2KDHA

The solution structure of human cardiac troponin c in complex with the green tea polyphenol; (-)-epigallocatechin-3-gallate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Solution structure of human cardiac troponin C in complex with the green tea polyphenol, (-)-epigallocatechin 3-gallate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kdhA00
4M2QA 1ZFSA 1S36A 3HCMA 4WQ2A 2LM5A 2A4JA 1DJIA 1NCXA 1QIWA 3O2PA 3PN7C 1QTXA 1XA5A 4MLWA 1K9UA 4ETOA 3DVJA 2JOJA 4IL1A 3OP0A 2ZRSA 2O5GA 1SY9A 3M0WA 1VRKA 3EK8A 3CS1A 1FW4A 1QS7A 2MHHA 3JVTB 4QJ3B 4OKHA 1KCYA 4TNCA 5HLVA 3VGOA 5KU1A 1J7OA 2COLB 5D7FA 2MBXA 1QX5B 2LNKA 1MHOA 1V1FA 4AQIA 4GFTA 4C0LA 1CB1A 1U5IB 3DF0A 3BUOB 2Y4QA 2F3YA 4PHKA 4Q04A 1CFFA 4R1EA 4GBAA 1CDLA 1WY9A 1JWDA 1QJTA 2KBMA 2KAXA 1K9PA 1YUSA 2LANA 3GK1A 2BE6A 1NX3A 1DT7B 1A29A 3TZ1A 1JC2A 1CDNA 3EVUA 1YRTB 1GJYA 3EVVA 1PVAA 4DS7A 2BL0B 1AP4A 1B8LA 1EL4A 3I5GC 1J7RA 5ER4X 1J7PA 1SYMA 4YBHB 3TS5C 1B8RA 3WNXB 2F2PA 1JBAA 1WLMA 1HQVA 1BR1B 1PVBA 2QACA 1WRKA 1IWQA 2LLUA 5FYXA 1OZSA 3VRPA 2PRUA 3BQ3A 2JTTA 1B7TZ 1M31A 1UHJA 2M97A 2F8PA 1NPQA 1OSAA 1M39A 1BG1A 4I5LB 1WRZA 1IH0A 3NSIA 1H8BA 2ZNEA 1B47A 3VRRA 2H2KA 4NDBA 1PSBA 4I5KA 4OV2A 4C0JA 1R6PA 2K2FA 2LMVA 5CSIA 1KFUL 1EG4A 1PK0D 5GQQC 1LINA 1KWOC 1W7IB 3FWBA 2Y1MA 1UURA 1AK8A 3SIAA 1CKKA 2OTGC 4BY5A 2G9BA 1YVHA 1XFUO 1DJYA 1WLZA 2CNPA 2L4HA 2Y1NA 4GAOA 2K7DA 1BJFA 1MXEA 3OB1B 2KQYA 1LA0A 1SR6B 1NCZA 2ISDA 3O4YA 1IJ6A 2E30A 3OX5A 4ICBA 1AHRA 1TOPA 1K96A 2LE9B 2Q91A 3RM1A 2BBMA 1DGUA 4OCIA 3BXKA 4GGNA 5AEQA 1A4PA 1DJGA 2L2EA 5D69A 1SL8A 2I18A 2M7NA 3LK0A 1JUOA 1PULA 2M49B 2MA2A 4U8DA 1KK7Y 3EK4A 3PM8A 4PE4A 2MRDA 2WNDA 1QVIZ 2WC8A 2M3WA 3BOWA 1YUUA 1JF0A 4MBEA 4WRIA 3SG5A 3KO0A 1XK4C 4AQJA 2GV5A 2AMIA 3LK1A 5HKZA 4BY4A 5DKRA 2AAOA 2LHLA 1M46A 2B1UA 2KQ6A 2I2RE 1LA3A 1M45A 2MLFC 4GGFA 1CM1A 3SG6A 4MN0A 4WQ3A 3AKAA 3DF0B 1EJ3A 1KK8C 2KSPA 2M8UA 4XJKA 5F6TA 1RROA 5KSZA 3I5HC 2LMTA 1WDCB 1L7ZA 1SKTA 1GGWA 5I2OA 5DKNA 1A75A 2SASA 1ZACA 1EXRA 5IBWA 2BBNA 1NYAA 1KFUS 1TNWA 3FS7A 4YRUA 3TUYB 1F54A 4N5XA 3DVEA 4MEWA 4CLNA 4UPGA 1N65A 3AAKA 1PALA 3NSLA 3KHEA 3CR2A 4AOMA 1B1GA 1KQMB 3VRQA 2FOTA 1TCOB 4CFRA 3GK4X 2JZIA 3EK7A 3FIAA 2KAVA 1SW8A 3BUXB 2JTZA 2K61A 3I5FB 1KK7Z 1S6CA 2I94A 4ORCB 2BKHB 1YR5A 2P6BB 2LAPA 5JJGA 2CTNA 2QPTA 4NDDA 2JC2A 4OR9B 2I7AA 1CLBA 1OOJA 1HT9A 1MWNA 2LLSA 3HX4A 1L2OC 2LV7A 2JT3A 1OQPA 2OTGB 3JTDC 3A8RA 4I5NB 2IS9A 1DTLA 1J7QA 2EC6C 1IG5A 2KI4C 3RLZA 2KI6D 1SRAA 1G33A 1CMGA 1YRUB 2BCAA 2WORA 3ZWHA 2HF5A 1SK6D 4XYNA 2PVBA 2HQ8A 1CTRA 4A4BA 1XFWO 1UHHA 5HYDA 2ZNDA 4HREE 3SG4A 3ZNIA 4M2OA 4MZLA 3KPXA 2L98A 4YGCB 2LHIA 1LVCD 1LKJA 1TCFA 1S6JA 1S3PA 1G4YR 1DJZA 3E3RA 1MR8A 5AANA 4MRYA 4PDZA 2HPSA 1QX2A 1UHKA 3BOWB 2K7CA 2LLTA 5B8IB 3WHTB 2OS8B 3QRXA 1CFDA 2LVJA 1DMOA 1MUXA 1KFXS 3I5HB 4YGBB 1QX7A 2GGZA 2KDHA 3C1VA 1K8UA 2K7BA 1ODBA 3ICBA 3I5IB 4XJKB 2JNFA 1BT6A 1CDMA 1Y0VH 4GUKA 4A4CA 3F45A 1TRFA 1DF0A 2BKIB 2L51A 3EKHA 3TDUA 2CCMA 5I8NA 1B4CA 1ALWA 1A75B 1CLLA 4QJ4B 3JVTC 3KEVA 1YTZC 3CR4X 1QV0A 5ER5A 5G08A 2HQWA 2JXCA 2LMUA 2KNEA 2LUCA 5CPVA 5BPJA 3PN7B 1TTXA 2KYCA 2BE4A 3CR5X 5KTYA 1BODA 1OE9B 3CTNA 3SG2A 2JXLA 2K7OA 1XFZO 1S6IA 2L50A 3EKJA 1YX7A 4MRXA 1RTP1 1XK4A 2NZ0A 4MZJA 1C7WA 1K94A 3MSEB 1NX1A 3SG3A 1CLMA 3PFVA 2G2BA 1CFCA 2NXQA 1C07A 2BL0C 1N0YA 1KSMA 1X02A 1RFJA 1SPYA 2FCDA 3JTDB 2MLEC 1BR4B 4ORBB 1ZMZA 4HRGA 4GNKB 5TNCA 1H4BA 2KFGA 2WCFA 2ZN8A 2EC6B 1RJVA 4DCKA 1Y1AA 3CGAA 3DD4A 1Y1XA 1TNXA 1K9KA 3PALA 1UP5A 1QXPA 1TN4A 2M1KB 1PRWA 2RGIA 3PSRA 4USLA 1PSRA 3I5GB 2BECA 3VROA 1KQVA 1OMDA 2KYFA 4JPZB 3TS5B 1K2HA 1IGVA 1B8CA 1NX2A 3PLFB 4MVFA 4NQGA 2LC5A 4M2PA 1JFKA 1MXLC 1Y1UA 2L4IA 4PHJA 1YX8A 2K8MB 2WOSA 4DRWA 1EG3A 1KFXL 1FBVA 1F55A 2LVIA 1XVJA 1TNPA 2KHNA 2PALA 2ZKMX 2LVVA 1BLQA 1XO5A 3CLNA 3TDIA 2L0PA 2MAZA 2PSRA 3OHMB 2F3ZA 1OMRA 1SMGA 2CT9A 4JQ0D 1UHNA 2AUCA 3IQQA 4HRHA 4DUQA 2KGRA 4E68A 1V1GA 1J1EA 1IQ3A 1CMFA 2WCEA 2M9GA 1QIVA 5CSJA 1KWOB 5AFPA 1F71A 2OPOA 2GGMA 3EVRA 4JWQA 1XFYO 2F2OA 1UWOA 2JNXA 1AUIB 1LXFC 2WCBA 4CPVA 3O78A 1QASA 2HETA 3BYAA 2KFFA 4HSZA 5AXIA 1NUBA 4P5OE 2LCPA 3WHUB 1B7TY 1BU3A 1IQ5A 4YI8A 4CIDA 1MQ1A 1WRLA 4PE0A 4F0ZB 1NIWA 4OVNF 1BMOA 1K90D 2F33A 2M1UA 1IRJA 5I2LA 4GPLB 1IJ5A 1KSOA 1DF0B 1QLKA 3BUNB 4FQOA 1SL9A 4ZCVA 1RK9A 1YVLA 4C0KA 2KOTA 5DKQA 1K93D 3IQOA 3D0YA 3H4SE 1S5GY 4DIRA 1SCMC 3FWCA 4QJ5B 3OX6A 1FI6A 2FJUB 3LCPC 3SIBA 3SG7A 1N2DA 2NLNA 1YURA 1BOCA 3D10A 4PE7A 1WDCC 4D1EA 2NCOA 5K89A 2VRGA 3DVMA 1A2XA 4I5JA 1ALVA 2KGBC 1B9AA 2KAYA 3CWGA 2R2IA 1SNLA 1E8AA 1NCYA 5PALA 1A03A 1C7VA 1QV1A 3KF9A 2JPTA 4PHMA 3TUYC 1KK8B 1J1DA 1F4QA 1NX0A 2JQ6A 1FI5A 1KQMC 5JOLA 2M29A 1Y6WA 2TN4A 2MJWB 2SCPA 1QLSA 3K21A 4P2YB 1XFVO 1S26D 2M0RA 1FF1A 1QVIY 3O6BA 2ZN9A 4YI9A 1K95A 1F4OA 3I5FC 1U5IA 1W7JB 1CDPA 3BUWB 3GK2A 1GQMA 1OZOA 1Q80A 4ORAB 2ZRTA 1F8HA 1NWDA 2PASA 4CFQA 5HLOA 1GGZA 2LP2A 4PHNA 1S5GZ 2BCBA 3IF7A 4MSPA 3NSOA 1JF2A 2KI6C 1UUSA 2DOQA 2EHBA 2L5XB 1M63B 1SCVA 1BF5A 2JU0A 1AVSA 1NP8A 2H61A 3CZTX 1CNPA 4L9MA 5J3XA 1CFPA 4N1GA 2CBLA 2KBIA 1XFXO 2H61C 3AKBA 2KFHA 2JRFA 2ZFDA 1L2OB 2JULA 1FPWA 1F70A 3LL8B 1TIZA 1OMVA 1DVIA 1CM4A 5CSFA 1EH2A 4PCWA 1RECA 1DJWA 1TNQA 2V53A 2KI4B 5I2QA 5CSNA 3OB2B 2BCXA 4N1FA 2K0JA 1AJ4A 3AAJA 2JWWA 2M7LA 1RWYA 1UHIA 1D1OA 1DJHA 4MZKA 2CXJA 2D8NA 4FTGA 1R2UA 1JFJA 5HKWA 3NSKA 4YGAA 3VRNA 1XYDA 1NSHA 1YUTA 2OS8C 2JT0A 1SCMB 4ZCUA 2E6WA 2LP3A 1DGVA 2PMYA 3LLEA 1SBJA 3TDZA 1QATA 1ZOTB 3WXAA 3D0YB 2Q4UA 1AJ5A 4GGFC 1S1EA 2Y5IA 1JSAA 1G8IA 2K2AA 1J55A 1SL7A 3BUMB 3NXAA 2LVKA 3GOFA 4PALA 5AERA 3DVKA 1ZUZA 3I5IC 1IKUA 2JT8A 2LUXA 1MF8B 1DJXA 4NDCA 1SR6C 2NCPA 4PE1A 3A4UB 2FCEA 2EGDA 3PATA 3SJSA 4YGEB 2O60A 5HKYA 4YGDB
