1BF5A 1RWYA 5PALA 1CFPA 1YR5A 2K2AA 2V53A 1DJHA 1NWDA 1SW8A 1A4PA 4AQJA 3TUYB 1TTXA 1DJXA 2OTGB 3EVUA 5B8IB 1WRZA 2AAOA 2KHNA 3D78A 1Y1UA 1KK8B 1QV1A 2E30A 1K9UA 1KQMC 1OSAA 3SG2A 3EKJA 1DJYA 3B86A 1JSAA 3PN7B 3PFVA 1QTXA 1KFXS 1A29A 1NCXA 3I5IB 2A4JA 2K61A 3WNXB 2JC2A 3O4XA 5HKWA 4MSPA 2NZ0A 3S0FA 2F8PA 2KLEA 1QXPA 1KQVA 3O6BA 2G9BA 4MZKA 4OV2A 1OZOA 1S3PA 2HQWA 2QACA 4DUQA 2CCMA 1NX0A 2L51A 3KF9A 3TS5B 4ORAB 3V2LA 1A75B 1QIVA 3FS7A 2PASA 2EC6B 1CM4A 5BPJA 3M0WA 3PM8A 4MLWA 1BJFA 2KI4B 3EKHA 2BCBA 2SASA 1OOHA 1XFUO 1KWOC 1YVHA 3BFAA 3NHIA 1EXRA 4XJKA 2HQ8A 2EGDA 3R1OA 2WC6A 4TNCA 4GNKB 1B4CA 1MXEA 2MLEC 2M3WA 3O2PA 1DTLA 1OOFA 1WDCC 4QJ5B 1EL4A 2P70A 3VB1A 1S36A 1KFXL 3GK1A 3JTDB 3O78A 1C7VA 2KQYA 4PE0A 3B87A 2JOJA 3NSOA 1H8BA 3WHTB 3TUYC 3FIAA 5ER5A 3QRXA 3PM2A 1KFUS 1SNLA 1UWOA 5IBWA 5K89A 4PHNA 1J7RA 1DQEA 1AP4A 5D7FA 5DKNA 2YGUA 3B88A 1TNWA 4YGBB 2B1UA 1CKKA 2BBNA 1UP5A 2FCEA 2PMYA 2G2BA 2H2KA 5CSIA 1V1FA 1NX2A 4UPGA 2WORA 1ZUZA 2ISDA 1B1GA 2WCBA 2L4IA 5CPVA 4OR9B 1QLKA 2KDHA 2WCKA 2ZNEA 2L50A 2NXQA 2Y1MA 3EK8A 3OB1B 1S5GY 2M1UA 1FBVA 2KBIA 3HCMA 2JPTA 1WRLA 1K9KA 1B9AA 4YGEB 2WC5A 3DXLA 1B8LA 1CMFA 2ERBA 1CLMA 3S0BA 1SR6C 1VRKA 2KI6D 3RM1A 2MLFC 3D10A 2WC8A 3DVJA 1TUZA 3I5HB 4U8DA 2M1KB 4HSZA 5FI6A 3BUMB 4INWA 4QJ4B 2K7DA 3BFHA 5AXIA 3VROA 1DMOA 1AK8A 2NCPA 4ETOA 4PALA 2FOTA 1V1GA 1YURA 2H61C 1KFUL 1LVCD 1YUTA 1JFKA 4QJ3B 5HKZA 3RLZA 4IL1A 5JJGA 3AAKA 5AERA 1F55A 2WCFA 3D75A 3OX5A 4P2YB 1SY9A 2K60A 4YGAA 2JQ6A 1R2UA 1EG4A 4YI8A 1OMVA 1IKUA 4A4CA 4DRWA 4GGFC 4NQGA 2MJWB 4YGDB 2L2CA 3DF0B 4KYNA 1ZFSA 4NDDA 1M31A 3D77A 1RFJA 2PALA 1CDMA 1DJIA 2WNDA 3ZNIA 3SJSA 4CIDA 2PSRA 1IRJA 1MF8B 2JULA 2KFFA 2VRGA 4L9MA 1CNPA 2I2RE 2Q91A 2QEOA 1NUBA 3CWGA 3I5FB 3F45A 3GOFA 5KU1A 3LCPC 1M46A 2MHHA 3PATA 1AVSA 5G08A 3NSIA 2LP2A 1ZACA 1SL8A 2GGMA 2JNFA 1RK9A 2GGZA 3JVTB 3EG5B 4JWQA 1K94A 2LMVA 3B6XA 4PT1A 5AANA 2WCHA 5DICA 3SIAA 1F54A 2JRFA 3IF7A 1DEKA 2K2FA 3L4AA 4WQ2A 1K96A 1UURA 1YRUB 1XFYO 4MRYA 1G4YR 1QX5B 4WRIA 3SIBA 1M63B 1KQMB 4XJKB 3SG4A 3LK0A 1JWDA 1AJ4A 4Q04A 4MVFA 3CR2A 1C7WA 1QX7A 1DF0B 3IVTA 1X02A 3OGNA 2LLSA 1SBJA 1T14A 2Q4UA 2LLUA 1UHHA 1LS8A 1N65A 2MRDA 3BYAA 1B7TY 4ICBA 3N7HA 4JD9A 4ORBB 2ZFDA 3H4SE 3PALA 2QEHA 1MUXA 1OQPA 1SCMB 3DF0A 1SKTA 1RECA 1SYMA 2BECA 5EL2A 1DJZA 1XK4C 3VGOA 1S1EA 2BL0B 1WLZA 1S26D 3PLFB 4GAOA 1BOCA 1BR4B 2F33A 1CTRA 2KAVA 3BUXB 2FCDA 4MRXA 1YRTB 2CNPA 3DD4A 2K0JA 2JWWA 2MAZA 3A4UB 1MR8A 1N2DA 3WHUB 1B47A 1Y6WA 1OMDA 1CMGA 3VRQA 1KK7Y 1TWOA 3E3RA 4GPLB 1KWOB 1C3ZA 1NX3A 2BE6A 3AKBA 1GGWA 2L98A 1NIWA 1B7TZ 1M39A 2JT8A 2K7BA 1K90D 2R2IA 5HLOA 1F70A 2Y1NA 1TCOB 2KAXA 3FWCA 2BE4A 2HF5A 1WDCB 1NX1A 2LMUA 4HRHA 4C0KA 1JC2A 1OE9B 1AJ5A 2AUCA 3CZTX 3OX6A 3DVKA 1KK8C 3EVRA 3K1EA 2I18A 1J7OA 2E6WA 2ZRTA 3ZWHA 1W7JB 4D1EA 5GQQC 4MBEA 4N5XA 4CFQA 1DF0A 1GQMA 2ZKMX 1PSBA 1SMGA 2LLTA 1XK4A 3PSRA 1NCZA 1XA5A 1OOJA 3NSKA 2F3YA 1ZOTB 4ZCVA 1XFZO 3BUWB 3LLEA 1KK7Z 1PALA 3GK4X 3LK1A 5FI2A 2M7LA 1TIZA 2LC5A 1N0YA 2KFHA 1Z2CB 1TUJA 3D76A 3B7AA 1FF1A 1K9PA 2LP3A 3AAJA 1L7ZA 5ER4X 2KNEA 1MWNA 4CFRA 1C3YA 3MSEB 2MBXA 2LANA 1ORGA 1KSMA 2LCPA 2QDIA 2ZN9A 4GGNA 2EC6C 4JPZB 2JTZA 1TRFA 4GFTA 5F6TA 3SS4A 1HT9A 1SPYA 1JF2A 1PULA 2PRUA 1QS7A 4MN0A 1A03A 2TN4A 3FE9A 3NSLA 4DS7A 2O60A 4NDCA 4MZJA 2KFGA 3DVMA 1K8UA 1CM1A 2KYFA 5I2OA 1F4OA 5I2QA 2RGIA 3UNWA 4C0LA 3RZSA 1CFFA 4YRUA 2EHBA 1EG3A 1XFVO 3R1PA 4MZLA 1IQ3A 2HETA 5KTYA 3FE8A 3O4YA 2LV7A 1BMOA 2ZNDA 5HYDA 1GJYA 1JF0A 2WCEA 5I94A 2LAPA 1XFXO 4M2QA 3TDIA 1QV0A 1BT6A 2D8NA 2AMIA 5D69A 4DIRA 4GBAA 4USLA 1K2HA 2JPOA 1IIOA 4I5LB 4P5OE 2CXJA 4I5KA 3A8RA 2JXLA 4F7FA 2KYCA 3BXKA 1TCFA 4PE7A 1QX2A 4N1FA 2L4HA 1IH0A 2WCMA 2LM5A 3CZ1A 1CDPA 2WOSA 3CR4X 3D0YB 1FW4A 3I5GC 1H4BA 2CT9A 2KI6C 1LXFC 1PRWA 2L5YA 1B8RA 2M29A 2M49B 4M2OA 3I5HC 3DYEA 2LUXA 1B8CA 2L2EA 3R72A 5CSJA 3D74A 1UHJA 2KQ6A 1EH2A 1A2XA 2F2PA 2P6BB 2PYQA 1DC1A 2BNXA 1C07A 3LL8B 1J7PA 1M45A 1ZMZA 2H61A 2GTEA 3SG7A 1R6PA 2KGRA 1CLLA 5HKYA 1LA0A 2QEVA 3IQOA 1EJ3A 2FJYA 5CSFA 1S6JA 2L5XB 2HPSA 1KSOA 1JBAA 1XFWO 3OHMB 1QWVA 3Q8IA 4GGFA 4HRGA 2KGBC 2QPTA 1YUSA 1LA3A 4ORCB 1Y0VH 3QMEA 1SL9A 5D3OA 1JUOA 1FI6A 1CFCA 4PE1A 3CZ0A 4OVNF 1Y1XA 3EVVA 3D73A 1BU3A 1QJTA 1WRKA
chains in the Genus database with same CATH topology
