2KDHA

The solution structure of human cardiac troponin c in complex with the green tea polyphenol; (-)-epigallocatechin-3-gallate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Solution structure of human cardiac troponin C in complex with the green tea polyphenol, (-)-epigallocatechin 3-gallate
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kdhA00
5GQQC 4GPLB 1KK7Z 1ODBA 1NCYA 1K2HA 1PK0D 4F0ZB 5BPJA 1CLBA 2LM5A 5G08A 1M31A 1XO5A 1B9AA 4WRIA 1DJZA 1SRAA 1SNLA 3FWBA 5KSZA 1SCMB 3DF0A 3PLFB 5CPVA 3O2PA 4N5XA 2P6BB 5DKRA 3CGAA 2L98A 1YX7A 2BKIB 1LKJA 1JWDA 2NXQA 2CXJA 3GK1A 2RGIA 3BUXB 3O6BA 1L2OC 3PN7C 4YI8A 2Y1NA 1NP8A 1NWDA 3I5HC 2KGRA 1TRFA 2Q91A 4MBEA 2CT9A 3F45A 1J7QA 2LVVA 2L51A 2JRFA 1IJ6A 1XFWO 1KCYA 5HKYA 2OS8C 1EJ3A 1TN4A 2I2RE 2WCEA 4XJKB 5HYDA 3WNXB 4ZCVA 3SIBA 1CDNA 1CMGA 1UHKA 5CSIA 3H4SE 4M2QA 1FI5A 1RROA 2KI6D 1SR6C 1BT6A 1A75B 2HQWA 4C0KA 2PVBA 2ZRSA 1SBJA 1B7TY 1HT9A 3MSEB 3ICBA 1HQVA 1KFUS 3CR5X 4A4CA 2LVIA 2O5GA 5KTYA 1IJ5A 1A03A 2JTTA 5D7FA 1FF1A 2JXCA 3BUWB 1QVIY 2JWWA 1V1GA 2LLTA 3KHEA 1E8AA 3CWGA 1CFPA 1UUSA 2KAVA 1CKKA 3SIAA 5HLVA 1DF0B 4ICBA 3SG5A 2GGZA 4YGEB 1ALVA 1KWOB 1YVHA 4YGDB 4ORBB 3LCPC 1U5IA 2CCMA 3TDUA 1K96A 1K9UA 3EVUA 4YGAA 3DVEA 3GOFA 4OVNF 1CDMA 1AJ5A 2FCDA 1AK8A 2LMVA 4FQOA 2H61A 3D10A 2KFHA 1JC2A 2KFFA 4YI9A 1KQMC 2KI4B 2NCOA 1TCFA 2JU0A 1J1DA 1CFCA 1XK4C 1SY9A 2EHBA 1QS7A 2OTGC 1YUUA 2H2KA 2F8PA 1SK6D 2M49B 1SL8A 3LK1A 1KK8C 1QIVA 1TNPA 3C1VA 1QV0A 2MJWB 3LLEA 4PDZA 2R2IA 3NXAA 1B8RA 2WC8A 1SPYA 2BE4A 2L0PA 4MN0A 2IS9A 2L5XB 2LUCA 2LMTA 3BOWB 4N1GA 1DMOA 3RM1A 3OB1B 2KAYA 1EG3A 3DVMA 1L2OB 4P5OE 1XFXO 4M2OA 3PN7B 1QLKA 2LV7A 1G8IA 3AKBA 4YGBB 5I2QA 1Y1AA 2KQ6A 2QACA 1DJIA 3VRNA 3A4UB 2PASA 2MRDA 2ISDA 1B4CA 1JF2A 3NSIA 2KQYA 1OSAA 4HRHA 1MHOA 1C7VA 4YRUA 3SG6A 1BMOA 1K93D 2JC2A 2Q4UA 1QV1A 2JT8A 1EG4A 1SR6B 4MZKA 4XJKA 3JTDB 3NSLA 1NCZA 3NSKA 2ZN8A 2E30A 2ZNEA 3FS7A 1CMFA 1W7JB 1NX1A 1MQ1A 3EK8A 1SL9A 2I94A 1XVJA 4I5LB 1A75A 2KI6C 2SASA 5D69A 1XYDA 1TCOB 2MLFC 3EKJA 1BODA 5F6TA 3VRQA 4YBHB 2LHLA 2LLUA 2MBXA 3O78A 2BECA 2TN4A 1V1FA 1IQ3A 1PSRA 2CTNA 1C7WA 4PE7A 1AVSA 3GK2A 4CLNA 4GGFA 4HSZA 1WDCC 3EK4A 2WCBA 4NQGA 1PULA 1CDLA 1S6IA 1JSAA 2WCFA 2LANA 1DF0A 1TTXA 1G33A 3WXAA 1LA3A 2BKHB 4CPVA 3PM8A 1QASA 5HKZA 1SKTA 1K95A 1K8UA 1PRWA 2HF5A 1J7OA 2JQ6A 1KQMB 2KSPA 1H8BA 1DVIA 2AAOA 3I5FC 4JWQA 1A4PA 1NIWA 2OTGB 1DJYA 4NDCA 4MSPA 1ZOTB 1K94A 1B47A 1CLLA 1CM4A 2LP2A 1BU3A 5IBWA 2GGMA 1BOCA 4P2YB 2NZ0A 4I5KA 1OMRA 2B1UA 1KFXL 3CR4X 1WY9A 3NSOA 2L4HA 3WHUB 2JT0A 4MRXA 1QXPA 2F2OA 1F54A 1QLSA 1KQVA 1CB1A 1M46A 5CSFA 5CSNA 3BOWA 2G9BA 1PALA 3CTNA 1UHNA 1YX8A 2M29A 1CFDA 2FCEA 4UPGA 1CFFA 2PALA 1JUOA 2KYCA 4IL1A 3TS5C 5JJGA 4PALA 1XFUO 1SCVA 3D0YB 3JVTB 1BF5A 3E3RA 1MR8A 2K8MB 1CNPA 3CZTX 1A2XA 1KSMA 3OX6A 1WLZA 2JOJA 1EL4A 2M97A 3EVVA 1RFJA 1B1GA 4GFTA 1IG5A 1OMVA 2K7BA 1XFZO 5AANA 1GGZA 2H61C 1S1EA 1OOJA 3SG3A 1UURA 2WNDA 4AOMA 1XFYO 4U8DA 2MA2A 2LLSA 1WLMA 1KK7Y 1K9PA 2COLB 2BL0C 1N2DA 1FI6A 2MAZA 1QX7A 1GQMA 1S6JA 2LNKA 4PHMA 3CS1A 3BXKA 1MUXA 4L9MA 1OZOA 1ZMZA 4M2PA 4WQ2A 2Y4QA 3OX5A 2Y5IA 3M0WA 4Q04A 1ZUZA 1F4OA 1F4QA 1QIWA 1ZACA 3DD4A 4TNCA 2M9GA 3PALA 1Q80A 2O60A 1LINA 3WHTB 1JF0A 2PSRA 1L7ZA 5DKNA 4C0JA 3I5FB 4PCWA 2K61A 1C07A 1YUTA 1QTXA 4E68A 1EXRA 2ZNDA 4OCIA 2FOTA 4C0LA 1UHJA 3FIAA 3I5HB 3TDZA 1LA0A 4DRWA 2OS8B 1BR4B 5B8IB 3I5GC 4PE1A 3I5IC 5PALA 1QX5B 1RWYA 4BY4A 1JFKA 1WRZA 2AUCA 1BLQA 4AQIA 1YTZC 1TOPA 1NUBA 4DIRA 1DJHA 5AFPA 1G4YR 5J3XA 3HX4A 1F70A 1NSHA 2M8UA 3TDIA 3EKHA 5FYXA 5KU1A 1UHHA 1FPWA 1Y0VH 2ZN9A 3ZWHA 3TS5B 1W7IB 4GBAA 2MLEC 1UWOA 2KBIA 4DCKA 1YURA 2L50A 2PRUA 4YGCB 1DJWA 2HQ8A 1KFXS 2K2FA 1S6CA 2ZFDA 2V53A 2HPSA 1BG1A 4MZJA 3D0YA 1N65A 3BUNB 1UP5A 1S36A 2EC6C 2F3YA 4PE4A 5K89A 1NCXA 1NX0A 2VRGA 2A4JA 1H4BA 2BL0B 1F71A 2K7OA 1XFVO 2KBMA 3SG2A 1PVBA 3LK0A 4MVFA 5DKQA 3IF7A 1FBVA 1PSBA 1S5GZ 2EGDA 3CLNA 3LL8B 4ORCB 2JULA 1KK8B 4PE0A 1IWQA 3IQQA 4PHNA 4QJ4B 3HCMA 3DVKA 1IKUA 1DGUA 3KEVA 1SYMA 2NLNA 1AUIB 1BJFA 4HREE 2NCPA 1WRKA 1D1OA 1OZSA 1WRLA 1CM1A 1QJTA 4I5JA 1J7PA 2F2PA 1S26D 2I18A 2KYFA 2SCPA 1J55A 3OB2B 5AXIA 4AQJA 3KF9A 1AP4A 2L2EA 2KFGA 2BCBA 3AKAA 4GGNA 4BY5A 4QJ3B 1FW4A 4CIDA 1DJXA 1Y1XA 4CFQA 4MLWA 2F33A 4MEWA 2BBMA 2LP3A 4CFRA 4ETOA 1SMGA 1OMDA 2BE6A 2M7LA 1F55A 5HLOA 2ZKMX 2KNEA 2LVJA 2LC5A 5JOLA 1OE9B 1XA5A 3I5GB 5I2LA 2G2BA 3OHMB 3I5IB 2AMIA 4OKHA 2KDHA 4DS7A 1IH0A 2M3WA 1F8HA 4USLA 2F3ZA 2DOQA 3ZNIA 5ER5A 1B8LA 1SL7A 2PMYA 1R6PA 4MRYA 2KHNA 1IRJA 3JTDC 1MXEA 3TUYC 3SG4A 1Y1UA 2CBLA 5CSJA 3EVRA 1X02A 1R2UA 2BCAA 1QATA 3A8RA 2OPOA 1IQ5A 3QRXA 1KSOA 1TNXA 5TNCA 3BUOB 4PHJA 1J7RA 3CR2A 2LMUA 2BCXA 4FTGA 1YRUB 1CDPA 2M1UA 1DT7B 1J1EA 3RLZA 2JNXA 4GNKB 1WDCB 1ZFSA 2BBNA 2JTZA 3DF0B 4GAOA 3GK4X 2LHIA 4PHKA 2K2AA 1M39A 3AAJA 1B8CA 1N0YA 1VRKA 1M63B 3SJSA 1CLMA 1SCMC 4A4BA 3VRRA 1K9KA 4D1EA 2EC6B 1MF8B 1GJYA 4JPZB 2WOSA 1YVLA 1S5GY 3OP0A 4XYNA 2LVKA 1KFUL 1AHRA 3K21A 1AJ4A 1RECA 2JZIA 2LUXA 3KO0A 2KAXA 4N1FA 1YUSA 2LCPA 4R1EA 1XK4A 2Y1MA 4MZLA 4NDBA 2K0JA 2LE9B 2K7DA 1DTLA 2JNFA 2QPTA 3FWCA 3VRPA 3KPXA 3AAKA 3BUMB 1TIZA 4QJ5B 1TNQA 1DGVA 2K7CA 1JFJA 1NX2A 1OQPA 1TNWA 4WQ3A 1BR1B 1NPQA 3O4YA 1QX2A 1SW8A 4OV2A 4DUQA 4JQ0D 2M7NA 3EK7A 4GUKA 1LXFC 1GGWA 1NX3A 1NYAA 1Y6WA 1EH2A 1DJGA 5I8NA 2JPTA 1YRTB 2M1KB 5AERA 1B7TZ 3VGOA 3VROA 5ER4X 1RTP1 3BQ3A 3TZ1A 1RJVA 1UHIA 1A29A 2HETA 3BYAA 5HKWA 4GGFC 1CTRA 4NDDA 1M45A 3DVJA 2WORA 1ALWA 1QVIZ 1U5IB 3SG7A 3JVTC 5I2OA 2FJUB 1MWNA 1IGVA 1MXLC 3TUYB 2L4IA 2MHHA 2GV5A 1KWOC 2CNPA 2ZRTA 2KOTA 1RK9A 1YR5A 1PVAA 3PSRA 4ZCUA 1JBAA 5AEQA 1S3PA 2KGBC 2M0RA 3PFVA 1K90D 2D8NA 3IQOA 4HRGA 2JXLA 4I5NB 4ORAB 2I7AA 1LVCD 2LAPA 2JT3A 2E6WA 4OR9B 3PATA 2KI4C
