2KDHA

The solution structure of human cardiac troponin c in complex with the green tea polyphenol; (-)-epigallocatechin-3-gallate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Solution structure of human cardiac troponin C in complex with the green tea polyphenol, (-)-epigallocatechin 3-gallate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kdhA00
1FBVA 1IGVA 2CNPA 1YX7A 4UPGA 2MLEC 2K2AA 1RTP1 1X02A 1B1GA 2JXLA 2KI6C 1Y1AA 1J55A 4DUQA 2KOTA 1IQ5A 2NCPA 2RGIA 4ETOA 1S6CA 2A4JA 2FCEA 1M46A 3EVUA 4OR9B 1AP4A 1Y6WA 2K7CA 2CBLA 2K7DA 5JJGA 1TOPA 1CDLA 2M3WA 2M7NA 1QX2A 2SASA 3SG4A 4A4BA 2K2FA 2R2IA 1EJ3A 1TRFA 1AJ4A 1UURA 3ICBA 1Q80A 1PULA 2I94A 3KEVA 1XFZO 5G08A 3PM8A 1D1OA 1EG4A 3HX4A 1AHRA 2PVBA 4R1EA 1NSHA 1TNXA 1OZOA 1K95A 4OVNF 3QRXA 3RM1A 4E68A 3EK8A 2K7OA 3LL8B 4I5KA 3DF0B 1BF5A 1IRJA 4L9MA 4AQIA 2H61C 4FQOA 1L2OC 1DJYA 1J1EA 1M31A 1PK0D 1R2UA 2HQWA 2M7LA 1ZFSA 3JTDB 4ORBB 4D1EA 5HYDA 3JVTC 4NQGA 1F55A 5DKQA 2KBMA 1NX1A 1KFXL 3PATA 2JULA 2K8MB 1KK7Y 1W7JB 1BJFA 3O4YA 3TDZA 2I2RE 4OCIA 4I5LB 1ODBA 3AKAA 2KFFA 1WDCC 4QJ3B 1BR1B 2BBNA 2CTNA 4HSZA 1K90D 1CDPA 2Q4UA 1TNWA 3VGOA 1CTRA 1SPYA 4N5XA 1KQVA 3DF0A 3HCMA 1VRKA 4XYNA 2K61A 4PHMA 2BL0B 1KFUS 2HQ8A 1NWDA 1NX2A 2Y1NA 1XFXO 1DJHA 1CB1A 1QS7A 4DS7A 1FF1A 5K89A 2FOTA 2LVIA 2ZRTA 4I5NB 2HPSA 1BODA 2M49B 4AQJA 1CFFA 2B1UA 4P2YB 1Y0VH 1NIWA 1JF2A 1SRAA 1QLKA 2LLTA 4NDBA 1S36A 1FI6A 1KQMC 1DJIA 3DVEA 4A4CA 2FCDA 5IBWA 5CSFA 1WRLA 2OS8C 1L7ZA 1IJ6A 1M39A 1L2OB 1CLLA 1S6JA 3FS7A 3JVTB 2LE9B 1TN4A 3KHEA 4Q04A 4YI9A 2V53A 1J7RA 1B8LA 3WHTB 2KNEA 4YGCB 3RLZA 1B7TZ 1XFUO 3TS5C 1QASA 2NLNA 5JOLA 1RWYA 2ZKMX 1BR4B 3VRRA 1QV1A 3VRNA 5D7FA 1WDCB 3SIBA 2LHLA 4OV2A 4YRUA 4TNCA 2F3ZA 1YX8A 2M0RA 4PHJA 3BXKA 3EKJA 1IH0A 1YRUB 2P6BB 1CDNA 1G33A 2F8PA 2JNXA 2PSRA 2H61A 3FWCA 1OZSA 4I5JA 4BY5A 1SBJA 1S6IA 1DF0B 2L2EA 4GGFA 4CPVA 2LUCA 4MVFA 3WHUB 3LCPC 2JT3A 1N2DA 1M63B 5D69A 1OMDA 1PSRA 2WCEA 1QX7A 1XVJA 4PCWA 2BCBA 2KQYA 1G4YR 1CMGA 3K21A 