2KDHA

The solution structure of human cardiac troponin c in complex with the green tea polyphenol; (-)-epigallocatechin-3-gallate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of human cardiac troponin C in complex with the green tea polyphenol, (-)-epigallocatechin 3-gallate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kdhA00
5ER5A 1UUSA 3JTDC 2JNXA 5DKRA 1NCXA 2BCXA 2KYCA 1UHIA 1NCZA 1BT6A 1A4PA 1SY9A 1B8LA 3K21A 4PHNA 1BU3A 3GK2A 2COLB 1DJHA 1IGVA 1NIWA 3O4YA 1OMRA 2BE4A 4N5XA 2NXQA 1UWOA 1IH0A 1KK8B 1DJZA 2ZN9A 2QPTA 3HX4A 1SPYA 1SYMA 1FW4A 2SCPA 5HKYA 4IL1A 2K61A 1KCYA 2JT3A 2AUCA 4PHKA 1Y6WA 3PSRA 1OMDA 1NX2A 2KQ6A 3BYAA 5KTYA 3KF9A 1CLLA 1RFJA 2KI4C 1B8RA 2LCPA 1YR5A 1AJ5A 1PK0D 1EL4A 3E3RA 2L4HA 1TNPA 3SG4A 1F4QA 1J1EA 1LA3A 3OP0A 1IQ3A 4ZCVA 1S26D 1YVLA 4QJ3B 4ETOA 1RJVA 1QVIZ 1UP5A 4XYNA 1C7VA 1B8CA 2JTTA 2JPTA 1BOCA 4GNKB 1EJ3A 5AFPA 1K8UA 4MVFA 5CSIA 1CM1A 1CDLA 2FCEA 1HQVA 1J7OA 3CLNA 4D1EA 3RM1A 1J1DA 2LLSA 5AANA 1CFDA 3FWCA 3DVKA 2LC5A 2IS9A 4PDZA 2LHIA 1TTXA 2FOTA 2R2IA 1SL8A 3SJSA 1XK4A 3CWGA 1RECA 4CFQA 2RGIA 3ICBA 1AUIB 3BUNB 1DGUA 1JC2A 4MZKA 1JBAA 1XFZO 1JFJA 2K2AA 1SW8A 3EK8A 4JWQA 1M63B 1YUSA 4MZJA 3TDIA 2E6WA 1ZMZA 1A03A 4MRXA 3KPXA 1H4BA 4MSPA 1NWDA 1B7TZ 1UHKA 2Y4QA 4HRHA 2BL0B 2NLNA 1OE9B 1C7WA 2JXCA 3LK1A 1QLSA 2AAOA 2LANA 3TDZA 2LP3A 1NX3A 2H61C 4YGAA 1SR6C 4MEWA 3LCPC 5I2OA 1EH2A 1HT9A 1S6IA 2F2PA 4GAOA 2FJUB 2KNEA 2L2EA 2H2KA 1QV1A 3I5GB 4YGEB 1DTLA 1SCMC 4PALA 1CKKA 1MR8A 2H61A 2LLTA 3AAKA 2PRUA 1LXFC 2KBMA 3FWBA 2MRDA 3SIBA 3WNXB 4HREE 1ALWA 4AOMA 2Q91A 4WRIA 2B1UA 1B9AA 1KFUS 1KWOB 2PVBA 3I5HC 4DIRA 3BUWB 5B8IB 5DKNA 2EC6C 2KFGA 1XK4C 2MA2A 3IQOA 4I5NB 2M49B 1CFPA 1QLKA 2LE9B 2PASA 2PMYA 5FYXA 4ORBB 3NSIA 4YI9A 3LK0A 2LUCA 1OQPA 1PVBA 2K7CA 2CCMA 2ZRSA 1PALA 1EXRA 2WC8A 2AMIA 1L7ZA 2KAXA 1RWYA 2O60A 3I5GC 4NDBA 1JUOA 2KI6C 2GV5A 1K93D 1ALVA 2GGMA 1NCYA 2KGRA 3SG6A 4M2PA 3TUYB 1RTP1 2FCDA 1XFWO 1YURA 2HF5A 4YI8A 1J55A 2CBLA 2F33A 2LMTA 1B4CA 3VRQA 5PALA 2DOQA 4MN0A 2BCAA 1S1EA 3WHTB 1SKTA 4YGCB 4USLA 4M2OA 1GGZA 1JF2A 2SASA 4MBEA 1FPWA 4A4CA 1UURA 1AJ4A 1MXLC 4CLNA 4UPGA 5ER4X 2K2FA 2LM5A 1CTRA 1TNXA 2ZFDA 3A8RA 1YUUA 1M46A 1DJXA 1J7QA 3LL8B 2NCOA 1DF0A 5CPVA 1VRKA 2KSPA 4PHMA 3VRNA 2KGBC 1CFCA 1JWDA 2K7DA 2F3YA 4AQIA 1CMGA 4JQ0D 1OMVA 3BUMB 1BMOA 2EHBA 2ISDA 1F55A 2EGDA 3PALA 3ZWHA 3CTNA 1S6JA 2JRFA 1M45A 4YBHB 1G4YR 3WXAA 1N0YA 1OZOA 1ZOTB 3CR5X 4BY5A 3VGOA 1YTZC 1CM4A 5KU1A 1TIZA 1F71A 5D69A 3PM8A 4JPZB 5HLVA 1D1OA 2BBNA 2BECA 5K89A 3EVUA 2KI4B 1S6CA 3BXKA 1YRUB 3SIAA 2OPOA 1RROA 2BCBA 1B1GA 3TS5C 1K9UA 4BY4A 1DMOA 4F0ZB 2M3WA 4ORCB 2M1UA 3PN7C 1BODA 2KAVA 1N65A 1F8HA 2HQWA 1G33A 1KFXL 2F3ZA 1XYDA 4R1EA 1XFUO 2KBIA 1DGVA 3TS5B 1KK7Z 1CDMA 2WCFA 4PCWA 5D7FA 2ZKMX 2HETA 1W7JB 3SG3A 1DT7B 1K9KA 1L2OC 2JT0A 5I8NA 3D10A 2G9BA 3C1VA 1SMGA 1KSMA 3CGAA 3OHMB 3CR2A 1NPQA 1F4OA 3SG2A 1V1GA 2JWWA 4YGDB 3EKJA 2WCEA 2LHLA 1G8IA 3D0YB 1UHNA 3M0WA 1RK9A 1KQMB 1MQ1A 4HRGA 2I7AA 3EK4A 5AEQA 1C07A 2L5XB 4GGNA 3HCMA 1S5GZ 1ZUZA 3DF0A 4OKHA 1WRKA 1FF1A 2BBMA 3KO0A 2V53A 2M29A 4ORAB 1L2OB 2ZNEA 1U5IA 1QIWA 2BKIB 3DD4A 3I5FC 2JOJA 3EKHA 4GBAA 4I5LB 1TCFA 2JTZA 1X02A 3NSLA 2K0JA 1QATA 1QX5B 2GGZA 2L4IA 1QXPA 5CSNA 1TRFA 2LUXA 1NX1A 1ODBA 1B7TY 3JVTC 3DF0B 1IJ6A 3OB2B 3ZNIA 1A29A 2ZN8A 4A4BA 1N2DA 1CLBA 2OTGB 5GQQC 4QJ5B 1A75B 4OVNF 3LLEA 1YUTA 1V1FA 2JZIA 2LNKA 4XJKA 3PFVA 1U5IB 1M39A 4ZCUA 1KFUL 3TUYC 1CDPA 3A4UB 3NSKA 4HSZA 3BOWB 4P2YB 1W7IB 4N1GA 5HKZA 1Y0VH 2JU0A 3WHUB 3IF7A 2KI6D 1YX8A 3AAJA 1QJTA 2KFHA 4E68A 4NQGA 1SNLA 2Y1MA 1OZSA 3JTDB 1M31A 2M8UA 2K8MB 3SG5A 1TN4A 3OX6A 1JF0A 2JT8A 1Y1AA 2LVKA 3FS7A 5HLOA 4QJ4B 1AVSA 2P6BB 1K95A 2I2RE 1QV0A 2F8PA 1PULA 2JULA 3TDUA 2TN4A 3AKBA 4GFTA 1GGWA 4C0LA 1SCMB 2BKHB 3EVVA 5BPJA 5CSFA 5G08A 1J7PA 1QASA 1QX7A 3DVJA 2WCBA 1Y1XA 4GGFA 1IG5A 5CSJA 5JOLA 1SBJA 4I5KA 1BLQA 3QRXA 2MLFC 1YX7A 2M1KB 3BUOB 2E30A 3O2PA 1CNPA 1CFFA 1K2HA 1IJ5A 1DJGA 2M0RA 3JVTB 2JNFA 3SG7A 1KSOA 1WY9A 2OTGC 1DJWA 1A75A 1MF8B 1LVCD 5F6TA 1LINA 1K96A 1DVIA 2M7NA 3TZ1A 2LMUA 3KEVA 1CDNA 2A4JA 1EG4A 1UHJA 2Q4UA 3VRPA 1SRAA 2BL0C 1XFYO 4DUQA 1TNWA 5I2LA 2CXJA 3O6BA 2KQYA 2Y5IA 4Q04A 2K7BA 1OSAA 1EG3A 3MSEB 2MAZA 5AXIA 1QTXA 1XO5A 4FQOA 1FI5A 3IQQA 4GPLB 5IBWA 1WDCC 2HQ8A 1YVHA 5KSZA 2LV7A 3OX5A 1AK8A 2LLUA 4P5OE 1SL9A 1UHHA 1TNQA 1AHRA 3CR4X 3BUXB 1QX2A 2WOSA 4WQ2A 4OR9B 3I5IB 5HKWA 5AERA 2L50A 2O5GA 4GGFC 4MZLA 1TCOB 1K94A 4PE0A 1KFXS 1BR4B 1IQ5A 2JC2A 2KAYA 3GOFA 1DJYA 1PRWA 2M7LA 1QS7A 4U8DA 1SCVA 3PLFB 2LVIA 1ZACA 1NP8A 1IWQA 3RLZA 4CIDA 3I5FB 4OV2A 1IKUA 1QVIY 1SL7A 2I94A 2PALA 4ICBA 2KDHA 4PE4A 2ZNDA 2JXLA 1K9PA 1NUBA 3PN7B 5TNCA 4TNCA 3F45A 1DF0B 1XA5A 1Q80A 2VRGA 3VROA 1F70A 1WRLA 2NCPA 3EK7A 3CS1A 1DJIA 4DCKA 4CPVA 1ZFSA 3FIAA 1K90D 1A2XA 1KK7Y 1KWOC 3I5HB 3OB1B 4OCIA 2M9GA 4WQ3A 3KHEA 1FBVA 2EC6B 4YRUA 2G2BA 1MWNA 1QIVA 1WLZA 2KOTA 1MXEA 5HYDA 5JJGA 1F54A 3I5IC 1WLMA 2KYFA 1R6PA 2Y1NA 3BQ3A 3PATA 1SK6D 1WRZA 1FI6A 1J7RA 1WDCB 2KFFA 1OOJA 2MHHA 1E8AA 3NSOA 2OS8B 4FTGA 4C0KA 1R2UA 1TOPA 4L9MA 2CT9A 1S36A 1XFVO 2L51A 1SR6B 2JQ6A 4AQJA 4N1FA 2I18A 1MHOA 1PSBA 1B47A 3GK4X 4I5JA 2PSRA 1PSRA 1LA0A 2CTNA 4XJKB 1XVJA 3BOWA 3AKAA 1CMFA 5J3XA 2BE6A 3DVMA 4NDDA 4PE7A 2LVJA 1BJFA 2MJWB 4CFRA 1NX0A 2LVVA 4PE1A 3EVRA 1IRJA 1LKJA 3D0YA 3O78A 1AP4A 1BR1B 2LMVA 2HPSA 1PVAA 4NDCA 2F2OA 5I2QA 2QACA 5DKQA 1BF5A 1H8BA 3CZTX 1MUXA 2LP2A 1NYAA 2NZ0A 2L98A 4DS7A 4GUKA 1JSAA 2CNPA 3VRRA 1S5GY 2LAPA 1S3PA 2L0PA 2OS8C 2ZRTA 4MRYA 3DVEA 3GK1A 2WORA 1KK8C 4YGBB 1KQMC 1JFKA 4C0JA 2D8NA 4DRWA 2KHNA 1GJYA 1CB1A 4MLWA 2K7OA 1Y1UA 1CLMA 2MBXA 3H4SE 1YRTB 3NXAA 2M97A 1XFXO 1GQMA 2WNDA 4PHJA 1BG1A 4M2QA 1NSHA 2MLEC 1KQVA