chains in the Genus database with same CATH superfamily
3DY9A 5GQQC 4GPLB 3CYZA 1KK7Z 1ODBA 1NCYA 1K2HA 1PK0D 4F0ZB 5BPJA 1CLBA 2LM5A 1ORGA 5G08A 1M31A 1XO5A 1B9AA 4WRIA 1DJZA 1SRAA 1SNLA 3FWBA 3O4XA 1SCMB 5KSZA 3DF0A 3PLFB 5CPVA 3O2PA 4N5XA 2P6BB 5DKRA 3CGAA 3R1PA 2L98A 3BFBA 1YX7A 2BKIB 1LKJA 1JWDA 2NXQA 2CXJA 3GK1A 2RGIA 3BUXB 3O6BA 1DC1A 1L2OC 3OBVA 3PN7C 4YI8A 2Y1NA 1Z4HA 3SS3A 1NP8A 1NWDA 3PJIA 3I5HC 2KGRA 1TRFA 2Q91A 4MBEA 2CT9A 3F45A 1J7QA 1C3ZA 2L51A 2JRFA 2LVVA 1IJ6A 1XFWO 1KCYA 5HKYA 2OS8C 1EJ3A 1TN4A 2I2RE 2WCEA 4XJKB 5HYDA 3WNXB 4ZCVA 3SIBA 1CDNA 1CMGA 1UHKA 5CSIA 3H4SE 4M2QA 1FI5A 1RROA 2KI6D 1SR6C 1BT6A 1A75B 2HQWA 4C0KA 2PVBA 2ZRSA 1SBJA 3B7AA 3K1EA 1B7TY 1HT9A 3MSEB 3ICBA 1HQVA 1KFUS 3CR5X 4A4CA 2LVIA 2O5GA 5KTYA 1IJ5A 1A03A 2JTTA 3IVTA 5D7FA 1FF1A 2JXCA 3BUWB 1QVIY 2JWWA 1V1GA 2LLTA 3KHEA 1E8AA 3CWGA 1CFPA 1UUSA 2KAVA 4AOMA 1CKKA 4JD9A 3SIAA 5HLVA 1DF0B 4ICBA 3SG5A 2GGZA 4YGEB 1ALVA 3SS4A 1KWOB 1YVHA 4YGDB 4ORBB 3LCPC 1U5IA 2CCMA 3TDUA 1K96A 1K9UA 3EVUA 4YGAA 3DVEA 3NHTA 1OOIX 3GOFA 4OVNF 1CDMA 1AJ5A 2FCDA 1AK8A 5EL2A 2LMVA 3B87A 4FQOA 2H61A 2GTEA 3D10A 2KFHA 3DZTA 3UO9A 2KFFA 4YI9A 1KQMC 2KI4B 2NCOA 1TCFA 2JU0A 1J1DA 1JC2A 1CFCA 1XK4C 1SY9A 2EHBA 1QS7A 2OTGC 1YUUA 2H2KA 2F8PA 2WCMA 1SK6D 2WCKA 2M49B 1SL8A 3LK1A 1KK8C 1QIVA 2BNXA 1TNPA 4INXA 3C1VA 3RZSA 1QV0A 2MJWB 3LLEA 4PDZA 2R2IA 3NXAA 1B8RA 2WC8A 1SPYA 2BE4A 3CDNA 2L0PA 4MN0A 2IS9A 2L5XB 2LUCA 2LMTA 3BOWB 4N1GA 1DMOA 3RM1A 1TWOA 2K60A 3OB1B 2KAYA 1EG3A 3DVMA 1L2OB 4P5OE 1XFXO 4M2OA 3PN7B 1QLKA 2LV7A 1G8IA 3AKBA 4YGBB 4F7FA 5I2QA 1Y1AA 3B88A 2KQ6A 2QACA 1DJIA 2BAPA 3A4UB 3VRNA 2PASA 2MRDA 2ISDA 1B4CA 3R72A 1JF2A 3NSIA 2KQYA 2KLEA 1OSAA 3R1OA 4HRHA 1MHOA 1OOGA 1C7VA 4YRUA 3SG6A 1BMOA 1K93D 2JC2A 2Q4UA 2PYQA 1QV1A 3DXLA 2JT8A 1EG4A 1SR6B 4MZKA 4XJKA 3JTDB 3NSLA 1NCZA 3NSKA 2ZN8A 2E30A 2ZNEA 3FS7A 1CMFA 1W7JB 1NX1A 1MQ1A 3EK8A 1SL9A 2I94A 1DQEA 1XVJA 4I5LB 1A75A 2P70A 2KI6C 2SASA 5D69A 1XYDA 1TCOB 2MLFC 3D74A 3EKJA 5F6TA 1BODA 3VRQA 4YBHB 2LHLA 2LLUA 2MBXA 3CZ1A 3O78A 2BECA 2TN4A 3L4AA 1V1FA 1IQ3A 3BJHA 1PSRA 2CTNA 1C7WA 4PE7A 1AVSA 3GK2A 4CLNA 4GGFA 4HSZA 1WDCC 3EK4A 2WCBA 4NQGA 1PULA 1CDLA 1S6IA 5FI7A 1JSAA 2WCFA 2LANA 1DF0A 1TTXA 1G33A 3D76A 3SS5A 1LA3A 3WXAA 2BKHB 4CPVA 3PM8A 1QASA 5HKZA 1SKTA 1K95A 1K8UA 1PRWA 2HF5A 1J7OA 2JQ6A 1KQMB 2KSPA 1H8BA 1DVIA 1H4BA 2AAOA 3I5FC 4JWQA 1A4PA 1NIWA 2OTGB 1DJYA 3OGNA 3UNWA 4NDCA 4MSPA 1ZOTB 1K94A 1B47A 1CLLA 3L47A 1CM4A 2LP2A 4PT1A 1BU3A 5IBWA 2GGMA 1BOCA 3FE9A 4P2YB 2NZ0A 3EG5B 1OMRA 2B1UA 2WC6A 4I5KA 1KFXL 3CR4X 1WY9A 3NSOA 2L4HA 3WHUB 2JT0A 4MRXA 1QXPA 2F2OA 2PQLA 2KPHA 1IIOA 1OW4A 1F54A 1QLSA 1KQVA 1CB1A 1M46A 3N7HA 5CSFA 5CSNA 2ERBA 3BOWA 2G9BA 1OOHA 1PALA 3CTNA 1UHNA 1YX8A 2M29A 1CFDA 2FCEA 4UPGA 1CFFA 2PALA 1JUOA 2KYCA 4IL1A 3TS5C 1XFRA 5JJGA 4PALA 1XFUO 1SCVA 3D0YB 3JVTB 1BF5A 3E3RA 1MR8A 2K8MB 1CNPA 3CZTX 1A2XA 1KSMA 3OX6A 1P28A 1WLZA 1EL4A 2JOJA 2M97A 3EVVA 1RFJA 1B1GA 4GFTA 1IG5A 1OMVA 2K7BA 1XFZO 5AANA 1GGZA 2H61C 1S1EA 1OOJA 3B86A 1UURA 2WNDA 3BFHA 1XFYO 3DYEA 3SG3A 4U8DA 2MA2A 2LLSA 2QDIA 1WLMA 3D77A 3QMEA 1KK7Y 1K9PA 2COLB 1N2DA 2BL0C 1FI6A 1TUJA 1QX7A 2MAZA 1GQMA 1S6JA 2LNKA 3L4LA 2QEOA 4PHMA 2WCHA 3BXKA 3CS1A 1MUXA 4L9MA 1OZOA 1ZMZA 4M2PA 4WQ2A 2Y4QA 3OX5A 2Y5IA 3M0WA 4Q04A 1ZUZA 1F4OA 1F4QA 1QIWA 3Q8IA 1ZACA 3DD4A 1T14A 4TNCA 2L5YA 2M9GA 3PALA 1Q80A 3S0FA 2O60A 1LINA 3NHIA 3WHTB 1JF0A 2PSRA 1L7ZA 5DKNA 4C0JA 3I5FB 2JPOA 4PCWA 3S0DA 2K61A 1DEKA 1C07A 1YUTA 1QTXA 4E68A 1EXRA 2ZNDA 4OCIA 2FOTA 4C0LA 1UHJA 3FIAA 3I5HB 3TDZA 1LA0A 1SSEB 4DRWA 2OS8B 3FE6A 3V2LA 1BR4B 5B8IB 3I5GC 4PE1A 3I5IC 5PALA 1QX5B 1RWYA 4BY4A 2YGUA 1JFKA 1WRZA 2AUCA 1BLQA 4AQIA 3S0EA 1YTZC 1TOPA 1NUBA 4DIRA 1DJHA 1DELA 5AFPA 1G4YR 5J3XA 3CZ2A 3HX4A 1F70A 1NSHA 2M8UA 3TDIA 3EKHA 5FYXA 5KU1A 1UHHA 1FPWA 1Y0VH 2ZN9A 3ZWHA 3TS5B 1W7IB 4GBAA 2MLEC 1UWOA 3NGVA 2KBIA 3BFAA 4DCKA 1YURA 2L50A 2PRUA 4YGCB 1DJWA 2HQ8A 1KFXS 2K2FA 1S6CA 2ZFDA 2V53A 2HPSA 1BG1A 4MZJA 3D0YA 1N65A 3BUNB 1UP5A 1S36A 2EC6C 2F3YA 4PE4A 5K89A 1NCXA 1NX0A 2VRGA 2A4JA 1GM0A 2BL0B 1F71A 2K7OA 1XFVO 2KBMA 2WCJA 3SG2A 1PVBA 5FI2A 3LK0A 4MVFA 5DKQA 3IF7A 1FBVA 1PSBA 3S0AA 1S5GZ 2EGDA 3CLNA 3LL8B 4ORCB 2JULA 1KK8B 4PE0A 2QEBA 1IWQA 3IQQA 4PHNA 4QJ4B 3HCMA 3DVKA 1IKUA 1DGUA 3KEVA 3PM2A 1SYMA 4JKTA 2NLNA 3CZ0A 1AUIB 1BJFA 4HREE 2NCPA 1WRKA 1D1OA 3CABA 1OZSA 1WRLA 1CM1A 1QJTA 4I5JA 1J7PA 2F2PA 1S26D 2I18A 2KYFA 2SCPA 1J55A 3OB2B 5AXIA 4AQJA 3KF9A 1AP4A 2L2EA 2KFGA 2BCBA 3AKAA 4GGNA 4BY5A 4QJ3B 4KYNA 1FW4A 4CIDA 1DJXA 1Y1XA 3D78A 4CFQA 4MLWA 2F33A 4MEWA 2BBMA 2LP3A 4CFRA 4ETOA 1SMGA 1OMDA 2BE6A 2M7LA 1F55A 5HLOA 2ZKMX 2KNEA 2LVJA 2LC5A 5JOLA 1OE9B 1XA5A 3I5GB 5I2LA 4IJ7A 2G2BA 3OHMB 3I5IB 2AMIA 4OKHA 2KDHA 4DS7A 1IH0A 2M3WA 1F8HA 4USLA 2F3ZA 2DOQA 3ZNIA 5ER5A 1B8LA 1SL7A 1LS8A 2PMYA 1R6PA 4MRYA 2KHNA 1IRJA 3JTDC 1MXEA 3TUYC 3SG4A 1Y1UA 2CBLA 5CSJA 3EVRA 5D3OA 1X02A 1R2UA 2BCAA 1QATA 3A8RA 2OPOA 3D73A 3S0BA 1IQ5A 3QRXA 1KSOA 1TNXA 5TNCA 3BUOB 