5KSZA 3CTNA 5I2LA 1SK6D 3AKAA 4PHJA 1NYAA 1QVIY 4XYNA 4OCIA 4A4BA 2JT3A 3JVTC 3D0YA 1PVBA 1L2OC 1XO5A 1SL7A 3C1VA 2KBMA 3VRRA 2OS8C 3TDUA 2L0PA 1MXLC 3BOWB 2Y5IA 3KPXA 4CLNA 1TN4A 2DOQA 2LVJA 4NDBA 1J1EA 3EK4A 4PE4A 2KAYA 1TNXA 2NCOA 3KHEA 3TUYC 1IG5A 2OTGC 1U5IA 3OB2B 1YVLA 1LKJA 4YI9A 1CLBA 1IQ5A 4F0ZB 2BCAA 2F3ZA 4E68A 1QLSA 2BKHB 1QVIZ 1CFDA 4N1GA 4AQIA 1DJGA 3PN7C 1NSHA 4OKHA 2MA2A 3WXAA 1KCYA 1SCMC 2I7AA 3I5IC 1DVIA 1SRAA 2GV5A 1YUUA 1ALVA 2BL0C 5I8NA 4PHMA 4C0JA 2F2OA 2KOTA 2O5GA 2LMTA 4YGCB 1IJ6A 1YX7A 4BY5A 1RJVA 2JXCA 4R1EA 1PSRA 4WQ3A 3SG6A 2IS9A 1S6CA 2JU0A 3CS1A 3TS5C 2M8UA 4PDZA 1K93D 1K95A 1RROA 2BCXA 1UHNA 3BUNB 1BODA 1RTP1 3BQ3A 2I94A 2LVIA 1IWQA 1SR6B 3KO0A 1IGVA 1LINA 4HREE 4BY4A 1F71A 5FYXA 1UHIA 1UUSA 2KI4C 1F8HA 3BOWA 2CTNA 1FPWA 2ZRSA 4M2PA 1PVAA 1NPQA 4ZCUA 2K7CA 5TNCA 1XYDA 5DKQA 1ALWA 3JTDC 3EK7A 1E8AA 1NP8A 4PCWA 1CDNA 5AEQA 2M97A 3HX4A 1S6IA 1SCVA 1DT7B 1TNQA 1MHOA 1AHRA 4DCKA 1BR1B 2LHLA 2LUCA 1J1DA 5DKRA 2ZN8A 2JTTA 3IQQA 3NXAA 2PVBA 1G33A 1NCYA 1A75A 1JFJA 1TNPA 3SG3A 2CBLA 1J55A 2M7NA 1DGUA 1YX8A 2LHIA 2BKIB 3I5GB 1CB1A 2SCPA 2M0RA 3SG5A 1CDLA 1GGZA 1HQVA 5CSNA 2BBMA 4YBHB 1F4QA 5JOLA 5AFPA 4I5JA 1Y1AA 2JNXA 1S5GZ 1YTZC 2JT0A 1DJWA 3DVEA 1QASA 3GK2A 1UHKA 3VRPA 1D1OA 2M9GA 1MQ1A 2KSPA 2Y4QA 1TOPA 1BG1A 1QIWA 3K21A 1AUIB 1G8IA 1U5IB 3KEVA 4JQ0D 4FQOA 2LNKA 1BLQA 1DGVA 2FJUB 2JZIA 1IJ5A 4I5NB 2OPOA 4MEWA 4GUKA 3ICBA 2LVVA 3CLNA 4CPVA 2COLB 1XVJA 4PHKA 5HLVA 4AOMA 3BUOB 1OMRA 3FWBA 2LVKA 4FTGA 3TDZA 1ODBA 1PK0D 2NLNA 1QATA 1L2OB 1WY9A 3OP0A 3VRNA 1J7QA 3I5FC 1WLMA 3CR5X 1Q80A 2LE9B 3TZ1A 2OS8B 2K7OA 2K8MB 1FI5A 1CFPA 3CGAA 5J3XA 1W7IB 1OZSA 1BF5A 1RWYA 5PALA 1YR5A 2K2AA 2V53A 1DJHA 1NWDA 1SW8A 1A4PA 4AQJA 3TUYB 1TTXA 1DJXA 2OTGB 3EVUA 5B8IB 1WRZA 2AAOA 2KHNA 1Y1UA 1KK8B 1QV1A 2E30A 1K9UA 1KQMC 1OSAA 3SG2A 3EKJA 1DJYA 1JSAA 3PN7B 3PFVA 1QTXA 1KFXS 1A29A 1NCXA 3I5IB 2A4JA 2K61A 3WNXB 2JC2A 5HKWA 4MSPA 2NZ0A 2F8PA 1QXPA 1KQVA 3O6BA 2G9BA 4MZKA 4OV2A 1OZOA 1S3PA 2HQWA 2QACA 4DUQA 2CCMA 1NX0A 2L51A 3KF9A 3TS5B 4ORAB 1A75B 1QIVA 3FS7A 2PASA 2EC6B 1CM4A 5BPJA 3M0WA 3PM8A 4MLWA 1BJFA 2KI4B 3EKHA 2BCBA 2SASA 1XFUO 1KWOC 1YVHA 1EXRA 4XJKA 2HQ8A 2EGDA 1B4CA 4TNCA 4GNKB 1MXEA 2MLEC 2M3WA 3O2PA 1DTLA 1WDCC 4QJ5B 1EL4A 1S36A 1KFXL 3GK1A 3JTDB 3O78A 1C7VA 2KQYA 4PE0A 2JOJA 3NSOA 1H8BA 3WHTB 3FIAA 5ER5A 3QRXA 1KFUS 1SNLA 1UWOA 5IBWA 5K89A 4PHNA 1J7RA 1AP4A 5D7FA 5DKNA 1TNWA 4YGBB 2B1UA 1CKKA 2BBNA 1UP5A 2FCEA 2PMYA 2G2BA 2H2KA 5CSIA 1V1FA 1NX2A 4UPGA 2WORA 1ZUZA 2ISDA 1B1GA 2WCBA 2L4IA 5CPVA 4OR9B 1QLKA 2KDHA 2ZNEA 2L50A 2NXQA 2Y1MA 3EK8A 3OB1B 1S5GY 2M1UA 1FBVA 2KBIA 3HCMA 2JPTA 1WRLA 1K9KA 1B9AA 4YGEB 1CMFA 1B8LA 1CLMA 1SR6C 1VRKA 2KI6D 3RM1A 2MLFC 3D10A 2WC8A 3DVJA 3I5HB 4U8DA 2M1KB 4HSZA 3BUMB 4QJ4B 2K7DA 5AXIA 3VROA 1DMOA 1AK8A 2NCPA 4ETOA 4PALA 2FOTA 1V1GA 1YURA 2H61C 1KFUL 1LVCD 1YUTA 1JFKA 4QJ3B 5HKZA 3RLZA 4IL1A 5JJGA 3AAKA 5AERA 1F55A 2WCFA 3OX5A 4P2YB 1SY9A 4YGAA 2JQ6A 1R2UA 1EG4A 4YI8A 1OMVA 1IKUA 4A4CA 4DRWA 4GGFC 4NQGA 2MJWB 4YGDB 3DF0B 1ZFSA 4NDDA 1M31A 1RFJA 2PALA 1CDMA 1DJIA 2WNDA 3ZNIA 3SJSA 4CIDA 2PSRA 1IRJA 1MF8B 2JULA 2KFFA 2VRGA 4L9MA 1CNPA 2I2RE 2Q91A 1NUBA 3CWGA 3I5FB 3F45A 3GOFA 5KU1A 3LCPC 1M46A 2MHHA 3PATA 1AVSA 5G08A 3NSIA 2LP2A 1ZACA 1SL8A 2GGMA 2JNFA 1RK9A 2GGZA 3JVTB 4JWQA 1K94A 2LMVA 5AANA 3SIAA 1F54A 2JRFA 3IF7A 2K2FA 4WQ2A 1K96A 1UURA 1YRUB 1XFYO 4MRYA 1G4YR 1QX5B 4WRIA 3SIBA 1M63B 1KQMB 4XJKB 3SG4A 3LK0A 1JWDA 1AJ4A 4Q04A 4MVFA 3CR2A 1C7WA 1QX7A 1DF0B 1X02A 2LLSA 1SBJA 2Q4UA 2LLUA 1UHHA 1N65A 2MRDA 3BYAA 4ICBA 1B7TY 4ORBB 2ZFDA 3H4SE 3PALA 1MUXA 1OQPA 1SCMB 3DF0A 1SKTA 1RECA 1SYMA 2BECA 1DJZA 1XK4C 3VGOA 1S1EA 2BL0B 1WLZA 1S26D 3PLFB 4GAOA 1BOCA 1BR4B 2F33A 1CTRA 2KAVA 3BUXB 2FCDA 4MRXA 1YRTB 2CNPA 3DD4A 2K0JA 2JWWA 2MAZA 3A4UB 1MR8A 1N2DA 3WHUB 1B47A 1Y6WA 1OMDA 1CMGA 3VRQA 1KK7Y 3E3RA 4GPLB 1KWOB 1NX3A 2BE6A 3AKBA 1GGWA 2L98A 1NIWA 1B7TZ 1M39A 2JT8A 2K7BA 1K90D 2R2IA 5HLOA 1F70A 2Y1NA 1TCOB 2KAXA 3FWCA 2BE4A 2HF5A 1WDCB 1NX1A 2LMUA 4HRHA 4C0KA 1JC2A 2AUCA 1OE9B 1AJ5A 3CZTX 3OX6A 3DVKA 1KK8C 3EVRA 2I18A 1J7OA 2E6WA 2ZRTA 3ZWHA 1W7JB 4D1EA 5GQQC 4MBEA 4N5XA 4CFQA 1DF0A 1GQMA 2ZKMX 1PSBA 1SMGA 2LLTA 1XK4A 3PSRA 1NCZA 1XA5A 1OOJA 3NSKA 2F3YA 1ZOTB 4ZCVA 1XFZO 3BUWB 3LLEA 1KK7Z 1PALA 3GK4X 3LK1A 2M7LA 1TIZA 2LC5A 1N0YA 2KFHA 1FF1A 1K9PA 2LP3A 3AAJA 1L7ZA 5ER4X 2KNEA 1MWNA 4CFRA 3MSEB 2MBXA 2LANA 1KSMA 2LCPA 2ZN9A 4GGNA 2EC6C 4JPZB 2JTZA 1TRFA 4GFTA 5F6TA 1HT9A 1SPYA 1JF2A 