chains in the Genus database with same CATH superfamily
5ER5A 1UUSA 1W9ZA 2JNXA 3JTDC 5DKRA 1NCXA 2BCXA 2KYCA 1UHIA 1NCZA 1BT6A 1A4PA 1SY9A 1B8LA 2P70A 3K21A 4PHNA 1BU3A 3GK2A 2COLB 1DJHA 1IGVA 1NIWA 3O4YA 1OMRA 2BE4A 3DZTA 4N5XA 2NXQA 1UWOA 1IH0A 1KK8B 1DJZA 2ZN9A 2QPTA 3HX4A 1SPYA 1SYMA 1FW4A 2SCPA 5HKYA 4IL1A 2K61A 1KCYA 2JT3A 2AUCA 4PHKA 1Y6WA 3PSRA 1OMDA 1NX2A 2KQ6A 3BYAA 5KTYA 3KF9A 3R1VA 1CLLA 1RFJA 2KI4C 1B8RA 2LCPA 1YR5A 1AJ5A 1PK0D 1EL4A 3E3RA 2L4HA 1TNPA 3SG4A 1F4QA 1J1EA 1LA3A 3OP0A 1IQ3A 4ZCVA 1S26D 1YVLA 4QJ3B 1QWVA 4ETOA 1RJVA 1QVIZ 1UP5A 2KPHA 4XYNA 1C7VA 1B8CA 2JTTA 2JPTA 1BOCA 3R72A 4GNKB 1EJ3A 5AFPA 1K8UA 4MVFA 5CSIA 1CM1A 5EL2A 1CDLA 2FCEA 1HQVA 1J7OA 3CLNA 4D1EA 3RM1A 1J1DA 2LLSA 3CYZA 1CFDA 5AANA 3FWCA 2L2CA 2LC5A 2IS9A 3DVKA 4PDZA 4A4BA 2LHIA 1TTXA 2FOTA 2R2IA 1SL8A 3SJSA 1XK4A 3CWGA 1DC1A 1RECA 4CFQA 3OBVA 2RGIA 3ICBA 1AUIB 3BUNB 1DGUA 1JC2A 4MZKA 1JBAA 1XFZO 1TWOA 1JFJA 2K2AA 1SW8A 3EK8A 4JWQA 1M63B 1YUSA 4MZJA 3TDIA 2E6WA 1ZMZA 1A03A 1C3YA 4MRXA 3KPXA 3SS5A 1H4BA 4MSPA 3UO9A 1NWDA 2L5YA 1B7TZ 1UHKA 2Y4QA 4HRHA 4JKTA 2BL0B 2NLNA 1OE9B 1C7WA 2JXCA 3LK1A 1OOGA 1QLSA 2AAOA 2LANA 3TDZA 2LP3A 1NX3A 2H61C 4YGAA 1SR6C 4MEWA 3LCPC 5D3OA 5I2OA 1EH2A 1HT9A 1ORGA 1S6IA 2F2PA 4GAOA 2FJUB 2KNEA 2L2EA 2H2KA 1QV1A 3I5GB 3CZ1A 4YGEB 5DICA 1DTLA 3BFBA 1SCMC 4PALA 1CKKA 1MR8A 2H61A 2LLTA 3AAKA 2PRUA 1LXFC 2KBMA 3FWBA 2MRDA 3SIBA 3WNXB 4HREE 1ALWA 4AOMA 2Q91A 4WRIA 2B1UA 1B9AA 1KFUS 1KWOB 2PVBA 3FE6A 3I5HC 2PYQA 4DIRA 3BUWB 5B8IB 5DKNA 2EC6C 2KFGA 1XK4C 2MA2A 3IQOA 4I5NB 2M49B 1CFPA 1QLKA 2QEHA 2LE9B 2PASA 2PMYA 5FYXA 4ORBB 3NSIA 4YI9A 3LK0A 2LUCA 1OQPA 1PVBA 2K7CA 2CCMA 2ZRSA 1PALA 3CDNA 1EXRA 2WC8A 2AMIA 1L7ZA 2KAXA 1RWYA 2O60A 3I5GC 4NDBA 1JUOA 2KI6C 2GV5A 1K93D 2BNXA 1ALVA 2GGMA 1NCYA 2KGRA 3SG6A 4M2PA 3TUYB 1RTP1 2FCDA 3D73A 1XFWO 1YURA 2HF5A 2WCLA 1J55A 2CBLA 4YI8A 2F33A 2LMTA 1B4CA 3VRQA 5PALA 2DOQA 4MN0A 2QDIA 2BCAA 1LS8A 1S1EA 3WHTB 1SKTA 4YGCB 3L4LA 4USLA 3S0BA 4M2OA 1GGZA 1JF2A 2SASA 3S0FA 4MBEA 1FPWA 4A4CA 1UURA 1AJ4A 1MXLC 4CLNA 4UPGA 5ER4X 2K2FA 2LM5A 2WCMA 1CTRA 1TNXA 2ZFDA 3A8RA 1YUUA 1M46A 1DJXA 1J7QA 3LL8B 2NCOA 1DF0A 2WCHA 5CPVA 1VRKA 2KSPA 4PHMA 3VRNA 2KGBC 1CFCA 1JWDA 2K7DA 2F3YA 3DY9A 4AQIA 1CMGA 4JQ0D 1OMVA 1SSEB 3BUMB 1BMOA 2EHBA 3B6XA 2ISDA 1F55A 2EGDA 3PALA 3S0EA 3ZWHA 1OOHA 3CTNA 1S6JA 2JRFA 1M45A 4YBHB 1G4YR 3WXAA 1N0YA 1OZOA 1ZOTB 3CR5X 3OGNA 4BY5A 3VGOA 2WCJA 1YTZC 5FI2A 1CM4A 2FJYA 5KU1A 1TIZA 2BAPA 3D76A 5D69A 1F71A 3PM8A 4JPZB 5HLVA 1D1OA 2BBNA 2BECA 5K89A 3EVUA 2KI4B 1S6CA 3BXKA 1YRUB 3B86A 2OPOA 3SIAA 1RROA 4FQTA 2BCBA 3R1PA 1B1GA 3TS5C 1K9UA 4F7FA 4BY4A 1DMOA 4F0ZB 4INWA 2M3WA 4IJ7A 4ORCB 2M1UA 3PN7C 1BODA 2KAVA 1N65A 1F8HA 2HQWA 1G33A 1KFXL 2F3ZA 1XYDA 4R1EA 1XFUO 2KBIA 1DGVA 3TS5B 1KK7Z 1CDMA 1OW4A 2WCFA 3R1OA 4PCWA 5D7FA 2ZKMX 3CABA 2HETA 1W7JB 2QEOA 3SG3A 1DT7B 1K9KA 1L2OC 2JT0A 5I8NA 3D10A 2G9BA 3C1VA 1GM0A 1SMGA 1KSMA 3CGAA 3OHMB 4OZDA 3CR2A 1NPQA 1F4OA 3SG2A 1V1GA 2JWWA 4YGDB 3EKJA 2WCEA 2LHLA 1G8IA 3D0YB 1UHNA 3M0WA 1RK9A 3NGVA 1KQMB 3PM2A 1MQ1A 4HRGA 2I7AA 3EK4A 5AEQA 1C07A 2L5XB 2WCKA 4GGNA 3HCMA 1ZUZA 1S5GZ 3DF0A 4OKHA 1WRKA 1FF1A 2BBMA 3KO0A 2V53A 2M29A 4ORAB 1L2OB 2ZNEA 1T14A 1QIWA 1U5IA 2BKIB 2PQLA 3DD4A 3I5FC 2JOJA 3EKHA 4GBAA 4I5LB 3D77A 1TCFA 2JTZA 1X02A 3NSLA 2K0JA 1QATA 1QX5B 2GGZA 2L4IA 1QXPA 5CSNA 3L47A 1TRFA 2LUXA 1NX1A 1ODBA 1B7TY 3JVTC 3DF0B 1IJ6A 3OB2B 3ZNIA 1A29A 1DELA 2ZN8A 1N2DA 1CLBA 2OTGB 5GQQC 4QJ5B 1A75B 4OVNF 3LLEA 1YUTA 2K60A 1V1FA 2JZIA 2LNKA 4XJKA 2GTEA 3PFVA 1U5IB 1M39A 5I94A 1C3ZA 1KFUL 4ZCUA 1DEKA 3TUYC 1CDPA 3A4UB 3NSKA 4HSZA 3BOWB 4P2YB 3RZSA 1W7IB 4N1GA 5HKZA 1Y0VH 2JU0A 1Z4HA 3WHUB 3IF7A 2KI6D 1YX8A 3AAJA 1QJTA 2KFHA 4E68A 4NQGA 1SNLA 2Y1MA 1OZSA 3JTDB 1M31A 2M8UA 2K8MB 3SG5A 1TN4A 3DXLA 3OX6A 1JF0A 2JT8A 1Y1AA 2LVKA 3FS7A 5HLOA 4QJ4B 1AVSA 2P6BB 1K95A 2I2RE 1QV0A 2F8PA 1PULA 2JULA 3SS3A 3TDUA 2TN4A 3AKBA 3B7AA 2ERBA 4GFTA 3S0GA 1GGWA 3S0DA 4C0LA 1SCMB 2YGUA 2BKHB 2QEVA 3EVVA 3N7HA 3O4XA 5BPJA 5CSFA 5G08A 1J7PA 1IIOA 1QASA 1QX7A 3DVJA 2WCBA 1Y1XA 4GGFA 1IG5A 5CSJA 5JOLA 1SBJA 4I5KA 1BLQA 3QRXA 2MLFC 1YX7A 2M1KB 3BUOB 2E30A 3O2PA 1CNPA 3D75A 4KYNA 2JPOA 1CFFA 1K2HA 1IJ5A 1DJGA 2M0RA 3JVTB 2JNFA 3SG7A 1KSOA 1WY9A 2OTGC 1DJWA 1A75A 1MF8B 1LVCD 5F6TA 3IVTA 1OOFA 1LINA 1K96A 1DVIA 2M7NA 3TZ1A 2LMUA 2WC5A 4PT1A 3KEVA 1CDNA 2A4JA 1EG4A 1UHJA 2Q4UA 3VRPA 1SRAA 2BL0C 1XFYO 4DUQA 1TNWA 5I2LA 2CXJA 3O6BA 2KQYA 2Y5IA 4Q04A 2K7BA 1OSAA 1EG3A 3MSEB 4INXA 2MAZA 5AXIA 2QEBA 3FE9A 1QTXA 1XO5A 4FQOA 1FI5A 3IQQA 3Q8IA 4GPLB 5IBWA 1DQEA 3FE8A 1WDCC 2HQ8A 3EG5B 1YVHA 5KSZA 2LV7A 3OX5A 1AK8A 2LLUA 4P5OE 1SL9A 1UHHA 1TNQA 1AHRA 3CR4X 3QMEA 3BUXB 1QX2A 2WOSA 4WQ2A 4OR9B 3I5IB 5HKWA 5AERA 2L50A 2O5GA 4GGFC 4MZLA 1TCOB 3S0AA 1K94A 4PE0A 1TUZA 1KFXS 3K1EA 1BR4B 1IQ5A 2JC2A 2KAYA 3GOFA 1DJYA 1PRWA 2M7LA 1QS7A 4U8DA 1SCVA 3PLFB 2LVIA 1ZACA 1NP8A 1IWQA 3RLZA 4CIDA 3I5FB 5FI6A 4OV2A 1IKUA 1QVIY 1SL7A 2I94A 2PALA 4ICBA 2KDHA 3CZ2A 4PE4A 2KLEA 2ZNDA 2JXLA 