1EL4A 1KQMB 1OSAA 2GGZA 3NSIA 4YI8A 1QVIZ 4ICBA 5I2QA 3NSKA 2OS8B 3EK7A 1MHOA 2G9BA 2LUXA 1SK6D 1NPQA 2L5XB 5AXIA 3CR2A 3OHMB 2PMYA 1F8HA 3DD4A 1NCXA 3NXAA 2M1UA 2MLFC 4MBEA 2KGRA 3NSOA 4PE7A 1S1EA 1DF0A 1YUUA 3TS5B 1QVIY 3I5IC 3WXAA 2FJUB 1SKTA 1QIWA 1LXFC 3BYAA 2F2OA 2AUCA 2KAXA 4QJ4B 2GGMA 2M97A 1WRZA 1C7VA 4WQ2A 1EG3A 2BL0C 5HLOA 1XFVO 2MA2A 2MHHA 4MRXA 1TCFA 2JTZA 2L98A 1JBAA 2JPTA 1UUSA 4MRYA 3FWBA 2EC6C 5CSNA 2E30A 1UHHA 4MSPA 3CR5X 2JC2A 1JUOA 2HETA 1BU3A 2KAYA 2LC5A 5BPJA 1OE9B 1ZOTB 1XA5A 2M9GA 4MLWA 5PALA 1NUBA 1SNLA 2L51A 3FIAA 4GGFC 1DT7B 1BLQA 1KFXS 3BUXB 1N0YA 3PALA 2LNKA 2JRFA 1NYAA 1WLZA 1PALA 1W7IB 4GNKB 1CFDA 1C7WA 2DOQA 2KGBC 4ORAB 2BBMA 2JZIA 2KYCA 2LVJA 3OB2B 4C0KA 1Y1XA 1QV0A 1EXRA 5J3XA 2Y5IA 2JXCA 3GOFA 2M29A 1NX3A 4OKHA 1YURA 3I5IB 2CCMA 4C0JA 2SCPA 3PLFB 1YUSA 3EVRA 1A4PA 1JF0A 1SW8A 2ZNDA 3I5FC 1QX5B 1AUIB 2BKHB 4YBHB 5I2LA 3D10A 5B8IB 1MWNA 1SCMC 1V1GA 2H2KA 1Y1UA 5FYXA 2NZ0A 1MF8B 1YTZC 3EK4A 4MZJA 2Y4QA 5TNCA 2EC6B 4WRIA 1JFJA 5KU1A 1LA0A 2KFHA 1F54A 2BKIB 3SG6A 1F4QA 1K8UA 2L0PA 1NX0A 3CZTX 2BECA 2F2PA 3GK1A 1CM1A 3BUOB 1ZUZA 2KQ6A 4YGBB 3C1VA 1J7QA 2EGDA 3EKHA 4DCKA 4JPZB 1KFUL 1B8CA 5AERA 1KWOC 1S5GZ 1UHKA 1CNPA 1SMGA 2MBXA 1WLMA 1A75B 1DMOA 1SCVA 3DVJA 2COLB 2L4IA 1HT9A 1M45A 2BCXA 3PN7B 3OB1B 3D0YB 5HKYA 5KSZA 5F6TA 3TUYB 4HRGA 1S26D 2K0JA 4AOMA 2L50A 1KCYA 2JQ6A 1K2HA 2D8NA 2PALA 1KK8C 3MSEB 5DKRA 4QJ5B 3I5FB 1B4CA 3DVMA 1B7TY 2PASA 3BUWB 1DJWA 1N65A 4JQ0D 3CLNA 1SCMB 2AMIA 2WNDA 3CR4X 1XO5A 4N1GA 1E8AA 2LP3A 4CIDA 2F3YA 1YRTB 1KSMA 3OP0A 1AK8A 2QPTA 3E3RA 1NCYA 3TDUA 4ZCVA 1JSAA 2JU0A 3CTNA 1XYDA 1A75A 1F4OA 1RJVA 2BCAA 1A2XA 3AAKA 3CWGA 4MN0A 3BUMB 1NCZA 1LKJA 4GUKA 4C0LA 2KDHA 3D0YA 4CLNA 2L4HA 2KYFA 1TNPA 1HQVA 3NSLA 1AJ5A 2KI4C 3AKBA 2M1KB 1RROA 3TDIA 3OX5A 4P5OE 4YGEB 1KWOB 4HREE 1JFKA 1ALWA 1LINA 3SG3A 2I7AA 2VRGA 4M2OA 2ISDA 1BMOA 4USLA 1U5IB 1CLMA 1PVAA 2MRDA 1QXPA 1J7PA 4GBAA 2GV5A 3SG5A 4PDZA 5DKNA 1G8IA 3A8RA 1MXLC 3BQ3A 2LLSA 1C07A 1J7OA 