1PULA 2PRUA 1QS7A 4MN0A 1A03A 2TN4A 3NSLA 4DS7A 2O60A 4NDCA 4MZJA 2KFGA 3DVMA 1K8UA 1CM1A 2KYFA 5I2OA 1F4OA 5I2QA 2RGIA 4C0LA 1CFFA 4YRUA 2EHBA 1EG3A 1XFVO 4MZLA 1IQ3A 2HETA 5KTYA 3O4YA 2LV7A 1BMOA 2ZNDA 5HYDA 1GJYA 1JF0A 2WCEA 2LAPA 1XFXO 4M2QA 3TDIA 1QV0A 1BT6A 2D8NA 2AMIA 5D69A 4DIRA 4GBAA 4USLA 1K2HA 4I5LB 4P5OE 2CXJA 4I5KA 3A8RA 2JXLA 2KYCA 3BXKA 1TCFA 4PE7A 1QX2A 4N1FA 2L4HA 1IH0A 2LM5A 1CDPA 2WOSA 3CR4X 3D0YB 1FW4A 3I5GC 1H4BA 2CT9A 2KI6C 1LXFC 1PRWA 2M29A 1B8RA 2M49B 4M2OA 3I5HC 2LUXA 1B8CA 2L2EA 5CSJA 1UHJA 2KQ6A 1EH2A 1A2XA 2F2PA 2P6BB 1C07A 3LL8B 1J7PA 1M45A 1ZMZA 2H61A 3SG7A 1R6PA 2KGRA 1CLLA 5HKYA 1LA0A 3IQOA 1EJ3A 5CSFA 1S6JA 2L5XB 2HPSA 1KSOA 1JBAA 1XFWO 3OHMB 4HRGA 4GGFA 2KGBC 2QPTA 1YUSA 1LA3A 4ORCB 1Y0VH 1SL9A 1JUOA 1FI6A 1CFCA 4PE1A 4OVNF 1Y1XA 3EVVA 1BU3A 1QJTA 1WRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KSZ A;  3CTN A;  5I2L A;  1SK6 D;  3AKA A;  4PHJ A;  1NYA A;  1QVI Y;  4XYN A;  4OCI A;  4A4B A;  2JT3 A;  3JVT C;  3D0Y A;  1PVB A;  1L2O C;  1XO5 A;  1SL7 A;  3C1V A;  2KBM A;  3VRR A;  2OS8 C;  3TDU A;  2L0P A;  1MXL C;  3BOW B;  2Y5I A;  3KPX A;  4CLN A;  1TN4 A;  2DOQ A;  2LVJ A;  4NDB A;  1J1E A;  3EK4 A;  4PE4 A;  2KAY A;  1TNX A;  2NCO A;  3KHE A;  3TUY C;  1IG5 A;  2OTG C;  1U5I A;  3OB2 B;  1YVL A;  1LKJ A;  4YI9 A;  1CLB A;  1IQ5 A;  4F0Z B;  2BCA A;  2F3Z A;  4E68 A;  1QLS A;  2BKH B;  1QVI Z;  1CFD A;  4N1G A;  4AQI A;  1DJG A;  3PN7 C;  1NSH A;  4OKH A;  2MA2 A;  3WXA A;  1KCY A;  1SCM C;  2I7A A;  3I5I C;  1DVI A;  1SRA A;  2GV5 A;  1YUU A;  1ALV A;  2BL0 C;  5I8N A;  4PHM A;  4C0J A;  2F2O A;  2KOT A;  2O5G A;  2LMT A;  4YGC B;  1IJ6 A;  1YX7 A;  4BY5 A;  1RJV A;  2JXC A;  4R1E A;  1PSR A;  4WQ3 A;  3SG6 A;  2IS9 A;  1S6C A;  2JU0 A;  3CS1 A;  3TS5 C;  2M8U A;  4PDZ A;  1K93 D;  1K95 A;  1RRO A;  2BCX A;  1UHN A;  3BUN B;  1BOD A;  1RTP 1;  3BQ3 A;  2I94 A;  2LVI A;  1IWQ A;  1SR6 B;  3KO0 A;  1IGV A;  1LIN A;  4HRE E;  4BY4 A;  1F71 A;  5FYX A;  1UHI A;  1UUS A;  2KI4 C;  1F8H A;  3BOW A;  2CTN A;  1FPW A;  2ZRS A;  4M2P A;  1PVA A;  1NPQ A;  4ZCU A;  2K7C A;  5TNC A;  1XYD A;  5DKQ A;  1ALW A;  3JTD C;  3EK7 A;  1E8A A;  1NP8 A;  4PCW A;  1CDN A;  5AEQ A;  2M97 A;  3HX4 A;  1S6I A;  1SCV A;  1DT7 B;  1TNQ A;  1MHO A;  1AHR A;  4DCK A;  1BR1 B;  2LHL A;  2LUC A;  1J1D A;  5DKR A;  2ZN8 A;  2JTT A;  3IQQ A;  3NXA A;  2PVB A;  1G33 A;  1NCY A;  1A75 A;  1JFJ A;  1TNP A;  3SG3 A;  2CBL A;  1J55 A;  2M7N A;  1DGU A;  1YX8 A;  2LHI A;  2BKI B;  3I5G B;  1CB1 A;  2SCP A;  2M0R A;  3SG5 A;  1CDL A;  1GGZ A;  1HQV A;  5CSN A;  2BBM A;  4YBH B;  1F4Q A;  5JOL A;  5AFP A;  4I5J A;  1Y1A A;  2JNX A;  1S5G Z;  1YTZ C;  2JT0 A;  1DJW A;  3DVE A;  1QAS A;  3GK2 A;  1UHK A;  3VRP A;  1D1O A;  2M9G A;  1MQ1 A;  2KSP A;  2Y4Q A;  1TOP A;  1BG1 A;  1QIW A;  3K21 A;  1AUI B;  1G8I A;  1U5I B;  3KEV A;  4JQ0 D;  4FQO A;  2LNK A;  1BLQ A;  1DGV A;  2FJU B;  2JZI A;  1IJ5 A;  4I5N B;  2OPO A;  4MEW A;  4GUK A;  3ICB A;  2LVV A;  3CLN A;  4CPV A;  2COL B;  1XVJ A;  4PHK A;  5HLV A;  4AOM A;  3BUO B;  1OMR A;  3FWB A;  2LVK A;  4FTG A;  3TDZ A;  1ODB A;  1PK0 D;  2NLN A;  1QAT A;  1L2O B;  1WY9 A;  3OP0 A;  3VRN A;  1J7Q A;  3I5F C;  1WLM A;  3CR5 X;  1Q80 A;  2LE9 B;  3TZ1 A;  2OS8 B;  2K7O A;  2K8M B;  1FI5 A;  1CFP A;  3CGA A;  5J3X A;  1W7I B;  1OZS A;  1BF5 A;  1RWY A;  5PAL A;  1YR5 A;  2K2A A;  2V53 A;  1DJH A;  1NWD A;  1SW8 A;  1A4P A;  4AQJ A;  3TUY B;  1TTX A;  1DJX A;  2OTG B;  3EVU A;  5B8I B;  1WRZ A;  2AAO A;  2KHN A;  1Y1U A;  1KK8 B;  1QV1 A;  2E30 A;  1K9U A;  1KQM C;  1OSA A;  3SG2 A;  3EKJ A;  1DJY A;  1JSA A;  3PN7 B;  3PFV A;  1QTX A;  1KFX S;  1A29 A;  1NCX A;  3I5I B;  2A4J A;  2K61 A;  3WNX B;  2JC2 A;  5HKW A;  4MSP A;  2NZ0 A;  2F8P A;  1QXP A;  1KQV A;  3O6B A;  2G9B A;  4MZK A;  4OV2 A;  1OZO A;  1S3P A;  2HQW A;  2QAC A;  4DUQ A;  2CCM A;  1NX0 A;  2L51 A;  3KF9 A;  3TS5 B;  4ORA B;  1A75 B;  1QIV A;  3FS7 A;  2PAS A;  2EC6 B;  1CM4 A;  5BPJ A;  3M0W A;  3PM8 A;  4MLW A;  1BJF A;  2KI4 B;  3EKH A;  2BCB A;  2SAS A;  1XFU O;  1KWO C;  1YVH A;  1EXR A;  4XJK A;  2HQ8 A;  2EGD A;  1B4C A;  4TNC A;  4GNK B;  1MXE A;  2MLE C;  2M3W A;  3O2P A;  1DTL A;  1WDC C;  4QJ5 B;  1EL4 A;  1S36 A;  1KFX L;  3GK1 A;  3JTD B;  3O78 A;  1C7V A;  2KQY A;  4PE0 A;  2JOJ A;  3NSO A;  