2KLDA 3CZ0A 1K9PA 1NUBA 3PN7B 5TNCA 4TNCA 3SS4A 3F45A 1DF0B 1XA5A 1Q80A 2VRGA 3VROA 1F70A 1WRLA 2NCPA 3EK7A 3CS1A 1DJIA 4DCKA 4CPVA 3VB1A 1ZFSA 1XFRA 3FIAA 1K90D 1A2XA 1KK7Y 1KWOC 3I5HB 3OB1B 4OCIA 2M9GA 4WQ3A 3KHEA 3NHIA 1FBVA 2EC6B 4YRUA 2G2BA 1MWNA 1QIVA 1WLZA 2KOTA 1MXEA 5HYDA 5JJGA 1F54A 3BFHA 1WLMA 2KYFA 1R6PA 2Y1NA 3I5IC 3BQ3A 3D74A 3PATA 3UNWA 1SK6D 1TUJA 1WRZA 1FI6A 1J7RA 1WDCB 2KFFA 1OOJA 2MHHA 1E8AA 3NSOA 2OS8B 3NHTA 4FTGA 4C0KA 3PJIA 1R2UA 1TOPA 4L9MA 2CT9A 5HL1A 1S36A 2WC6A 3V2LA 1XFVO 2L51A 1SR6B 2JQ6A 3L4AA 4N1FA 2I18A 1MHOA 3DYEA 4AQJA 1PSBA 1B47A 3GK4X 4I5JA 2PSRA 1PSRA 1LA0A 2CTNA 4XJKB 1XVJA 3BOWA 3AKAA 1CMFA 5J3XA 2BE6A 3DVMA 4NDDA 3BJHA 4PE7A 2LVJA 1BJFA 2MJWB 4CFRA 1NX0A 2LVVA 4PE1A 3D78A 3EVRA 1IRJA 1LKJA 3D0YA 3O78A 1AP4A 1BR1B 2LMVA 2HPSA 1PVAA 2P71A 4NDCA 2F2OA 5I2QA 2QACA 1OOIX 5DKQA 5FI7A 1BF5A 1H8BA 3CZTX 1MUXA 2LP2A 1NYAA 2NZ0A 2L98A 4DS7A 4GUKA 1JSAA 2CNPA 3VRRA 1S5GY 2LAPA 1Z2CB 1P28A 1S3PA 2L0PA 2OS8C 2ZRTA 3B87A 3DVEA 4MRYA 3GK1A 2WORA 1KK8C 4YGBB 1KQMC 1JFKA 4C0JA 2D8NA 4DRWA 2H8VA 1GJYA 2KHNA 4MLWA 1CB1A 2K7OA 1Y1UA 1CLMA 2MBXA 3H4SE 1YRTB 3NXAA 3BFAA 2M97A 1XFXO 4JD9A 1GQMA 2WNDA 4PHJA 1BG1A 3B88A 4M2QA 1NSHA 2MLEC 1KQVA
chains in the Genus database with same CATH topology
5ER5A 1UUSA 3JTDC 2JNXA 5DKRA 1NCXA 2BCXA 2KYCA 1UHIA 1NCZA 1BT6A 1A4PA 1SY9A 1B8LA 3K21A 4PHNA 1BU3A 3GK2A 2COLB 1DJHA 1IGVA 1NIWA 3O4YA 1OMRA 2BE4A 4N5XA 2NXQA 1UWOA 1IH0A 1KK8B 1DJZA 2ZN9A 2QPTA 3HX4A 1SPYA 1SYMA 1FW4A 2SCPA 5HKYA 4IL1A 2K61A 1KCYA 2JT3A 2AUCA 4PHKA 1Y6WA 3PSRA 1OMDA 1NX2A 2KQ6A 3BYAA 5KTYA 3KF9A 1CLLA 1RFJA 2KI4C 1B8RA 2LCPA 1YR5A 1AJ5A 1PK0D 1EL4A 3E3RA 2L4HA 1TNPA 3SG4A 1F4QA 1J1EA 1LA3A 3OP0A 1IQ3A 4ZCVA 1S26D 1YVLA 4QJ3B 4ETOA 1RJVA 1QVIZ 1UP5A 4XYNA 1C7VA 1B8CA 2JTTA 2JPTA 1BOCA 4GNKB 1EJ3A 5AFPA 1K8UA 4MVFA 5CSIA 1CM1A 1CDLA 2FCEA 1HQVA 1J7OA 3CLNA 4D1EA 3RM1A 1J1DA 2LLSA 5AANA 1CFDA 3FWCA 3DVKA 2LC5A 2IS9A 4PDZA 2LHIA 1TTXA 2FOTA 2R2IA 1SL8A 3SJSA 1XK4A 3CWGA 1RECA 4CFQA 2RGIA 3ICBA 1AUIB 3BUNB 1DGUA 1JC2A 4MZKA 1JBAA 1XFZO 1JFJA 2K2AA 1SW8A 3EK8A 4JWQA 1M63B 1YUSA 4MZJA 3TDIA 2E6WA 1ZMZA 1A03A 4MRXA 3KPXA 1H4BA 4MSPA 1NWDA 1B7TZ 1UHKA 2Y4QA 4HRHA 2BL0B 2NLNA 1OE9B 1C7WA 2JXCA 3LK1A 1QLSA 2AAOA 2LANA 3TDZA 2LP3A 1NX3A 2H61C 4YGAA 1SR6C 4MEWA 3LCPC 5I2OA 1EH2A 1HT9A 1S6IA 2F2PA 4GAOA 2FJUB 2KNEA 2L2EA 2H2KA 1QV1A 3I5GB 4YGEB 1DTLA 1SCMC 4PALA 1CKKA 1MR8A 2H61A 2LLTA 3AAKA 2PRUA 1LXFC 2KBMA 3FWBA 2MRDA 3SIBA 3WNXB 4HREE 1ALWA 4AOMA 2Q91A 4WRIA 2B1UA 1B9AA 1KFUS 1KWOB 2PVBA 3I5HC 4DIRA 3BUWB 5B8IB 5DKNA 2EC6C 2KFGA 1XK4C 2MA2A 3IQOA 4I5NB 2M49B 1CFPA 1QLKA 2LE9B 2PASA 2PMYA 5FYXA 4ORBB 3NSIA 4YI9A 3LK0A 2LUCA 1OQPA 1PVBA 2K7CA 2CCMA 2ZRSA 1PALA 1EXRA 2WC8A 2AMIA 1L7ZA 2KAXA 1RWYA 2O60A 3I5GC 4NDBA 1JUOA 2KI6C 2GV5A 1K93D 1ALVA 2GGMA 1NCYA 2KGRA 3SG6A 4M2PA 3TUYB 1RTP1 2FCDA 1XFWO 1YURA 2HF5A 4YI8A 1J55A 2CBLA 2F33A 2LMTA 1B4CA 3VRQA 5PALA 2DOQA 4MN0A 2BCAA 1S1EA 3WHTB 1SKTA 4YGCB 4USLA 4M2OA 1GGZA 1JF2A 2SASA 4MBEA 1FPWA 4A4CA 1UURA 1AJ4A 1MXLC 4CLNA 4UPGA 5ER4X 2K2FA 2LM5A 1CTRA 1TNXA 2ZFDA 3A8RA 1YUUA 1M46A 1DJXA 1J7QA 3LL8B 2NCOA 1DF0A 5CPVA 1VRKA 2KSPA 4PHMA 3VRNA 2KGBC 1CFCA 1JWDA 2K7DA 2F3YA 4AQIA 1CMGA 4JQ0D 1OMVA 3BUMB 1BMOA 2EHBA 2ISDA 1F55A 2EGDA 3PALA 3ZWHA 3CTNA 1S6JA 2JRFA 1M45A 4YBHB 1G4YR 3WXAA 1N0YA 1OZOA 1ZOTB 3CR5X 4BY5A 3VGOA 1YTZC 1CM4A 5KU1A 1TIZA 1F71A 5D69A 3PM8A 4JPZB 5HLVA 1D1OA 2BBNA 2BECA 5K89A 3EVUA 2KI4B 1S6CA 3BXKA 1YRUB 3SIAA 2OPOA 1RROA 2BCBA 1B1GA 3TS5C 1K9UA 4BY4A 1DMOA 4F0ZB 2M3WA 4ORCB 2M1UA 3PN7C 1BODA 2KAVA 1N65A 1F8HA 2HQWA 1G33A 1KFXL 2F3ZA 1XYDA 4R1EA 1XFUO 2KBIA 1DGVA 3TS5B 1KK7Z 1CDMA 2WCFA 4PCWA 5D7FA 2ZKMX 2HETA 1W7JB 3SG3A 1DT7B 1K9KA 1L2OC 2JT0A 5I8NA 3D10A 2G9BA 3C1VA 1SMGA 1KSMA 3CGAA 3OHMB 3CR2A 1NPQA 1F4OA 3SG2A 1V1GA 2JWWA 4YGDB 3EKJA 2WCEA 2LHLA 1G8IA 3D0YB 1UHNA 3M0WA 1RK9A 1KQMB 1MQ1A 4HRGA 2I7AA 3EK4A 5AEQA 1C07A 2L5XB 4GGNA 3HCMA 1S5GZ 1ZUZA 3DF0A 4OKHA 1WRKA 1FF1A 2BBMA 3KO0A 2V53A 2M29A 4ORAB 1L2OB 2ZNEA 1U5IA 1QIWA 2BKIB 3DD4A 3I5FC 2JOJA 3EKHA 4GBAA 4I5LB 1TCFA 2JTZA 1X02A 3NSLA 2K0JA 1QATA 1QX5B 2GGZA 2L4IA 1QXPA 5CSNA 1TRFA 2LUXA 1NX1A 1ODBA 1B7TY 3JVTC 3DF0B 1IJ6A 3OB2B 3ZNIA 1A29A 2ZN8A 4A4BA 1N2DA 1CLBA 2OTGB 5GQQC 4QJ5B 1A75B 4OVNF 3LLEA 1YUTA 1V1FA 2JZIA 2LNKA 4XJKA 3PFVA 1U5IB 1M39A 4ZCUA 1KFUL 3TUYC 1CDPA 3A4UB 3NSKA 4HSZA 3BOWB 4P2YB 1W7IB 4N1GA 5HKZA 1Y0VH 2JU0A 3WHUB 3IF7A 2KI6D 1YX8A 3AAJA 1QJTA 2KFHA 4E68A 4NQGA 1SNLA 2Y1MA 1OZSA 3JTDB 1M31A 2M8UA 2K8MB 3SG5A 1TN4A 3OX6A 1JF0A 2JT8A 1Y1AA 2LVKA 3FS7A 5HLOA 4QJ4B 1AVSA 2P6BB 1K95A 2I2RE 1QV0A 2F8PA 1PULA 2JULA 3TDUA 2TN4A 3AKBA 4GFTA 1GGWA 4C0LA 1SCMB 2BKHB 3EVVA 5BPJA 5CSFA 5G08A 1J7PA 1QASA 1QX7A 3DVJA 2WCBA 1Y1XA 4GGFA 1IG5A 5CSJA 5JOLA 1SBJA 4I5KA 1BLQA 3QRXA 2MLFC 1YX7A 2M1KB 3BUOB 2E30A 3O2PA 1CNPA 1CFFA 1K2HA 1IJ5A 1DJGA 2M0RA 3JVTB 2JNFA 3SG7A 1KSOA 1WY9A 2OTGC 1DJWA 1A75A 1MF8B 1LVCD 5F6TA 1LINA 1K96A 1DVIA 2M7NA 3TZ1A 2LMUA 3KEVA 1CDNA 2A4JA 1EG4A 1UHJA 2Q4UA 3VRPA 1SRAA 2BL0C 1XFYO 4DUQA 1TNWA 5I2LA 2CXJA 3O6BA 2KQYA 2Y5IA 4Q04A 2K7BA 1OSAA 1EG3A 3MSEB 2MAZA 5AXIA 1QTXA 1XO5A 4FQOA 1FI5A 3IQQA 4GPLB 5IBWA 1WDCC 2HQ8A 1YVHA 5KSZA 2LV7A 3OX5A 1AK8A 2LLUA 4P5OE 1SL9A 1UHHA 1TNQA 1AHRA 3CR4X 3BUXB 1QX2A 2WOSA 4WQ2A 4OR9B 3I5IB 5HKWA 5AERA 2L50A 2O5GA 4GGFC 