chains in the Genus database with same CATH superfamily
4M2QA 1ZFSA 1S36A 3HCMA 4WQ2A 2LM5A 2A4JA 1DJIA 1NCXA 1QIWA 3O2PA 3PN7C 1QTXA 1XA5A 4MLWA 1K9UA 3S0BA 3DVJA 4ETOA 2JOJA 4IL1A 3OP0A 2ZRSA 2O5GA 1SY9A 3M0WA 2KLDA 1VRKA 3EK8A 3CS1A 1FW4A 1QS7A 2MHHA 3JVTB 4QJ3B 4OKHA 1KCYA 4TNCA 5HLVA 3VGOA 5KU1A 3S0DA 1J7OA 2COLB 5D7FA 5FI6A 1QX5B 2MBXA 2LNKA 1MHOA 1V1FA 4AQIA 1OOFA 4GFTA 3RZSA 4C0LA 1CB1A 1U5IB 3DF0A 3BUOB 2Y4QA 2F3YA 4PHKA 4Q04A 1CFFA 4R1EA 2P70A 4GBAA 1CDLA 1WY9A 3DXLA 1JWDA 1QJTA 2KBMA 2KAXA 1K9PA 1YUSA 2LANA 3GK1A 2BE6A 1NX3A 1DT7B 1A29A 3TZ1A 1JC2A 1CDNA 3EVUA 1YRTB 1GJYA 3EVVA 1PVAA 4DS7A 2BL0B 1AP4A 1B8LA 1EL4A 3I5GC 1J7RA 2GTEA 5ER4X 1J7PA 1SYMA 4YBHB 3TS5C 1B8RA 3WNXB 2F2PA 3N7HA 1JBAA 1WLMA 1HQVA 1BR1B 1PVBA 2QACA 1WRKA 1IWQA 2LLUA 5FYXA 1OZSA 3VRPA 2PRUA 3BQ3A 2JTTA 1B7TZ 1M31A 1UHJA 2M97A 2F8PA 1NPQA 1OSAA 1M39A 1BG1A 3BJHA 1WRZA 4I5LB 3NSIA 1H8BA 2ZNEA 2YGUA 1B47A 3VRRA 2H2KA 2QEVA 4NDBA 1PSBA 4I5KA 4OV2A 4C0JA 1R6PA 2K2FA 2LMVA 5CSIA 1KFUL 3UO9A 1EG4A 1PK0D 5GQQC 1LINA 1KWOC 1W7IB 3FWBA 2Y1MA 1UURA 2P71A 3SIAA 1AK8A 1CKKA 2OTGC 2WCLA 4BY5A 2G9BA 1YVHA 1XFUO 3SS4A 1DJYA 1WLZA 2CNPA 3NHIA 2L4HA 2Y1NA 4GAOA 2K7DA 1BJFA 1MXEA 3OB1B 2KQYA 1LA0A 3D75A 1SR6B 1NCZA 2L2CA 2ISDA 3O4YA 1IJ6A 2E30A 3OX5A 4ICBA 1AHRA 1TOPA 1K96A 2LE9B 2Q91A 4FQTA 3RM1A 2BBMA 1DGUA 1TUZA 3BXKA 4GGNA 4OCIA 5AEQA 4F7FA 1A4PA 1DJGA 2L2EA 5D69A 1SL8A 2I18A 2M7NA 3SS5A 3LK0A 1JUOA 1PULA 2M49B 2MA2A 4U8DA 1KK7Y 3EK4A 3PM8A 4PE4A 2MRDA 2WNDA 1QVIZ 2WC8A 2M3WA 3BOWA 1YUUA 1JF0A 4MBEA 4WRIA 3SG5A 3KO0A 1XK4C 4AQJA 2GV5A 2PYQA 2AMIA 3LK1A 5HKZA 4BY4A 1IQ3A 5DKRA 3R72A 2AAOA 2LHLA 1M46A 2B1UA 2KQ6A 3SS3A 2I2RE 1LA3A 1M45A 2MLFC 4GGFA 1CM1A 3SG6A 4MN0A 4WQ3A 3AKAA 3K1EA 3DF0B 1EJ3A 1KK8C 2KSPA 2M8UA 4XJKA 5F6TA 1RROA 5KSZA 3I5HC 2LMTA 5I94A 1WDCB 1L7ZA 1SKTA 1GGWA 5I2OA 5DKNA 1A75A 2SASA 1ZACA 2BAPA 4KYNA 3PM2A 1EXRA 5IBWA 2BBNA 1NYAA 2KLEA 3BFBA 3NHTA 1OW4A 1KFUS 2WCMA 1TNWA 3PJIA 3FS7A 4YRUA 3TUYB 1F54A 4N5XA 3DVEA 4MEWA 4CLNA 4UPGA 1N65A 3AAKA 1PALA 3NSLA 3KHEA 3CR2A 5DICA 3FE9A 1KQMB 4AOMA 3VRQA 1B1GA 2FOTA 1TCOB 4CFRA 3GK4X 2JZIA 3EK7A 3FIAA 3VB1A 2KAVA 1SW8A 3BUXB 2JTZA 2K61A 3DY9A 3I5FB 1KK7Z 1S6CA 2I94A 4ORCB 2BKHB 1YR5A 2P6BB 2LAPA 2KPHA 5JJGA 2CTNA 2QPTA 4NDDA 2JC2A 4OR9B 3S0AA 3V2LA 3S0GA 2I7AA 3S0FA 1CLBA 1OOJA 1HT9A 3FE8A 1MWNA 2LLSA 3HX4A 1L2OC 2LV7A 2JT3A 3D78A 1OQPA 1W9ZA 2OTGB 2BNXA 3JTDC 3A8RA 3L4LA 4I5NB 2IS9A 3B86A 1DTLA 1J7QA 2EC6C 1IG5A 2KI4C 3RLZA 2KI6D 1SRAA 1G33A 1CMGA 3EG5B 1YRUB 2BCAA 2WORA 3ZWHA 2HF5A 1SK6D 4XYNA 2PVBA 2HQ8A 1CTRA 4A4BA 1XFWO 1UHHA 5HYDA 2ZNDA 4HREE 3SG4A 3ZNIA 4M2OA 4MZLA 3OGNA 3KPXA 2L98A 4YGCB 2LHIA 1LVCD 1LKJA 1TCFA 3CDNA 2WCJA 1S6JA 1S3PA 1G4YR 1DJZA 2QEOA 3E3RA 1MR8A 1XFRA 5AANA 4MRYA 4PDZA 2HPSA 1QX2A 1UHKA 3BOWB 2K7CA 2LLTA 5B8IB 3WHTB 2OS8B 3QRXA 3L4AA 1CFDA 2LVJA 3DZTA 1DMOA 1MUXA 1KFXS 3I5HB 4YGBB 1QX7A 2GGZA 2KDHA 3C1VA 1K8UA 2K7BA 1ODBA 3ICBA 3I5IB 4XJKB 2JNFA 1BT6A 3CZ2A 1CDMA 1Y0VH 4GUKA 4A4CA 3F45A 1TRFA 1DF0A 2BKIB 2L51A 3EKHA 3TDUA 2CCMA 5I8NA 1B4CA 1ALWA 1A75B 1CLLA 4QJ4B 3JVTC 3KEVA 1YTZC 2QEHA 1QV0A 3CR4X 5ER5A 5FI2A 2HQWA 2JXCA 5G08A 2LMUA 2KNEA 2LUCA 5CPVA 5BPJA 3PN7B 1TTXA 2KYCA 2BE4A 3CR5X 3Q8IA 1A03A 5KTYA 1BODA 1OE9B 3CTNA 3SG2A 2JXLA 1OOGA 2K7OA 1XFZO 1S6IA 2L50A 3EKJA 1YX7A 4MRXA 1RTP1 1XK4A 2NZ0A 4MZJA 1C7WA 1K94A 3MSEB 1NX1A 1C3YA 3SG3A 1CLMA 3PFVA 2G2BA 2WCHA 1CFCA 1IH0A 2NXQA 1C07A 2BL0C 1N0YA 1KSMA 1X02A 4JKTA 1RFJA 1SPYA 2WC5A 2FCDA 3JTDB 2MLEC 1BR4B 4ORBB 1DELA 1ZMZA 4HRGA 5HL1A 4GNKB 5TNCA 1H4BA 2KFGA 2WCFA 2ZN8A 2EC6B 1RJVA 4DCKA 1Y1AA 3CGAA 3DD4A 3NGVA 1Y1XA 1TNXA 1C3ZA 1K9KA 3PALA 1UP5A 1QXPA 1TN4A 2M1KB 1PRWA 2RGIA 3PSRA 4USLA 1ORGA 1PSRA 2BECA 3I5GB 3VROA 1KQVA 1OMDA 2KYFA 4JPZB 3TS5B 1K2HA 1IGVA 1B8CA 1NX2A 3D74A 3PLFB 3IVTA 4MVFA 4NQGA 2LC5A 4M2PA 1JFKA 1MXLC 3BFHA 1Y1UA 2L4IA 2WC6A 4PHJA 1YX8A 2K8MB 3DYEA 1P28A 2WOSA 4DRWA 1EG3A 1KFXL 1FBVA 2FJYA 3O4XA 1F55A 2LVIA 1XVJA 1TNPA 2KHNA 2PALA 2ZKMX 2LVVA 1BLQA 1XO5A 3CLNA 3FE6A 3TDIA 2L0PA 2MAZA 2PSRA 3OHMB 2F3ZA 1OMRA 1SMGA 2CT9A 4JQ0D 1UHNA 2AUCA 3IQQA 4HRHA 3B6XA 2KGRA 3B87A 1V1GA 1J1EA 4DUQA 4E68A 1CMFA 2WCEA 2M9GA 1QIVA 5CSJA 1KWOB 5AFPA 1F71A 2OPOA 2GGMA 3D77A 3EVRA 1XFYO 4JWQA 2F2OA 1UWOA 2JNXA 1AUIB 1LXFC 2WCBA 4CPVA 3O78A 1QASA 2HETA 3BYAA 2KFFA 4HSZA 5AXIA 1NUBA 4P5OE 2LCPA 4INXA 3WHUB 1B7TY 3D73A 1BU3A 1IQ5A 4YI8A 5EL2A 4CIDA 1MQ1A 1DEKA 1WRLA 4PE0A 4F0ZB 1NIWA 3UNWA 4OVNF 1BMOA 1K90D 2F33A 2M1UA 1IRJA 3CABA 3OBVA 4GPLB 5I2LA 1T14A 1IJ5A 1DC1A 1LS8A 1KSOA 1DF0B 1QLKA 3BUNB 3CZ0A 3S0EA 1Z4HA 3QMEA 4FQOA 1SL9A 4ZCVA 1RK9A 1YVLA 4C0KA 2JPOA 2KOTA 5DKQA 1K93D 3IQOA 3D0YA 3H4SE 1S5GY 4DIRA 1SCMC 3FWCA 4QJ5B 3OX6A 1FI6A 2FJUB 3LCPC 3SIBA 4PT1A 3SG7A 1N2DA 1TWOA 2NLNA 1YURA 1BOCA 1DQEA 1QWVA 3BFAA 3D10A 4PE7A 1WDCC 4D1EA 2NCOA 5K89A 2VRGA 3DVMA 2PQLA 3R1OA 1A2XA 4I5JA 1ALVA 2KGBC 1B9AA 2KAYA 3CWGA 2R2IA 1SNLA 1E8AA 1NCYA 2K60A 5PALA 1C7VA 3R1VA 1QV1A 3KF9A 2JPTA 4PHMA 3TUYC 