4PHJA 1J7RA 2QEHA 3CR2A 2LMUA 2BCXA 4FTGA 3FE8A 1YRUB 1CDPA 5HL1A 2M1UA 1DT7B 1J1EA 3RLZA 2JNXA 3D75A 4GNKB 1WDCB 1ZFSA 2BBNA 3B6XA 2JTZA 3DF0B 3VB1A 4GAOA 3GK4X 2LHIA 5FI6A 4PHKA 2K2AA 1M39A 3AAJA 1B8CA 1N0YA 1VRKA 1M63B 1OOFA 3SJSA 1CLMA 1SCMC 4A4BA 3VRRA 1K9KA 4D1EA 2EC6B 1MF8B 1GJYA 2L2CA 4JPZB 2WOSA 1YVLA 1QWVA 1S5GY 3OP0A 4XYNA 3S0GA 2LVKA 2P71A 1KFUL 1AHRA 3K21A 1AJ4A 1RECA 2JZIA 2LUXA 3KO0A 2KAXA 4N1FA 1YUSA 2LCPA 4FQTA 4R1EA 1XK4A 2Y1MA 4MZLA 4NDBA 2K0JA 2LE9B 2K7DA 1DTLA 2H8VA 2JNFA 2QPTA 3FWCA 3VRPA 3KPXA 3AAKA 3BUMB 1TIZA 4QJ5B 1TNQA 1DGVA 2K7CA 1JFJA 1NX2A 1OQPA 2WC5A 1TNWA 2QEVA 1BR1B 4WQ3A 1NPQA 3O4YA 1Z2CB 1QX2A 1SW8A 4OV2A 4DUQA 4JQ0D 2M7NA 1TUZA 3EK7A 4GUKA 1LXFC 1GGWA 1NX3A 1NYAA 1Y6WA 1EH2A 1DJGA 1W9ZA 5I8NA 2JPTA 2KLDA 1YRTB 2M1KB 1C3YA 5AERA 1B7TZ 3VGOA 3VROA 5ER4X 1RTP1 3BQ3A 3TZ1A 1RJVA 1UHIA 1A29A 2HETA 3BYAA 5HKWA 2FJYA 4GGFC 1CTRA 4NDDA 1M45A 3DVJA 2WORA 1ALWA 1QVIZ 1U5IB 3SG7A 3R1VA 3JVTC 5DICA 5I2OA 2FJUB 1MWNA 1IGVA 1MXLC 3TUYB 2L4IA 2MHHA 2GV5A 4OZDA 1KWOC 2CNPA 2ZRTA 2KOTA 1RK9A 1YR5A 1PVAA 3PSRA 4ZCUA 1JBAA 2WCLA 5AEQA 1S3PA 2KGBC 2M0RA 5I94A 4INWA 3PFVA 1K90D 2D8NA 3IQOA 4HRGA 2JXLA 4I5NB 4ORAB 2I7AA 1LVCD 2LAPA 2JT3A 2E6WA 4OR9B 3PATA 2KI4C
chains in the Genus database with same CATH topology
5GQQC 4GPLB 1KK7Z 1ODBA 1NCYA 1K2HA 1PK0D 4F0ZB 5BPJA 1CLBA 2LM5A 5G08A 1M31A 1XO5A 1B9AA 4WRIA 1DJZA 1SRAA 1SNLA 3FWBA 5KSZA 1SCMB 3DF0A 3PLFB 5CPVA 3O2PA 4N5XA 2P6BB 5DKRA 3CGAA 2L98A 1YX7A 2BKIB 1LKJA 1JWDA 2NXQA 2CXJA 3GK1A 2RGIA 3BUXB 3O6BA 1L2OC 3PN7C 4YI8A 2Y1NA 1NP8A 1NWDA 3I5HC 2KGRA 1TRFA 2Q91A 4MBEA 2CT9A 3F45A 1J7QA 2LVVA 2L51A 2JRFA 1IJ6A 1XFWO 1KCYA 5HKYA 2OS8C 1EJ3A 1TN4A 2I2RE 2WCEA 4XJKB 5HYDA 3WNXB 4ZCVA 3SIBA 1CDNA 1CMGA 1UHKA 5CSIA 3H4SE 4M2QA 1FI5A 1RROA 2KI6D 1SR6C 1BT6A 1A75B 2HQWA 4C0KA 2PVBA 2ZRSA 1SBJA 1B7TY 1HT9A 3MSEB 3ICBA 1HQVA 1KFUS 3CR5X 4A4CA 2LVIA 2O5GA 5KTYA 1IJ5A 1A03A 2JTTA 5D7FA 1FF1A 2JXCA 3BUWB 1QVIY 2JWWA 1V1GA 2LLTA 3KHEA 1E8AA 3CWGA 1CFPA 1UUSA 2KAVA 1CKKA 3SIAA 5HLVA 1DF0B 4ICBA 3SG5A 2GGZA 4YGEB 1ALVA 1KWOB 1YVHA 4YGDB 4ORBB 3LCPC 1U5IA 2CCMA 3TDUA 1K96A 1K9UA 3EVUA 4YGAA 3DVEA 3GOFA 4OVNF 1CDMA 1AJ5A 2FCDA 1AK8A 2LMVA 4FQOA 2H61A 3D10A 2KFHA 1JC2A 2KFFA 4YI9A 1KQMC 2KI4B 2NCOA 1TCFA 2JU0A 1J1DA 1CFCA 1XK4C 1SY9A 2EHBA 1QS7A 2OTGC 1YUUA 2H2KA 2F8PA 1SK6D 2M49B 1SL8A 3LK1A 1KK8C 1QIVA 1TNPA 3C1VA 1QV0A 2MJWB 3LLEA 4PDZA 2R2IA 3NXAA 1B8RA 2WC8A 1SPYA 2BE4A 2L0PA 4MN0A 2IS9A 2L5XB 2LUCA 2LMTA 3BOWB 4N1GA 1DMOA 3RM1A 3OB1B 2KAYA 1EG3A 3DVMA 1L2OB 4P5OE 1XFXO 4M2OA 3PN7B 1QLKA 2LV7A 1G8IA 3AKBA 4YGBB 5I2QA 1Y1AA 2KQ6A 2QACA 1DJIA 3VRNA 3A4UB 2PASA 2MRDA 2ISDA 1B4CA 1JF2A 3NSIA 2KQYA 1OSAA 4HRHA 1MHOA 1C7VA 4YRUA 3SG6A 1BMOA 1K93D 2JC2A 2Q4UA 1QV1A 2JT8A 1EG4A 1SR6B 4MZKA 4XJKA 3JTDB 3NSLA 1NCZA 3NSKA 2ZN8A 2E30A 2ZNEA 3FS7A 1CMFA 1W7JB 1NX1A 1MQ1A 3EK8A 1SL9A 2I94A 1XVJA 4I5LB 1A75A 2KI6C 2SASA 5D69A 1XYDA 1TCOB 2MLFC 3EKJA 1BODA 5F6TA 3VRQA 4YBHB 2LHLA 2LLUA 2MBXA 3O78A 2BECA 2TN4A 1V1FA 1IQ3A 1PSRA 2CTNA 1C7WA 4PE7A 1AVSA 3GK2A 4CLNA 4GGFA 4HSZA 1WDCC 3EK4A 2WCBA 4NQGA 1PULA 1CDLA 1S6IA 1JSAA 2WCFA 2LANA 1DF0A 1TTXA 1G33A 3WXAA 1LA3A 2BKHB 4CPVA 3PM8A 1QASA 5HKZA 1SKTA 1K95A 1K8UA 1PRWA 2HF5A 1J7OA 2JQ6A 1KQMB 2KSPA 1H8BA 1DVIA 2AAOA 3I5FC 4JWQA 1A4PA 1NIWA 2OTGB 1DJYA 4NDCA 4MSPA 1ZOTB 1K94A 1B47A 1CLLA 1CM4A 2LP2A 1BU3A 5IBWA 2GGMA 1BOCA 4P2YB 2NZ0A 4I5KA 1OMRA 2B1UA 1KFXL 3CR4X 1WY9A 3NSOA 2L4HA 3WHUB 2JT0A 4MRXA 1QXPA 2F2OA 1F54A 1QLSA 1KQVA 1CB1A 1M46A 5CSFA 5CSNA 3BOWA 2G9BA 1PALA 3CTNA 1UHNA 1YX8A 2M29A 1CFDA 2FCEA 4UPGA 1CFFA 2PALA 1JUOA 2KYCA 4IL1A 3TS5C 5JJGA 4PALA 1XFUO 1SCVA 3D0YB 3JVTB 1BF5A 3E3RA 1MR8A 2K8MB 1CNPA 3CZTX 1A2XA 1KSMA 3OX6A 1WLZA 2JOJA 1EL4A 2M97A 3EVVA 1RFJA 1B1GA 4GFTA 1IG5A 1OMVA 2K7BA 1XFZO 5AANA 1GGZA 2H61C 1S1EA 1OOJA 3SG3A 1UURA 2WNDA 4AOMA 1XFYO 4U8DA 2MA2A 2LLSA 1WLMA 1KK7Y 1K9PA 2COLB 2BL0C 1N2DA 1FI6A 2MAZA 1QX7A 1GQMA 1S6JA 2LNKA 4PHMA 3CS1A 3BXKA 1MUXA 4L9MA 1OZOA 1ZMZA 4M2PA 4WQ2A 2Y4QA 3OX5A 2Y5IA 3M0WA 4Q04A 1ZUZA 1F4OA 1F4QA 1QIWA 1ZACA 3DD4A 4TNCA 2M9GA 3PALA 1Q80A 2O60A 1LINA 3WHTB 1JF0A 2PSRA 1L7ZA 5DKNA 4C0JA 3I5FB 4PCWA 2K61A 1C07A 1YUTA 1QTXA 4E68A 1EXRA 2ZNDA 4OCIA 2FOTA 4C0LA 1UHJA 3FIAA 3I5HB 3TDZA 1LA0A 4DRWA 2OS8B 1BR4B 5B8IB 3I5GC 4PE1A 3I5IC 5PALA 1QX5B 1RWYA 4BY4A 1JFKA 1WRZA 2AUCA 1BLQA 4AQIA 1YTZC 1TOPA 1NUBA 4DIRA 1DJHA 5AFPA 1G4YR 5J3XA 3HX4A 1F70A 1NSHA 2M8UA 3TDIA 3EKHA 5FYXA 5KU1A 1UHHA 1FPWA 1Y0VH 2ZN9A 3ZWHA 3TS5B 1W7IB 4GBAA 2MLEC 1UWOA 2KBIA 4DCKA 1YURA 2L50A 2PRUA 4YGCB 1DJWA 2HQ8A 1KFXS 2K2FA 1S6CA 2ZFDA 2V53A 2HPSA 1BG1A 4MZJA 3D0YA 1N65A 3BUNB 1UP5A 1S36A 2EC6C 2F3YA 4PE4A 5K89A 1NCXA 1NX0A 2VRGA 2A4JA 1H4BA 2BL0B 1F71A 2K7OA 1XFVO 2KBMA 3SG2A 1PVBA 3LK0A 4MVFA 5DKQA 3IF7A 1FBVA 1PSBA 1S5GZ 2EGDA 3CLNA 3LL8B 4ORCB 2JULA 1KK8B 4PE0A 1IWQA 3IQQA 4PHNA 4QJ4B 3HCMA 3DVKA 1IKUA 1DGUA 3KEVA 1SYMA 2NLNA 1AUIB 1BJFA 4HREE 2NCPA 1WRKA 1D1OA 1OZSA 1WRLA 1CM1A 1QJTA 4I5JA 1J7PA 2F2PA 1S26D 2I18A 2KYFA 2SCPA 1J55A 3OB2B 5AXIA 4AQJA 3KF9A 1AP4A 2L2EA 2KFGA 2BCBA 3AKAA 4GGNA 4BY5A 4QJ3B 1FW4A 4CIDA 1DJXA 1Y1XA 4CFQA 4MLWA 2F33A 4MEWA 2BBMA 2LP3A 4CFRA 4ETOA 1SMGA 1OMDA 2BE6A 2M7LA 1F55A 5HLOA 2ZKMX 2KNEA 2LVJA 2LC5A 5JOLA 1OE9B 1XA5A 3I5GB 5I2LA 2G2BA 3OHMB 3I5IB 2AMIA 4OKHA 2KDHA 4DS7A 1IH0A 2M3WA 