4MZLA 1TCOB 1K94A 4PE0A 1KFXS 1BR4B 1IQ5A 2JC2A 2KAYA 3GOFA 1DJYA 1PRWA 2M7LA 1QS7A 4U8DA 1SCVA 3PLFB 2LVIA 1ZACA 1NP8A 1IWQA 3RLZA 4CIDA 3I5FB 4OV2A 1IKUA 1QVIY 1SL7A 2I94A 2PALA 4ICBA 2KDHA 4PE4A 2ZNDA 2JXLA 1K9PA 1NUBA 3PN7B 5TNCA 4TNCA 3F45A 1DF0B 1XA5A 1Q80A 2VRGA 3VROA 1F70A 1WRLA 2NCPA 3EK7A 3CS1A 1DJIA 4DCKA 4CPVA 1ZFSA 3FIAA 1K90D 1A2XA 1KK7Y 1KWOC 3I5HB 3OB1B 4OCIA 2M9GA 4WQ3A 3KHEA 1FBVA 2EC6B 4YRUA 2G2BA 1MWNA 1QIVA 1WLZA 2KOTA 1MXEA 5HYDA 5JJGA 1F54A 3I5IC 1WLMA 2KYFA 1R6PA 2Y1NA 3BQ3A 3PATA 1SK6D 1WRZA 1FI6A 1J7RA 1WDCB 2KFFA 1OOJA 2MHHA 1E8AA 3NSOA 2OS8B 4FTGA 4C0KA 1R2UA 1TOPA 4L9MA 2CT9A 1S36A 1XFVO 2L51A 1SR6B 2JQ6A 4AQJA 4N1FA 2I18A 1MHOA 1PSBA 1B47A 3GK4X 4I5JA 2PSRA 1PSRA 1LA0A 2CTNA 4XJKB 1XVJA 3BOWA 3AKAA 1CMFA 5J3XA 2BE6A 3DVMA 4NDDA 4PE7A 2LVJA 1BJFA 2MJWB 4CFRA 1NX0A 2LVVA 4PE1A 3EVRA 1IRJA 1LKJA 3D0YA 3O78A 1AP4A 1BR1B 2LMVA 2HPSA 1PVAA 4NDCA 2F2OA 5I2QA 2QACA 5DKQA 1BF5A 1H8BA 3CZTX 1MUXA 2LP2A 1NYAA 2NZ0A 2L98A 4DS7A 4GUKA 1JSAA 2CNPA 3VRRA 1S5GY 2LAPA 1S3PA 2L0PA 2OS8C 2ZRTA 4MRYA 3DVEA 3GK1A 2WORA 1KK8C 4YGBB 1KQMC 1JFKA 4C0JA 2D8NA 4DRWA 2KHNA 1GJYA 1CB1A 4MLWA 2K7OA 1Y1UA 1CLMA 2MBXA 3H4SE 1YRTB 3NXAA 2M97A 1XFXO 1GQMA 2WNDA 4PHJA 1BG1A 4M2QA 1NSHA 2MLEC 1KQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ER5 A;  1UUS A;  3JTD C;  2JNX A;  5DKR A;  1NCX A;  2BCX A;  2KYC A;  1UHI A;  1NCZ A;  1BT6 A;  1A4P A;  1SY9 A;  1B8L A;  3K21 A;  4PHN A;  1BU3 A;  3GK2 A;  2COL B;  1DJH A;  1IGV A;  1NIW A;  3O4Y A;  1OMR A;  2BE4 A;  4N5X A;  2NXQ A;  1UWO A;  1IH0 A;  1KK8 B;  1DJZ A;  2ZN9 A;  2QPT A;  3HX4 A;  1SPY A;  1SYM A;  1FW4 A;  2SCP A;  5HKY A;  4IL1 A;  2K61 A;  1KCY A;  2JT3 A;  2AUC A;  4PHK A;  1Y6W A;  3PSR A;  1OMD A;  1NX2 A;  2KQ6 A;  3BYA A;  5KTY A;  3KF9 A;  1CLL A;  1RFJ A;  2KI4 C;  1B8R A;  2LCP A;  1YR5 A;  1AJ5 A;  1PK0 D;  1EL4 A;  3E3R A;  2L4H A;  1TNP A;  3SG4 A;  1F4Q A;  1J1E A;  1LA3 A;  3OP0 A;  1IQ3 A;  4ZCV A;  1S26 D;  1YVL A;  4QJ3 B;  4ETO A;  1RJV A;  1QVI Z;  1UP5 A;  4XYN A;  1C7V A;  1B8C A;  2JTT A;  2JPT A;  1BOC A;  4GNK B;  1EJ3 A;  5AFP A;  1K8U A;  4MVF A;  5CSI A;  1CM1 A;  1CDL A;  2FCE A;  1HQV A;  1J7O A;  3CLN A;  4D1E A;  3RM1 A;  1J1D A;  2LLS A;  5AAN A;  1CFD A;  3FWC A;  3DVK A;  2LC5 A;  2IS9 A;  4PDZ A;  2LHI A;  1TTX A;  2FOT A;  2R2I A;  1SL8 A;  3SJS A;  1XK4 A;  3CWG A;  1REC A;  4CFQ A;  2RGI A;  3ICB A;  1AUI B;  3BUN B;  1DGU A;  1JC2 A;  4MZK A;  1JBA A;  1XFZ O;  1JFJ A;  2K2A A;  1SW8 A;  3EK8 A;  4JWQ A;  1M63 B;  1YUS A;  4MZJ A;  3TDI A;  2E6W A;  1ZMZ A;  1A03 A;  4MRX A;  3KPX A;  1H4B A;  4MSP A;  1NWD A;  1B7T Z;  1UHK A;  2Y4Q A;  4HRH A;  2BL0 B;  2NLN A;  1OE9 B;  1C7W A;  2JXC A;  3LK1 A;  1QLS A;  2AAO A;  2LAN A;  3TDZ A;  2LP3 A;  1NX3 A;  2H61 C;  4YGA A;  1SR6 C;  4MEW A;  3LCP C;  5I2O A;  1EH2 A;  1HT9 A;  1S6I A;  2F2P A;  4GAO A;  2FJU B;  2KNE A;  2L2E A;  2H2K A;  1QV1 A;  3I5G B;  4YGE B;  1DTL A;  1SCM C;  4PAL A;  1CKK A;  1MR8 A;  2H61 A;  2LLT A;  3AAK A;  2PRU A;  1LXF C;  2KBM A;  3FWB A;  2MRD A;  3SIB A;  3WNX B;  4HRE E;  1ALW A;  4AOM A;  2Q91 A;  4WRI A;  2B1U A;  1B9A A;  1KFU S;  1KWO B;  2PVB A;  3I5H C;  4DIR A;  3BUW B;  5B8I B;  5DKN A;  2EC6 C;  2KFG A;  1XK4 C;  2MA2 A;  3IQO A;  4I5N B;  2M49 B;  1CFP A;  1QLK A;  2LE9 B;  2PAS A;  2PMY A;  5FYX A;  4ORB B;  3NSI A;  4YI9 A;  3LK0 A;  2LUC A;  1OQP A;  1PVB A;  2K7C A;  2CCM A;  2ZRS A;  1PAL A;  1EXR A;  2WC8 A;  2AMI A;  1L7Z A;  2KAX A;  1RWY A;  2O60 A;  3I5G C;  4NDB A;  1JUO A;  2KI6 C;  2GV5 A;  1K93 D;  1ALV A;  2GGM A;  1NCY A;  2KGR A;  3SG6 A;  4M2P A;  3TUY B;  1RTP 1;  2FCD A;  1XFW O;  1YUR A;  2HF5 A;  4YI8 A;  1J55 A;  2CBL A;  2F33 A;  2LMT A;  1B4C A;  3VRQ A;  5PAL A;  2DOQ A;  4MN0 A;  2BCA A;  1S1E A;  3WHT B;  1SKT A;  4YGC B;  4USL A;  4M2O A;  1GGZ A;  1JF2 A;  2SAS A;  4MBE A;  1FPW A;  4A4C A;  1UUR A;  1AJ4 A;  1MXL C;  4CLN A;  4UPG A;  5ER4 X;  2K2F A;  2LM5 A;  1CTR A;  1TNX A;  2ZFD A;  3A8R A;  1YUU A;  1M46 A;  1DJX A;  1J7Q A;  3LL8 B;  2NCO A;  1DF0 A;  5CPV A;  1VRK A;  2KSP A;  4PHM A;  3VRN A;  2KGB C;  1CFC A;  1JWD A;  2K7D A;  2F3Y A;  4AQI A;  1CMG A;  4JQ0 D;  1OMV A;  3BUM B;  1BMO A;  2EHB A;  2ISD A;  1F55 A;  2EGD A;  3PAL A;  3ZWH A;  3CTN A;  1S6J A;  2JRF A;  1M45 A;  4YBH B;  1G4Y R;  3WXA A;  1N0Y A;  1OZO A;  1ZOT B;  3CR5 X;  4BY5 A;  3VGO A;  1YTZ C;  1CM4 A;  5KU1 A;  1TIZ A;  1F71 A;  5D69 A;  3PM8 A;  4JPZ B;  5HLV A;  1D1O A;  2BBN A;  2BEC A;  5K89 A;  3EVU A;  2KI4 B;  1S6C A;  3BXK A;  1YRU B;  3SIA A;  2OPO A;  1RRO A;  2BCB A;  1B1G A;  3TS5 C;  1K9U A;  4BY4 A;  1DMO A;  4F0Z B;  2M3W A;  4ORC B;  2M1U A;  3PN7 C;  1BOD A;  2KAV A;  1N65 A;  1F8H A;  2HQW A;  1G33 A;  1KFX L;  2F3Z A;  1XYD A;  4R1E A;  1XFU O;  2KBI A;  1DGV A;  3TS5 B;  1KK7 Z;  1CDM A;  2WCF A;  4PCW A;  5D7F A;  2ZKM X;  2HET A;  1W7J B;  3SG3 A;  1DT7 B;  1K9K A;  1L2O C;  2JT0 A;  5I8N A;  3D10 A;  2G9B A;  3C1V A;  1SMG A;  1KSM A;  3CGA A;  3OHM B;  3CR2 A;  1NPQ A;  1F4O A;  3SG2 A;  1V1G A;  2JWW A;  4YGD B;  3EKJ A;  2WCE A;  2LHL A;  1G8I A;  3D0Y B;  1UHN A;  3M0W A;  1RK9 A;  1KQM B;  1MQ1 A;  4HRG A;  2I7A A;  3EK4 A;  5AEQ A;  1C07 A;  2L5X B;  4GGN A;  3HCM A;  1S5G Z;  1ZUZ A;  3DF0 