1KK8B 1J1DA 1F4QA 1NX0A 2JQ6A 1FI5A 1KQMC 5JOLA 2M29A 1Y6WA 2TN4A 3B7AA 2MJWB 2SCPA 1QLSA 3K21A 3B88A 4P2YB 1XFVO 1S26D 2M0RA 1FF1A 1QVIY 1SSEB 3O6BA 2ZN9A 4YI9A 1K95A 1F4OA 3I5FC 1U5IA 1W7JB 1CDPA 3BUWB 3GK2A 1GQMA 1OZOA 1Q80A 4ORAB 2ZRTA 2L5YA 1F8HA 1NWDA 2PASA 4CFQA 5HLOA 1GGZA 1OOIX 5FI7A 2LP2A 2QDIA 4PHNA 1S5GZ 2BCBA 3IF7A 4MSPA 3NSOA 1JF2A 2KI6C 1UUSA 1TUJA 2DOQA 2EHBA 2L5XB 1M63B 1SCVA 1BF5A 2H8VA 1AVSA 1NP8A 2H61A 2JU0A 3CZTX 1CNPA 4L9MA 5J3XA 1CFPA 4N1GA 2CBLA 2KBIA 4JD9A 1XFXO 2H61C 3AKBA 2KFHA 2JRFA 2ZFDA 1L2OB 3L47A 2JULA 1FPWA 1IIOA 1F70A 2QEBA 3LL8B 1TIZA 1OMVA 1DVIA 1CM4A 5CSFA 1EH2A 4PCWA 1RECA 1DJWA 1TNQA 2V53A 2KI4B 5I2QA 5CSNA 3OB2B 2BCXA 4N1FA 2K0JA 1AJ4A 3AAJA 2JWWA 2M7LA 2ERBA 1RWYA 3D76A 1UHIA 1D1OA 2WCKA 1DJHA 3CZ1A 4MZKA 2CXJA 3R1PA 2D8NA 4FTGA 4IJ7A 1R2UA 1JFJA 5HKWA 3NSKA 4YGAA 3VRNA 1XYDA 3CYZA 1NSHA 1YUTA 2OS8C 2JT0A 1GM0A 1SCMB 4ZCUA 2E6WA 2LP3A 1DGVA 2PMYA 3LLEA 1SBJA 5D3OA 1QATA 3TDZA 1ZOTB 4OZDA 3WXAA 1OOHA 3D0YB 2Q4UA 1AJ5A 4GGFC 1S1EA 2Y5IA 1JSAA 1G8IA 2K2AA 1J55A 1SL7A 3BUMB 3NXAA 2LVKA 3GOFA 4PALA 5AERA 3DVKA 1ZUZA 3I5IC 1IKUA 2JT8A 2LUXA 1MF8B 1DJXA 4NDCA 1SR6C 2NCPA 4PE1A 3A4UB 2FCEA 2EGDA 3PATA 3SJSA 1Z2CB 4YGEB 2O60A 5HKYA 4INWA 4YGDB
chains in the Genus database with same CATH topology
4M2QA 1ZFSA 1S36A 3HCMA 4WQ2A 2LM5A 2A4JA 1DJIA 1NCXA 1QIWA 3O2PA 3PN7C 1QTXA 1XA5A 4MLWA 1K9UA 4ETOA 3DVJA 2JOJA 4IL1A 3OP0A 2ZRSA 2O5GA 1SY9A 3M0WA 1VRKA 3EK8A 3CS1A 1FW4A 1QS7A 2MHHA 3JVTB 4QJ3B 4OKHA 1KCYA 4TNCA 5HLVA 3VGOA 5KU1A 1J7OA 2COLB 5D7FA 2MBXA 1QX5B 2LNKA 1MHOA 1V1FA 4AQIA 4GFTA 4C0LA 1CB1A 1U5IB 3DF0A 3BUOB 2Y4QA 2F3YA 4PHKA 4Q04A 1CFFA 4R1EA 4GBAA 1CDLA 1WY9A 1JWDA 1QJTA 2KBMA 2KAXA 1K9PA 1YUSA 2LANA 3GK1A 2BE6A 1NX3A 1DT7B 1A29A 3TZ1A 1JC2A 1CDNA 3EVUA 1YRTB 1GJYA 3EVVA 1PVAA 4DS7A 2BL0B 1AP4A 1B8LA 1EL4A 3I5GC 1J7RA 5ER4X 1J7PA 1SYMA 4YBHB 3TS5C 1B8RA 3WNXB 2F2PA 1JBAA 1WLMA 1HQVA 1BR1B 1PVBA 2QACA 1WRKA 1IWQA 2LLUA 5FYXA 1OZSA 3VRPA 2PRUA 3BQ3A 2JTTA 1B7TZ 1M31A 1UHJA 2M97A 2F8PA 1NPQA 1OSAA 1M39A 1BG1A 4I5LB 1WRZA 1IH0A 3NSIA 1H8BA 2ZNEA 1B47A 3VRRA 2H2KA 4NDBA 1PSBA 4I5KA 4OV2A 4C0JA 1R6PA 2K2FA 2LMVA 5CSIA 1KFUL 1EG4A 1PK0D 5GQQC 1LINA 1KWOC 1W7IB 3FWBA 2Y1MA 1UURA 1AK8A 3SIAA 1CKKA 2OTGC 4BY5A 2G9BA 1YVHA 1XFUO 1DJYA 1WLZA 2CNPA 2L4HA 2Y1NA 4GAOA 2K7DA 1BJFA 1MXEA 3OB1B 2KQYA 1LA0A 1SR6B 1NCZA 2ISDA 3O4YA 1IJ6A 2E30A 3OX5A 4ICBA 1AHRA 1TOPA 1K96A 2LE9B 2Q91A 3RM1A 2BBMA 1DGUA 4OCIA 3BXKA 4GGNA 5AEQA 1A4PA 1DJGA 2L2EA 5D69A 1SL8A 2I18A 2M7NA 3LK0A 1JUOA 1PULA 2M49B 2MA2A 4U8DA 1KK7Y 3EK4A 3PM8A 4PE4A 2MRDA 2WNDA 1QVIZ 2WC8A 2M3WA 3BOWA 1YUUA 1JF0A 4MBEA 4WRIA 3SG5A 3KO0A 1XK4C 4AQJA 2GV5A 2AMIA 3LK1A 5HKZA 4BY4A 5DKRA 2AAOA 2LHLA 1M46A 2B1UA 2KQ6A 2I2RE 1LA3A 1M45A 2MLFC 4GGFA 1CM1A 3SG6A 4MN0A 4WQ3A 3AKAA 3DF0B 1EJ3A 1KK8C 2KSPA 2M8UA 4XJKA 5F6TA 1RROA 5KSZA 3I5HC 2LMTA 1WDCB 1L7ZA 1SKTA 1GGWA 5I2OA 5DKNA 1A75A 2SASA 1ZACA 1EXRA 5IBWA 2BBNA 1NYAA 1KFUS 1TNWA 3FS7A 4YRUA 3TUYB 1F54A 4N5XA 3DVEA 4MEWA 4CLNA 4UPGA 1N65A 3AAKA 1PALA 3NSLA 3KHEA 3CR2A 4AOMA 1B1GA 1KQMB 3VRQA 2FOTA 1TCOB 4CFRA 3GK4X 2JZIA 3EK7A 3FIAA 2KAVA 1SW8A 3BUXB 2JTZA 2K61A 3I5FB 1KK7Z 1S6CA 2I94A 4ORCB 2BKHB 1YR5A 2P6BB 2LAPA 5JJGA 2CTNA 2QPTA 4NDDA 2JC2A 4OR9B 2I7AA 1CLBA 1OOJA 1HT9A 1MWNA 2LLSA 3HX4A 1L2OC 2LV7A 2JT3A 1OQPA 2OTGB 3JTDC 3A8RA 4I5NB 2IS9A 1DTLA 1J7QA 2EC6C 1IG5A 2KI4C 3RLZA 2KI6D 1SRAA 1G33A 1CMGA 1YRUB 2BCAA 2WORA 3ZWHA 2HF5A 1SK6D 4XYNA 2PVBA 2HQ8A 1CTRA 4A4BA 1XFWO 1UHHA 5HYDA 2ZNDA 4HREE 3SG4A 3ZNIA 4M2OA 4MZLA 3KPXA 2L98A 4YGCB 2LHIA 1LVCD 1LKJA 1TCFA 1S6JA 1S3PA 1G4YR 1DJZA 3E3RA 1MR8A 5AANA 4MRYA 4PDZA 2HPSA 1QX2A 1UHKA 3BOWB 2K7CA 2LLTA 5B8IB 3WHTB 2OS8B 3QRXA 1CFDA 2LVJA 1DMOA 1MUXA 1KFXS 3I5HB 4YGBB 1QX7A 2GGZA 2KDHA 3C1VA 1K8UA 2K7BA 1ODBA 3ICBA 3I5IB 4XJKB 2JNFA 1BT6A 1CDMA 1Y0VH 4GUKA 4A4CA 3F45A 1TRFA 1DF0A 2BKIB 2L51A 3EKHA 3TDUA 2CCMA 5I8NA 1B4CA 1ALWA 1A75B 1CLLA 4QJ4B 3JVTC 3KEVA 1YTZC 3CR4X 1QV0A 5ER5A 5G08A 2HQWA 2JXCA 2LMUA 2KNEA 2LUCA 5CPVA 5BPJA 3PN7B 1TTXA 2KYCA 2BE4A 3CR5X 5KTYA 1BODA 1OE9B 3CTNA 3SG2A 2JXLA 2K7OA 1XFZO 1S6IA 2L50A 3EKJA 1YX7A 4MRXA 1RTP1 1XK4A 2NZ0A 4MZJA 1C7WA 1K94A 3MSEB 1NX1A 3SG3A 1CLMA 3PFVA 2G2BA 1CFCA 2NXQA 1C07A 2BL0C 1N0YA 1KSMA 1X02A 1RFJA 1SPYA 2FCDA 3JTDB 2MLEC 1BR4B 4ORBB 1ZMZA 4HRGA 4GNKB 5TNCA 1H4BA 2KFGA 2WCFA 2ZN8A 2EC6B 1RJVA 4DCKA 1Y1AA 3CGAA 3DD4A 1Y1XA 1TNXA 1K9KA 3PALA 1UP5A 1QXPA 1TN4A 2M1KB 1PRWA 2RGIA 3PSRA 4USLA 1PSRA 3I5GB 2BECA 3VROA 1KQVA 1OMDA 2KYFA 4JPZB 3TS5B 1K2HA 1IGVA 1B8CA 1NX2A 3PLFB 4MVFA 4NQGA 2LC5A 4M2PA 1JFKA 1MXLC 1Y1UA 2L4IA 4PHJA 1YX8A 2K8MB 2WOSA 4DRWA 1EG3A 1KFXL 1FBVA 1F55A 2LVIA 1XVJA 1TNPA 2KHNA 2PALA 2ZKMX 2LVVA 1BLQA 1XO5A 3CLNA 3TDIA 2L0PA 2MAZA 2PSRA 3OHMB 2F3ZA 1OMRA 1SMGA 2CT9A 4JQ0D 1UHNA 2AUCA 3IQQA 4HRHA 4DUQA 2KGRA 4E68A 1V1GA 1J1EA 1IQ3A 1CMFA 2WCEA 2M9GA 1QIVA 5CSJA 1KWOB 5AFPA 1F71A 2OPOA 2GGMA 3EVRA 4JWQA 1XFYO 2F2OA 1UWOA 2JNXA 1AUIB 1LXFC 2WCBA 4CPVA 3O78A 1QASA 2HETA 3BYAA 2KFFA 4HSZA 5AXIA 1NUBA 4P5OE 2LCPA 3WHUB 1B7TY 1BU3A 1IQ5A 4YI8A 4CIDA 1MQ1A 1WRLA 4PE0A 4F0ZB 1NIWA 4OVNF 1BMOA 1K90D 2F33A 2M1UA 1IRJA 5I2LA 4GPLB 1IJ5A 1KSOA 1DF0B 1QLKA 3BUNB 4FQOA 1SL9A 4ZCVA 1RK9A 1YVLA 4C0KA 2KOTA 5DKQA 1K93D 3IQOA 3D0YA 3H4SE 1S5GY 4DIRA 1SCMC 3FWCA 4QJ5B 3OX6A 1FI6A 2FJUB 3LCPC 3SIBA 3SG7A 