1F8HA 4USLA 2F3ZA 2DOQA 3ZNIA 5ER5A 1B8LA 1SL7A 2PMYA 1R6PA 4MRYA 2KHNA 1IRJA 3JTDC 1MXEA 3TUYC 3SG4A 1Y1UA 2CBLA 5CSJA 3EVRA 1X02A 1R2UA 2BCAA 1QATA 3A8RA 2OPOA 1IQ5A 3QRXA 1KSOA 1TNXA 5TNCA 3BUOB 4PHJA 1J7RA 3CR2A 2LMUA 2BCXA 4FTGA 1YRUB 1CDPA 2M1UA 1DT7B 1J1EA 3RLZA 2JNXA 4GNKB 1WDCB 1ZFSA 2BBNA 2JTZA 3DF0B 4GAOA 3GK4X 2LHIA 4PHKA 2K2AA 1M39A 3AAJA 1B8CA 1N0YA 1VRKA 1M63B 3SJSA 1CLMA 1SCMC 4A4BA 3VRRA 1K9KA 4D1EA 2EC6B 1MF8B 1GJYA 4JPZB 2WOSA 1YVLA 1S5GY 3OP0A 4XYNA 2LVKA 1KFUL 1AHRA 3K21A 1AJ4A 1RECA 2JZIA 2LUXA 3KO0A 2KAXA 4N1FA 1YUSA 2LCPA 4R1EA 1XK4A 2Y1MA 4MZLA 4NDBA 2K0JA 2LE9B 2K7DA 1DTLA 2JNFA 2QPTA 3FWCA 3VRPA 3KPXA 3AAKA 3BUMB 1TIZA 4QJ5B 1TNQA 1DGVA 2K7CA 1JFJA 1NX2A 1OQPA 1TNWA 4WQ3A 1BR1B 1NPQA 3O4YA 1QX2A 1SW8A 4OV2A 4DUQA 4JQ0D 2M7NA 3EK7A 4GUKA 1LXFC 1GGWA 1NX3A 1NYAA 1Y6WA 1EH2A 1DJGA 5I8NA 2JPTA 1YRTB 2M1KB 5AERA 1B7TZ 3VGOA 3VROA 5ER4X 1RTP1 3BQ3A 3TZ1A 1RJVA 1UHIA 1A29A 2HETA 3BYAA 5HKWA 4GGFC 1CTRA 4NDDA 1M45A 3DVJA 2WORA 1ALWA 1QVIZ 1U5IB 3SG7A 3JVTC 5I2OA 2FJUB 1MWNA 1IGVA 1MXLC 3TUYB 2L4IA 2MHHA 2GV5A 1KWOC 2CNPA 2ZRTA 2KOTA 1RK9A 1YR5A 1PVAA 3PSRA 4ZCUA 1JBAA 5AEQA 1S3PA 2KGBC 2M0RA 3PFVA 1K90D 2D8NA 3IQOA 4HRGA 2JXLA 4I5NB 4ORAB 2I7AA 1LVCD 2LAPA 2JT3A 2E6WA 4OR9B 3PATA 2KI4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQQ C;  4GPL B;  1KK7 Z;  1ODB A;  1NCY A;  1K2H A;  1PK0 D;  4F0Z B;  5BPJ A;  1CLB A;  2LM5 A;  5G08 A;  1M31 A;  1XO5 A;  1B9A A;  4WRI A;  1DJZ A;  1SRA A;  1SNL A;  3FWB A;  5KSZ A;  1SCM B;  3DF0 A;  3PLF B;  5CPV A;  3O2P A;  4N5X A;  2P6B B;  5DKR A;  3CGA A;  2L98 A;  1YX7 A;  2BKI B;  1LKJ A;  1JWD A;  2NXQ A;  2CXJ A;  3GK1 A;  2RGI A;  3BUX B;  3O6B A;  1L2O C;  3PN7 C;  4YI8 A;  2Y1N A;  1NP8 A;  1NWD A;  3I5H C;  2KGR A;  1TRF A;  2Q91 A;  4MBE A;  2CT9 A;  3F45 A;  1J7Q A;  2LVV A;  2L51 A;  2JRF A;  1IJ6 A;  1XFW O;  1KCY A;  5HKY A;  2OS8 C;  1EJ3 A;  1TN4 A;  2I2R E;  2WCE A;  4XJK B;  5HYD A;  3WNX B;  4ZCV A;  3SIB A;  1CDN A;  1CMG A;  1UHK A;  5CSI A;  3H4S E;  4M2Q A;  1FI5 A;  1RRO A;  2KI6 D;  1SR6 C;  1BT6 A;  1A75 B;  2HQW A;  4C0K A;  2PVB A;  2ZRS A;  1SBJ A;  1B7T Y;  1HT9 A;  3MSE B;  3ICB A;  1HQV A;  1KFU S;  3CR5 X;  4A4C A;  2LVI A;  2O5G A;  5KTY A;  1IJ5 A;  1A03 A;  2JTT A;  5D7F A;  1FF1 A;  2JXC A;  3BUW B;  1QVI Y;  2JWW A;  1V1G A;  2LLT A;  3KHE A;  1E8A A;  3CWG A;  1CFP A;  1UUS A;  2KAV A;  1CKK A;  3SIA A;  5HLV A;  1DF0 B;  4ICB A;  3SG5 A;  2GGZ A;  4YGE B;  1ALV A;  1KWO B;  1YVH A;  4YGD B;  4ORB B;  3LCP C;  1U5I A;  2CCM A;  3TDU A;  1K96 A;  1K9U A;  3EVU A;  4YGA A;  3DVE A;  3GOF A;  4OVN F;  1CDM A;  1AJ5 A;  2FCD A;  1AK8 A;  2LMV A;  4FQO A;  2H61 A;  3D10 A;  2KFH A;  1JC2 A;  2KFF A;  4YI9 A;  1KQM C;  2KI4 B;  2NCO A;  1TCF A;  2JU0 A;  1J1D A;  1CFC A;  1XK4 C;  1SY9 A;  2EHB A;  1QS7 A;  2OTG C;  1YUU A;  2H2K A;  2F8P A;  1SK6 D;  2M49 B;  1SL8 A;  3LK1 A;  1KK8 C;  1QIV A;  1TNP A;  3C1V A;  1QV0 A;  2MJW B;  3LLE A;  4PDZ A;  2R2I A;  3NXA A;  1B8R A;  2WC8 A;  1SPY A;  2BE4 A;  2L0P A;  4MN0 A;  2IS9 A;  2L5X B;  2LUC A;  2LMT A;  3BOW B;  4N1G A;  1DMO A;  3RM1 A;  3OB1 B;  2KAY A;  1EG3 A;  3DVM A;  1L2O B;  4P5O E;  1XFX O;  4M2O A;  3PN7 B;  1QLK A;  2LV7 A;  1G8I A;  3AKB A;  4YGB B;  5I2Q A;  1Y1A A;  2KQ6 A;  2QAC A;  1DJI A;  3VRN A;  3A4U B;  2PAS A;  2MRD A;  2ISD A;  1B4C A;  1JF2 A;  3NSI A;  2KQY A;  1OSA A;  4HRH A;  1MHO A;  1C7V A;  4YRU A;  3SG6 A;  1BMO A;  1K93 D;  2JC2 A;  2Q4U A;  1QV1 A;  2JT8 A;  1EG4 A;  1SR6 B;  4MZK A;  4XJK A;  3JTD B;  3NSL A;  1NCZ A;  3NSK A;  2ZN8 A;  2E30 A;  2ZNE A;  3FS7 A;  1CMF A;  1W7J B;  1NX1 A;  1MQ1 A;  3EK8 A;  1SL9 A;  2I94 A;  1XVJ A;  4I5L B;  1A75 A;  2KI6 C;  2SAS A;  5D69 A;  1XYD A;  1TCO B;  2MLF C;  3EKJ A;  1BOD A;  5F6T A;  3VRQ A;  4YBH B;  2LHL A;  2LLU A;  2MBX A;  3O78 A;  2BEC A;  2TN4 A;  1V1F A;  1IQ3 A;  1PSR A;  2CTN A;  1C7W A;  4PE7 A;  1AVS A;  3GK2 A;  4CLN A;  4GGF A;  4HSZ A;  1WDC C;  3EK4 A;  2WCB A;  4NQG A;  1PUL A;  1CDL A;  1S6I A;  1JSA A;  2WCF A;  2LAN A;  1DF0 A;  1TTX A;  1G33 A;  3WXA A;  1LA3 A;  2BKH B;  4CPV A;  3PM8 A;  1QAS A;  5HKZ A;  1SKT A;  1K95 A;  1K8U A;  1PRW A;  2HF5 A;  1J7O A;  2JQ6 A;  1KQM B;  2KSP A;  1H8B A;  1DVI A;  2AAO A;  3I5F C;  4JWQ A;  1A4P A;  1NIW A;  2OTG B;  1DJY A;  4NDC A;  4MSP A;  1ZOT B;  1K94 A;  1B47 A;  1CLL A;  1CM4 A;  2LP2 A;  1BU3 A;  5IBW A;  2GGM A;  1BOC A;  4P2Y B;  2NZ0 A;  4I5K A;  1OMR A;  2B1U A;  1KFX L;  3CR4 X;  1WY9 A;  3NSO A;  2L4H A;  3WHU B;  2JT0 A;  4MRX A;  1QXP A;  2F2O A;  1F54 A;  1QLS A;  1KQV A;  1CB1 A;  1M46 A;  5CSF A;  5CSN A;  3BOW A;  2G9B A;  1PAL A;  3CTN A;  1UHN A;  1YX8 A;  2M29 A;  1CFD A;  2FCE A;  4UPG A;  1CFF A;  2PAL A;  1JUO A;  2KYC A;  4IL1 A;  3TS5 C;  5JJG A;  4PAL A;  1XFU O;  1SCV A;  3D0Y B;  3JVT B;  1BF5 A;  3E3R A;  1MR8 A;  2K8M B;  1CNP A;  3CZT X;  1A2X A;  1KSM A;  3OX6 A;  1WLZ A;  2JOJ A;  1EL4 A;  2M97 A;  3EVV A;  1RFJ A;  1B1G A;  4GFT A;  1IG5 A;  1OMV A;  2K7B A;  1XFZ O;  5AAN A;  1GGZ A;  2H61 C;  1S1E A;  1OOJ A;  3SG3 A;  1UUR A;  2WND A;  4AOM A;  1XFY O;  4U8D A;  2MA2 A;  2LLS A;  1WLM A;  1KK7 Y;  1K9P A;  2COL B;  2BL0 C;  1N2D A;  1FI6 A;  2MAZ A;  1QX7 A;  1GQM A;  1S6J A;  2LNK A;  4PHM A;  3CS1 