A;  4OKH A;  1WRK A;  1FF1 A;  2BBM A;  3KO0 A;  2V53 A;  2M29 A;  4ORA B;  1L2O B;  2ZNE A;  1U5I A;  1QIW A;  2BKI B;  3DD4 A;  3I5F C;  2JOJ A;  3EKH A;  4GBA A;  4I5L B;  1TCF A;  2JTZ A;  1X02 A;  3NSL A;  2K0J A;  1QAT A;  1QX5 B;  2GGZ A;  2L4I A;  1QXP A;  5CSN A;  1TRF A;  2LUX A;  1NX1 A;  1ODB A;  1B7T Y;  3JVT C;  3DF0 B;  1IJ6 A;  3OB2 B;  3ZNI A;  1A29 A;  2ZN8 A;  4A4B A;  1N2D A;  1CLB A;  2OTG B;  5GQQ C;  4QJ5 B;  1A75 B;  4OVN F;  3LLE A;  1YUT A;  1V1F A;  2JZI A;  2LNK A;  4XJK A;  3PFV A;  1U5I B;  1M39 A;  4ZCU A;  1KFU L;  3TUY C;  1CDP A;  3A4U B;  3NSK A;  4HSZ A;  3BOW B;  4P2Y B;  1W7I B;  4N1G A;  5HKZ A;  1Y0V H;  2JU0 A;  3WHU B;  3IF7 A;  2KI6 D;  1YX8 A;  3AAJ A;  1QJT A;  2KFH A;  4E68 A;  4NQG A;  1SNL A;  2Y1M A;  1OZS A;  3JTD B;  1M31 A;  2M8U A;  2K8M B;  3SG5 A;  1TN4 A;  3OX6 A;  1JF0 A;  2JT8 A;  1Y1A A;  2LVK A;  3FS7 A;  5HLO A;  4QJ4 B;  1AVS A;  2P6B B;  1K95 A;  2I2R E;  1QV0 A;  2F8P A;  1PUL A;  2JUL A;  3TDU A;  2TN4 A;  3AKB A;  4GFT A;  1GGW A;  4C0L A;  1SCM B;  2BKH B;  3EVV A;  5BPJ A;  5CSF A;  5G08 A;  1J7P A;  1QAS A;  1QX7 A;  3DVJ A;  2WCB A;  1Y1X A;  4GGF A;  1IG5 A;  5CSJ A;  5JOL A;  1SBJ A;  4I5K A;  1BLQ A;  3QRX A;  2MLF C;  1YX7 A;  2M1K B;  3BUO B;  2E30 A;  3O2P A;  1CNP A;  1CFF A;  1K2H A;  1IJ5 A;  1DJG A;  2M0R A;  3JVT B;  2JNF A;  3SG7 A;  1KSO A;  1WY9 A;  2OTG C;  1DJW A;  1A75 A;  1MF8 B;  1LVC D;  5F6T A;  1LIN A;  1K96 A;  1DVI A;  2M7N A;  3TZ1 A;  2LMU A;  3KEV A;  1CDN A;  2A4J A;  1EG4 A;  1UHJ A;  2Q4U A;  3VRP A;  1SRA A;  2BL0 C;  1XFY O;  4DUQ A;  1TNW A;  5I2L A;  2CXJ A;  3O6B A;  2KQY A;  2Y5I A;  4Q04 A;  2K7B A;  1OSA A;  1EG3 A;  3MSE B;  2MAZ A;  5AXI A;  1QTX A;  1XO5 A;  4FQO A;  1FI5 A;  3IQQ A;  4GPL B;  5IBW A;  1WDC C;  2HQ8 A;  1YVH A;  5KSZ A;  2LV7 A;  3OX5 A;  1AK8 A;  2LLU A;  4P5O E;  1SL9 A;  1UHH A;  1TNQ A;  1AHR A;  3CR4 X;  3BUX B;  1QX2 A;  2WOS A;  4WQ2 A;  4OR9 B;  3I5I B;  5HKW A;  5AER A;  2L50 A;  2O5G A;  4GGF C;  4MZL A;  1TCO B;  1K94 A;  4PE0 A;  1KFX S;  1BR4 B;  1IQ5 A;  2JC2 A;  2KAY A;  3GOF A;  1DJY A;  1PRW A;  2M7L A;  1QS7 A;  4U8D A;  1SCV A;  3PLF B;  2LVI A;  1ZAC A;  1NP8 A;  1IWQ A;  3RLZ A;  4CID A;  3I5F B;  4OV2 A;  1IKU A;  1QVI Y;  1SL7 A;  2I94 A;  2PAL A;  4ICB A;  2KDH A;  4PE4 A;  2ZND A;  2JXL A;  1K9P A;  1NUB A;  3PN7 B;  5TNC A;  4TNC A;  3F45 A;  1DF0 B;  1XA5 A;  1Q80 A;  2VRG A;  3VRO A;  1F70 A;  1WRL A;  2NCP A;  3EK7 A;  3CS1 A;  1DJI A;  4DCK A;  4CPV A;  1ZFS A;  3FIA A;  1K90 D;  1A2X A;  1KK7 Y;  1KWO C;  3I5H B;  3OB1 B;  4OCI A;  2M9G A;  4WQ3 A;  3KHE A;  1FBV A;  2EC6 B;  4YRU A;  2G2B A;  1MWN A;  1QIV A;  1WLZ A;  2KOT A;  1MXE A;  5HYD A;  5JJG A;  1F54 A;  3I5I C;  1WLM A;  2KYF A;  1R6P A;  2Y1N A;  3BQ3 A;  3PAT A;  1SK6 D;  1WRZ A;  1FI6 A;  1J7R A;  1WDC B;  2KFF A;  1OOJ A;  2MHH A;  1E8A A;  3NSO A;  2OS8 B;  4FTG A;  4C0K A;  1R2U A;  1TOP A;  4L9M A;  2CT9 A;  1S36 A;  1XFV O;  2L51 A;  1SR6 B;  2JQ6 A;  4AQJ A;  4N1F A;  2I18 A;  1MHO A;  1PSB A;  1B47 A;  3GK4 X;  4I5J A;  2PSR A;  1PSR A;  1LA0 A;  2CTN A;  4XJK B;  1XVJ A;  3BOW A;  3AKA A;  1CMF A;  5J3X A;  2BE6 A;  3DVM A;  4NDD A;  4PE7 A;  2LVJ A;  1BJF A;  2MJW B;  4CFR A;  1NX0 A;  2LVV A;  4PE1 A;  3EVR A;  1IRJ A;  1LKJ A;  3D0Y A;  3O78 A;  1AP4 A;  1BR1 B;  2LMV A;  2HPS A;  1PVA A;  4NDC A;  2F2O A;  5I2Q A;  2QAC A;  5DKQ A;  1BF5 A;  1H8B A;  3CZT X;  1MUX A;  2LP2 A;  1NYA A;  2NZ0 A;  2L98 A;  4DS7 A;  4GUK A;  1JSA A;  2CNP A;  3VRR A;  1S5G Y;  2LAP A;  1S3P A;  2L0P A;  2OS8 C;  2ZRT A;  4MRY A;  3DVE A;  3GK1 A;  2WOR A;  1KK8 C;  4YGB B;  1KQM C;  1JFK A;  4C0J A;  2D8N A;  4DRW A;  2KHN A;  1GJY A;  1CB1 A;  4MLW A;  2K7O A;  1Y1U A;  1CLM A;  2MBX A;  3H4S E;  1YRT B;  3NXA A;  2M97 A;  1XFX O;  1GQM A;  2WND A;  4PHJ A;  1BG1 A;  4M2Q A;  1NSH A;  2MLE C;  1KQV A; 
#chains in the Genus database with same CATH topology
 5ER5 A;  1UUS A;  1W9Z A;  2JNX A;  3JTD C;  5DKR A;  1NCX A;  2BCX A;  2KYC A;  1UHI A;  1NCZ A;  1BT6 A;  1A4P A;  1SY9 A;  1B8L A;  2P70 A;  3K21 A;  4PHN A;  1BU3 A;  3GK2 A;  2COL B;  1DJH A;  1IGV A;  1NIW A;  3O4Y A;  1OMR A;  2BE4 A;  3DZT A;  4N5X A;  2NXQ A;  1UWO A;  1IH0 A;  1KK8 B;  1DJZ A;  2ZN9 A;  2QPT A;  3HX4 A;  1SPY A;  1SYM A;  1FW4 A;  2SCP A;  5HKY A;  4IL1 A;  2K61 A;  1KCY A;  2JT3 A;  2AUC A;  4PHK A;  1Y6W A;  3PSR A;  1OMD A;  1NX2 A;  2KQ6 A;  3BYA A;  5KTY A;  3KF9 A;  3R1V A;  1CLL A;  1RFJ A;  2KI4 C;  1B8R A;  2LCP A;  1YR5 A;  1AJ5 A;  1PK0 D;  1EL4 A;  3E3R A;  2L4H A;  1TNP A;  3SG4 A;  1F4Q A;  1J1E A;  1LA3 A;  3OP0 A;  1IQ3 A;  4ZCV A;  1S26 D;  1YVL A;  4QJ3 B;  1QWV A;  4ETO A;  1RJV A;  1QVI Z;  1UP5 A;  2KPH A;  4XYN A;  1C7V A;  1B8C A;  2JTT A;  2JPT A;  1BOC A;  3R72 A;  4GNK B;  1EJ3 A;  5AFP A;  1K8U A;  4MVF A;  5CSI A;  1CM1 A;  5EL2 A;  1CDL A;  2FCE A;  1HQV A;  1J7O A;  3CLN A;  4D1E A;  3RM1 A;  1J1D A;  2LLS A;  3CYZ A;  1CFD A;  5AAN A;  3FWC A;  2L2C A;  2LC5 A;  2IS9 A;  3DVK A;  4PDZ A;  4A4B A;  2LHI A;  1TTX A;  2FOT A;  2R2I A;  1SL8 A;  3SJS A;  1XK4 A;  3CWG A;  1DC1 A;  1REC A;  4CFQ A;  3OBV A;  2RGI A;  3ICB A;  1AUI B;  3BUN B;  1DGU A;  1JC2 A;  4MZK A;  1JBA A;  1XFZ O;  1TWO A;  1JFJ A;  2K2A A;  1SW8 A;  3EK8 A;  4JWQ A;  1M63 B;  1YUS A;  4MZJ A;  3TDI A;  2E6W A;  1ZMZ A;  1A03 A;  1C3Y A;  4MRX A;  3KPX A;  3SS5 A;  1H4B A;  4MSP A;  3UO9 A;  1NWD A;  2L5Y A;  1B7T Z;  1UHK A;  2Y4Q A;  4HRH A;  4JKT A;  2BL0 B;  2NLN A;  1OE9 B;  1C7W A;  2JXC A;  3LK1 A;  1OOG A;  1QLS A;  2AAO A;  2LAN A;  3TDZ A;  2LP3 A;  1NX3 A;  2H61 C;  4YGA A;  1SR6 C;  4MEW A;  3LCP C;  5D3O A;  5I2O A;  1EH2 A;  1HT9 A;  1ORG A;  1S6I A;  2F2P A;  4GAO A;  2FJU B;  2KNE A;  2L2E A;  2H2K A;  1QV1 A;  3I5G B;  3CZ1 A;  4YGE B;  5DIC A;  1DTL A;  3BFB A;  1SCM C;  4PAL A;  1CKK A;  1MR8 A;  2H61 A;  2LLT A;  3AAK A;  2PRU A;  1LXF C;  2KBM A;  3FWB A;  2MRD A;  3SIB A;  3WNX B;  4HRE E;  1ALW A;  4AOM A;  2Q91 A;  4WRI A;  2B1U A;  1B9A A;  1KFU S;  1KWO B;  2PVB A;  3FE6 A;  3I5H C;  2PYQ A;  4DIR A;  3BUW B;  5B8I B;  5DKN A;  2EC6 C;  2KFG A;  1XK4 C;  2MA2 A;  3IQO A;  4I5N B;  2M49 B;  1CFP A;  1QLK A;  2QEH A;  2LE9 B;  2PAS A;  2PMY A;  5FYX A;  4ORB B;  3NSI A;  4YI9 A;  3LK0 A;  2LUC A;  1OQP A;  1PVB A;  2K7C A;  2CCM A;  2ZRS A;  1PAL A;  3CDN A;  1EXR A;  2WC8 A;  2AMI A;  1L7Z A;  2KAX A;  1RWY A;  2O60 A;  3I5G C;  4NDB A;  1JUO A;  2KI6 C;  2GV5 A;  1K93 D;  2BNX A;  1ALV A;  2GGM A;  1NCY A;  2KGR A;  3SG6 A;  4M2P A;  3TUY B;  1RTP 1;  2FCD A;  3D73 A;  1XFW O;  1YUR A;  2HF5 A;  2WCL A;  1J55 A;  2CBL A;  4YI8 A;  2F33 A;  2LMT A;  1B4C A;  3VRQ A;  5PAL A;  2DOQ A;  4MN0 A;  2QDI A;  2BCA A;  1LS8 A;  1S1E A;  3WHT B;  1SKT A;  4YGC B;  3L4L A;  4USL A;  3S0B A;  4M2O A;  1GGZ A;  1JF2 A;  2SAS A;  3S0F A;  4MBE A;  1FPW A;  4A4C A;  1UUR A;  1AJ4 A;  1MXL C;  4CLN A;  4UPG A;  5ER4 X;  2K2F A;  2LM5 A;  2WCM A;  1CTR A;  1TNX A;  2ZFD A;  3A8R A;  1YUU A;  1M46 A;  1DJX A;  1J7Q A;  3LL8 B;  2NCO A;  1DF0 A;  2WCH A;  5CPV A;  1VRK A;  2KSP A;  4PHM A;  3VRN A;  2KGB C;  1CFC A;  1JWD A;  2K7D A;  2F3Y A;  3DY9 A;  4AQI A;  1CMG A;  4JQ0 D;  1OMV A;  1SSE B;  3BUM B;  1BMO A;  2EHB A;  3B6X A;  2ISD A;  1F55 A;  2EGD A;  3PAL A;  3S0E A;  3ZWH A;  1OOH A;  3CTN A;  1S6J A;  2JRF A;  1M45 A;  4YBH B;  1G4Y R;  3WXA A;  1N0Y A;  1OZO A;  1ZOT B;  3CR5 X;  3OGN A;  4BY5 A;  3VGO A;  2WCJ A;  1YTZ C;  5FI2 A;  1CM4 A;  2FJY A;  5KU1 A;  1TIZ A;  2BAP A;  3D76 A;  5D69 A;  1F71 A;  3PM8 A;  4JPZ B;  5HLV A;  1D1O A;  2BBN A;  2BEC A;  5K89 A;  3EVU A;  2KI4 B;  1S6C A;  3BXK A;  1YRU B;  3B86 A;  2OPO A;  3SIA A;  1RRO A;  4FQT A;  2BCB A;  3R1P A;  1B1G A;  3TS5 C;  1K9U A;  4F7F A;  4BY4 A;  1DMO A;  4F0Z B;  4INW A;  2M3W A;  4IJ7 A;  4ORC B;  2M1U A;  3PN7 C;  1BOD A;  2KAV A;  1N65 A;  1F8H A;  2HQW A;  1G33 A;  1KFX L;  2F3Z A;  1XYD A;  4R1E A;  1XFU O;  2KBI A;  1DGV A;  3TS5 B;  1KK7 Z;  1CDM A;  1OW4 A;  2WCF A;  3R1O A;  4PCW A;  5D7F A;  2ZKM X;  3CAB A;  2HET A;  1W7J B;  2QEO A;  3SG3 A;  1DT7 B;  1K9K A;  1L2O C;  2JT0 A;  5I8N A;  3D10 A;  2G9B A;  3C1V A;  1GM0 A;  1SMG A;  1KSM A;  3CGA A;  3OHM B;  4OZD A;  3CR2 A;  1NPQ A;  1F4O A;  3SG2 A;  1V1G A;  2JWW A;  4YGD B;  3EKJ A;  2WCE A;  2LHL A;  1G8I A;  3D0Y B;  1UHN A;  3M0W A;  1RK9 A;  3NGV A;  1KQM B;  3PM2 A;  1MQ1 A;  4HRG A;  2I7A A;  3EK4 A;  5AEQ A;  1C07 A;  2L5X B;  2WCK A;  4GGN A;  3HCM A;  1ZUZ A;  1S5G Z;  3DF0 A;  4OKH A;  1WRK A;  1FF1 A;  2BBM A;  3KO0 A;  2V53 A;  2M29 A;  4ORA B;  1L2O B;  2ZNE A;  1T14 A;  1QIW A;  1U5I A;  2BKI B;  2PQL A;  3DD4 A;  3I5F C;  2JOJ A;  3EKH A;  4GBA A;  4I5L B;  3D77 A;  1TCF A;  2JTZ A;  1X02 A;  3NSL A;  2K0J A;  1QAT A;  1QX5 B;  2GGZ A;  2L4I A;  1QXP A;  5CSN A;  3L47 A;  1TRF A;  2LUX A;  1NX1 A;  1ODB A;  1B7T Y;  3JVT C;  3DF0 B;  1IJ6 A;  3OB2 B;  3ZNI A;  1A29 A;  1DEL A;  2ZN8 A;  1N2D A;  1CLB A;  2OTG B;  5GQQ C;  4QJ5 B;  1A75 B;  4OVN F;  3LLE A;  1YUT A;  2K60 A;  1V1F A;  2JZI A;  2LNK A;  4XJK A;  2GTE A;  3PFV A;  1U5I B;  1M39 A;  5I94 A;  1C3Z A;  1KFU L;  4ZCU A;  1DEK A;  3TUY C;  1CDP A;  3A4U B;  3NSK A;  4HSZ A;  3BOW B;  4P2Y B;  3RZS A;  1W7I B;  4N1G A;  5HKZ A;  1Y0V H;  2JU0 A;  1Z4H A;  3WHU B;  3IF7 A;  2KI6 D;  1YX8 A;  3AAJ A;  1QJT A;  2KFH A;  4E68 A;  4NQG A;  1SNL A;  2Y1M A;  1OZS A;  3JTD B;  1M31 A;  2M8U A;  2K8M B;  3SG5 A;  1TN4 A;  3DXL A;  3OX6 A;  1JF0 A;  2JT8 A;  1Y1A A;  2LVK A;  3FS7 A;  5HLO A;  4QJ4 B;  1AVS A;  2P6B B;  1K95 A;  2I2R E;  1QV0 A;  2F8P A;  1PUL A;  2JUL A;  3SS3 A;  3TDU A;  2TN4 A;  3AKB A;  3B7A A;  2ERB A;  4GFT A;  3S0G A;  1GGW A;  3S0D A;  4C0L A;  1SCM B;  2YGU A;  2BKH B;  2QEV A;  3EVV A;  3N7H A;  3O4X A;  5BPJ A;  5CSF A;  5G08 A;  1J7P A;  1IIO A;  1QAS A;  1QX7 A;  3DVJ A;  2WCB A;  1Y1X A;  4GGF A;  1IG5 A;  5CSJ A;  5JOL A;  1SBJ A;  4I5K A;  1BLQ A;  3QRX A;  2MLF C;  1YX7 A;  2M1K B;  3BUO B;  2E30 A;  3O2P A;  1CNP A;  3D75 A;  4KYN A;  2JPO A;  1CFF A;  1K2H A;  1IJ5 A;  1DJG A;  2M0R A;  3JVT B;  2JNF A;  3SG7 A;  1KSO A;  1WY9 A;  2OTG C;  1DJW A;  1A75 A;  1MF8 B;  1LVC D;  5F6T A;  3IVT A;  1OOF A;  1LIN A;  1K96 A;  1DVI A;  2M7N A;  3TZ1 A;  2LMU A;  2WC5 A;  4PT1 A;  3KEV A;  1CDN A;  2A4J A;  1EG4 A;  1UHJ A;  2Q4U A;  3VRP A;  1SRA A;  2BL0 C;  1XFY O;  4DUQ A;  1TNW A;  5I2L A;  2CXJ A;  3O6B A;  2KQY A;  2Y5I A;  4Q04 A;  2K7B A;  1OSA A;  1EG3 A;  3MSE B;  4INX A;  2MAZ A;  5AXI A;  