1N2DA 2NLNA 1YURA 1BOCA 3D10A 4PE7A 1WDCC 4D1EA 2NCOA 5K89A 2VRGA 3DVMA 1A2XA 4I5JA 1ALVA 2KGBC 1B9AA 2KAYA 3CWGA 2R2IA 1SNLA 1E8AA 1NCYA 5PALA 1A03A 1C7VA 1QV1A 3KF9A 2JPTA 4PHMA 3TUYC 1KK8B 1J1DA 1F4QA 1NX0A 2JQ6A 1FI5A 1KQMC 5JOLA 2M29A 1Y6WA 2TN4A 2MJWB 2SCPA 1QLSA 3K21A 4P2YB 1XFVO 1S26D 2M0RA 1FF1A 1QVIY 3O6BA 2ZN9A 4YI9A 1K95A 1F4OA 3I5FC 1U5IA 1W7JB 1CDPA 3BUWB 3GK2A 1GQMA 1OZOA 1Q80A 4ORAB 2ZRTA 1F8HA 1NWDA 2PASA 4CFQA 5HLOA 1GGZA 2LP2A 4PHNA 1S5GZ 2BCBA 3IF7A 4MSPA 3NSOA 1JF2A 2KI6C 1UUSA 2DOQA 2EHBA 2L5XB 1M63B 1SCVA 1BF5A 2JU0A 1AVSA 1NP8A 2H61A 3CZTX 1CNPA 4L9MA 5J3XA 1CFPA 4N1GA 2CBLA 2KBIA 1XFXO 2H61C 3AKBA 2KFHA 2JRFA 2ZFDA 1L2OB 2JULA 1FPWA 1F70A 3LL8B 1TIZA 1OMVA 1DVIA 1CM4A 5CSFA 1EH2A 4PCWA 1RECA 1DJWA 1TNQA 2V53A 2KI4B 5I2QA 5CSNA 3OB2B 2BCXA 4N1FA 2K0JA 1AJ4A 3AAJA 2JWWA 2M7LA 1RWYA 1UHIA 1D1OA 1DJHA 4MZKA 2CXJA 2D8NA 4FTGA 1R2UA 1JFJA 5HKWA 3NSKA 4YGAA 3VRNA 1XYDA 1NSHA 1YUTA 2OS8C 2JT0A 1SCMB 4ZCUA 2E6WA 2LP3A 1DGVA 2PMYA 3LLEA 1SBJA 3TDZA 1QATA 1ZOTB 3WXAA 3D0YB 2Q4UA 1AJ5A 4GGFC 1S1EA 2Y5IA 1JSAA 1G8IA 2K2AA 1J55A 1SL7A 3BUMB 3NXAA 2LVKA 3GOFA 4PALA 5AERA 3DVKA 1ZUZA 3I5IC 1IKUA 2JT8A 2LUXA 1MF8B 1DJXA 4NDCA 1SR6C 2NCPA 4PE1A 3A4UB 2FCEA 2EGDA 3PATA 3SJSA 4YGEB 2O60A 5HKYA 4YGDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2Q A;  1ZFS A;  1S36 A;  3HCM A;  4WQ2 A;  2LM5 A;  2A4J A;  1DJI A;  1NCX A;  1QIW A;  3O2P A;  3PN7 C;  1QTX A;  1XA5 A;  4MLW A;  1K9U A;  4ETO A;  3DVJ A;  2JOJ A;  4IL1 A;  3OP0 A;  2ZRS A;  2O5G A;  1SY9 A;  3M0W A;  1VRK A;  3EK8 A;  3CS1 A;  1FW4 A;  1QS7 A;  2MHH A;  3JVT B;  4QJ3 B;  4OKH A;  1KCY A;  4TNC A;  5HLV A;  3VGO A;  5KU1 A;  1J7O A;  2COL B;  5D7F A;  2MBX A;  1QX5 B;  2LNK A;  1MHO A;  1V1F A;  4AQI A;  4GFT A;  4C0L A;  1CB1 A;  1U5I B;  3DF0 A;  3BUO B;  2Y4Q A;  2F3Y A;  4PHK A;  4Q04 A;  1CFF A;  4R1E A;  4GBA A;  1CDL A;  1WY9 A;  1JWD A;  1QJT A;  2KBM A;  2KAX A;  1K9P A;  1YUS A;  2LAN A;  3GK1 A;  2BE6 A;  1NX3 A;  1DT7 B;  1A29 A;  3TZ1 A;  1JC2 A;  1CDN A;  3EVU A;  1YRT B;  1GJY A;  3EVV A;  1PVA A;  4DS7 A;  2BL0 B;  1AP4 A;  1B8L A;  1EL4 A;  3I5G C;  1J7R A;  5ER4 X;  1J7P A;  1SYM A;  4YBH B;  3TS5 C;  1B8R A;  3WNX B;  2F2P A;  1JBA A;  1WLM A;  1HQV A;  1BR1 B;  1PVB A;  2QAC A;  1WRK A;  1IWQ A;  2LLU A;  5FYX A;  1OZS A;  3VRP A;  2PRU A;  3BQ3 A;  2JTT A;  1B7T Z;  1M31 A;  1UHJ A;  2M97 A;  2F8P A;  1NPQ A;  1OSA A;  1M39 A;  1BG1 A;  4I5L B;  1WRZ A;  1IH0 A;  3NSI A;  1H8B A;  2ZNE A;  1B47 A;  3VRR A;  2H2K A;  4NDB A;  1PSB A;  4I5K A;  4OV2 A;  4C0J A;  1R6P A;  2K2F A;  2LMV A;  5CSI A;  1KFU L;  1EG4 A;  1PK0 D;  5GQQ C;  1LIN A;  1KWO C;  1W7I B;  3FWB A;  2Y1M A;  1UUR A;  1AK8 A;  3SIA A;  1CKK A;  2OTG C;  4BY5 A;  2G9B A;  1YVH A;  1XFU O;  1DJY A;  1WLZ A;  2CNP A;  2L4H A;  2Y1N A;  4GAO A;  2K7D A;  1BJF A;  1MXE A;  3OB1 B;  2KQY A;  1LA0 A;  1SR6 B;  1NCZ A;  2ISD A;  3O4Y A;  1IJ6 A;  2E30 A;  3OX5 A;  4ICB A;  1AHR A;  1TOP A;  1K96 A;  2LE9 B;  2Q91 A;  3RM1 A;  2BBM A;  1DGU A;  4OCI A;  3BXK A;  4GGN A;  5AEQ A;  1A4P A;  1DJG A;  2L2E A;  5D69 A;  1SL8 A;  2I18 A;  2M7N A;  3LK0 A;  1JUO A;  1PUL A;  2M49 B;  2MA2 A;  4U8D A;  1KK7 Y;  3EK4 A;  3PM8 A;  4PE4 A;  2MRD A;  2WND A;  1QVI Z;  2WC8 A;  2M3W A;  3BOW A;  1YUU A;  1JF0 A;  4MBE A;  4WRI A;  3SG5 A;  3KO0 A;  1XK4 C;  4AQJ A;  2GV5 A;  2AMI A;  3LK1 A;  5HKZ A;  4BY4 A;  5DKR A;  2AAO A;  2LHL A;  1M46 A;  2B1U A;  2KQ6 A;  2I2R E;  1LA3 A;  1M45 A;  2MLF C;  4GGF A;  1CM1 A;  3SG6 A;  4MN0 A;  4WQ3 A;  3AKA A;  3DF0 B;  1EJ3 A;  1KK8 C;  2KSP A;  2M8U A;  4XJK A;  5F6T A;  1RRO A;  5KSZ A;  3I5H C;  2LMT A;  1WDC B;  1L7Z A;  1SKT A;  1GGW A;  5I2O A;  5DKN A;  1A75 A;  2SAS A;  1ZAC A;  1EXR A;  5IBW A;  2BBN A;  1NYA A;  1KFU S;  1TNW A;  3FS7 A;  4YRU A;  3TUY B;  1F54 A;  4N5X A;  3DVE A;  4MEW A;  4CLN A;  4UPG A;  1N65 A;  3AAK A;  1PAL A;  3NSL A;  3KHE A;  3CR2 A;  4AOM A;  1B1G A;  1KQM B;  3VRQ A;  2FOT A;  1TCO B;  4CFR A;  3GK4 X;  2JZI A;  3EK7 A;  3FIA A;  2KAV A;  1SW8 A;  3BUX B;  2JTZ A;  2K61 A;  3I5F B;  1KK7 Z;  1S6C A;  2I94 A;  4ORC B;  2BKH B;  1YR5 A;  2P6B B;  2LAP A;  5JJG A;  2CTN A;  2QPT A;  4NDD A;  2JC2 A;  4OR9 B;  2I7A A;  1CLB A;  1OOJ A;  1HT9 A;  1MWN A;  2LLS A;  3HX4 A;  1L2O C;  2LV7 A;  2JT3 A;  1OQP A;  2OTG B;  3JTD C;  3A8R A;  4I5N B;  2IS9 A;  1DTL A;  1J7Q A;  2EC6 C;  1IG5 A;  2KI4 C;  3RLZ A;  2KI6 D;  1SRA A;  1G33 A;  1CMG A;  1YRU B;  2BCA A;  2WOR A;  3ZWH A;  2HF5 A;  1SK6 D;  4XYN A;  2PVB A;  2HQ8 A;  1CTR A;  4A4B A;  1XFW O;  1UHH A;  5HYD A;  2ZND A;  4HRE E;  3SG4 A;  3ZNI A;  4M2O A;  4MZL A;  3KPX A;  2L98 A;  4YGC B;  2LHI A;  1LVC D;  1LKJ A;  1TCF A;  1S6J A;  1S3P A;  1G4Y R;  1DJZ A;  3E3R A;  1MR8 A;  5AAN A;  4MRY A;  4PDZ A;  2HPS A;  1QX2 A;  1UHK A;  3BOW B;  2K7C A;  2LLT A;  5B8I B;  3WHT B;  2OS8 B;  3QRX A;  1CFD A;  2LVJ A;  1DMO A;  1MUX A;  1KFX S;  3I5H B;  4YGB B;  1QX7 A;  2GGZ A;  2KDH A;  3C1V A;  1K8U A;  2K7B A;  1ODB A;  3ICB A;  3I5I B;  4XJK B;  2JNF A;  1BT6 A;  1CDM A;  1Y0V H;  4GUK A;  4A4C A;  3F45 A;  1TRF A;  1DF0 A;  2BKI B;  2L51 A;  3EKH A;  3TDU A;  2CCM A;  5I8N A;  1B4C A;  1ALW A;  1A75 B;  1CLL A;  4QJ4 B;  3JVT C;  3KEV A;  1YTZ C;  3CR4 X;  1QV0 