A;  3BXK A;  1MUX A;  4L9M A;  1OZO A;  1ZMZ A;  4M2P A;  4WQ2 A;  2Y4Q A;  3OX5 A;  2Y5I A;  3M0W A;  4Q04 A;  1ZUZ A;  1F4O A;  1F4Q A;  1QIW A;  1ZAC A;  3DD4 A;  4TNC A;  2M9G A;  3PAL A;  1Q80 A;  2O60 A;  1LIN A;  3WHT B;  1JF0 A;  2PSR A;  1L7Z A;  5DKN A;  4C0J A;  3I5F B;  4PCW A;  2K61 A;  1C07 A;  1YUT A;  1QTX A;  4E68 A;  1EXR A;  2ZND A;  4OCI A;  2FOT A;  4C0L A;  1UHJ A;  3FIA A;  3I5H B;  3TDZ A;  1LA0 A;  4DRW A;  2OS8 B;  1BR4 B;  5B8I B;  3I5G C;  4PE1 A;  3I5I C;  5PAL A;  1QX5 B;  1RWY A;  4BY4 A;  1JFK A;  1WRZ A;  2AUC A;  1BLQ A;  4AQI A;  1YTZ C;  1TOP A;  1NUB A;  4DIR A;  1DJH A;  5AFP A;  1G4Y R;  5J3X A;  3HX4 A;  1F70 A;  1NSH A;  2M8U A;  3TDI A;  3EKH A;  5FYX A;  5KU1 A;  1UHH A;  1FPW A;  1Y0V H;  2ZN9 A;  3ZWH A;  3TS5 B;  1W7I B;  4GBA A;  2MLE C;  1UWO A;  2KBI A;  4DCK A;  1YUR A;  2L50 A;  2PRU A;  4YGC B;  1DJW A;  2HQ8 A;  1KFX S;  2K2F A;  1S6C A;  2ZFD A;  2V53 A;  2HPS A;  1BG1 A;  4MZJ A;  3D0Y A;  1N65 A;  3BUN B;  1UP5 A;  1S36 A;  2EC6 C;  2F3Y A;  4PE4 A;  5K89 A;  1NCX A;  1NX0 A;  2VRG A;  2A4J A;  1H4B A;  2BL0 B;  1F71 A;  2K7O A;  1XFV O;  2KBM A;  3SG2 A;  1PVB A;  3LK0 A;  4MVF A;  5DKQ A;  3IF7 A;  1FBV A;  1PSB A;  1S5G Z;  2EGD A;  3CLN A;  3LL8 B;  4ORC B;  2JUL A;  1KK8 B;  4PE0 A;  1IWQ A;  3IQQ A;  4PHN A;  4QJ4 B;  3HCM A;  3DVK A;  1IKU A;  1DGU A;  3KEV A;  1SYM A;  2NLN A;  1AUI B;  1BJF A;  4HRE E;  2NCP A;  1WRK A;  1D1O A;  1OZS A;  1WRL A;  1CM1 A;  1QJT A;  4I5J A;  1J7P A;  2F2P A;  1S26 D;  2I18 A;  2KYF A;  2SCP A;  1J55 A;  3OB2 B;  5AXI A;  4AQJ A;  3KF9 A;  1AP4 A;  2L2E A;  2KFG A;  2BCB A;  3AKA A;  4GGN A;  4BY5 A;  4QJ3 B;  1FW4 A;  4CID A;  1DJX A;  1Y1X A;  4CFQ A;  4MLW A;  2F33 A;  4MEW A;  2BBM A;  2LP3 A;  4CFR A;  4ETO A;  1SMG A;  1OMD A;  2BE6 A;  2M7L A;  1F55 A;  5HLO A;  2ZKM X;  2KNE A;  2LVJ A;  2LC5 A;  5JOL A;  1OE9 B;  1XA5 A;  3I5G B;  5I2L A;  2G2B A;  3OHM B;  3I5I B;  2AMI A;  4OKH A;  2KDH A;  4DS7 A;  1IH0 A;  2M3W A;  1F8H A;  4USL A;  2F3Z A;  2DOQ A;  3ZNI A;  5ER5 A;  1B8L A;  1SL7 A;  2PMY A;  1R6P A;  4MRY A;  2KHN A;  1IRJ A;  3JTD C;  1MXE A;  3TUY C;  3SG4 A;  1Y1U A;  2CBL A;  5CSJ A;  3EVR A;  1X02 A;  1R2U A;  2BCA A;  1QAT A;  3A8R A;  2OPO A;  1IQ5 A;  3QRX A;  1KSO A;  1TNX A;  5TNC A;  3BUO B;  4PHJ A;  1J7R A;  3CR2 A;  2LMU A;  2BCX A;  4FTG A;  1YRU B;  1CDP A;  2M1U A;  1DT7 B;  1J1E A;  3RLZ A;  2JNX A;  4GNK B;  1WDC B;  1ZFS A;  2BBN A;  2JTZ A;  3DF0 B;  4GAO A;  3GK4 X;  2LHI A;  4PHK A;  2K2A A;  1M39 A;  3AAJ A;  1B8C A;  1N0Y A;  1VRK A;  1M63 B;  3SJS A;  1CLM A;  1SCM C;  4A4B A;  3VRR A;  1K9K A;  4D1E A;  2EC6 B;  1MF8 B;  1GJY A;  4JPZ B;  2WOS A;  1YVL A;  1S5G Y;  3OP0 A;  4XYN A;  2LVK A;  1KFU L;  1AHR A;  3K21 A;  1AJ4 A;  1REC A;  2JZI A;  2LUX A;  3KO0 A;  2KAX A;  4N1F A;  1YUS A;  2LCP A;  4R1E A;  1XK4 A;  2Y1M A;  4MZL A;  4NDB A;  2K0J A;  2LE9 B;  2K7D A;  1DTL A;  2JNF A;  2QPT A;  3FWC A;  3VRP A;  3KPX A;  3AAK A;  3BUM B;  1TIZ A;  4QJ5 B;  1TNQ A;  1DGV A;  2K7C A;  1JFJ A;  1NX2 A;  1OQP A;  1TNW A;  4WQ3 A;  1BR1 B;  1NPQ A;  3O4Y A;  1QX2 A;  1SW8 A;  4OV2 A;  4DUQ A;  4JQ0 D;  2M7N A;  3EK7 A;  4GUK A;  1LXF C;  1GGW A;  1NX3 A;  1NYA A;  1Y6W A;  1EH2 A;  1DJG A;  5I8N A;  2JPT A;  1YRT B;  2M1K B;  5AER A;  1B7T Z;  3VGO A;  3VRO A;  5ER4 X;  1RTP 1;  3BQ3 A;  3TZ1 A;  1RJV A;  1UHI A;  1A29 A;  2HET A;  3BYA A;  5HKW A;  4GGF C;  1CTR A;  4NDD A;  1M45 A;  3DVJ A;  2WOR A;  1ALW A;  1QVI Z;  1U5I B;  3SG7 A;  3JVT C;  5I2O A;  2FJU B;  1MWN A;  1IGV A;  1MXL C;  3TUY B;  2L4I A;  2MHH A;  2GV5 A;  1KWO C;  2CNP A;  2ZRT A;  2KOT A;  1RK9 A;  1YR5 A;  1PVA A;  3PSR A;  4ZCU A;  1JBA A;  5AEQ A;  1S3P A;  2KGB C;  2M0R A;  3PFV A;  1K90 D;  2D8N A;  3IQO A;  4HRG A;  2JXL A;  4I5N B;  4ORA B;  2I7A A;  1LVC D;  2LAP A;  2JT3 A;  2E6W A;  4OR9 B;  3PAT A;  2KI4 C; 
#chains in the Genus database with same CATH topology
 3DY9 A;  5GQQ C;  4GPL B;  3CYZ A;  1KK7 Z;  1ODB A;  1NCY A;  1K2H A;  1PK0 D;  4F0Z B;  5BPJ A;  1CLB A;  2LM5 A;  1ORG A;  5G08 A;  1M31 A;  1XO5 A;  1B9A A;  4WRI A;  1DJZ A;  1SRA A;  1SNL A;  3FWB A;  3O4X A;  1SCM B;  5KSZ A;  3DF0 A;  3PLF B;  5CPV A;  3O2P A;  4N5X A;  2P6B B;  5DKR A;  3CGA A;  3R1P A;  2L98 A;  3BFB A;  1YX7 A;  2BKI B;  1LKJ A;  1JWD A;  2NXQ A;  2CXJ A;  3GK1 A;  2RGI A;  3BUX B;  3O6B A;  1DC1 A;  1L2O C;  3OBV A;  3PN7 C;  4YI8 A;  2Y1N A;  1Z4H A;  3SS3 A;  1NP8 A;  1NWD A;  3PJI A;  3I5H C;  2KGR A;  1TRF A;  2Q91 A;  4MBE A;  2CT9 A;  3F45 A;  1J7Q A;  1C3Z A;  2L51 A;  2JRF A;  2LVV A;  1IJ6 A;  1XFW O;  1KCY A;  5HKY A;  2OS8 C;  1EJ3 A;  1TN4 A;  2I2R E;  2WCE A;  4XJK B;  5HYD A;  3WNX B;  4ZCV A;  3SIB A;  1CDN A;  1CMG A;  1UHK A;  5CSI A;  3H4S E;  4M2Q A;  1FI5 A;  1RRO A;  2KI6 D;  1SR6 C;  1BT6 A;  1A75 B;  2HQW A;  4C0K A;  2PVB A;  2ZRS A;  1SBJ A;  3B7A A;  3K1E A;  1B7T Y;  1HT9 A;  3MSE B;  3ICB A;  1HQV A;  1KFU S;  3CR5 X;  4A4C A;  2LVI A;  2O5G A;  5KTY A;  1IJ5 A;  1A03 A;  2JTT A;  3IVT A;  5D7F A;  1FF1 A;  2JXC A;  3BUW B;  1QVI Y;  2JWW A;  1V1G A;  2LLT A;  3KHE A;  1E8A A;  3CWG A;  1CFP A;  1UUS A;  2KAV A;  4AOM A;  1CKK A;  4JD9 A;  3SIA A;  5HLV A;  1DF0 B;  4ICB A;  3SG5 A;  2GGZ A;  