3LK1A 1GJYA 1SR6B 1FI5A 1KK8B 3VROA 4M2QA 1IJ5A 5CSIA 2LM5A 2LCPA 2WOSA 1H4BA 1B9AA 2LVKA 5HLVA 3LLEA 2WCBA 4CFRA 1K94A 2ZFDA 2KBIA 3I5GC 4PE4A 5ER5A 5ER4X 4XJKB 2NCOA 4GFTA 1DJZA 2OTGC 3PFVA 3ZNIA 5AEQA 1XK4C 1MQ1A 2HF5A 1JC2A 1U5IA 2O60A 4BY4A 1TIZA 3KO0A 3O6BA 2JWWA 1CFCA 4JWQA 3BOWB 3A4UB 3O78A 2KI4B 1ZMZA 4PE0A 4YGAA 2LHIA 4GPLB 1PVBA 4F0ZB 3ZWHA 1KK7Z 1B47A 3PN7C 4DIRA 1WY9A 2M8UA 4IL1A 2AAOA 3TUYC 1QLSA 1ZACA 2LMVA 2WC8A 1CLBA 1XFYO 2KSPA 4XJKA 3F45A 2LV7A 1DJGA 2CXJA 2NXQA 1B8RA 1V1FA 1WRKA 3KPXA 1ALVA 3GK4X 2BE6A 2F33A 3CGAA 3VRPA 5I2OA 2JTTA 2LVVA 1UHIA 1R6PA 2WCFA 5I8NA 1DVIA 1OMRA 2OPOA 1CKKA 1H8BA 3BOWA 1SYMA 1GGWA 3GK2A 2O5GA 1IG5A 1GGZA 1SY9A 5HKZA 2TN4A 5CSJA 2E6WA 1EH2A 3I5GB 2LAPA 4GAOA 2LLUA 2JNFA 1MUXA 3KF9A 2OTGB 1IQ3A 3LK0A 4NDCA 1BG1A 1A03A 1FPWA 4PHKA 1OOJA 4N1FA 5CPVA 4M2PA 2KFGA 4GGNA 2IS9A 2KI6D 2PRUA 2EHBA 3I5HC 2QACA 1QJTA 1TTXA 1CMFA 2ZN8A 1A29A 1UHJA 4ZCUA 3SJSA 2Q91A 1F71A 1OQPA 1YVLA 5HKWA 2CT9A 3BUNB 1J1DA 3IQOA 3OX6A 1BOCA 2ZRSA 3SG7A 1SL8A 1SL9A 1K93D 4CFQA 1YVHA 1IWQA 2K7BA 3PSRA 5GQQC 1JWDA 1SR6C 1TCOB 1GQMA 3IQQA 1RK9A 1S5GY 2JOJA 1SL7A 1QIVA 2WORA 2JT0A 1XK4A 5KTYA 1YR5A 2JT8A 1XFWO 3CS1A 1DGUA 4MZLA 2I18A 4MZKA 1F70A 1CDMA 2KAVA 2G2BA 4ORCB 1RFJA 4FTGA 2LANA 1QATA 1UWOA 3H4SE 1DTLA 3DVKA 5AANA 1UHNA 4PALA 1YUTA 1MXEA 1LVCD 1DJXA 2BE4A 4PE1A 3EVVA 5AFPA 3TZ1A 1S3PA 1LA3A 2MJWB 2MAZA 1NP8A 1CM4A 3SIAA 1OMVA 4PHNA 1QTXA 1K9KA 2ZNEA 1K9PA 1BT6A 2Y1MA 1K96A 1MR8A 1CFPA 1FW4A 1UP5A 3SG2A 3O2PA 4YGDB 1DGVA 1RECA 1K9UA 3M0WA 3WNXB 3I5HB 4NDDA 1TNQA 3VRQA 3IF7A 1IKUA 1PRWA 1PSBA 3AAJA 1KSOA 3JTDC 2LP2A 2ZN9A 4WQ3A 4MEWA 2KHNA 4U8DA 4DRWA 1AVSA 4HRHA 2LMUA 2LMTA
chains in the Genus database with same CATH superfamily