A;  5ER5 A;  5G08 A;  2HQW A;  2JXC A;  2LMU A;  2KNE A;  2LUC A;  5CPV A;  5BPJ A;  3PN7 B;  1TTX A;  2KYC A;  2BE4 A;  3CR5 X;  5KTY A;  1BOD A;  1OE9 B;  3CTN A;  3SG2 A;  2JXL A;  2K7O A;  1XFZ O;  1S6I A;  2L50 A;  3EKJ A;  1YX7 A;  4MRX A;  1RTP 1;  1XK4 A;  2NZ0 A;  4MZJ A;  1C7W A;  1K94 A;  3MSE B;  1NX1 A;  3SG3 A;  1CLM A;  3PFV A;  2G2B A;  1CFC A;  2NXQ A;  1C07 A;  2BL0 C;  1N0Y A;  1KSM A;  1X02 A;  1RFJ A;  1SPY A;  2FCD A;  3JTD B;  2MLE C;  1BR4 B;  4ORB B;  1ZMZ A;  4HRG A;  4GNK B;  5TNC A;  1H4B A;  2KFG A;  2WCF A;  2ZN8 A;  2EC6 B;  1RJV A;  4DCK A;  1Y1A A;  3CGA A;  3DD4 A;  1Y1X A;  1TNX A;  1K9K A;  3PAL A;  1UP5 A;  1QXP A;  1TN4 A;  2M1K B;  1PRW A;  2RGI A;  3PSR A;  4USL A;  1PSR A;  3I5G B;  2BEC A;  3VRO A;  1KQV A;  1OMD A;  2KYF A;  4JPZ B;  3TS5 B;  1K2H A;  1IGV A;  1B8C A;  1NX2 A;  3PLF B;  4MVF A;  4NQG A;  2LC5 A;  4M2P A;  1JFK A;  1MXL C;  1Y1U A;  2L4I A;  4PHJ A;  1YX8 A;  2K8M B;  2WOS A;  4DRW A;  1EG3 A;  1KFX L;  1FBV A;  1F55 A;  2LVI A;  1XVJ A;  1TNP A;  2KHN A;  2PAL A;  2ZKM X;  2LVV A;  1BLQ A;  1XO5 A;  3CLN A;  3TDI A;  2L0P A;  2MAZ A;  2PSR A;  3OHM B;  2F3Z A;  1OMR A;  1SMG A;  2CT9 A;  4JQ0 D;  1UHN A;  2AUC A;  3IQQ A;  4HRH A;  4DUQ A;  2KGR A;  4E68 A;  1V1G A;  1J1E A;  1IQ3 A;  1CMF A;  2WCE A;  2M9G A;  1QIV A;  5CSJ A;  1KWO B;  5AFP A;  1F71 A;  2OPO A;  2GGM A;  3EVR A;  4JWQ A;  1XFY O;  2F2O A;  1UWO A;  2JNX A;  1AUI B;  1LXF C;  2WCB A;  4CPV A;  3O78 A;  1QAS A;  2HET A;  3BYA A;  2KFF A;  4HSZ A;  5AXI A;  1NUB A;  4P5O E;  2LCP A;  3WHU B;  1B7T Y;  1BU3 A;  1IQ5 A;  4YI8 A;  4CID A;  1MQ1 A;  1WRL A;  4PE0 A;  4F0Z B;  1NIW A;  4OVN F;  1BMO A;  1K90 D;  2F33 A;  2M1U A;  1IRJ A;  5I2L A;  4GPL B;  1IJ5 A;  1KSO A;  1DF0 B;  1QLK A;  3BUN B;  4FQO A;  1SL9 A;  4ZCV A;  1RK9 A;  1YVL A;  4C0K A;  2KOT A;  5DKQ A;  1K93 D;  3IQO A;  3D0Y A;  3H4S E;  1S5G Y;  4DIR A;  1SCM C;  3FWC A;  4QJ5 B;  3OX6 A;  1FI6 A;  2FJU B;  3LCP C;  3SIB A;  3SG7 A;  1N2D A;  2NLN A;  1YUR A;  1BOC A;  3D10 A;  4PE7 A;  1WDC C;  4D1E A;  2NCO A;  5K89 A;  2VRG A;  3DVM A;  1A2X A;  4I5J A;  1ALV A;  2KGB C;  1B9A A;  2KAY A;  3CWG A;  2R2I A;  1SNL A;  1E8A A;  1NCY A;  5PAL A;  1A03 A;  1C7V A;  1QV1 A;  3KF9 A;  2JPT A;  4PHM A;  3TUY C;  1KK8 B;  1J1D A;  1F4Q A;  1NX0 A;  2JQ6 A;  1FI5 A;  1KQM C;  5JOL A;  2M29 A;  1Y6W A;  2TN4 A;  2MJW B;  2SCP A;  1QLS A;  3K21 A;  4P2Y B;  1XFV O;  1S26 D;  2M0R A;  1FF1 A;  1QVI Y;  3O6B A;  2ZN9 A;  4YI9 A;  1K95 A;  1F4O A;  3I5F C;  1U5I A;  1W7J B;  1CDP A;  3BUW B;  3GK2 A;  1GQM A;  1OZO A;  1Q80 A;  4ORA B;  2ZRT A;  1F8H A;  1NWD A;  2PAS A;  4CFQ A;  5HLO A;  1GGZ A;  2LP2 A;  4PHN A;  1S5G Z;  2BCB A;  3IF7 A;  4MSP A;  3NSO A;  1JF2 A;  2KI6 C;  1UUS A;  2DOQ A;  2EHB A;  2L5X B;  1M63 B;  1SCV A;  1BF5 A;  2JU0 A;  1AVS A;  1NP8 A;  2H61 A;  3CZT X;  1CNP A;  4L9M A;  5J3X A;  1CFP A;  4N1G A;  2CBL A;  2KBI A;  1XFX O;  2H61 C;  3AKB A;  2KFH A;  2JRF A;  2ZFD A;  1L2O B;  2JUL A;  1FPW A;  1F70 A;  3LL8 B;  1TIZ A;  1OMV A;  1DVI A;  1CM4 A;  5CSF A;  1EH2 A;  4PCW A;  1REC A;  1DJW A;  1TNQ A;  2V53 A;  2KI4 B;  5I2Q A;  5CSN A;  3OB2 B;  2BCX A;  4N1F A;  2K0J A;  1AJ4 A;  3AAJ A;  2JWW A;  2M7L A;  1RWY A;  1UHI A;  1D1O A;  1DJH A;  4MZK A;  2CXJ A;  2D8N A;  4FTG A;  1R2U A;  1JFJ A;  5HKW A;  3NSK A;  4YGA A;  3VRN A;  1XYD A;  1NSH A;  1YUT A;  2OS8 C;  2JT0 A;  1SCM B;  4ZCU A;  2E6W A;  2LP3 A;  1DGV A;  2PMY A;  3LLE A;  1SBJ A;  3TDZ A;  1QAT A;  1ZOT B;  3WXA A;  3D0Y B;  2Q4U A;  1AJ5 A;  4GGF C;  1S1E A;  2Y5I A;  1JSA A;  1G8I A;  2K2A A;  1J55 A;  1SL7 A;  3BUM B;  3NXA A;  2LVK A;  3GOF A;  4PAL A;  5AER A;  3DVK A;  1ZUZ A;  3I5I C;  1IKU A;  2JT8 A;  2LUX A;  1MF8 B;  1DJX A;  4NDC A;  1SR6 C;  2NCP A;  4PE1 A;  3A4U B;  2FCE A;  2EGD A;  3PAT A;  3SJS A;  4YGE B;  2O60 A;  5HKY A;  4YGD B; 
#chains in the Genus database with same CATH topology
 4M2Q A;  1ZFS A;  1S36 A;  3HCM A;  4WQ2 A;  2LM5 A;  2A4J A;  1DJI A;  1NCX A;  1QIW A;  3O2P A;  3PN7 C;  1QTX A;  1XA5 A;  4MLW A;  1K9U A;  3S0B A;  3DVJ A;  4ETO A;  2JOJ A;  4IL1 A;  3OP0 A;  2ZRS A;  2O5G A;  1SY9 A;  3M0W A;  2KLD A;  1VRK A;  3EK8 A;  3CS1 A;  1FW4 A;  1QS7 A;  2MHH A;  3JVT B;  4QJ3 B;  4OKH A;  1KCY A;  4TNC A;  5HLV A;  3VGO A;  5KU1 A;  3S0D A;  1J7O A;  2COL B;  5D7F A;  5FI6 A;  1QX5 B;  2MBX A;  2LNK A;  1MHO A;  1V1F A;  4AQI A;  1OOF A;  4GFT A;  3RZS A;  4C0L A;  1CB1 A;  1U5I B;  3DF0 A;  3BUO B;  2Y4Q A;  2F3Y A;  4PHK A;  4Q04 A;  1CFF A;  4R1E A;  2P70 A;  4GBA A;  1CDL A;  1WY9 A;  3DXL A;  1JWD A;  1QJT A;  2KBM A;  2KAX A;  1K9P A;  1YUS A;  2LAN A;  3GK1 A;  2BE6 A;  1NX3 A;  1DT7 B;  1A29 A;  3TZ1 A;  1JC2 A;  1CDN A;  3EVU A;  1YRT B;  1GJY A;  3EVV A;  1PVA A;  4DS7 A;  2BL0 B;  1AP4 A;  1B8L A;  1EL4 A;  3I5G C;  1J7R A;  2GTE A;  5ER4 X;  1J7P A;  1SYM A;  4YBH B;  3TS5 C;  1B8R A;  3WNX B;  2F2P A;  3N7H A;  1JBA A;  1WLM A;  1HQV A;  1BR1 B;  1PVB A;  2QAC A;  1WRK A;  1IWQ A;  2LLU A;  5FYX A;  1OZS A;  3VRP A;  2PRU A;  3BQ3 A;  2JTT A;  1B7T Z;  1M31 A;  1UHJ A;  2M97 A;  2F8P A;  1NPQ A;  1OSA A;  1M39 A;  1BG1 A;  3BJH A;  1WRZ A;  4I5L B;  3NSI A;  1H8B A;  2ZNE A;  2YGU A;  1B47 A;  3VRR A;  