4YGE B;  1ALV A;  3SS4 A;  1KWO B;  1YVH A;  4YGD B;  4ORB B;  3LCP C;  1U5I A;  2CCM A;  3TDU A;  1K96 A;  1K9U A;  3EVU A;  4YGA A;  3DVE A;  3NHT A;  1OOI X;  3GOF A;  4OVN F;  1CDM A;  1AJ5 A;  2FCD A;  1AK8 A;  5EL2 A;  2LMV A;  3B87 A;  4FQO A;  2H61 A;  2GTE A;  3D10 A;  2KFH A;  3DZT A;  3UO9 A;  2KFF A;  4YI9 A;  1KQM C;  2KI4 B;  2NCO A;  1TCF A;  2JU0 A;  1J1D A;  1JC2 A;  1CFC A;  1XK4 C;  1SY9 A;  2EHB A;  1QS7 A;  2OTG C;  1YUU A;  2H2K A;  2F8P A;  2WCM A;  1SK6 D;  2WCK A;  2M49 B;  1SL8 A;  3LK1 A;  1KK8 C;  1QIV A;  2BNX A;  1TNP A;  4INX A;  3C1V A;  3RZS A;  1QV0 A;  2MJW B;  3LLE A;  4PDZ A;  2R2I A;  3NXA A;  1B8R A;  2WC8 A;  1SPY A;  2BE4 A;  3CDN A;  2L0P A;  4MN0 A;  2IS9 A;  2L5X B;  2LUC A;  2LMT A;  3BOW B;  4N1G A;  1DMO A;  3RM1 A;  1TWO A;  2K60 A;  3OB1 B;  2KAY A;  1EG3 A;  3DVM A;  1L2O B;  4P5O E;  1XFX O;  4M2O A;  3PN7 B;  1QLK A;  2LV7 A;  1G8I A;  3AKB A;  4YGB B;  4F7F A;  5I2Q A;  1Y1A A;  3B88 A;  2KQ6 A;  2QAC A;  1DJI A;  2BAP A;  3A4U B;  3VRN A;  2PAS A;  2MRD A;  2ISD A;  1B4C A;  3R72 A;  1JF2 A;  3NSI A;  2KQY A;  2KLE A;  1OSA A;  3R1O A;  4HRH A;  1MHO A;  1OOG A;  1C7V A;  4YRU A;  3SG6 A;  1BMO A;  1K93 D;  2JC2 A;  2Q4U A;  2PYQ A;  1QV1 A;  3DXL A;  2JT8 A;  1EG4 A;  1SR6 B;  4MZK A;  4XJK A;  3JTD B;  3NSL A;  1NCZ A;  3NSK A;  2ZN8 A;  2E30 A;  2ZNE A;  3FS7 A;  1CMF A;  1W7J B;  1NX1 A;  1MQ1 A;  3EK8 A;  1SL9 A;  2I94 A;  1DQE A;  1XVJ A;  4I5L B;  1A75 A;  2P70 A;  2KI6 C;  2SAS A;  5D69 A;  1XYD A;  1TCO B;  2MLF C;  3D74 A;  3EKJ A;  5F6T A;  1BOD A;  3VRQ A;  4YBH B;  2LHL A;  2LLU A;  2MBX A;  3CZ1 A;  3O78 A;  2BEC A;  2TN4 A;  3L4A A;  1V1F A;  1IQ3 A;  3BJH A;  1PSR A;  2CTN A;  1C7W A;  4PE7 A;  1AVS A;  3GK2 A;  4CLN A;  4GGF A;  4HSZ A;  1WDC C;  3EK4 A;  2WCB A;  4NQG A;  1PUL A;  1CDL A;  1S6I A;  5FI7 A;  1JSA A;  2WCF A;  2LAN A;  1DF0 A;  1TTX A;  1G33 A;  3D76 A;  3SS5 A;  1LA3 A;  3WXA A;  2BKH B;  4CPV A;  3PM8 A;  1QAS A;  5HKZ A;  1SKT A;  1K95 A;  1K8U A;  1PRW A;  2HF5 A;  1J7O A;  2JQ6 A;  1KQM B;  2KSP A;  1H8B A;  1DVI A;  1H4B A;  2AAO A;  3I5F C;  4JWQ A;  1A4P A;  1NIW A;  2OTG B;  1DJY A;  3OGN A;  3UNW A;  4NDC A;  4MSP A;  1ZOT B;  1K94 A;  1B47 A;  1CLL A;  3L47 A;  1CM4 A;  2LP2 A;  4PT1 A;  1BU3 A;  5IBW A;  2GGM A;  1BOC A;  3FE9 A;  4P2Y B;  2NZ0 A;  3EG5 B;  1OMR A;  2B1U A;  2WC6 A;  4I5K A;  1KFX L;  3CR4 X;  1WY9 A;  3NSO A;  2L4H A;  3WHU B;  2JT0 A;  4MRX A;  1QXP A;  2F2O A;  2PQL A;  2KPH A;  1IIO A;  1OW4 A;  1F54 A;  1QLS A;  1KQV A;  1CB1 A;  1M46 A;  3N7H A;  5CSF A;  5CSN A;  2ERB A;  3BOW A;  2G9B A;  1OOH A;  1PAL A;  3CTN A;  1UHN A;  1YX8 A;  2M29 A;  1CFD A;  2FCE A;  4UPG A;  1CFF A;  2PAL A;  1JUO A;  2KYC A;  4IL1 A;  3TS5 C;  1XFR A;  5JJG A;  4PAL A;  1XFU O;  1SCV A;  3D0Y B;  3JVT B;  1BF5 A;  3E3R A;  1MR8 A;  2K8M B;  1CNP A;  3CZT X;  1A2X A;  1KSM A;  3OX6 A;  1P28 A;  1WLZ A;  1EL4 A;  2JOJ A;  2M97 A;  3EVV A;  1RFJ A;  1B1G A;  4GFT A;  1IG5 A;  1OMV A;  2K7B A;  1XFZ O;  5AAN A;  1GGZ A;  2H61 C;  1S1E A;  1OOJ A;  3B86 A;  1UUR A;  2WND A;  3BFH A;  1XFY O;  3DYE A;  3SG3 A;  4U8D A;  2MA2 A;  2LLS A;  2QDI A;  1WLM A;  3D77 A;  3QME A;  1KK7 Y;  1K9P A;  2COL B;  1N2D A;  2BL0 C;  1FI6 A;  1TUJ A;  1QX7 A;  2MAZ A;  1GQM A;  1S6J A;  2LNK A;  3L4L A;  2QEO A;  4PHM A;  2WCH A;  3BXK A;  3CS1 A;  1MUX A;  4L9M A;  1OZO A;  1ZMZ A;  4M2P A;  4WQ2 A;  2Y4Q A;  3OX5 A;  2Y5I A;  3M0W A;  4Q04 A;  1ZUZ A;  1F4O A;  1F4Q A;  1QIW A;  3Q8I A;  1ZAC A;  3DD4 A;  1T14 A;  4TNC A;  2L5Y A;  2M9G A;  3PAL A;  1Q80 A;  3S0F A;  2O60 A;  1LIN A;  3NHI A;  3WHT B;  1JF0 A;  2PSR A;  1L7Z A;  5DKN A;  4C0J A;  3I5F B;  2JPO A;  4PCW A;  3S0D A;  2K61 A;  1DEK A;  1C07 A;  1YUT A;  1QTX A;  4E68 A;  1EXR A;  2ZND A;  4OCI A;  2FOT A;  4C0L A;  1UHJ A;  3FIA A;  3I5H B;  3TDZ A;  1LA0 A;  1SSE B;  4DRW A;  2OS8 B;  3FE6 A;  3V2L A;  1BR4 B;  5B8I B;  3I5G C;  4PE1 A;  3I5I C;  5PAL A;  1QX5 B;  1RWY A;  4BY4 A;  2YGU A;  1JFK A;  1WRZ A;  2AUC A;  1BLQ A;  4AQI A;  3S0E A;  1YTZ C;  1TOP A;  1NUB A;  4DIR A;  1DJH A;  1DEL A;  5AFP A;  1G4Y R;  5J3X A;  3CZ2 A;  3HX4 A;  1F70 A;  1NSH A;  2M8U A;  3TDI A;  3EKH A;  5FYX A;  5KU1 A;  1UHH A;  1FPW A;  1Y0V H;  2ZN9 A;  3ZWH A;  3TS5 B;  1W7I B;  4GBA A;  2MLE C;  1UWO A;  3NGV A;  2KBI A;  3BFA A;  4DCK A;  1YUR A;  2L50 A;  2PRU A;  4YGC B;  1DJW A;  2HQ8 A;  1KFX S;  2K2F A;  1S6C A;  2ZFD A;  2V53 A;  2HPS A;  1BG1 A;  4MZJ A;  3D0Y A;  1N65 A;  3BUN B;  1UP5 A;  1S36 A;  2EC6 C;  2F3Y A;  4PE4 A;  5K89 A;  1NCX A;  1NX0 A;  2VRG A;  2A4J A;  1GM0 A;  2BL0 B;  1F71 A;  2K7O A;  1XFV O;  2KBM A;  2WCJ A;  3SG2 A;  1PVB A;  5FI2 A;  3LK0 A;  4MVF A;  5DKQ A;  3IF7 A;  1FBV A;  1PSB A;  3S0A A;  1S5G Z;  2EGD A;  3CLN A;  3LL8 B;  4ORC B;  2JUL A;  1KK8 B;  4PE0 A;  2QEB A;  1IWQ A;  3IQQ A;  4PHN A;  4QJ4 B;  3HCM A;  3DVK A;  1IKU A;  1DGU A;  3KEV A;  3PM2 A;  1SYM A;  4JKT A;  2NLN A;  3CZ0 A;  1AUI B;  1BJF A;  4HRE E;  2NCP A;  1WRK A;  1D1O A;  3CAB A;  1OZS A;  1WRL A;  1CM1 A;  1QJT A;  4I5J A;  1J7P A;  2F2P A;  1S26 D;  2I18 A;  2KYF A;  2SCP A;  1J55 A;  3OB2 B;  5AXI A;  4AQJ A;  3KF9 A;  1AP4 A;  2L2E A;  2KFG A;  2BCB A;  3AKA A;  4GGN A;  4BY5 