1FBVA 1IGVA 2CNPA 1YX7A 4UPGA 2MLEC 3B87A 2H8VA 2K2AA 1RTP1 1X02A 1B1GA 2JXLA 2KI6C 1Y1AA 1J55A 4DUQA 2KOTA 1IQ5A 2NCPA 2RGIA 4ETOA 1S6CA 2A4JA 2FCEA 1M46A 3EVUA 4OR9B 1AP4A 1Y6WA 2K7CA 2CBLA 1GM0A 3OBVA 2K7DA 5JJGA 1TOPA 1CDLA 2M3WA 2M7NA 2PYQA 1QX2A 2SASA 4JD9A 3SG4A 4A4BA 2K2FA 2R2IA 1EJ3A 1TRFA 1AJ4A 1UURA 3ICBA 3S0BA 1Q80A 1PULA 2I94A 3D74A 3KEVA 1XFZO 5G08A 2WCMA 3BJHA 3PM8A 1D1OA 3FE9A 1EG4A 3HX4A 1AHRA 2PVBA 4R1EA 1NSHA 3EG5B 1TNXA 1DC1A 1OZOA 1K95A 2WCHA 3QRXA 4OVNF 3RM1A 4E68A 3EK8A 2K7OA 3LL8B 4I5KA 3DF0B 1BF5A 1IRJA 1OOGA 4L9MA 4AQIA 2H61C 4FQOA 1L2OC 1DJYA 1J1EA 1M31A 1PK0D 1R2UA 2HQWA 2M7LA 1ZFSA 3JTDB 4ORBB 4D1EA 5HYDA 3JVTC 4NQGA 1F55A 5DKQA 2KBMA 1OOFA 1NX1A 1KFXL 3PATA 2JULA 2K8MB 1KK7Y 1W7JB 5FI2A 1BJFA 2L2CA 3B88A 3O4YA 3TDZA 2I2RE 4OCIA 4I5LB 3DXLA 1ODBA 3AKAA 2KFFA 1WDCC 3D73A 1BR1B 4QJ3B 2BBNA 2CTNA 4HSZA 1K90D 1CDPA 2Q4UA 1TNWA 1SSEB 2P71A 1CTRA 3VGOA 1SPYA 4N5XA 1KQVA 3DF0A 3D77A 3HCMA 1VRKA 4XYNA 2K61A 4PHMA 2BL0B 1KFUS 2HQ8A 1NWDA 1NX2A 2Y1NA 1XFXO 1DJHA 1C3YA 1CB1A 1QS7A 4DS7A 1FF1A 5K89A 2FOTA 2LVIA 2ZRTA 4I5NB 2HPSA 1BODA 1Z4HA 2M49B 4AQJA 1CFFA 2B1UA 4P2YB 1Y0VH 1NIWA 1IIOA 1JF2A 1SRAA 1QLKA 2LLTA 3Q8IA 1S36A 4NDBA 1KQMC 1DJIA 1FI6A 2BAPA 3DVEA 4A4CA 2FCDA 5IBWA 5CSFA 1WRLA 2OS8C 3SS5A 1L7ZA 1IJ6A 1M39A 1L2OB 1CLLA 2ERBA 1S6JA 3FS7A 3FE6A 3JVTB 2LE9B 1TN4A 3KHEA 3N7HA 4Q04A 3D76A 4YI9A 2V53A 1J7RA 1B8LA 3WHTB 2KNEA 4YGCB 3RLZA 1B7TZ 1XFUO 5FI7A 3TS5C 1QASA 3FE8A 2NLNA 5JOLA 1RWYA 3SS4A 2ZKMX 1BR4B 3L47A 1QV1A 3VRRA 3VRNA 1OW4A 5D7FA 1WDCB 4OZDA 3SIBA 2LHLA 4OV2A 4YRUA 4TNCA 2F3ZA 1TWOA 1YX8A 2M0RA 3S0DA 4PHJA 3BXKA 3EKJA 1IH0A 1YRUB 2P6BB 1CDNA 1OOIX 1G33A 2F8PA 2JNXA 2PSRA 2H61A 3FWCA 1OZSA 4I5JA 4BY5A 5I94A 1SBJA 1S6IA 1DF0B 2L2EA 3B6XA 4GGFA 4CPVA 2LUCA 4MVFA 3WHUB 3LCPC 2JT3A 1N2DA 1M63B 5D69A 1OMDA 1PSRA 2WCEA 1QX7A 1XVJA 4PCWA 2BCBA 2KQYA 1G4YR 1CMGA 3K21A 1EL4A 1KQMB 1OSAA 2GGZA 2KLEA 3NSIA 4YI8A 1QVIZ 4ICBA 5I2QA 3NSKA 2OS8B 3EK7A 1MHOA 2G9BA 2LUXA 1SK6D 2PQLA 1NPQA 2L5XB 5AXIA 3CR2A 3OHMB 2PMYA 1F8HA 3DD4A 1NCXA 1T14A 3L4AA 3NXAA 2M1UA 2MLFC 4MBEA 2KGRA 3NSOA 4PE7A 1S1EA 1DF0A 1YUUA 2YGUA 1QVIY 3I5IC 3TS5B 2FJUB 3WXAA 1SKTA 1QIWA 1LXFC 2WC5A 3BYAA 2F2OA 2AUCA 2KAXA 4QJ4B 2GGMA 2M97A 1WRZA 1Z2CB 3R72A 1C7VA 4WQ2A 1EG3A 2GTEA 2BL0C 5HLOA 1XFVO 2MA2A 2MHHA 4MRXA 5FI6A 1TCFA 2JTZA 2L98A 4IJ7A 1JBAA 2JPTA 1UUSA 4MRYA 3FWBA 2EC6C 5CSNA 2E30A 1UHHA 4MSPA 3SS3A 3CR5X 2JC2A 1JUOA 2HETA 1BU3A 2KAYA 2LC5A 5BPJA 3K1EA 1OE9B 1ZOTB 1XA5A 2M9GA 4MLWA 3S0EA 5PALA 1NUBA 1SNLA 2L51A 3FIAA 4GGFC 1DT7B 1BLQA 1KFXS 3BUXB 1N0YA 3PALA 2LNKA 2JRFA 1NYAA 1WLZA 1PALA 1W7IB 4GNKB 1CFDA 1C7WA 2DOQA 2KGBC 4ORAB 2BBMA 2JZIA 2KYCA 2LVJA 3OB2B 4C0KA 1Y1XA 1QV0A 1EXRA 5J3XA 2P70A 2Y5IA 2JXCA 3GOFA 3S0FA 1ORGA 2M29A 1NX3A 4OKHA 1YURA 3I5IB 2CCMA 4C0JA 2SCPA 3UNWA 3PLFB 2JPOA 1YUSA 3EVRA 1A4PA 1JF0A 1SW8A 2ZNDA 3UO9A 3I5FC 1QX5B 1AUIB 2BKHB 4YBHB 5I2LA 3D10A 5B8IB 1MWNA 3PM2A 1SCMC 1V1GA 2H2KA 3NHTA 4JKTA 1Y1UA 5FYXA 1TUZA 2NZ0A 1MF8B 1YTZC 2WC6A 1W9ZA 3EK4A 4MZJA 2Y4QA 5TNCA 2EC6B 4WRIA 1JFJA 2WCJA 5KU1A 1LA0A 3CZ2A 2KFHA 1F54A 2BKIB 3SG6A 1F4QA 1K8UA 2L0PA 1NX0A 3CZTX 2BECA 2F2PA 3S0GA 3GK1A 1CM1A 3BUOB 1ZUZA 2KQ6A 4YGBB 3C1VA 1J7QA 2EGDA 3EKHA 4DCKA 4JPZB 1KFUL 1B8CA 2L5YA 5AERA 1KWOC 1S5GZ 1UHKA 1CNPA 1SMGA 2MBXA 1WLMA 1XFRA 1OOHA 1A75B 3OGNA 1DMOA 1SCVA 3DVJA 2COLB 2L4IA 1HT9A 1M45A 2BCXA 3PN7B 3OB1B 3D0YB 5HKYA 3B7AA 5F6TA 3TUYB 4HRGA 1S26D 2K0JA 3BFBA 4AOMA 2L50A 2WCLA 2JQ6A 1K2HA 1KCYA 2D8NA 2PALA 3CZ1A 1KK8C 3MSEB 5DKRA 4QJ5B 3I5FB 1B4CA 3DVMA 1B7TY 2QEVA 2PASA 3BUWB 1DJWA 1N65A 2WCKA 4JQ0D 3CLNA 1SCMB 2AMIA 2WNDA 3CR4X 3R1PA 1XO5A 4N1GA 1E8AA 2LP3A 4CIDA 2F3YA 1YRTB 1KSMA 3OP0A 1AK8A 2QPTA 3E3RA 1NCYA 3TDUA 4ZCVA 1JSAA 2JU0A 3CTNA 1XYDA 1A75A 1F4OA 1RJVA 2BCAA 1A2XA 3AAKA 3CWGA 3R1OA 4MN0A 3BUMB 1NCZA 1LKJA 4GUKA 4C0LA 2KDHA 3D0YA 4CLNA 2L4HA 2KYFA 1TNPA 1HQVA 3NSLA 3PJIA 1AJ5A 2KI4C 3AKBA 2M1KB 4FQTA 1RROA 2BNXA 3TDIA 3OX5A 4P5OE 4YGEB 1KWOB 4HREE 1JFKA 1ALWA 1LINA 3SG3A 3CABA 2I7AA 3VB1A 2VRGA 5KSZA 4M2OA 2ISDA 1BMOA 4USLA 3RZSA 1U5IB 1CLMA 1PVAA 2MRDA 1QXPA 5DICA 1J7PA 4GBAA 2GV5A 3SG5A 4PDZA 5DKNA 1P28A 1G8IA 3A8RA 1MXLC 3BQ3A 2LLSA 1C07A 1J7OA 3LK1A 1GJYA 1SR6B 1FI5A 1KK8B 3VROA 