2H2K A;  2QEV A;  4NDB A;  1PSB A;  4I5K A;  4OV2 A;  4C0J A;  1R6P A;  2K2F A;  2LMV A;  5CSI A;  1KFU L;  3UO9 A;  1EG4 A;  1PK0 D;  5GQQ C;  1LIN A;  1KWO C;  1W7I B;  3FWB A;  2Y1M A;  1UUR A;  2P71 A;  3SIA A;  1AK8 A;  1CKK A;  2OTG C;  2WCL A;  4BY5 A;  2G9B A;  1YVH A;  1XFU O;  3SS4 A;  1DJY A;  1WLZ A;  2CNP A;  3NHI A;  2L4H A;  2Y1N A;  4GAO A;  2K7D A;  1BJF A;  1MXE A;  3OB1 B;  2KQY A;  1LA0 A;  3D75 A;  1SR6 B;  1NCZ A;  2L2C A;  2ISD A;  3O4Y A;  1IJ6 A;  2E30 A;  3OX5 A;  4ICB A;  1AHR A;  1TOP A;  1K96 A;  2LE9 B;  2Q91 A;  4FQT A;  3RM1 A;  2BBM A;  1DGU A;  1TUZ A;  3BXK A;  4GGN A;  4OCI A;  5AEQ A;  4F7F A;  1A4P A;  1DJG A;  2L2E A;  5D69 A;  1SL8 A;  2I18 A;  2M7N A;  3SS5 A;  3LK0 A;  1JUO A;  1PUL A;  2M49 B;  2MA2 A;  4U8D A;  1KK7 Y;  3EK4 A;  3PM8 A;  4PE4 A;  2MRD A;  2WND A;  1QVI Z;  2WC8 A;  2M3W A;  3BOW A;  1YUU A;  1JF0 A;  4MBE A;  4WRI A;  3SG5 A;  3KO0 A;  1XK4 C;  4AQJ A;  2GV5 A;  2PYQ A;  2AMI A;  3LK1 A;  5HKZ A;  4BY4 A;  1IQ3 A;  5DKR A;  3R72 A;  2AAO A;  2LHL A;  1M46 A;  2B1U A;  2KQ6 A;  3SS3 A;  2I2R E;  1LA3 A;  1M45 A;  2MLF C;  4GGF A;  1CM1 A;  3SG6 A;  4MN0 A;  4WQ3 A;  3AKA A;  3K1E A;  3DF0 B;  1EJ3 A;  1KK8 C;  2KSP A;  2M8U A;  4XJK A;  5F6T A;  1RRO A;  5KSZ A;  3I5H C;  2LMT A;  5I94 A;  1WDC B;  1L7Z A;  1SKT A;  1GGW A;  5I2O A;  5DKN A;  1A75 A;  2SAS A;  1ZAC A;  2BAP A;  4KYN A;  3PM2 A;  1EXR A;  5IBW A;  2BBN A;  1NYA A;  2KLE A;  3BFB A;  3NHT A;  1OW4 A;  1KFU S;  2WCM A;  1TNW A;  3PJI A;  3FS7 A;  4YRU A;  3TUY B;  1F54 A;  4N5X A;  3DVE A;  4MEW A;  4CLN A;  4UPG A;  1N65 A;  3AAK A;  1PAL A;  3NSL A;  3KHE A;  3CR2 A;  5DIC A;  3FE9 A;  1KQM B;  4AOM A;  3VRQ A;  1B1G A;  2FOT A;  1TCO B;  4CFR A;  3GK4 X;  2JZI A;  3EK7 A;  3FIA A;  3VB1 A;  2KAV A;  1SW8 A;  3BUX B;  2JTZ A;  2K61 A;  3DY9 A;  3I5F B;  1KK7 Z;  1S6C A;  2I94 A;  4ORC B;  2BKH B;  1YR5 A;  2P6B B;  2LAP A;  2KPH A;  5JJG A;  2CTN A;  2QPT A;  4NDD A;  2JC2 A;  4OR9 B;  3S0A A;  3V2L A;  3S0G A;  2I7A A;  3S0F A;  1CLB A;  1OOJ A;  1HT9 A;  3FE8 A;  1MWN A;  2LLS A;  3HX4 A;  1L2O C;  2LV7 A;  2JT3 A;  3D78 A;  1OQP A;  1W9Z A;  2OTG B;  2BNX A;  3JTD C;  3A8R A;  3L4L A;  4I5N B;  2IS9 A;  3B86 A;  1DTL A;  1J7Q A;  2EC6 C;  1IG5 A;  2KI4 C;  3RLZ A;  2KI6 D;  1SRA A;  1G33 A;  1CMG A;  3EG5 B;  1YRU B;  2BCA A;  2WOR A;  3ZWH A;  2HF5 A;  1SK6 D;  4XYN A;  2PVB A;  2HQ8 A;  1CTR A;  4A4B A;  1XFW O;  1UHH A;  5HYD A;  2ZND A;  4HRE E;  3SG4 A;  3ZNI A;  4M2O A;  4MZL A;  3OGN A;  3KPX A;  2L98 A;  4YGC B;  2LHI A;  1LVC D;  1LKJ A;  1TCF A;  3CDN A;  2WCJ A;  1S6J A;  1S3P A;  1G4Y R;  1DJZ A;  2QEO A;  3E3R A;  1MR8 A;  1XFR A;  5AAN A;  4MRY A;  4PDZ A;  2HPS A;  1QX2 A;  1UHK A;  3BOW B;  2K7C A;  2LLT A;  5B8I B;  3WHT B;  2OS8 B;  3QRX A;  3L4A A;  1CFD A;  2LVJ A;  3DZT A;  1DMO A;  1MUX A;  1KFX S;  3I5H B;  4YGB B;  1QX7 A;  2GGZ A;  2KDH A;  3C1V A;  1K8U A;  2K7B A;  1ODB A;  3ICB A;  3I5I B;  4XJK B;  2JNF A;  1BT6 A;  3CZ2 A;  1CDM A;  1Y0V H;  4GUK A;  4A4C A;  3F45 A;  1TRF A;  1DF0 A;  2BKI B;  2L51 A;  3EKH A;  3TDU A;  2CCM A;  5I8N A;  1B4C A;  1ALW A;  1A75 B;  1CLL A;  4QJ4 B;  3JVT C;  3KEV A;  1YTZ C;  2QEH A;  1QV0 A;  3CR4 X;  5ER5 A;  5FI2 A;  2HQW A;  2JXC A;  5G08 A;  2LMU A;  2KNE A;  2LUC A;  5CPV A;  5BPJ A;  3PN7 B;  1TTX A;  2KYC A;  2BE4 A;  3CR5 X;  3Q8I A;  1A03 A;  5KTY A;  1BOD A;  1OE9 B;  3CTN A;  3SG2 A;  2JXL A;  1OOG A;  2K7O A;  1XFZ O;  1S6I A;  2L50 A;  3EKJ A;  1YX7 A;  4MRX A;  1RTP 1;  1XK4 A;  2NZ0 A;  4MZJ A;  1C7W A;  1K94 A;  3MSE B;  1NX1 A;  1C3Y A;  3SG3 A;  1CLM A;  3PFV A;  2G2B A;  2WCH A;  1CFC A;  1IH0 A;  2NXQ A;  1C07 A;  2BL0 C;  1N0Y A;  1KSM A;  1X02 A;  4JKT A;  1RFJ A;  1SPY A;  2WC5 A;  2FCD A;  3JTD B;  2MLE C;  1BR4 B;  4ORB B;  1DEL A;  1ZMZ A;  4HRG A;  5HL1 A;  4GNK B;  5TNC A;  1H4B A;  2KFG A;  2WCF A;  2ZN8 A;  2EC6 B;  1RJV A;  4DCK A;  1Y1A A;  3CGA A;  3DD4 A;  3NGV A;  1Y1X A;  1TNX A;  1C3Z A;  1K9K A;  3PAL A;  1UP5 A;  1QXP A;  1TN4 A;  2M1K B;  1PRW A;  2RGI A;  3PSR A;  4USL A;  1ORG A;  1PSR A;  2BEC A;  3I5G B;  3VRO A;  1KQV A;  1OMD A;  2KYF A;  4JPZ B;  3TS5 B;  1K2H A;  1IGV A;  1B8C A;  1NX2 A;  3D74 A;  3PLF B;  3IVT A;  4MVF A;  4NQG A;  2LC5 A;  4M2P A;  1JFK A;  1MXL C;  3BFH A;  1Y1U A;  2L4I A;  2WC6 A;  4PHJ A;  1YX8 A;  2K8M B;  3DYE A;  1P28 A;  2WOS A;  4DRW A;  1EG3 A;  1KFX L;  1FBV A;  2FJY A;  3O4X A;  1F55 A;  2LVI A;  1XVJ A;  1TNP A;  2KHN A;  2PAL A;  2ZKM X;  2LVV A;  1BLQ A;  1XO5 A;  3CLN A;  3FE6 A;  3TDI A;  2L0P A;  2MAZ A;  2PSR A;  3OHM B;  2F3Z A;  1OMR A;  1SMG A;  2CT9 A;  4JQ0 D;  1UHN A;  2AUC A;  3IQQ A;  4HRH A;  3B6X A;  2KGR A;  3B87 A;  1V1G A;  1J1E A;  4DUQ A;  4E68 A;  1CMF A;  2WCE A;  2M9G A;  1QIV A;  5CSJ A;  1KWO B;  5AFP A;  1F71 A;  2OPO A;  2GGM A;  3D77 A;  3EVR A;  1XFY O;  4JWQ A;  2F2O A;  1UWO A;  2JNX A;  1AUI B;  1LXF C;  2WCB A;  4CPV A;  3O78 A;  1QAS A;  2HET A;  3BYA A;  2KFF A;  4HSZ A;  5AXI A;  1NUB A;  4P5O E;  2LCP A;  4INX A;  3WHU B;  1B7T Y;  3D73 A;  1BU3 A;  1IQ5 A;  4YI8 A;  5EL2 A;  4CID A;  1MQ1 A;  1DEK A;  1WRL A;  4PE0 A;  4F0Z B;  1NIW A;  3UNW A;  4OVN F;  1BMO A;  1K90 D;  2F33 A;  2M1U A;  1IRJ A;  3CAB A;  3OBV