1H8B A;  3WHT B;  3FIA A;  5ER5 A;  3QRX A;  1KFU S;  1SNL A;  1UWO A;  5IBW A;  5K89 A;  4PHN A;  1J7R A;  1AP4 A;  5D7F A;  5DKN A;  1TNW A;  4YGB B;  2B1U A;  1CKK A;  2BBN A;  1UP5 A;  2FCE A;  2PMY A;  2G2B A;  2H2K A;  5CSI A;  1V1F A;  1NX2 A;  4UPG A;  2WOR A;  1ZUZ A;  2ISD A;  1B1G A;  2WCB A;  2L4I A;  5CPV A;  4OR9 B;  1QLK A;  2KDH A;  2ZNE A;  2L50 A;  2NXQ A;  2Y1M A;  3EK8 A;  3OB1 B;  1S5G Y;  2M1U A;  1FBV A;  2KBI A;  3HCM A;  2JPT A;  1WRL A;  1K9K A;  1B9A A;  4YGE B;  1CMF A;  1B8L A;  1CLM A;  1SR6 C;  1VRK A;  2KI6 D;  3RM1 A;  2MLF C;  3D10 A;  2WC8 A;  3DVJ A;  3I5H B;  4U8D A;  2M1K B;  4HSZ A;  3BUM B;  4QJ4 B;  2K7D A;  5AXI A;  3VRO A;  1DMO A;  1AK8 A;  2NCP A;  4ETO A;  4PAL A;  2FOT A;  1V1G A;  1YUR A;  2H61 C;  1KFU L;  1LVC D;  1YUT A;  1JFK A;  4QJ3 B;  5HKZ A;  3RLZ A;  4IL1 A;  5JJG A;  3AAK A;  5AER A;  1F55 A;  2WCF A;  3OX5 A;  4P2Y B;  1SY9 A;  4YGA A;  2JQ6 A;  1R2U A;  1EG4 A;  4YI8 A;  1OMV A;  1IKU A;  4A4C A;  4DRW A;  4GGF C;  4NQG A;  2MJW B;  4YGD B;  3DF0 B;  1ZFS A;  4NDD A;  1M31 A;  1RFJ A;  2PAL A;  1CDM A;  1DJI A;  2WND A;  3ZNI A;  3SJS A;  4CID A;  2PSR A;  1IRJ A;  1MF8 B;  2JUL A;  2KFF A;  2VRG A;  4L9M A;  1CNP A;  2I2R E;  2Q91 A;  1NUB A;  3CWG A;  3I5F B;  3F45 A;  3GOF A;  5KU1 A;  3LCP C;  1M46 A;  2MHH A;  3PAT A;  1AVS A;  5G08 A;  3NSI A;  2LP2 A;  1ZAC A;  1SL8 A;  2GGM A;  2JNF A;  1RK9 A;  2GGZ A;  3JVT B;  4JWQ A;  1K94 A;  2LMV A;  5AAN A;  3SIA A;  1F54 A;  2JRF A;  3IF7 A;  2K2F A;  4WQ2 A;  1K96 A;  1UUR A;  1YRU B;  1XFY O;  4MRY A;  1G4Y R;  1QX5 B;  4WRI A;  3SIB A;  1M63 B;  1KQM B;  4XJK B;  3SG4 A;  3LK0 A;  1JWD A;  1AJ4 A;  4Q04 A;  4MVF A;  3CR2 A;  1C7W A;  1QX7 A;  1DF0 B;  1X02 A;  2LLS A;  1SBJ A;  2Q4U A;  2LLU A;  1UHH A;  1N65 A;  2MRD A;  3BYA A;  4ICB A;  1B7T Y;  4ORB B;  2ZFD A;  3H4S E;  3PAL A;  1MUX A;  1OQP A;  1SCM B;  3DF0 A;  1SKT A;  1REC A;  1SYM A;  2BEC A;  1DJZ A;  1XK4 C;  3VGO A;  1S1E A;  2BL0 B;  1WLZ A;  1S26 D;  3PLF B;  4GAO A;  1BOC A;  1BR4 B;  2F33 A;  1CTR A;  2KAV A;  3BUX B;  2FCD A;  4MRX A;  1YRT B;  2CNP A;  3DD4 A;  2K0J A;  2JWW A;  2MAZ A;  3A4U B;  1MR8 A;  1N2D A;  3WHU B;  1B47 A;  1Y6W A;  1OMD A;  1CMG A;  3VRQ A;  1KK7 Y;  3E3R A;  4GPL B;  1KWO B;  1NX3 A;  2BE6 A;  3AKB A;  1GGW A;  2L98 A;  1NIW A;  1B7T Z;  1M39 A;  2JT8 A;  2K7B A;  1K90 D;  2R2I A;  5HLO A;  1F70 A;  2Y1N A;  1TCO B;  2KAX A;  3FWC A;  2BE4 A;  2HF5 A;  1WDC B;  1NX1 A;  2LMU A;  4HRH A;  4C0K A;  1JC2 A;  2AUC A;  1OE9 B;  1AJ5 A;  3CZT X;  3OX6 A;  3DVK A;  1KK8 C;  3EVR A;  2I18 A;  1J7O A;  2E6W A;  2ZRT A;  3ZWH A;  1W7J B;  4D1E A;  5GQQ C;  4MBE A;  4N5X A;  4CFQ A;  1DF0 A;  1GQM A;  2ZKM X;  1PSB A;  1SMG A;  2LLT A;  1XK4 A;  3PSR A;  1NCZ A;  1XA5 A;  1OOJ A;  3NSK A;  2F3Y A;  1ZOT B;  4ZCV A;  1XFZ O;  3BUW B;  3LLE A;  1KK7 Z;  1PAL A;  3GK4 X;  3LK1 A;  2M7L A;  1TIZ A;  2LC5 A;  1N0Y A;  2KFH A;  1FF1 A;  1K9P A;  2LP3 A;  3AAJ A;  1L7Z A;  5ER4 X;  2KNE A;  1MWN A;  4CFR A;  3MSE B;  2MBX A;  2LAN A;  1KSM A;  2LCP A;  2ZN9 A;  4GGN A;  2EC6 C;  4JPZ B;  2JTZ A;  1TRF A;  4GFT A;  5F6T A;  1HT9 A;  1SPY A;  1JF2 A;  1PUL A;  2PRU A;  1QS7 A;  4MN0 A;  1A03 A;  2TN4 A;  3NSL A;  4DS7 A;  2O60 A;  4NDC A;  4MZJ A;  2KFG A;  3DVM A;  1K8U A;  1CM1 A;  2KYF A;  5I2O A;  1F4O A;  5I2Q A;  2RGI A;  4C0L A;  1CFF A;  4YRU A;  2EHB A;  1EG3 A;  1XFV O;  4MZL A;  1IQ3 A;  2HET A;  5KTY A;  3O4Y A;  2LV7 A;  1BMO A;  2ZND A;  5HYD A;  1GJY A;  1JF0 A;  2WCE A;  2LAP A;  1XFX O;  4M2Q A;  3TDI A;  1QV0 A;  1BT6 A;  2D8N A;  2AMI A;  5D69 A;  4DIR A;  4GBA A;  4USL A;  1K2H A;  4I5L B;  4P5O E;  2CXJ A;  4I5K A;  3A8R A;  2JXL A;  2KYC A;  3BXK A;  1TCF A;  4PE7 A;  1QX2 A;  4N1F A;  2L4H A;  1IH0 A;  2LM5 A;  1CDP A;  2WOS A;  3CR4 X;  3D0Y B;  1FW4 A;  3I5G C;  1H4B A;  2CT9 A;  2KI6 C;  1LXF C;  1PRW A;  2M29 A;  1B8R A;  2M49 B;  4M2O A;  3I5H C;  2LUX A;  1B8C A;  2L2E A;  5CSJ A;  1UHJ A;  2KQ6 A;  1EH2 A;  1A2X A;  2F2P A;  2P6B B;  1C07 A;  3LL8 B;  1J7P A;  1M45 A;  1ZMZ A;  2H61 A;  3SG7 A;  1R6P A;  2KGR A;  1CLL A;  5HKY A;  1LA0 A;  3IQO A;  1EJ3 A;  5CSF A;  1S6J A;  2L5X B;  2HPS A;  1KSO A;  1JBA A;  1XFW O;  3OHM B;  4HRG A;  4GGF A;  2KGB C;  2QPT A;  1YUS A;  1LA3 A;  4ORC B;  1Y0V H;  1SL9 A;  1JUO A;  1FI6 A;  1CFC A;  4PE1 A;  4OVN F;  1Y1X A;  3EVV A;  1BU3 A;  1QJT A;  1WRK A; 