4M2QA 1IJ5A 5CSIA 2LM5A 2LCPA 2WOSA 3S0AA 1H4BA 1B9AA 2LVKA 3DZTA 5HLVA 3LLEA 2WCBA 4CFRA 1K94A 2ZFDA 2KBIA 3I5GC 4PE4A 5ER5A 5ER4X 4XJKB 2NCOA 4GFTA 1DJZA 2OTGC 3PFVA 3ZNIA 5AEQA 1XK4C 1MQ1A 2HF5A 1JC2A 1U5IA 2O60A 4BY4A 1TIZA 3KO0A 3O6BA 2JWWA 1CFCA 4JWQA 3BOWB 3A4UB 1DEKA 3O78A 2KI4B 1ZMZA 4PE0A 4YGAA 2LHIA 4GPLB 1PVBA 4F0ZB 3ZWHA 1KK7Z 2KPHA 5EL2A 3NHIA 1B47A 3PN7C 2K60A 1WY9A 2M8UA 4DIRA 4IL1A 2AAOA 3TUYC 1QLSA 1ZACA 2LMVA 2WC8A 1CLBA 1XFYO 2KSPA 2FJYA 3F45A 2LV7A 4XJKA 1DJGA 2CXJA 2NXQA 1B8RA 3DYEA 3CDNA 1V1FA 1WRKA 3KPXA 1ALVA 3QMEA 3CYZA 3GK4X 2BE6A 1C3ZA 2F33A 3CGAA 3VRPA 5I2OA 2JTTA 2LVVA 3L4LA 1UHIA 1R6PA 2WCFA 5I8NA 1DVIA 1OMRA 2OPOA 5HL1A 1CKKA 1H8BA 3BOWA 1SYMA 3D75A 1GGWA 3GK2A 2O5GA 1IG5A 1GGZA 1SY9A 5HKZA 2TN4A 5CSJA 2KLDA 2E6WA 1EH2A 3I5GB 2LAPA 4GAOA 4PT1A 5D3OA 2LLUA 2JNFA 1MUXA 3KF9A 2OTGB 1IQ3A 3R1VA 3LK0A 4NDCA 1BG1A 1A03A 1FPWA 4PHKA 1OOJA 4N1FA 5CPVA 1TUJA 3O4XA 4M2PA 2QEHA 2KFGA 4GGNA 2IS9A 2QEBA 2KI6D 2PRUA 2EHBA 3I5HC 2QACA 1QJTA 1TTXA 1CMFA 3CZ0A 2ZN8A 1A29A 1UHJA 4ZCUA 3SJSA 2Q91A 1F71A 1OQPA 1YVLA 4INXA 5HKWA 2CT9A 3BUNB 1J1DA 3IQOA 3OX6A 1BOCA 2ZRSA 3SG7A 1SL8A 3IVTA 1SL9A 1K93D 1QWVA 3BFHA 4CFQA 1YVHA 1IWQA 1DELA 2K7BA 3PSRA 4INWA 3V2LA 5GQQC 1JWDA 1SR6C 3DY9A 1TCOB 3D78A 1GQMA 3IQQA 1RK9A 1S5GY 2JOJA 1SL7A 1QIVA 2WORA 2JT0A 1XK4A 5KTYA 1YR5A 2JT8A 1XFWO 3CS1A 1DGUA 4MZLA 2I18A 4MZKA 1F70A 1CDMA 2KAVA 2G2BA 1LS8A 4ORCB 1RFJA 4FTGA 2LANA 1QATA 1UWOA 3H4SE 1DQEA 1DTLA 3DVKA 5AANA 4F7FA 1UHNA 4PALA 1YUTA 3B86A 1MXEA 1LVCD 1DJXA 2BE4A 4PE1A 3EVVA 5AFPA 2QEOA 1S3PA 3NGVA 1LA3A 3TZ1A 2MJWB 2MAZA 1NP8A 1CM4A 3SIAA 1OMVA 4PHNA 1QTXA 1K9KA 2ZNEA 1K9PA 1BT6A 2QDIA 2Y1MA 1K96A 1MR8A 1CFPA 1FW4A 1UP5A 3SG2A 3O2PA 4YGDB 1DGVA 1RECA 1K9UA 3M0WA 3WNXB 3I5HB 4NDDA 1TNQA 3VRQA 3IF7A 1IKUA 1PRWA 1PSBA 3AAJA 1KSOA 3BFAA 3JTDC 2LP2A 4KYNA 2ZN9A 4WQ3A 4MEWA 2KHNA 4U8DA 4DRWA 1AVSA 4HRHA 2LMUA 2LMTA
chains in the Genus database with same CATH topology