A;  4GPL B;  5I2L A;  1T14 A;  1IJ5 A;  1DC1 A;  1LS8 A;  1KSO A;  1DF0 B;  1QLK A;  3BUN B;  3CZ0 A;  3S0E A;  1Z4H A;  3QME A;  4FQO A;  1SL9 A;  4ZCV A;  1RK9 A;  1YVL A;  4C0K A;  2JPO A;  2KOT A;  5DKQ A;  1K93 D;  3IQO A;  3D0Y A;  3H4S E;  1S5G Y;  4DIR A;  1SCM C;  3FWC A;  4QJ5 B;  3OX6 A;  1FI6 A;  2FJU B;  3LCP C;  3SIB A;  4PT1 A;  3SG7 A;  1N2D A;  1TWO A;  2NLN A;  1YUR A;  1BOC A;  1DQE A;  1QWV A;  3BFA A;  3D10 A;  4PE7 A;  1WDC C;  4D1E A;  2NCO A;  5K89 A;  2VRG A;  3DVM A;  2PQL A;  3R1O A;  1A2X A;  4I5J A;  1ALV A;  2KGB C;  1B9A A;  2KAY A;  3CWG A;  2R2I A;  1SNL A;  1E8A A;  1NCY A;  2K60 A;  5PAL A;  1C7V A;  3R1V A;  1QV1 A;  3KF9 A;  2JPT A;  4PHM A;  3TUY C;  1KK8 B;  1J1D A;  1F4Q A;  1NX0 A;  2JQ6 A;  1FI5 A;  1KQM C;  5JOL A;  2M29 A;  1Y6W A;  2TN4 A;  3B7A A;  2MJW B;  2SCP A;  1QLS A;  3K21 A;  3B88 A;  4P2Y B;  1XFV O;  1S26 D;  2M0R A;  1FF1 A;  1QVI Y;  1SSE B;  3O6B A;  2ZN9 A;  4YI9 A;  1K95 A;  1F4O A;  3I5F C;  1U5I A;  1W7J B;  1CDP A;  3BUW B;  3GK2 A;  1GQM A;  1OZO A;  1Q80 A;  4ORA B;  2ZRT A;  2L5Y A;  1F8H A;  1NWD A;  2PAS A;  4CFQ A;  5HLO A;  1GGZ A;  1OOI X;  5FI7 A;  2LP2 A;  2QDI A;  4PHN A;  1S5G Z;  2BCB A;  3IF7 A;  4MSP A;  3NSO A;  1JF2 A;  2KI6 C;  1UUS A;  1TUJ A;  2DOQ A;  2EHB A;  2L5X B;  1M63 B;  1SCV A;  1BF5 A;  2H8V A;  1AVS A;  1NP8 A;  2H61 A;  2JU0 A;  3CZT X;  1CNP A;  4L9M A;  5J3X A;  1CFP A;  4N1G A;  2CBL A;  2KBI A;  4JD9 A;  1XFX O;  2H61 C;  3AKB A;  2KFH A;  2JRF A;  2ZFD A;  1L2O B;  3L47 A;  2JUL A;  1FPW A;  1IIO A;  1F70 A;  2QEB A;  3LL8 B;  1TIZ A;  1OMV A;  1DVI A;  1CM4 A;  5CSF A;  1EH2 A;  4PCW A;  1REC A;  1DJW A;  1TNQ A;  2V53 A;  2KI4 B;  5I2Q A;  5CSN A;  3OB2 B;  2BCX A;  4N1F A;  2K0J A;  1AJ4 A;  3AAJ A;  2JWW A;  2M7L A;  2ERB A;  1RWY A;  3D76 A;  1UHI A;  1D1O A;  2WCK A;  1DJH A;  3CZ1 A;  4MZK A;  2CXJ A;  3R1P A;  2D8N A;  4FTG A;  4IJ7 A;  1R2U A;  1JFJ A;  5HKW A;  3NSK A;  4YGA A;  3VRN A;  1XYD A;  3CYZ A;  1NSH A;  1YUT A;  2OS8 C;  2JT0 A;  1GM0 A;  1SCM B;  4ZCU A;  2E6W A;  2LP3 A;  1DGV A;  2PMY A;  3LLE A;  1SBJ A;  5D3O A;  1QAT A;  3TDZ A;  1ZOT B;  4OZD A;  3WXA A;  1OOH A;  3D0Y B;  2Q4U A;  1AJ5 A;  4GGF C;  1S1E A;  2Y5I A;  1JSA A;  1G8I A;  2K2A A;  1J55 A;  1SL7 A;  3BUM B;  3NXA A;  2LVK A;  3GOF A;  4PAL A;  5AER A;  3DVK A;  1ZUZ A;  3I5I C;  1IKU A;  2JT8 A;  2LUX A;  1MF8 B;  1DJX A;  4NDC A;  1SR6 C;  2NCP A;  4PE1 A;  3A4U B;  2FCE A;  2EGD A;  3PAT A;  3SJS A;  1Z2C B;  4YGE B;  2O60 A;  5HKY A;  4INW A;  4YGD B; 
#chains in the Genus database with same CATH homology
 4M2Q A;  1ZFS A;  1S36 A;  3HCM A;  4WQ2 A;  2LM5 A;  2A4J A;  1DJI A;  1NCX A;  1QIW A;  3O2P A;  3PN7 C;  1QTX A;  1XA5 A;  4MLW A;  1K9U A;  4ETO A;  3DVJ A;  2JOJ A;  4IL1 A;  3OP0 A;  2ZRS A;  2O5G A;  1SY9 A;  3M0W A;  1VRK A;  3EK8 A;  3CS1 A;  1FW4 A;  1QS7 A;  2MHH A;  3JVT B;  4QJ3 B;  4OKH A;  1KCY A;  4TNC A;  5HLV A;  3VGO A;  5KU1 A;  1J7O A;  2COL B;  5D7F A;  2MBX A;  1QX5 B;  2LNK A;  1MHO A;  1V1F A;  4AQI A;  4GFT A;  4C0L A;  1CB1 A;  1U5I B;  3DF0 A;  3BUO B;  2Y4Q A;  2F3Y A;  4PHK A;  4Q04 A;  1CFF A;  4R1E A;  4GBA A;  1CDL A;  1WY9 A;  1JWD A;  1QJT A;  2KBM A;  2KAX A;  1K9P A;  1YUS A;  2LAN A;  3GK1 A;  2BE6 A;  1NX3 A;  1DT7 B;  1A29 A;  3TZ1 A;  1JC2 A;  1CDN A;  3EVU A;  1YRT B;  1GJY A;  3EVV A;  1PVA A;  4DS7 A;  2BL0 B;  1AP4 A;  1B8L A;  1EL4 A;  3I5G C;  1J7R A;  5ER4 X;  1J7P A;  1SYM A;  4YBH B;  3TS5 C;  1B8R A;  3WNX B;  2F2P A;  1JBA A;  1WLM A;  1HQV A;  1BR1 B;  1PVB A;  2QAC A;  1WRK A;  1IWQ A;  2LLU A;  5FYX A;  1OZS A;  3VRP A;  2PRU A;  3BQ3 A;  2JTT A;  1B7T Z;  1M31 A;  1UHJ A;  2M97 A;  2F8P A;  1NPQ A;  1OSA A;  1M39 A;  1BG1 A;  4I5L B;  1WRZ A;  1IH0 A;  3NSI A;  1H8B A;  2ZNE A;  1B47 A;  3VRR A;  2H2K A;  4NDB A;  1PSB A;  4I5K A;  4OV2 A;  4C0J A;  1R6P A;  2K2F A;  2LMV A;  5CSI A;  1KFU L;  1EG4 A;  1PK0 D;  5GQQ C;  1LIN A;  1KWO C;  1W7I B;  3FWB A;  2Y1M A;  1UUR A;  1AK8 A;  3SIA A;  1CKK A;  2OTG C;  4BY5 A;  2G9B A;  1YVH A;  1XFU O;  1DJY A;  1WLZ A;  2CNP A;  2L4H A;  2Y1N A;  4GAO A;  2K7D A;  1BJF A;  1MXE A;  3OB1 B;  2KQY A;  1LA0 A;  1SR6 B;  1NCZ A;  2ISD A;  3O4Y A;  1IJ6 A;  2E30 A;  3OX5 A;  4ICB A;  1AHR A;  1TOP A;  1K96 A;  2LE9 B;  2Q91 A;  3RM1 A;  2BBM A;  1DGU A;  4OCI A;  3BXK A;  4GGN A;  5AEQ A;  1A4P A;  1DJG A;  2L2E A;  5D69 A;  1SL8 A;  2I18 A;  2M7N A;  3LK0 A;  1JUO A;  1PUL A;  2M49 B;  2MA2 A;  4U8D A;  1KK7 Y;  3EK4 A;  3PM8 A;  4PE4 A;  2MRD A;  2WND A;  1QVI Z;  2WC8 A;  2M3W A;  3BOW A;  1YUU A;  1JF0 A;  4MBE A;  4WRI A;  3SG5 A;  3KO0 A;  1XK4 C;  4AQJ A;  2GV5 A;  2AMI A;  3LK1 A;  5HKZ A;  4BY4 A;  5DKR A;  2AAO A;  2LHL A;  1M46 A;  2B1U A;  2KQ6 A;  2I2R E;  1LA3 A;  1M45 A;  2MLF C;  4GGF A;  1CM1 A;  3SG6 A;  4MN0 A;  4WQ3 A;  3AKA A;  3DF0 B;  1EJ3 A;  1KK8 C;  2KSP A;  2M8U A;  4XJK A;  5F6T A;  1RRO A;  5KSZ A;  3I5H C;  2LMT A;  1WDC B;  1L7Z A;  1SKT A;  1GGW A;  5I2O A;  5DKN A;  1A75 A;  2SAS A;  1ZAC A;  1EXR A;  5IBW A;  2BBN A;  1NYA A;  1KFU S;  1TNW A;  3FS7 A;  4YRU A;  3TUY B;  1F54 A;  4N5X A;  3DVE A;  4MEW A;  4CLN A;  4UPG A;  1N65 A;  3AAK A;  1PAL A;  3NSL A;  3KHE A;  3CR2 A;  4AOM A;  1B1G A;  1KQM B;  