#chains in the Genus database with same CATH topology
 5KSZ A;  3CTN A;  5I2L A;  1SK6 D;  2WCJ A;  3NGV A;  3AKA A;  4PHJ A;  1NYA A;  1QVI Y;  4XYN A;  4OCI A;  4A4B A;  2JT3 A;  1Z4H A;  3JVT C;  3D0Y A;  1PVB A;  1L2O C;  1XO5 A;  1SL7 A;  3C1V A;  2KBM A;  3VRR A;  3S0A A;  4FQT A;  2OS8 C;  3L47 A;  3TDU A;  2L0P A;  1MXL C;  2WCL A;  3BOW B;  2Y5I A;  3KPX A;  4CLN A;  1TN4 A;  2DOQ A;  2LVJ A;  4NDB A;  1J1E A;  3EK4 A;  4PE4 A;  1GM0 A;  2KAY A;  1TNX A;  2NCO A;  3KHE A;  5HL1 A;  4INX A;  1IG5 A;  2OTG C;  1U5I A;  3OB2 B;  1OOG A;  1LKJ A;  1YVL A;  4YI9 A;  1IQ5 A;  1CLB A;  4F0Z B;  2BCA A;  2F3Z A;  4E68 A;  1QLS A;  2BKH B;  1QVI Z;  1CFD A;  1OOI X;  4N1G A;  3CZ2 A;  4AQI A;  1DJG A;  3PN7 C;  1NSH A;  4OKH A;  2KLD A;  2P71 A;  2MA2 A;  3WXA A;  1KCY A;  1SCM C;  2I7A A;  3I5I C;  1DVI A;  1SRA A;  2GV5 A;  1YUU A;  1ALV A;  2BL0 C;  5I8N A;  4PHM A;  2KPH A;  3UO9 A;  4C0J A;  3PJI A;  2F2O A;  2KOT A;  2O5G A;  2LMT A;  4YGC B;  1IJ6 A;  1YX7 A;  4BY5 A;  1RJV A;  2JXC A;  3R1V A;  1PSR A;  4R1E A;  4WQ3 A;  2IS9 A;  3SG6 A;  1S6C A;  2JU0 A;  1P28 A;  3CS1 A;  3TS5 C;  2M8U A;  4PDZ A;  1K93 D;  1K95 A;  3S0E A;  3SS5 A;  1RRO A;  2BCX A;  1UHN A;  3BUN B;  2QEB A;  4OZD A;  1DEL A;  1RTP 1;  3BQ3 A;  1BOD A;  2I94 A;  2LVI A;  1IWQ A;  1SR6 B;  3KO0 A;  1IGV A;  1LIN A;  4HRE E;  4BY4 A;  1F71 A;  5FYX A;  1UHI A;  1UUS A;  2KI4 C;  1F8H A;  3BOW A;  2CTN A;  1FPW A;  2ZRS A;  4M2P A;  3DY9 A;  1PVA A;  1NPQ A;  4ZCU A;  2K7C A;  5TNC A;  1XYD A;  5DKQ A;  1ALW A;  3S0G A;  3JTD C;  3EK7 A;  1E8A A;  1NP8 A;  4PCW A;  1CDN A;  5AEQ A;  2M97 A;  3HX4 A;  1S6I A;  2H8V A;  1SCV A;  1DT7 B;  3BJH A;  1TNQ A;  1MHO A;  3NHT A;  1AHR A;  3CYZ A;  4DCK A;  1BR1 B;  2LHL A;  2LUC A;  1J1D A;  5DKR A;  2ZN8 A;  3L4L A;  2JTT A;  3IQQ A;  3NXA A;  2PVB A;  1G33 A;  1NCY A;  1A75 A;  1JFJ A;  1TNP A;  3SG3 A;  2CBL A;  1J55 A;  2M7N A;  1DGU A;  1YX8 A;  2LHI A;  2BKI B;  3I5G B;  1CB1 A;  3OBV A;  3DZT A;  2SCP A;  4JKT A;  2M0R A;  3SG5 A;  1CDL A;  1GGZ A;  1HQV A;  5CSN A;  2BBM A;  4YBH B;  1F4Q A;  5JOL A;  5AFP A;  4I5J A;  2PQL A;  1Y1A A;  2JNX A;  1S5G Z;  1YTZ C;  2JT0 A;  1DJW A;  3DVE A;  3S0D A;  1QAS A;  3GK2 A;  1UHK A;  3VRP A;  1D1O A;  2M9G A;  1MQ1 A;  2KSP A;  2Y4Q A;  1TOP A;  1BG1 A;  1QIW A;  3K21 A;  5FI7 A;  1AUI B;  1G8I A;  1U5I B;  3KEV A;  3BFB A;  1OW4 A;  4JQ0 D;  4FQO A;  2LNK A;  1BLQ A;  1DGV A;  2FJU B;  2JZI A;  3CAB A;  1IJ5 A;  4I5N B;  4IJ7 A;  1SSE B;  2OPO A;  4MEW A;  4GUK A;  3ICB A;  2LVV A;  3CLN A;  4CPV A;  2COL B;  1XVJ A;  4PHK A;  5HLV A;  4AOM A;  3BUO B;  1OMR A;  3FWB A;  2LVK A;  4FTG A;  3TDZ A;  1ODB A;  1PK0 D;  1XFR A;  2NLN A;  1QAT A;  1L2O B;  1WY9 A;  3OP0 A;  3VRN A;  3CDN A;  1J7Q A;  3FE6 A;  3I5F C;  1WLM A;  2BAP A;  1W9Z A;  1Q80 A;  2LE9 B;  3CR5 X;  3TZ1 A;  2OS8 B;  2K7O A;  2K8M B;  1FI5 A;  3SS3 A;  3CGA A;  5J3X A;  1W7I B;  1OZS A;  1BF5 A;  1RWY A;  5PAL A;  1CFP A;  1YR5 A;  2K2A A;  2V53 A;  1DJH A;  1NWD A;  1SW8 A;  1A4P A;  4AQJ A;  3TUY B;  1TTX A;  1DJX A;  2OTG B;  3EVU A;  5B8I B;  1WRZ A;  2AAO A;  2KHN A;  3D78 A;  1Y1U A;  1KK8 B;  1QV1 A;  2E30 A;  1K9U A;  1KQM C;  1OSA A;  3SG2 A;  3EKJ A;  1DJY A;  3B86 A;  1JSA A;  3PN7 B;  3PFV A;  1QTX A;  1KFX S;  1A29 A;  1NCX A;  3I5I B;  2A4J A;  2K61 A;  3WNX B;  2JC2 A;  3O4X A;  5HKW A;  4MSP A;  2NZ0 A;  3S0F A;  2F8P A;  2KLE A;  1QXP A;  1KQV A;  3O6B A;  2G9B A;  4MZK A;  4OV2 A;  1OZO A;  1S3P A;  2HQW A;  2QAC A;  4DUQ A;  2CCM A;  1NX0 A;  2L51 A;  3KF9 A;  3TS5 B;  4ORA B;  3V2L A;  1A75 B;  1QIV A;  3FS7 A;  2PAS A;  2EC6 B;  1CM4 A;  5BPJ A;  3M0W A;  3PM8 A;  4MLW A;  1BJF A;  2KI4 B;  3EKH A;  2BCB A;  2SAS A;  1OOH A;  1XFU O;  1KWO C;  1YVH A;  3BFA A;  3NHI A;  1EXR A;  4XJK A;  2HQ8 A;  2EGD A;  3R1O A;  2WC6 A;  4TNC A;  4GNK B;  1B4C A;  1MXE A;  2MLE C;  2M3W A;  3O2P A;  1DTL A;  1OOF A;  1WDC C;  4QJ5 B;  1EL4 A;  2P70 A;  3VB1 A;  1S36 A;  1KFX L;  3GK1 A;  3JTD B;  3O78 A;  1C7V A;  2KQY A;  4PE0 A;  3B87 A;  2JOJ A;  3NSO A;  1H8B A;  3WHT B;  3TUY C;  3FIA A;  5ER5 A;  3QRX A;  3PM2 A;  1KFU S;  1SNL A;  1UWO A;  5IBW A;  5K89 A;  4PHN A;  1J7R