2QEB A;  3FE9 A;  1QTX A;  1XO5 A;  4FQO A;  1FI5 A;  3IQQ A;  3Q8I A;  4GPL B;  5IBW A;  1DQE A;  3FE8 A;  1WDC C;  2HQ8 A;  3EG5 B;  1YVH A;  5KSZ A;  2LV7 A;  3OX5 A;  1AK8 A;  2LLU A;  4P5O E;  1SL9 A;  1UHH A;  1TNQ A;  1AHR A;  3CR4 X;  3QME A;  3BUX B;  1QX2 A;  2WOS A;  4WQ2 A;  4OR9 B;  3I5I B;  5HKW A;  5AER A;  2L50 A;  2O5G A;  4GGF C;  4MZL A;  1TCO B;  3S0A A;  1K94 A;  4PE0 A;  1TUZ A;  1KFX S;  3K1E A;  1BR4 B;  1IQ5 A;  2JC2 A;  2KAY A;  3GOF A;  1DJY A;  1PRW A;  2M7L A;  1QS7 A;  4U8D A;  1SCV A;  3PLF B;  2LVI A;  1ZAC A;  1NP8 A;  1IWQ A;  3RLZ A;  4CID A;  3I5F B;  5FI6 A;  4OV2 A;  1IKU A;  1QVI Y;  1SL7 A;  2I94 A;  2PAL A;  4ICB A;  2KDH A;  3CZ2 A;  4PE4 A;  2KLE A;  2ZND A;  2JXL A;  2KLD A;  3CZ0 A;  1K9P A;  1NUB A;  3PN7 B;  5TNC A;  4TNC A;  3SS4 A;  3F45 A;  1DF0 B;  1XA5 A;  1Q80 A;  2VRG A;  3VRO A;  1F70 A;  1WRL A;  2NCP A;  3EK7 A;  3CS1 A;  1DJI A;  4DCK A;  4CPV A;  3VB1 A;  1ZFS A;  1XFR A;  3FIA A;  1K90 D;  1A2X A;  1KK7 Y;  1KWO C;  3I5H B;  3OB1 B;  4OCI A;  2M9G A;  4WQ3 A;  3KHE A;  3NHI A;  1FBV A;  2EC6 B;  4YRU A;  2G2B A;  1MWN A;  1QIV A;  1WLZ A;  2KOT A;  1MXE A;  5HYD A;  5JJG A;  1F54 A;  3BFH A;  1WLM A;  2KYF A;  1R6P A;  2Y1N A;  3I5I C;  3BQ3 A;  3D74 A;  3PAT A;  3UNW A;  1SK6 D;  1TUJ A;  1WRZ A;  1FI6 A;  1J7R A;  1WDC B;  2KFF A;  1OOJ A;  2MHH A;  1E8A A;  3NSO A;  2OS8 B;  3NHT A;  4FTG A;  4C0K A;  3PJI A;  1R2U A;  1TOP A;  4L9M A;  2CT9 A;  5HL1 A;  1S36 A;  2WC6 A;  3V2L A;  1XFV O;  2L51 A;  1SR6 B;  2JQ6 A;  3L4A A;  4N1F A;  2I18 A;  1MHO A;  3DYE A;  4AQJ A;  1PSB A;  1B47 A;  3GK4 X;  4I5J A;  2PSR A;  1PSR A;  1LA0 A;  2CTN A;  4XJK B;  1XVJ A;  3BOW A;  3AKA A;  1CMF A;  5J3X A;  2BE6 A;  3DVM A;  4NDD A;  3BJH A;  4PE7 A;  2LVJ A;  1BJF A;  2MJW B;  4CFR A;  1NX0 A;  2LVV A;  4PE1 A;  3D78 A;  3EVR A;  1IRJ A;  1LKJ A;  3D0Y A;  3O78 A;  1AP4 A;  1BR1 B;  2LMV A;  2HPS A;  1PVA A;  2P71 A;  4NDC A;  2F2O A;  5I2Q A;  2QAC A;  1OOI X;  5DKQ A;  5FI7 A;  1BF5 A;  1H8B A;  3CZT X;  1MUX A;  2LP2 A;  1NYA A;  2NZ0 A;  2L98 A;  4DS7 A;  4GUK A;  1JSA A;  2CNP A;  3VRR A;  1S5G Y;  2LAP A;  1Z2C B;  1P28 A;  1S3P A;  2L0P A;  2OS8 C;  2ZRT A;  3B87 A;  3DVE A;  4MRY A;  3GK1 A;  2WOR A;  1KK8 C;  4YGB B;  1KQM C;  1JFK A;  4C0J A;  2D8N A;  4DRW A;  2H8V A;  1GJY A;  2KHN A;  4MLW A;  1CB1 A;  2K7O A;  1Y1U A;  1CLM A;  2MBX A;  3H4S E;  1YRT B;  3NXA A;  3BFA A;  2M97 A;  1XFX O;  4JD9 A;  1GQM A;  2WND A;  4PHJ A;  1BG1 A;  3B88 A;  4M2Q A;  1NSH A;  2MLE C;  1KQV A; 
#chains in the Genus database with same CATH homology
 5ER5 A;  1UUS A;  3JTD C;  2JNX A;  5DKR A;  1NCX A;  2BCX A;  2KYC A;  1UHI A;  1NCZ A;  1BT6 A;  1A4P A;  1SY9 A;  1B8L A;  3K21 A;  4PHN A;  1BU3 A;  3GK2 A;  2COL B;  1DJH A;  1IGV A;  1NIW A;  3O4Y A;  1OMR A;  2BE4 A;  4N5X A;  2NXQ A;  1UWO A;  1IH0 A;  1KK8 B;  1DJZ A;  2ZN9 A;  2QPT A;  3HX4 A;  1SPY A;  1SYM A;  1FW4 A;  2SCP A;  5HKY A;  4IL1 A;  2K61 A;  1KCY A;  2JT3 A;  2AUC A;  4PHK A;  1Y6W A;  3PSR A;  1OMD A;  1NX2 A;  2KQ6 A;  3BYA A;  5KTY A;  3KF9 A;  1CLL A;  1RFJ A;  2KI4 C;  1B8R A;  2LCP A;  1YR5 A;  1AJ5 A;  1PK0 D;  1EL4 A;  3E3R A;  2L4H A;  1TNP A;  3SG4 A;  1F4Q A;  1J1E A;  1LA3 A;  3OP0 A;  1IQ3 A;  4ZCV A;  1S26 D;  1YVL A;  4QJ3 B;  4ETO A;  1RJV A;  1QVI Z;  1UP5 A;  4XYN A;  1C7V A;  1B8C A;  2JTT A;  2JPT A;  1BOC A;  4GNK B;  1EJ3 A;  5AFP A;  1K8U A;  4MVF A;  5CSI A;  1CM1 A;  1CDL A;  2FCE A;  1HQV A;  1J7O A;  3CLN A;  4D1E A;  3RM1 A;  1J1D A;  2LLS A;  5AAN A;  1CFD A;  3FWC A;  3DVK A;  2LC5 A;  2IS9 A;  4PDZ A;  2LHI A;  1TTX A;  2FOT A;  2R2I A;  1SL8 A;  3SJS A;  1XK4 A;  3CWG A;  1REC A;  4CFQ A;  2RGI A;  3ICB A;  1AUI B;  3BUN B;  1DGU A;  1JC2 A;  4MZK A;  1JBA A;  1XFZ O;  1JFJ A;  2K2A A;  1SW8 A;  3EK8 A;  4JWQ A;  1M63 B;  1YUS A;  4MZJ A;  3TDI A;  2E6W A;  1ZMZ A;  1A03 A;  4MRX A;  3KPX A;  1H4B A;  4MSP A;  1NWD A;  1B7T Z;  1UHK A;  2Y4Q A;  4HRH A;  2BL0 B;  2NLN A;  1OE9 B;  1C7W A;  2JXC A;  3LK1 A;  1QLS A;  2AAO A;  2LAN A;  3TDZ A;  2LP3 A;  1NX3 A;  2H61 C;  4YGA A;  1SR6 C;  4MEW A;  3LCP C;  5I2O A;  1EH2 A;  1HT9 A;  1S6I A;  2F2P A;  4GAO A;  2FJU B;  2KNE A;  2L2E A;  2H2K A;  1QV1 A;  3I5G B;  4YGE B;  1DTL A;  1SCM C;  4PAL A;  1CKK A;  1MR8 A;  2H61 A;  2LLT A;  3AAK A;  2PRU A;  1LXF C;  2KBM A;  3FWB A;  2MRD A;  3SIB A;  3WNX B;  4HRE E;  1ALW A;  4AOM A;  2Q91 A;  4WRI A;  2B1U A;  1B9A A;  1KFU S;  1KWO B;  2PVB A;  3I5H C;  4DIR A;  3BUW B;  5B8I B;  5DKN A;  2EC6 C;  2KFG A;  1XK4 C;  2MA2 A;  3IQO A;  4I5N B;  2M49 B;  1CFP A;  1QLK A;  2LE9 B;  2PAS A;  2PMY A;  5FYX A;  4ORB B;  3NSI A;  4YI9 A;  3LK0 A;  2LUC A;  1OQP A;  1PVB A;  2K7C A;  2CCM A;  2ZRS A;  1PAL A;  1EXR A;  2WC8 A;  2AMI A;  1L7Z A;  2KAX A;  1RWY A;  2O60 A;  3I5G C;  4NDB A;  1JUO A;  2KI6 C;  2GV5 A;  1K93 D;  1ALV A;  2GGM A;  1NCY A;  2KGR A;  3SG6 A;  4M2P A;  3TUY B;  1RTP 1;  2FCD A;  1XFW O;  1YUR A;  2HF5 A;  4YI8 A;  1J55 A;  2CBL A;  2F33 A;  2LMT A;  1B4C A;  3VRQ A;  5PAL A;  2DOQ A;  4MN0 A;  2BCA A;  1S1E A;  3WHT B;  1SKT A;  4YGC B;  4USL A;  4M2O A;  1GGZ A;  1JF2 A;  2SAS A;  4MBE A;  1FPW A;  4A4C A;  1UUR A;  1AJ4 A;  1MXL C;  4CLN A;  4UPG A;  5ER4 X;  