A;  4QJ3 B;  4KYN A;  1FW4 A;  4CID A;  1DJX A;  1Y1X A;  3D78 A;  4CFQ A;  4MLW A;  2F33 A;  4MEW A;  2BBM A;  2LP3 A;  4CFR A;  4ETO A;  1SMG A;  1OMD A;  2BE6 A;  2M7L A;  1F55 A;  5HLO A;  2ZKM X;  2KNE A;  2LVJ A;  2LC5 A;  5JOL A;  1OE9 B;  1XA5 A;  3I5G B;  5I2L A;  4IJ7 A;  2G2B A;  3OHM B;  3I5I B;  2AMI A;  4OKH A;  2KDH A;  4DS7 A;  1IH0 A;  2M3W A;  1F8H A;  4USL A;  2F3Z A;  2DOQ A;  3ZNI A;  5ER5 A;  1B8L A;  1SL7 A;  1LS8 A;  2PMY A;  1R6P A;  4MRY A;  2KHN A;  1IRJ A;  3JTD C;  1MXE A;  3TUY C;  3SG4 A;  1Y1U A;  2CBL A;  5CSJ A;  3EVR A;  5D3O A;  1X02 A;  1R2U A;  2BCA A;  1QAT A;  3A8R A;  2OPO A;  3D73 A;  3S0B A;  1IQ5 A;  3QRX A;  1KSO A;  1TNX A;  5TNC A;  3BUO B;  4PHJ A;  1J7R A;  2QEH A;  3CR2 A;  2LMU A;  2BCX A;  4FTG A;  3FE8 A;  1YRU B;  1CDP A;  5HL1 A;  2M1U A;  1DT7 B;  1J1E A;  3RLZ A;  2JNX A;  3D75 A;  4GNK B;  1WDC B;  1ZFS A;  2BBN A;  3B6X A;  2JTZ A;  3DF0 B;  3VB1 A;  4GAO A;  3GK4 X;  2LHI A;  5FI6 A;  4PHK A;  2K2A A;  1M39 A;  3AAJ A;  1B8C A;  1N0Y A;  1VRK A;  1M63 B;  1OOF A;  3SJS A;  1CLM A;  1SCM C;  4A4B A;  3VRR A;  1K9K A;  4D1E A;  2EC6 B;  1MF8 B;  1GJY A;  2L2C A;  4JPZ B;  2WOS A;  1YVL A;  1QWV A;  1S5G Y;  3OP0 A;  4XYN A;  3S0G A;  2LVK A;  2P71 A;  1KFU L;  1AHR A;  3K21 A;  1AJ4 A;  1REC A;  2JZI A;  2LUX A;  3KO0 A;  2KAX A;  4N1F A;  1YUS A;  2LCP A;  4FQT A;  4R1E A;  1XK4 A;  2Y1M A;  4MZL A;  4NDB A;  2K0J A;  2LE9 B;  2K7D A;  1DTL A;  2H8V A;  2JNF A;  2QPT A;  3FWC A;  3VRP A;  3KPX A;  3AAK A;  3BUM B;  1TIZ A;  4QJ5 B;  1TNQ A;  1DGV A;  2K7C A;  1JFJ A;  1NX2 A;  1OQP A;  2WC5 A;  1TNW A;  2QEV A;  1BR1 B;  4WQ3 A;  1NPQ A;  3O4Y A;  1Z2C B;  1QX2 A;  1SW8 A;  4OV2 A;  4DUQ A;  4JQ0 D;  2M7N A;  1TUZ A;  3EK7 A;  4GUK A;  1LXF C;  1GGW A;  1NX3 A;  1NYA A;  1Y6W A;  1EH2 A;  1DJG A;  1W9Z A;  5I8N A;  2JPT A;  2KLD A;  1YRT B;  2M1K B;  1C3Y A;  5AER A;  1B7T Z;  3VGO A;  3VRO A;  5ER4 X;  1RTP 1;  3BQ3 A;  3TZ1 A;  1RJV A;  1UHI A;  1A29 A;  2HET A;  3BYA A;  5HKW A;  2FJY A;  4GGF C;  1CTR A;  4NDD A;  1M45 A;  3DVJ A;  2WOR A;  1ALW A;  1QVI Z;  1U5I B;  3SG7 A;  3R1V A;  3JVT C;  5DIC A;  5I2O A;  2FJU B;  1MWN A;  1IGV A;  1MXL C;  3TUY B;  2L4I A;  2MHH A;  2GV5 A;  4OZD A;  1KWO C;  2CNP A;  2ZRT A;  2KOT A;  1RK9 A;  1YR5 A;  1PVA A;  3PSR A;  4ZCU A;  1JBA A;  2WCL A;  5AEQ A;  1S3P A;  2KGB C;  2M0R A;  5I94 A;  4INW A;  3PFV A;  1K90 D;  2D8N A;  3IQO A;  4HRG A;  2JXL A;  4I5N B;  4ORA B;  2I7A A;  1LVC D;  2LAP A;  2JT3 A;  2E6W A;  4OR9 B;  3PAT A;  2KI4 C; 
#chains in the Genus database with same CATH homology
 5GQQ C;  4GPL B;  1KK7 Z;  1ODB A;  1NCY A;  1K2H A;  1PK0 D;  4F0Z B;  5BPJ A;  1CLB A;  2LM5 A;  5G08 A;  1M31 A;  1XO5 A;  1B9A A;  4WRI A;  1DJZ A;  1SRA A;  1SNL A;  3FWB A;  5KSZ A;  1SCM B;  3DF0 A;  3PLF B;  5CPV A;  3O2P A;  4N5X A;  2P6B B;  5DKR A;  3CGA A;  2L98 A;  1YX7 A;  2BKI B;  1LKJ A;  1JWD A;  2NXQ A;  2CXJ A;  3GK1 A;  2RGI A;  3BUX B;  3O6B A;  1L2O C;  3PN7 C;  4YI8 A;  2Y1N A;  1NP8 A;  1NWD A;  3I5H C;  2KGR A;  1TRF A;  2Q91 A;  4MBE A;  2CT9 A;  3F45 A;  1J7Q A;  2LVV A;  2L51 A;  2JRF A;  1IJ6 A;  1XFW O;  1KCY A;  5HKY A;  2OS8 C;  1EJ3 A;  1TN4 A;  2I2R E;  2WCE A;  4XJK B;  5HYD A;  3WNX B;  4ZCV A;  3SIB A;  1CDN A;  1CMG A;  1UHK A;  5CSI A;  3H4S E;  4M2Q A;  1FI5 A;  1RRO A;  2KI6 D;  1SR6 C;  1BT6 A;  1A75 B;  2HQW A;  4C0K A;  2PVB A;  2ZRS A;  1SBJ A;  1B7T Y;  1HT9 A;  3MSE B;  3ICB A;  1HQV A;  1KFU S;  3CR5 X;  4A4C A;  2LVI A;  2O5G A;  5KTY A;  1IJ5 A;  1A03 A;  2JTT A;  5D7F A;  1FF1 A;  2JXC A;  3BUW B;  1QVI Y;  2JWW A;  1V1G A;  2LLT A;  3KHE A;  1E8A A;  3CWG A;  1CFP A;  1UUS A;  2KAV A;  1CKK A;  3SIA A;  5HLV A;  1DF0 B;  4ICB A;  3SG5 A;  2GGZ A;  4YGE B;  1ALV A;  1KWO B;  1YVH A;  4YGD B;  4ORB B;  3LCP C;  1U5I A;  2CCM A;  3TDU A;  1K96 A;  1K9U A;  3EVU A;  4YGA A;  3DVE A;  3GOF A;  4OVN F;  1CDM A;  1AJ5 A;  2FCD A;  1AK8 A;  2LMV A;  4FQO A;  2H61 A;  3D10 A;  2KFH A;  1JC2 A;  2KFF A;  4YI9 A;  1KQM C;  2KI4 B;  2NCO A;  1TCF A;  2JU0 A;  1J1D A;  1CFC A;  1XK4 C;  1SY9 A;  2EHB A;  1QS7 A;  2OTG C;  1YUU A;  2H2K A;  2F8P A;  1SK6 D;  2M49 B;  1SL8 A;  3LK1 A;  1KK8 C;  1QIV A;  1TNP A;  3C1V A;  1QV0 A;  2MJW B;  3LLE A;  4PDZ A;  2R2I A;  3NXA A;  1B8R A;  2WC8 A;  1SPY A;  2BE4 A;  2L0P A;  4MN0 A;  2IS9 A;  2L5X B;  2LUC A;  2LMT A;  3BOW B;  4N1G A;  1DMO A;  3RM1 A;  3OB1 B;  2KAY A;  1EG3 A;  3DVM A;  1L2O B;  4P5O E;  1XFX O;  4M2O A;  3PN7 B;  1QLK A;  2LV7 A;  1G8I A;  3AKB A;  4YGB B;  5I2Q A;  1Y1A A;  2KQ6 A;  2QAC A;  1DJI A;  3VRN A;  3A4U B;  2PAS A;  2MRD A;  2ISD A;  1B4C A;  1JF2 A;  3NSI A;  2KQY A;  1OSA A;  4HRH A;  1MHO A;  1C7V A;  4YRU A;  3SG6 A;  1BMO A;  1K93 D;  2JC2 A;  2Q4U A;  1QV1 A;  2JT8 A;  1EG4 A;  1SR6 B;  4MZK A;  4XJK A;  3JTD B;  3NSL A;  1NCZ A;  3NSK A;  2ZN8 A;  2E30 A;  2ZNE A;  3FS7 A;  1CMF A;  1W7J B;  1NX1 A;  1MQ1 A;  3EK8 A;  1SL9 A;  2I94 A;  1XVJ A;  4I5L B;  1A75 A;  2KI6 C;  2SAS A;  5D69 A;  1XYD A;  1TCO B;  2MLF C;  3EKJ A;  1BOD A;  5F6T A;  3VRQ A;  4YBH B;  2LHL A;  2LLU A;  2MBX A;  3O78 A;  2BEC A;  2TN4 A;  1V1F A;  1IQ3 A;  1PSR A;  2CTN A;  1C7W A;  4PE7 A;  1AVS A;  3GK2 A;  4CLN A;  4GGF A;  4HSZ A;  