A;  1DQE A;  1AP4 A;  5D7F A;  5DKN A;  2YGU A;  3B88 A;  1TNW A;  4YGB B;  2B1U A;  1CKK A;  2BBN A;  1UP5 A;  2FCE A;  2PMY A;  2G2B A;  2H2K A;  5CSI A;  1V1F A;  1NX2 A;  4UPG A;  2WOR A;  1ZUZ A;  2ISD A;  1B1G A;  2WCB A;  2L4I A;  5CPV A;  4OR9 B;  1QLK A;  2KDH A;  2WCK A;  2ZNE A;  2L50 A;  2NXQ A;  2Y1M A;  3EK8 A;  3OB1 B;  1S5G Y;  2M1U A;  1FBV A;  2KBI A;  3HCM A;  2JPT A;  1WRL A;  1K9K A;  1B9A A;  4YGE B;  2WC5 A;  3DXL A;  1B8L A;  1CMF A;  2ERB A;  1CLM A;  3S0B A;  1SR6 C;  1VRK A;  2KI6 D;  3RM1 A;  2MLF C;  3D10 A;  2WC8 A;  3DVJ A;  1TUZ A;  3I5H B;  4U8D A;  2M1K B;  4HSZ A;  5FI6 A;  3BUM B;  4INW A;  4QJ4 B;  2K7D A;  3BFH A;  5AXI A;  3VRO A;  1DMO A;  1AK8 A;  2NCP A;  4ETO A;  4PAL A;  2FOT A;  1V1G A;  1YUR A;  2H61 C;  1KFU L;  1LVC D;  1YUT A;  1JFK A;  4QJ3 B;  5HKZ A;  3RLZ A;  4IL1 A;  5JJG A;  3AAK A;  5AER A;  1F55 A;  2WCF A;  3D75 A;  3OX5 A;  4P2Y B;  1SY9 A;  2K60 A;  4YGA A;  2JQ6 A;  1R2U A;  1EG4 A;  4YI8 A;  1OMV A;  1IKU A;  4A4C A;  4DRW A;  4GGF C;  4NQG A;  2MJW B;  4YGD B;  2L2C A;  3DF0 B;  4KYN A;  1ZFS A;  4NDD A;  1M31 A;  3D77 A;  1RFJ A;  2PAL A;  1CDM A;  1DJI A;  2WND A;  3ZNI A;  3SJS A;  4CID A;  2PSR A;  1IRJ A;  1MF8 B;  2JUL A;  2KFF A;  2VRG A;  4L9M A;  1CNP A;  2I2R E;  2Q91 A;  2QEO A;  1NUB A;  3CWG A;  3I5F B;  3F45 A;  3GOF A;  5KU1 A;  3LCP C;  1M46 A;  2MHH A;  3PAT A;  1AVS A;  5G08 A;  3NSI A;  2LP2 A;  1ZAC A;  1SL8 A;  2GGM A;  2JNF A;  1RK9 A;  2GGZ A;  3JVT B;  3EG5 B;  4JWQ A;  1K94 A;  2LMV A;  3B6X A;  4PT1 A;  5AAN A;  2WCH A;  5DIC A;  3SIA A;  1F54 A;  2JRF A;  3IF7 A;  1DEK A;  2K2F A;  3L4A A;  4WQ2 A;  1K96 A;  1UUR A;  1YRU B;  1XFY O;  4MRY A;  1G4Y R;  1QX5 B;  4WRI A;  3SIB A;  1M63 B;  1KQM B;  4XJK B;  3SG4 A;  3LK0 A;  1JWD A;  1AJ4 A;  4Q04 A;  4MVF A;  3CR2 A;  1C7W A;  1QX7 A;  1DF0 B;  3IVT A;  1X02 A;  3OGN A;  2LLS A;  1SBJ A;  1T14 A;  2Q4U A;  2LLU A;  1UHH A;  1LS8 A;  1N65 A;  2MRD A;  3BYA A;  1B7T Y;  4ICB A;  3N7H A;  4JD9 A;  4ORB B;  2ZFD A;  3H4S E;  3PAL A;  2QEH A;  1MUX A;  1OQP A;  1SCM B;  3DF0 A;  1SKT A;  1REC A;  1SYM A;  2BEC A;  5EL2 A;  1DJZ A;  1XK4 C;  3VGO A;  1S1E A;  2BL0 B;  1WLZ A;  1S26 D;  3PLF B;  4GAO A;  1BOC A;  1BR4 B;  2F33 A;  1CTR A;  2KAV A;  3BUX B;  2FCD A;  4MRX A;  1YRT B;  2CNP A;  3DD4 A;  2K0J A;  2JWW A;  2MAZ A;  3A4U B;  1MR8 A;  1N2D A;  3WHU B;  1B47 A;  1Y6W A;  1OMD A;  1CMG A;  3VRQ A;  1KK7 Y;  1TWO A;  3E3R A;  4GPL B;  1KWO B;  1C3Z A;  1NX3 A;  2BE6 A;  3AKB A;  1GGW A;  2L98 A;  1NIW A;  1B7T Z;  1M39 A;  2JT8 A;  2K7B A;  1K90 D;  2R2I A;  5HLO A;  1F70 A;  2Y1N A;  1TCO B;  2KAX A;  3FWC A;  2BE4 A;  2HF5 A;  1WDC B;  1NX1 A;  2LMU A;  4HRH A;  4C0K A;  1JC2 A;  1OE9 B;  1AJ5 A;  2AUC A;  3CZT X;  3OX6 A;  3DVK A;  1KK8 C;  3EVR A;  3K1E A;  2I18 A;  1J7O A;  2E6W A;  2ZRT A;  3ZWH A;  1W7J B;  4D1E A;  5GQQ C;  4MBE A;  4N5X A;  4CFQ A;  1DF0 A;  1GQM A;  2ZKM X;  1PSB A;  1SMG A;  2LLT A;  1XK4 A;  3PSR A;  1NCZ A;  1XA5 A;  1OOJ A;  3NSK A;  2F3Y A;  1ZOT B;  4ZCV A;  1XFZ O;  3BUW B;  3LLE A;  1KK7 Z;  1PAL A;  3GK4 X;  3LK1 A;  5FI2 A;  2M7L A;  1TIZ A;  2LC5 A;  1N0Y A;  2KFH A;  1Z2C B;  1TUJ A;  3D76 A;  3B7A A;  1FF1 A;  1K9P A;  2LP3 A;  3AAJ A;  1L7Z A;  5ER4 X;  2KNE A;  1MWN A;  4CFR A;  1C3Y A;  3MSE B;  2MBX A;  2LAN A;  1ORG A;  1KSM A;  2LCP A;  2QDI A;  2ZN9 A;  4GGN A;  2EC6 C;  4JPZ B;  2JTZ A;  1TRF A;  4GFT A;  5F6T A;  3SS4 A;  1HT9 A;  1SPY A;  1JF2 A;  1PUL A;  2PRU A;  1QS7 A;  4MN0 A;  1A03 A;  2TN4 A;  3FE9 A;  3NSL A;  4DS7 A;  2O60 A;  4NDC A;  4MZJ A;  2KFG A;  3DVM A;  1K8U A;  1CM1 A;  2KYF A;  5I2O A;  1F4O A;  5I2Q A;  2RGI A;  3UNW A;  4C0L A;  3RZS A;  1CFF A;  4YRU A;  2EHB A;  1EG3 A;  1XFV O;  3R1P A;  4MZL A;  1IQ3 A;  2HET A;  5KTY A;  3FE8 A;  3O4Y A;  2LV7 A;  1BMO A;  2ZND A;  5HYD A;  1GJY A;  1JF0 A;  2WCE A;  5I94 A;  2LAP A;  1XFX O;  4M2Q A;  3TDI A;  1QV0 A;  1BT6 A;  2D8N A;  2AMI A;  5D69 A;  4DIR A;  4GBA A;  4USL A;  1K2H A;  2JPO A;  1IIO A;  4I5L B;  4P5O E;  2CXJ A;  4I5K A;  3A8R A;  2JXL A;  4F7F A;  2KYC A;  3BXK A;  1TCF A;  4PE7 A;  1QX2 A;  4N1F A;  2L4H A;  1IH0 A;  2WCM A;  2LM5 A;  3CZ1 A;  1CDP A;  2WOS A;  3CR4 X;  3D0Y B;  1FW4 A;  3I5G C;  1H4B A;  2CT9 A;  2KI6 C;  1LXF C;  1PRW A;  2L5Y