2K2F A;  2LM5 A;  1CTR A;  1TNX A;  2ZFD A;  3A8R A;  1YUU A;  1M46 A;  1DJX A;  1J7Q A;  3LL8 B;  2NCO A;  1DF0 A;  5CPV A;  1VRK A;  2KSP A;  4PHM A;  3VRN A;  2KGB C;  1CFC A;  1JWD A;  2K7D A;  2F3Y A;  4AQI A;  1CMG A;  4JQ0 D;  1OMV A;  3BUM B;  1BMO A;  2EHB A;  2ISD A;  1F55 A;  2EGD A;  3PAL A;  3ZWH A;  3CTN A;  1S6J A;  2JRF A;  1M45 A;  4YBH B;  1G4Y R;  3WXA A;  1N0Y A;  1OZO A;  1ZOT B;  3CR5 X;  4BY5 A;  3VGO A;  1YTZ C;  1CM4 A;  5KU1 A;  1TIZ A;  1F71 A;  5D69 A;  3PM8 A;  4JPZ B;  5HLV A;  1D1O A;  2BBN A;  2BEC A;  5K89 A;  3EVU A;  2KI4 B;  1S6C A;  3BXK A;  1YRU B;  3SIA A;  2OPO A;  1RRO A;  2BCB A;  1B1G A;  3TS5 C;  1K9U A;  4BY4 A;  1DMO A;  4F0Z B;  2M3W A;  4ORC B;  2M1U A;  3PN7 C;  1BOD A;  2KAV A;  1N65 A;  1F8H A;  2HQW A;  1G33 A;  1KFX L;  2F3Z A;  1XYD A;  4R1E A;  1XFU O;  2KBI A;  1DGV A;  3TS5 B;  1KK7 Z;  1CDM A;  2WCF A;  4PCW A;  5D7F A;  2ZKM X;  2HET A;  1W7J B;  3SG3 A;  1DT7 B;  1K9K A;  1L2O C;  2JT0 A;  5I8N A;  3D10 A;  2G9B A;  3C1V A;  1SMG A;  1KSM A;  3CGA A;  3OHM B;  3CR2 A;  1NPQ A;  1F4O A;  3SG2 A;  1V1G A;  2JWW A;  4YGD B;  3EKJ A;  2WCE A;  2LHL A;  1G8I A;  3D0Y B;  1UHN A;  3M0W A;  1RK9 A;  1KQM B;  1MQ1 A;  4HRG A;  2I7A A;  3EK4 A;  5AEQ A;  1C07 A;  2L5X B;  4GGN A;  3HCM A;  1S5G Z;  1ZUZ A;  3DF0 A;  4OKH A;  1WRK A;  1FF1 A;  2BBM A;  3KO0 A;  2V53 A;  2M29 A;  4ORA B;  1L2O B;  2ZNE A;  1U5I A;  1QIW A;  2BKI B;  3DD4 A;  3I5F C;  2JOJ A;  3EKH A;  4GBA A;  4I5L B;  1TCF A;  2JTZ A;  1X02 A;  3NSL A;  2K0J A;  1QAT A;  1QX5 B;  2GGZ A;  2L4I A;  1QXP A;  5CSN A;  1TRF A;  2LUX A;  1NX1 A;  1ODB A;  1B7T Y;  3JVT C;  3DF0 B;  1IJ6 A;  3OB2 B;  3ZNI A;  1A29 A;  2ZN8 A;  4A4B A;  1N2D A;  1CLB A;  2OTG B;  5GQQ C;  4QJ5 B;  1A75 B;  4OVN F;  3LLE A;  1YUT A;  1V1F A;  2JZI A;  2LNK A;  4XJK A;  3PFV A;  1U5I B;  1M39 A;  4ZCU A;  1KFU L;  3TUY C;  1CDP A;  3A4U B;  3NSK A;  4HSZ A;  3BOW B;  4P2Y B;  1W7I B;  4N1G A;  5HKZ A;  1Y0V H;  2JU0 A;  3WHU B;  3IF7 A;  2KI6 D;  1YX8 A;  3AAJ A;  1QJT A;  2KFH A;  4E68 A;  4NQG A;  1SNL A;  2Y1M A;  1OZS A;  3JTD B;  1M31 A;  2M8U A;  2K8M B;  3SG5 A;  1TN4 A;  3OX6 A;  1JF0 A;  2JT8 A;  1Y1A A;  2LVK A;  3FS7 A;  5HLO A;  4QJ4 B;  1AVS A;  2P6B B;  1K95 A;  2I2R E;  1QV0 A;  2F8P A;  1PUL A;  2JUL A;  3TDU A;  2TN4 A;  3AKB A;  4GFT A;  1GGW A;  4C0L A;  1SCM B;  2BKH B;  3EVV A;  5BPJ A;  5CSF A;  5G08 A;  1J7P A;  1QAS A;  1QX7 A;  3DVJ A;  2WCB A;  1Y1X A;  4GGF A;  1IG5 A;  5CSJ A;  5JOL A;  1SBJ A;  4I5K A;  1BLQ A;  3QRX A;  2MLF C;  1YX7 A;  2M1K B;  3BUO B;  2E30 A;  3O2P A;  1CNP A;  1CFF A;  1K2H A;  1IJ5 A;  1DJG A;  2M0R A;  3JVT B;  2JNF A;  3SG7 A;  1KSO A;  1WY9 A;  2OTG C;  1DJW A;  1A75 A;  1MF8 B;  1LVC D;  5F6T A;  1LIN A;  1K96 A;  1DVI A;  2M7N A;  3TZ1 A;  2LMU A;  3KEV A;  1CDN A;  2A4J A;  1EG4 A;  1UHJ A;  2Q4U A;  3VRP A;  1SRA A;  2BL0 C;  1XFY O;  4DUQ A;  1TNW A;  5I2L A;  2CXJ A;  3O6B A;  2KQY A;  2Y5I A;  4Q04 A;  2K7B A;  1OSA A;  1EG3 A;  3MSE B;  2MAZ A;  5AXI A;  1QTX A;  1XO5 A;  4FQO A;  1FI5 A;  3IQQ A;  4GPL B;  5IBW A;  1WDC C;  2HQ8 A;  1YVH A;  5KSZ A;  2LV7 A;  3OX5 A;  1AK8 A;  2LLU A;  4P5O E;  1SL9 A;  1UHH A;  1TNQ A;  1AHR A;  3CR4 X;  3BUX B;  1QX2 A;  2WOS A;  4WQ2 A;  4OR9 B;  3I5I B;  5HKW A;  5AER A;  2L50 A;  2O5G A;  4GGF C;  4MZL A;  1TCO B;  1K94 A;  4PE0 A;  1KFX S;  1BR4 B;  1IQ5 A;  2JC2 A;  2KAY A;  3GOF A;  1DJY A;  1PRW A;  2M7L A;  1QS7 A;  4U8D A;  1SCV A;  3PLF B;  2LVI A;  1ZAC A;  1NP8 A;  1IWQ A;  3RLZ A;  4CID A;  3I5F B;  4OV2 A;  1IKU A;  1QVI Y;  1SL7 A;  2I94 A;  2PAL A;  4ICB A;  2KDH A;  4PE4 A;  2ZND A;  2JXL A;  1K9P A;  1NUB A;  3PN7 B;  5TNC A;  4TNC A;  3F45 A;  1DF0 B;  1XA5 A;  1Q80 A;  2VRG A;  3VRO A;  1F70 A;  1WRL A;  2NCP A;  3EK7 A;  3CS1 A;  1DJI A;  4DCK A;  4CPV A;  1ZFS A;  3FIA A;  1K90 D;  1A2X A;  1KK7 Y;  1KWO C;  3I5H B;  3OB1 B;  4OCI A;  2M9G A;  4WQ3 A;  3KHE A;  1FBV A;  2EC6 B;  4YRU A;  2G2B A;  1MWN A;  1QIV A;  1WLZ A;  2KOT A;  1MXE A;  5HYD A;  5JJG A;  1F54 A;  3I5I C;  1WLM A;  2KYF A;  1R6P A;  2Y1N A;  3BQ3 A;  3PAT A;  1SK6 D;  1WRZ A;  1FI6 A;  1J7R A;  1WDC B;  2KFF A;  1OOJ A;  2MHH A;  1E8A A;  3NSO A;  2OS8 B;  4FTG A;  4C0K A;  1R2U A;  1TOP A;  4L9M A;  2CT9 A;  1S36 A;  1XFV O;  2L51 A;  1SR6 B;  2JQ6 A;  4AQJ A;  4N1F A;  2I18 A;  1MHO A;  1PSB A;  1B47 A;  3GK4 X;  4I5J A;  2PSR A;  1PSR A;  1LA0 A;  2CTN A;  4XJK B;  1XVJ A;  3BOW A;  3AKA A;  1CMF A;  5J3X A;  2BE6 A;  3DVM A;  4NDD A;  4PE7 A;  2LVJ A;  1BJF A;  2MJW B;  4CFR A;  1NX0 A;  2LVV A;  4PE1 A;  3EVR A;  1IRJ A;  1LKJ A;  3D0Y A;  3O78 A;  1AP4 A;  1BR1 B;  2LMV A;  2HPS A;  1PVA A;  4NDC A;  2F2O A;  5I2Q A;  2QAC A;  5DKQ A;  1BF5 A;  1H8B A;  3CZT X;  1MUX A;  2LP2 A;  1NYA A;  2NZ0 A;  2L98 A;  4DS7 A;  4GUK A;  1JSA A;  2CNP A;  3VRR A;  1S5G Y;  2LAP A;  1S3P A;  2L0P A;  2OS8 C;  2ZRT A;  4MRY A;  3DVE A;  3GK1 A;  2WOR A;  1KK8 C;  4YGB B;  1KQM C;  1JFK A;  4C0J A;  2D8N A;  4DRW A;  2KHN A;  1GJY A;  1CB1 A;  4MLW A;  2K7O A;  1Y1U A;  1CLM A;  2MBX A;  3H4S E;  1YRT B;  3NXA A;  2M97 A;  1XFX O;  1GQM A;  2WND A;  4PHJ A;  1BG1 A;  4M2Q A;  1NSH A;  2MLE C;  1KQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...