1WDC C;  3EK4 A;  2WCB A;  4NQG A;  1PUL A;  1CDL A;  1S6I A;  1JSA A;  2WCF A;  2LAN A;  1DF0 A;  1TTX A;  1G33 A;  3WXA A;  1LA3 A;  2BKH B;  4CPV A;  3PM8 A;  1QAS A;  5HKZ A;  1SKT A;  1K95 A;  1K8U A;  1PRW A;  2HF5 A;  1J7O A;  2JQ6 A;  1KQM B;  2KSP A;  1H8B A;  1DVI A;  2AAO A;  3I5F C;  4JWQ A;  1A4P A;  1NIW A;  2OTG B;  1DJY A;  4NDC A;  4MSP A;  1ZOT B;  1K94 A;  1B47 A;  1CLL A;  1CM4 A;  2LP2 A;  1BU3 A;  5IBW A;  2GGM A;  1BOC A;  4P2Y B;  2NZ0 A;  4I5K A;  1OMR A;  2B1U A;  1KFX L;  3CR4 X;  1WY9 A;  3NSO A;  2L4H A;  3WHU B;  2JT0 A;  4MRX A;  1QXP A;  2F2O A;  1F54 A;  1QLS A;  1KQV A;  1CB1 A;  1M46 A;  5CSF A;  5CSN A;  3BOW A;  2G9B A;  1PAL A;  3CTN A;  1UHN A;  1YX8 A;  2M29 A;  1CFD A;  2FCE A;  4UPG A;  1CFF A;  2PAL A;  1JUO A;  2KYC A;  4IL1 A;  3TS5 C;  5JJG A;  4PAL A;  1XFU O;  1SCV A;  3D0Y B;  3JVT B;  1BF5 A;  3E3R A;  1MR8 A;  2K8M B;  1CNP A;  3CZT X;  1A2X A;  1KSM A;  3OX6 A;  1WLZ A;  2JOJ A;  1EL4 A;  2M97 A;  3EVV A;  1RFJ A;  1B1G A;  4GFT A;  1IG5 A;  1OMV A;  2K7B A;  1XFZ O;  5AAN A;  1GGZ A;  2H61 C;  1S1E A;  1OOJ A;  3SG3 A;  1UUR A;  2WND A;  4AOM A;  1XFY O;  4U8D A;  2MA2 A;  2LLS A;  1WLM A;  1KK7 Y;  1K9P A;  2COL B;  2BL0 C;  1N2D A;  1FI6 A;  2MAZ A;  1QX7 A;  1GQM A;  1S6J A;  2LNK A;  4PHM A;  3CS1 A;  3BXK A;  1MUX A;  4L9M A;  1OZO A;  1ZMZ A;  4M2P A;  4WQ2 A;  2Y4Q A;  3OX5 A;  2Y5I A;  3M0W A;  4Q04 A;  1ZUZ A;  1F4O A;  1F4Q A;  1QIW A;  1ZAC A;  3DD4 A;  4TNC A;  2M9G A;  3PAL A;  1Q80 A;  2O60 A;  1LIN A;  3WHT B;  1JF0 A;  2PSR A;  1L7Z A;  5DKN A;  4C0J A;  3I5F B;  4PCW A;  2K61 A;  1C07 A;  1YUT A;  1QTX A;  4E68 A;  1EXR A;  2ZND A;  4OCI A;  2FOT A;  4C0L A;  1UHJ A;  3FIA A;  3I5H B;  3TDZ A;  1LA0 A;  4DRW A;  2OS8 B;  1BR4 B;  5B8I B;  3I5G C;  4PE1 A;  3I5I C;  5PAL A;  1QX5 B;  1RWY A;  4BY4 A;  1JFK A;  1WRZ A;  2AUC A;  1BLQ A;  4AQI A;  1YTZ C;  1TOP A;  1NUB A;  4DIR A;  1DJH A;  5AFP A;  1G4Y R;  5J3X A;  3HX4 A;  1F70 A;  1NSH A;  2M8U A;  3TDI A;  3EKH A;  5FYX A;  5KU1 A;  1UHH A;  1FPW A;  1Y0V H;  2ZN9 A;  3ZWH A;  3TS5 B;  1W7I B;  4GBA A;  2MLE C;  1UWO A;  2KBI A;  4DCK A;  1YUR A;  2L50 A;  2PRU A;  4YGC B;  1DJW A;  2HQ8 A;  1KFX S;  2K2F A;  1S6C A;  2ZFD A;  2V53 A;  2HPS A;  1BG1 A;  4MZJ A;  3D0Y A;  1N65 A;  3BUN B;  1UP5 A;  1S36 A;  2EC6 C;  2F3Y A;  4PE4 A;  5K89 A;  1NCX A;  1NX0 A;  2VRG A;  2A4J A;  1H4B A;  2BL0 B;  1F71 A;  2K7O A;  1XFV O;  2KBM A;  3SG2 A;  1PVB A;  3LK0 A;  4MVF A;  5DKQ A;  3IF7 A;  1FBV A;  1PSB A;  1S5G Z;  2EGD A;  3CLN A;  3LL8 B;  4ORC B;  2JUL A;  1KK8 B;  4PE0 A;  1IWQ A;  3IQQ A;  4PHN A;  4QJ4 B;  3HCM A;  3DVK A;  1IKU A;  1DGU A;  3KEV A;  1SYM A;  2NLN A;  1AUI B;  1BJF A;  4HRE E;  2NCP A;  1WRK A;  1D1O A;  1OZS A;  1WRL A;  1CM1 A;  1QJT A;  4I5J A;  1J7P A;  2F2P A;  1S26 D;  2I18 A;  2KYF A;  2SCP A;  1J55 A;  3OB2 B;  5AXI A;  4AQJ A;  3KF9 A;  1AP4 A;  2L2E A;  2KFG A;  2BCB A;  3AKA A;  4GGN A;  4BY5 A;  4QJ3 B;  1FW4 A;  4CID A;  1DJX A;  1Y1X A;  4CFQ A;  4MLW A;  2F33 A;  4MEW A;  2BBM A;  2LP3 A;  4CFR A;  4ETO A;  1SMG A;  1OMD A;  2BE6 A;  2M7L A;  1F55 A;  5HLO A;  2ZKM X;  2KNE A;  2LVJ A;  2LC5 A;  5JOL A;  1OE9 B;  1XA5 A;  3I5G B;  5I2L A;  2G2B A;  3OHM B;  3I5I B;  2AMI A;  4OKH A;  2KDH A;  4DS7 A;  1IH0 A;  2M3W A;  1F8H A;  4USL A;  2F3Z A;  2DOQ A;  3ZNI A;  5ER5 A;  1B8L A;  1SL7 A;  2PMY A;  1R6P A;  4MRY A;  2KHN A;  1IRJ A;  3JTD C;  1MXE A;  3TUY C;  3SG4 A;  1Y1U A;  2CBL A;  5CSJ A;  3EVR A;  1X02 A;  1R2U A;  2BCA A;  1QAT A;  3A8R A;  2OPO A;  1IQ5 A;  3QRX A;  1KSO A;  1TNX A;  5TNC A;  3BUO B;  4PHJ A;  1J7R A;  3CR2 A;  2LMU A;  2BCX A;  4FTG A;  1YRU B;  1CDP A;  2M1U A;  1DT7 B;  1J1E A;  3RLZ A;  2JNX A;  4GNK B;  1WDC B;  1ZFS A;  2BBN A;  2JTZ A;  3DF0 B;  4GAO A;  3GK4 X;  2LHI A;  4PHK A;  2K2A A;  1M39 A;  3AAJ A;  1B8C A;  1N0Y A;  1VRK A;  1M63 B;  3SJS A;  1CLM A;  1SCM C;  4A4B A;  3VRR A;  1K9K A;  4D1E A;  2EC6 B;  1MF8 B;  1GJY A;  4JPZ B;  2WOS A;  1YVL A;  1S5G Y;  3OP0 A;  4XYN A;  2LVK A;  1KFU L;  1AHR A;  3K21 A;  1AJ4 A;  1REC A;  2JZI A;  2LUX A;  3KO0 A;  2KAX A;  4N1F A;  1YUS A;  2LCP A;  4R1E A;  1XK4 A;  2Y1M A;  4MZL A;  4NDB A;  2K0J A;  2LE9 B;  2K7D A;  1DTL A;  2JNF A;  2QPT A;  3FWC A;  3VRP A;  3KPX A;  3AAK A;  3BUM B;  1TIZ A;  4QJ5 B;  1TNQ A;  1DGV A;  2K7C A;  1JFJ A;  1NX2 A;  1OQP A;  1TNW A;  4WQ3 A;  1BR1 B;  1NPQ A;  3O4Y A;  1QX2 A;  1SW8 A;  4OV2 A;  4DUQ A;  4JQ0 D;  2M7N A;  3EK7 A;  4GUK A;  1LXF C;  1GGW A;  1NX3 A;  1NYA A;  1Y6W A;  1EH2 A;  1DJG A;  5I8N A;  2JPT A;  1YRT B;  2M1K B;  5AER A;  1B7T Z;  3VGO A;  3VRO A;  5ER4 X;  1RTP 1;  3BQ3 A;  3TZ1 A;  1RJV A;  1UHI A;  1A29 A;  2HET A;  3BYA A;  5HKW A;  4GGF C;  1CTR A;  4NDD A;  1M45 A;  3DVJ A;  2WOR A;  1ALW A;  1QVI Z;  1U5I B;  3SG7 A;  3JVT C;  5I2O A;  2FJU B;  1MWN A;  1IGV A;  1MXL C;  3TUY B;  2L4I A;  2MHH A;  2GV5 A;  1KWO C;  2CNP A;  2ZRT A;  2KOT A;  1RK9 A;  1YR5 A;  1PVA A;  3PSR A;  4ZCU A;  1JBA A;  5AEQ A;  1S3P A;  2KGB C;  2M0R A;  3PFV A;  1K90 D;  2D8N A;  3IQO A;  4HRG A;  2JXL A;  4I5N B;  4ORA B;  2I7A A;  1LVC D;  2LAP A;  2JT3 A;  2E6W A;  4OR9 B;  3PAT A;  2KI4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...