A;  1B8R A;  2M29 A;  2M49 B;  4M2O A;  3I5H C;  3DYE A;  2LUX A;  1B8C A;  2L2E A;  3R72 A;  5CSJ A;  3D74 A;  1UHJ A;  2KQ6 A;  1EH2 A;  1A2X A;  2F2P A;  2P6B B;  2PYQ A;  1DC1 A;  2BNX A;  1C07 A;  3LL8 B;  1J7P A;  1M45 A;  1ZMZ A;  2H61 A;  2GTE A;  3SG7 A;  1R6P A;  2KGR A;  1CLL A;  5HKY A;  1LA0 A;  2QEV A;  3IQO A;  1EJ3 A;  2FJY A;  5CSF A;  1S6J A;  2L5X B;  2HPS A;  1KSO A;  1JBA A;  1XFW O;  3OHM B;  1QWV A;  3Q8I A;  4GGF A;  4HRG A;  2KGB C;  2QPT A;  1YUS A;  1LA3 A;  4ORC B;  1Y0V H;  3QME A;  1SL9 A;  5D3O A;  1JUO A;  1FI6 A;  1CFC A;  4PE1 A;  3CZ0 A;  4OVN F;  1Y1X A;  3EVV A;  3D73 A;  1BU3 A;  1QJT A;  1WRK A; 
#chains in the Genus database with same CATH homology
 5KSZ A;  3CTN A;  5I2L A;  1SK6 D;  3AKA A;  4PHJ A;  1NYA A;  1QVI Y;  4XYN A;  4OCI A;  4A4B A;  2JT3 A;  3JVT C;  3D0Y A;  1PVB A;  1L2O C;  1XO5 A;  1SL7 A;  3C1V A;  2KBM A;  3VRR A;  2OS8 C;  3TDU A;  2L0P A;  1MXL C;  3BOW B;  2Y5I A;  3KPX A;  4CLN A;  1TN4 A;  2DOQ A;  2LVJ A;  4NDB A;  1J1E A;  3EK4 A;  4PE4 A;  2KAY A;  1TNX A;  2NCO A;  3KHE A;  3TUY C;  1IG5 A;  2OTG C;  1U5I A;  3OB2 B;  1YVL A;  1LKJ A;  4YI9 A;  1CLB A;  1IQ5 A;  4F0Z B;  2BCA A;  2F3Z A;  4E68 A;  1QLS A;  2BKH B;  1QVI Z;  1CFD A;  4N1G A;  4AQI A;  1DJG A;  3PN7 C;  1NSH A;  4OKH A;  2MA2 A;  3WXA A;  1KCY A;  1SCM C;  2I7A A;  3I5I C;  1DVI A;  1SRA A;  2GV5 A;  1YUU A;  1ALV A;  2BL0 C;  5I8N A;  4PHM A;  4C0J A;  2F2O A;  2KOT A;  2O5G A;  2LMT A;  4YGC B;  1IJ6 A;  1YX7 A;  4BY5 A;  1RJV A;  2JXC A;  4R1E A;  1PSR A;  4WQ3 A;  3SG6 A;  2IS9 A;  1S6C A;  2JU0 A;  3CS1 A;  3TS5 C;  2M8U A;  4PDZ A;  1K93 D;  1K95 A;  1RRO A;  2BCX A;  1UHN A;  3BUN B;  1BOD A;  1RTP 1;  3BQ3 A;  2I94 A;  2LVI A;  1IWQ A;  1SR6 B;  3KO0 A;  1IGV A;  1LIN A;  4HRE E;  4BY4 A;  1F71 A;  5FYX A;  1UHI A;  1UUS A;  2KI4 C;  1F8H A;  3BOW A;  2CTN A;  1FPW A;  2ZRS A;  4M2P A;  1PVA A;  1NPQ A;  4ZCU A;  2K7C A;  5TNC A;  1XYD A;  5DKQ A;  1ALW A;  3JTD C;  3EK7 A;  1E8A A;  1NP8 A;  4PCW A;  1CDN A;  5AEQ A;  2M97 A;  3HX4 A;  1S6I A;  1SCV A;  1DT7 B;  1TNQ A;  1MHO A;  1AHR A;  4DCK A;  1BR1 B;  2LHL A;  2LUC A;  1J1D A;  5DKR A;  2ZN8 A;  2JTT A;  3IQQ A;  3NXA A;  2PVB A;  1G33 A;  1NCY A;  1A75 A;  1JFJ A;  1TNP A;  3SG3 A;  2CBL A;  1J55 A;  2M7N A;  1DGU A;  1YX8 A;  2LHI A;  2BKI B;  3I5G B;  1CB1 A;  2SCP A;  2M0R A;  3SG5 A;  1CDL A;  1GGZ A;  1HQV A;  5CSN A;  2BBM A;  4YBH B;  1F4Q A;  5JOL A;  5AFP A;  4I5J A;  1Y1A A;  2JNX A;  1S5G Z;  1YTZ C;  2JT0 A;  1DJW A;  3DVE A;  1QAS A;  3GK2 A;  1UHK A;  3VRP A;  1D1O A;  2M9G A;  1MQ1 A;  2KSP A;  2Y4Q A;  1TOP A;  1BG1 A;  1QIW A;  3K21 A;  1AUI B;  1G8I A;  1U5I B;  3KEV A;  4JQ0 D;  4FQO A;  2LNK A;  1BLQ A;  1DGV A;  2FJU B;  2JZI A;  1IJ5 A;  4I5N B;  2OPO A;  4MEW A;  4GUK A;  3ICB A;  2LVV A;  3CLN A;  4CPV A;  2COL B;  1XVJ A;  4PHK A;  5HLV A;  4AOM A;  3BUO B;  1OMR A;  3FWB A;  2LVK A;  4FTG A;  3TDZ A;  1ODB A;  1PK0 D;  2NLN A;  1QAT A;  1L2O B;  1WY9 A;  3OP0 A;  3VRN A;  1J7Q A;  3I5F C;  1WLM A;  3CR5 X;  1Q80 A;  2LE9 B;  3TZ1 A;  2OS8 B;  2K7O A;  2K8M B;  1FI5 A;  1CFP A;  3CGA A;  5J3X A;  1W7I B;  1OZS A;  1BF5 A;  1RWY A;  5PAL A;  1YR5 A;  2K2A A;  2V53 A;  1DJH A;  1NWD A;  1SW8 A;  1A4P A;  4AQJ A;  3TUY B;  1TTX A;  1DJX A;  2OTG B;  3EVU A;  5B8I B;  1WRZ A;  2AAO A;  2KHN A;  1Y1U A;  1KK8 B;  1QV1 A;  2E30 A;  1K9U A;  1KQM C;  1OSA A;  3SG2 A;  3EKJ A;  1DJY A;  1JSA A;  3PN7 B;  3PFV A;  1QTX A;  1KFX S;  1A29 A;  1NCX A;  3I5I B;  2A4J A;  2K61 A;  3WNX B;  2JC2 A;  5HKW A;  4MSP A;  2NZ0 A;  2F8P A;  1QXP A;  1KQV A;  3O6B A;  2G9B A;  4MZK A;  4OV2 A;  1OZO A;  1S3P A;  2HQW A;  2QAC A;  4DUQ A;  2CCM A;  1NX0 A;  2L51 A;  3KF9 A;  3TS5 B;  4ORA B;  1A75 B;  1QIV A;  3FS7 A;  2PAS A;  2EC6 B;  1CM4 A;  5BPJ A;  3M0W A;  3PM8 A;  4MLW A;  1BJF A;  2KI4 B;  3EKH A;  2BCB A;  2SAS A;  1XFU O;  1KWO C;  1YVH A;  1EXR A;  4XJK A;  2HQ8 A;  2EGD A;  1B4C A;  4TNC A;  4GNK B;  1MXE A;  2MLE C;  2M3W A;  3O2P A;  1DTL A;  1WDC C;  4QJ5 B;  1EL4 A;  1S36 A;  1KFX L;  3GK1 A;  3JTD B;  3O78 A;  1C7V A;  2KQY A;  4PE0 A;  2JOJ A;  3NSO A;  1H8B A;  3WHT B;  3FIA A;  5ER5 A;  3QRX A;  1KFU S;  1SNL A;  1UWO A;  5IBW A;  5K89 A;  4PHN A;  1J7R A;  1AP4 A;  5D7F A;  5DKN A;  1TNW A;  4YGB