1FBVA 1IGVA 2CNPA 1YX7A 4UPGA 2MLEC 2K2AA 1RTP1 1X02A 1B1GA 2JXLA 2KI6C 1Y1AA 1J55A 4DUQA 2KOTA 1IQ5A 2NCPA 2RGIA 4ETOA 1S6CA 2A4JA 2FCEA 1M46A 3EVUA 4OR9B 1AP4A 1Y6WA 2K7CA 2CBLA 2K7DA 5JJGA 1TOPA 1CDLA 2M3WA 2M7NA 1QX2A 2SASA 3SG4A 4A4BA 2K2FA 2R2IA 1EJ3A 1TRFA 1AJ4A 1UURA 3ICBA 1Q80A 1PULA 2I94A 3KEVA 1XFZO 5G08A 3PM8A 1D1OA 1EG4A 3HX4A 1AHRA 2PVBA 4R1EA 1NSHA 1TNXA 1OZOA 1K95A 4OVNF 3QRXA 3RM1A 4E68A 3EK8A 2K7OA 3LL8B 4I5KA 3DF0B 1BF5A 1IRJA 4L9MA 4AQIA 2H61C 4FQOA 1L2OC 1DJYA 1J1EA 1M31A 1PK0D 1R2UA 2HQWA 2M7LA 1ZFSA 3JTDB 4ORBB 4D1EA 5HYDA 3JVTC 4NQGA 1F55A 5DKQA 2KBMA 1NX1A 1KFXL 3PATA 2JULA 2K8MB 1KK7Y 1W7JB 1BJFA 3O4YA 3TDZA 2I2RE 4OCIA 4I5LB 1ODBA 3AKAA 2KFFA 1WDCC 4QJ3B 1BR1B 2BBNA 2CTNA 4HSZA 1K90D 1CDPA 2Q4UA 1TNWA 3VGOA 1CTRA 1SPYA 4N5XA 1KQVA 3DF0A 3HCMA 1VRKA 4XYNA 2K61A 4PHMA 2BL0B 1KFUS 2HQ8A 1NWDA 1NX2A 2Y1NA 1XFXO 1DJHA 1CB1A 1QS7A 4DS7A 1FF1A 5K89A 2FOTA 2LVIA 2ZRTA 4I5NB 2HPSA 1BODA 2M49B 4AQJA 1CFFA 2B1UA 4P2YB 1Y0VH 1NIWA 1JF2A 1SRAA 1QLKA 2LLTA 4NDBA 1S36A 1FI6A 1KQMC 1DJIA 3DVEA 4A4CA 2FCDA 5IBWA 5CSFA 1WRLA 2OS8C 1L7ZA 1IJ6A 1M39A 1L2OB 1CLLA 1S6JA 3FS7A 3JVTB 2LE9B 1TN4A 3KHEA 4Q04A 4YI9A 2V53A 1J7RA 1B8LA 3WHTB 2KNEA 4YGCB 3RLZA 1B7TZ 1XFUO 3TS5C 1QASA 2NLNA 5JOLA 1RWYA 2ZKMX 1BR4B 3VRRA 1QV1A 3VRNA 5D7FA 1WDCB 3SIBA 2LHLA 4OV2A 4YRUA 4TNCA 2F3ZA 1YX8A 2M0RA 4PHJA 3BXKA 3EKJA 1IH0A 1YRUB 2P6BB 1CDNA 1G33A 2F8PA 2JNXA 2PSRA 2H61A 3FWCA 1OZSA 4I5JA 4BY5A 1SBJA 1S6IA 1DF0B 2L2EA 4GGFA 4CPVA 2LUCA 4MVFA 3WHUB 3LCPC 2JT3A 1N2DA 1M63B 5D69A 1OMDA 1PSRA 2WCEA 1QX7A 1XVJA 4PCWA 2BCBA 2KQYA 1G4YR 1CMGA 3K21A 1EL4A 1KQMB 1OSAA 2GGZA 3NSIA 4YI8A 1QVIZ 4ICBA 5I2QA 3NSKA 2OS8B 3EK7A 1MHOA 2G9BA 2LUXA 1SK6D 1NPQA 2L5XB 5AXIA 3CR2A 3OHMB 2PMYA 1F8HA 3DD4A 1NCXA 3NXAA 2M1UA 2MLFC 4MBEA 2KGRA 3NSOA 4PE7A 1S1EA 1DF0A 1YUUA 3TS5B 1QVIY 3I5IC 3WXAA 2FJUB 1SKTA 1QIWA 1LXFC 3BYAA 2F2OA 2AUCA 2KAXA 4QJ4B 2GGMA 2M97A 1WRZA 1C7VA 4WQ2A 1EG3A 2BL0C 5HLOA 1XFVO 2MA2A 2MHHA 4MRXA 1TCFA 2JTZA 2L98A 1JBAA 