3VRQ A;  2FOT A;  1TCO B;  4CFR A;  3GK4 X;  2JZI A;  3EK7 A;  3FIA A;  2KAV A;  1SW8 A;  3BUX B;  2JTZ A;  2K61 A;  3I5F B;  1KK7 Z;  1S6C A;  2I94 A;  4ORC B;  2BKH B;  1YR5 A;  2P6B B;  2LAP A;  5JJG A;  2CTN A;  2QPT A;  4NDD A;  2JC2 A;  4OR9 B;  2I7A A;  1CLB A;  1OOJ A;  1HT9 A;  1MWN A;  2LLS A;  3HX4 A;  1L2O C;  2LV7 A;  2JT3 A;  1OQP A;  2OTG B;  3JTD C;  3A8R A;  4I5N B;  2IS9 A;  1DTL A;  1J7Q A;  2EC6 C;  1IG5 A;  2KI4 C;  3RLZ A;  2KI6 D;  1SRA A;  1G33 A;  1CMG A;  1YRU B;  2BCA A;  2WOR A;  3ZWH A;  2HF5 A;  1SK6 D;  4XYN A;  2PVB A;  2HQ8 A;  1CTR A;  4A4B A;  1XFW O;  1UHH A;  5HYD A;  2ZND A;  4HRE E;  3SG4 A;  3ZNI A;  4M2O A;  4MZL A;  3KPX A;  2L98 A;  4YGC B;  2LHI A;  1LVC D;  1LKJ A;  1TCF A;  1S6J A;  1S3P A;  1G4Y R;  1DJZ A;  3E3R A;  1MR8 A;  5AAN A;  4MRY A;  4PDZ A;  2HPS A;  1QX2 A;  1UHK A;  3BOW B;  2K7C A;  2LLT A;  5B8I B;  3WHT B;  2OS8 B;  3QRX A;  1CFD A;  2LVJ A;  1DMO A;  1MUX A;  1KFX S;  3I5H B;  4YGB B;  1QX7 A;  2GGZ A;  2KDH A;  3C1V A;  1K8U A;  2K7B A;  1ODB A;  3ICB A;  3I5I B;  4XJK B;  2JNF A;  1BT6 A;  1CDM A;  1Y0V H;  4GUK A;  4A4C A;  3F45 A;  1TRF A;  1DF0 A;  2BKI B;  2L51 A;  3EKH A;  3TDU A;  2CCM A;  5I8N A;  1B4C A;  1ALW A;  1A75 B;  1CLL A;  4QJ4 B;  3JVT C;  3KEV A;  1YTZ C;  3CR4 X;  1QV0 A;  5ER5 A;  5G08 A;  2HQW A;  2JXC A;  2LMU A;  2KNE A;  2LUC A;  5CPV A;  5BPJ A;  3PN7 B;  1TTX A;  2KYC A;  2BE4 A;  3CR5 X;  5KTY A;  1BOD A;  1OE9 B;  3CTN A;  3SG2 A;  2JXL A;  2K7O A;  1XFZ O;  1S6I A;  2L50 A;  3EKJ A;  1YX7 A;  4MRX A;  1RTP 1;  1XK4 A;  2NZ0 A;  4MZJ A;  1C7W A;  1K94 A;  3MSE B;  1NX1 A;  3SG3 A;  1CLM A;  3PFV A;  2G2B A;  1CFC A;  2NXQ A;  1C07 A;  2BL0 C;  1N0Y A;  1KSM A;  1X02 A;  1RFJ A;  1SPY A;  2FCD A;  3JTD B;  2MLE C;  1BR4 B;  4ORB B;  1ZMZ A;  4HRG A;  4GNK B;  5TNC A;  1H4B A;  2KFG A;  2WCF A;  2ZN8 A;  2EC6 B;  1RJV A;  4DCK A;  1Y1A A;  3CGA A;  3DD4 A;  1Y1X A;  1TNX A;  1K9K A;  3PAL A;  1UP5 A;  1QXP A;  1TN4 A;  2M1K B;  1PRW A;  2RGI A;  3PSR A;  4USL A;  1PSR A;  3I5G B;  2BEC A;  3VRO A;  1KQV A;  1OMD A;  2KYF A;  4JPZ B;  3TS5 B;  1K2H A;  1IGV A;  1B8C A;  1NX2 A;  3PLF B;  4MVF A;  4NQG A;  2LC5 A;  4M2P A;  1JFK A;  1MXL C;  1Y1U A;  2L4I A;  4PHJ A;  1YX8 A;  2K8M B;  2WOS A;  4DRW A;  1EG3 A;  1KFX L;  1FBV A;  1F55 A;  2LVI A;  1XVJ A;  1TNP A;  2KHN A;  2PAL A;  2ZKM X;  2LVV A;  1BLQ A;  1XO5 A;  3CLN A;  3TDI A;  2L0P A;  2MAZ A;  2PSR A;  3OHM B;  2F3Z A;  1OMR A;  1SMG A;  2CT9 A;  4JQ0 D;  1UHN A;  2AUC A;  3IQQ A;  4HRH A;  4DUQ A;  2KGR A;  4E68 A;  1V1G A;  1J1E A;  1IQ3 A;  1CMF A;  2WCE A;  2M9G A;  1QIV A;  5CSJ A;  1KWO B;  5AFP A;  1F71 A;  2OPO A;  2GGM A;  3EVR A;  4JWQ A;  1XFY O;  2F2O A;  1UWO A;  2JNX A;  1AUI B;  1LXF C;  2WCB A;  4CPV A;  3O78 A;  1QAS A;  2HET A;  3BYA A;  2KFF A;  4HSZ A;  5AXI A;  1NUB A;  4P5O E;  2LCP A;  3WHU B;  1B7T Y;  1BU3 A;  1IQ5 A;  4YI8 A;  4CID A;  1MQ1 A;  1WRL A;  4PE0 A;  4F0Z B;  1NIW A;  4OVN F;  1BMO A;  1K90 D;  2F33 A;  2M1U A;  1IRJ A;  5I2L A;  4GPL B;  1IJ5 A;  1KSO A;  1DF0 B;  1QLK A;  3BUN B;  4FQO A;  1SL9 A;  4ZCV A;  1RK9 A;  1YVL A;  4C0K A;  2KOT A;  5DKQ A;  1K93 D;  3IQO A;  3D0Y A;  3H4S E;  1S5G Y;  4DIR A;  1SCM C;  3FWC A;  4QJ5 B;  3OX6 A;  1FI6 A;  2FJU B;  3LCP C;  3SIB A;  3SG7 A;  1N2D A;  2NLN A;  1YUR A;  1BOC A;  3D10 A;  4PE7 A;  1WDC C;  4D1E A;  2NCO A;  5K89 A;  2VRG A;  3DVM A;  1A2X A;  4I5J A;  1ALV A;  2KGB C;  1B9A A;  2KAY A;  3CWG A;  2R2I A;  1SNL A;  1E8A A;  1NCY A;  5PAL A;  1A03 A;  1C7V A;  1QV1 A;  3KF9 A;  2JPT A;  4PHM A;  3TUY C;  1KK8 B;  1J1D A;  1F4Q A;  1NX0 A;  2JQ6 A;  1FI5 A;  1KQM C;  5JOL A;  2M29 A;  1Y6W A;  2TN4 A;  2MJW B;  2SCP A;  1QLS A;  3K21 A;  4P2Y B;  1XFV O;  1S26 D;  2M0R A;  1FF1 A;  1QVI Y;  3O6B A;  2ZN9 A;  4YI9 A;  1K95 A;  1F4O A;  3I5F C;  1U5I A;  1W7J B;  1CDP A;  3BUW B;  3GK2 A;  1GQM A;  1OZO A;  1Q80 A;  4ORA B;  2ZRT A;  1F8H A;  1NWD A;  2PAS A;  4CFQ A;  5HLO A;  1GGZ A;  2LP2 A;  4PHN A;  1S5G Z;  2BCB A;  3IF7 A;  4MSP A;  3NSO A;  1JF2 A;  2KI6 C;  1UUS A;  2DOQ A;  2EHB A;  2L5X B;  1M63 B;  1SCV A;  1BF5 A;  2JU0 A;  1AVS A;  1NP8 A;  2H61 A;  3CZT X;  1CNP A;  4L9M A;  5J3X A;  1CFP A;  4N1G A;  2CBL A;  2KBI A;  1XFX O;  2H61 C;  3AKB A;  2KFH A;  2JRF A;  2ZFD A;  1L2O B;  2JUL A;  1FPW A;  1F70 A;  3LL8 B;  1TIZ A;  1OMV A;  1DVI A;  1CM4 A;  5CSF A;  1EH2 A;  4PCW A;  1REC A;  1DJW A;  1TNQ A;  2V53 A;  2KI4 B;  5I2Q A;  5CSN A;  3OB2 B;  2BCX A;  4N1F A;  2K0J A;  1AJ4 A;  3AAJ A;  2JWW A;  2M7L A;  1RWY A;  1UHI A;  1D1O A;  1DJH A;  4MZK A;  2CXJ A;  2D8N A;  4FTG A;  1R2U A;  1JFJ A;  5HKW A;  3NSK A;  4YGA A;  3VRN A;  1XYD A;  1NSH A;  1YUT A;  2OS8 C;  2JT0 A;  1SCM B;  4ZCU A;  2E6W A;  2LP3 A;  1DGV A;  2PMY A;  3LLE A;  1SBJ A;  3TDZ A;  1QAT A;  1ZOT B;  3WXA A;  3D0Y B;  2Q4U A;  1AJ5 A;  4GGF C;  1S1E A;  2Y5I A;  1JSA A;  1G8I A;  2K2A A;  1J55 A;  1SL7 A;  3BUM B;  3NXA A;  2LVK A;  3GOF A;  4PAL A;  5AER A;  3DVK A;  1ZUZ A;  3I5I C;  1IKU A;  2JT8 A;  2LUX A;  1MF8 B;  1DJX A;  4NDC A;  1SR6 C;  2NCP A;  4PE1 A;  3A4U B;  2FCE A;  2EGD A;  3PAT A;  3SJS A;  4YGE B;  2O60 A;  5HKY A;  4YGD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...