B;  2B1U A;  1CKK A;  2BBN A;  1UP5 A;  2FCE A;  2PMY A;  2G2B A;  2H2K A;  5CSI A;  1V1F A;  1NX2 A;  4UPG A;  2WOR A;  1ZUZ A;  2ISD A;  1B1G A;  2WCB A;  2L4I A;  5CPV A;  4OR9 B;  1QLK A;  2KDH A;  2ZNE A;  2L50 A;  2NXQ A;  2Y1M A;  3EK8 A;  3OB1 B;  1S5G Y;  2M1U A;  1FBV A;  2KBI A;  3HCM A;  2JPT A;  1WRL A;  1K9K A;  1B9A A;  4YGE B;  1CMF A;  1B8L A;  1CLM A;  1SR6 C;  1VRK A;  2KI6 D;  3RM1 A;  2MLF C;  3D10 A;  2WC8 A;  3DVJ A;  3I5H B;  4U8D A;  2M1K B;  4HSZ A;  3BUM B;  4QJ4 B;  2K7D A;  5AXI A;  3VRO A;  1DMO A;  1AK8 A;  2NCP A;  4ETO A;  4PAL A;  2FOT A;  1V1G A;  1YUR A;  2H61 C;  1KFU L;  1LVC D;  1YUT A;  1JFK A;  4QJ3 B;  5HKZ A;  3RLZ A;  4IL1 A;  5JJG A;  3AAK A;  5AER A;  1F55 A;  2WCF A;  3OX5 A;  4P2Y B;  1SY9 A;  4YGA A;  2JQ6 A;  1R2U A;  1EG4 A;  4YI8 A;  1OMV A;  1IKU A;  4A4C A;  4DRW A;  4GGF C;  4NQG A;  2MJW B;  4YGD B;  3DF0 B;  1ZFS A;  4NDD A;  1M31 A;  1RFJ A;  2PAL A;  1CDM A;  1DJI A;  2WND A;  3ZNI A;  3SJS A;  4CID A;  2PSR A;  1IRJ A;  1MF8 B;  2JUL A;  2KFF A;  2VRG A;  4L9M A;  1CNP A;  2I2R E;  2Q91 A;  1NUB A;  3CWG A;  3I5F B;  3F45 A;  3GOF A;  5KU1 A;  3LCP C;  1M46 A;  2MHH A;  3PAT A;  1AVS A;  5G08 A;  3NSI A;  2LP2 A;  1ZAC A;  1SL8 A;  2GGM A;  2JNF A;  1RK9 A;  2GGZ A;  3JVT B;  4JWQ A;  1K94 A;  2LMV A;  5AAN A;  3SIA A;  1F54 A;  2JRF A;  3IF7 A;  2K2F A;  4WQ2 A;  1K96 A;  1UUR A;  1YRU B;  1XFY O;  4MRY A;  1G4Y R;  1QX5 B;  4WRI A;  3SIB A;  1M63 B;  1KQM B;  4XJK B;  3SG4 A;  3LK0 A;  1JWD A;  1AJ4 A;  4Q04 A;  4MVF A;  3CR2 A;  1C7W A;  1QX7 A;  1DF0 B;  1X02 A;  2LLS A;  1SBJ A;  2Q4U A;  2LLU A;  1UHH A;  1N65 A;  2MRD A;  3BYA A;  4ICB A;  1B7T Y;  4ORB B;  2ZFD A;  3H4S E;  3PAL A;  1MUX A;  1OQP A;  1SCM B;  3DF0 A;  1SKT A;  1REC A;  1SYM A;  2BEC A;  1DJZ A;  1XK4 C;  3VGO A;  1S1E A;  2BL0 B;  1WLZ A;  1S26 D;  3PLF B;  4GAO A;  1BOC A;  1BR4 B;  2F33 A;  1CTR A;  2KAV A;  3BUX B;  2FCD A;  4MRX A;  1YRT B;  2CNP A;  3DD4 A;  2K0J A;  2JWW A;  2MAZ A;  3A4U B;  1MR8 A;  1N2D A;  3WHU B;  1B47 A;  1Y6W A;  1OMD A;  1CMG A;  3VRQ A;  1KK7 Y;  3E3R A;  4GPL B;  1KWO B;  1NX3 A;  2BE6 A;  3AKB A;  1GGW A;  2L98 A;  1NIW A;  1B7T Z;  1M39 A;  2JT8 A;  2K7B A;  1K90 D;  2R2I A;  5HLO A;  1F70 A;  2Y1N A;  1TCO B;  2KAX A;  3FWC A;  2BE4 A;  2HF5 A;  1WDC B;  1NX1 A;  2LMU A;  4HRH A;  4C0K A;  1JC2 A;  2AUC A;  1OE9 B;  1AJ5 A;  3CZT X;  3OX6 A;  3DVK A;  1KK8 C;  3EVR A;  2I18 A;  1J7O A;  2E6W A;  2ZRT A;  3ZWH A;  1W7J B;  4D1E A;  5GQQ C;  4MBE A;  4N5X A;  4CFQ A;  1DF0 A;  1GQM A;  2ZKM X;  1PSB A;  1SMG A;  2LLT A;  1XK4 A;  3PSR A;  1NCZ A;  1XA5 A;  1OOJ A;  3NSK A;  2F3Y A;  1ZOT B;  4ZCV A;  1XFZ O;  3BUW B;  3LLE A;  1KK7 Z;  1PAL A;  3GK4 X;  3LK1 A;  2M7L A;  1TIZ A;  2LC5 A;  1N0Y A;  2KFH A;  1FF1 A;  1K9P A;  2LP3 A;  3AAJ A;  1L7Z A;  5ER4 X;  2KNE A;  1MWN A;  4CFR A;  3MSE B;  2MBX A;  2LAN A;  1KSM A;  2LCP A;  2ZN9 A;  4GGN A;  2EC6 C;  4JPZ B;  2JTZ A;  1TRF A;  4GFT A;  5F6T A;  1HT9 A;  1SPY A;  1JF2 A;  1PUL A;  2PRU A;  1QS7 A;  4MN0 A;  1A03 A;  2TN4 A;  3NSL A;  4DS7 A;  2O60 A;  4NDC A;  4MZJ A;  2KFG A;  3DVM A;  1K8U A;  1CM1 A;  2KYF A;  5I2O A;  1F4O A;  5I2Q A;  2RGI A;  4C0L A;  1CFF A;  4YRU A;  2EHB A;  1EG3 A;  1XFV O;  4MZL A;  1IQ3 A;  2HET A;  5KTY A;  3O4Y A;  2LV7 A;  1BMO A;  2ZND A;  5HYD A;  1GJY A;  1JF0 A;  2WCE A;  2LAP A;  1XFX O;  4M2Q A;  3TDI A;  1QV0 A;  1BT6 A;  2D8N A;  2AMI A;  5D69 A;  4DIR A;  4GBA A;  4USL A;  1K2H A;  4I5L B;  4P5O E;  2CXJ A;  4I5K A;  3A8R A;  2JXL A;  2KYC A;  3BXK A;  1TCF A;  4PE7 A;  1QX2 A;  4N1F A;  2L4H A;  1IH0 A;  2LM5 A;  1CDP A;  2WOS A;  3CR4 X;  3D0Y B;  1FW4 A;  3I5G C;  1H4B A;  2CT9 A;  2KI6 C;  1LXF C;  1PRW A;  2M29 A;  1B8R A;  2M49 B;  4M2O A;  3I5H C;  2LUX A;  1B8C A;  2L2E A;  5CSJ A;  1UHJ A;  2KQ6 A;  1EH2 A;  1A2X A;  2F2P A;  2P6B B;  1C07 A;  3LL8 B;  1J7P A;  1M45 A;  1ZMZ A;  2H61 A;  3SG7 A;  1R6P A;  2KGR A;  1CLL A;  5HKY A;  1LA0 A;  3IQO A;  1EJ3 A;  5CSF A;  1S6J A;  2L5X B;  2HPS A;  1KSO A;  1JBA A;  1XFW O;  3OHM B;  4HRG A;  4GGF A;  2KGB C;  2QPT A;  1YUS A;  1LA3 A;  4ORC B;  1Y0V H;  1SL9 A;  1JUO A;  1FI6 A;  1CFC A;  4PE1 A;  4OVN F;  1Y1X A;  3EVV A;  1BU3 A;  1QJT A;  1WRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...