2JPTA 1UUSA 4MRYA 3FWBA 2EC6C 5CSNA 2E30A 1UHHA 4MSPA 3CR5X 2JC2A 1JUOA 2HETA 1BU3A 2KAYA 2LC5A 5BPJA 1OE9B 1ZOTB 1XA5A 2M9GA 4MLWA 5PALA 1NUBA 1SNLA 2L51A 3FIAA 4GGFC 1DT7B 1BLQA 1KFXS 3BUXB 1N0YA 3PALA 2LNKA 2JRFA 1NYAA 1WLZA 1PALA 1W7IB 4GNKB 1CFDA 1C7WA 2DOQA 2KGBC 4ORAB 2BBMA 2JZIA 2KYCA 2LVJA 3OB2B 4C0KA 1Y1XA 1QV0A 1EXRA 5J3XA 2Y5IA 2JXCA 3GOFA 2M29A 1NX3A 4OKHA 1YURA 3I5IB 2CCMA 4C0JA 2SCPA 3PLFB 1YUSA 3EVRA 1A4PA 1JF0A 1SW8A 2ZNDA 3I5FC 1QX5B 1AUIB 2BKHB 4YBHB 5I2LA 3D10A 5B8IB 1MWNA 1SCMC 1V1GA 2H2KA 1Y1UA 5FYXA 2NZ0A 1MF8B 1YTZC 3EK4A 4MZJA 2Y4QA 5TNCA 2EC6B 4WRIA 1JFJA 5KU1A 1LA0A 2KFHA 1F54A 2BKIB 3SG6A 1F4QA 1K8UA 2L0PA 1NX0A 3CZTX 2BECA 2F2PA 3GK1A 1CM1A 3BUOB 1ZUZA 2KQ6A 4YGBB 3C1VA 1J7QA 2EGDA 3EKHA 4DCKA 4JPZB 1KFUL 1B8CA 5AERA 1KWOC 1S5GZ 1UHKA 1CNPA 1SMGA 2MBXA 1WLMA 1A75B 1DMOA 1SCVA 3DVJA 2COLB 2L4IA 1HT9A 1M45A 2BCXA 3PN7B 3OB1B 3D0YB 5HKYA 5KSZA 5F6TA 3TUYB 4HRGA 1S26D 2K0JA 4AOMA 2L50A 1KCYA 2JQ6A 1K2HA 2D8NA 2PALA 1KK8C 3MSEB 5DKRA 4QJ5B 3I5FB 1B4CA 3DVMA 1B7TY 2PASA 3BUWB 1DJWA 1N65A 4JQ0D 3CLNA 1SCMB 2AMIA 2WNDA 3CR4X 1XO5A 4N1GA 1E8AA 2LP3A 4CIDA 2F3YA 1YRTB 1KSMA 3OP0A 1AK8A 2QPTA 3E3RA 1NCYA 3TDUA 4ZCVA 1JSAA 2JU0A 3CTNA 1XYDA 1A75A 1F4OA 1RJVA 2BCAA 1A2XA 3AAKA 3CWGA 4MN0A 3BUMB 1NCZA 1LKJA 4GUKA 4C0LA 2KDHA 3D0YA 4CLNA 2L4HA 2KYFA 1TNPA 1HQVA 3NSLA 1AJ5A 2KI4C 3AKBA 2M1KB 1RROA 3TDIA 3OX5A 4P5OE 4YGEB 1KWOB 4HREE 1JFKA 1ALWA 1LINA 3SG3A 2I7AA 2VRGA 4M2OA 2ISDA 1BMOA 4USLA 1U5IB 1CLMA 1PVAA 2MRDA 1QXPA 1J7PA 4GBAA 2GV5A 3SG5A 4PDZA 5DKNA 1G8IA 3A8RA 1MXLC 3BQ3A 2LLSA 1C07A 1J7OA 3LK1A 1GJYA 1SR6B 1FI5A 1KK8B 3VROA 4M2QA 1IJ5A 5CSIA 2LM5A 2LCPA 2WOSA 1H4BA 1B9AA 2LVKA 5HLVA 3LLEA 2WCBA 4CFRA 1K94A 2ZFDA 2KBIA 3I5GC 4PE4A 5ER5A 5ER4X 4XJKB 2NCOA 4GFTA 1DJZA 2OTGC 3PFVA 3ZNIA 5AEQA 1XK4C 1MQ1A 2HF5A 1JC2A 1U5IA 2O60A 4BY4A 1TIZA 3KO0A 3O6BA 2JWWA 1CFCA 4JWQA 3BOWB 3A4UB 3O78A 2KI4B 1ZMZA 4PE0A 4YGAA 2LHIA 4GPLB 1PVBA 4F0ZB 3ZWHA 1KK7Z 1B47A 3PN7C 4DIRA 1WY9A 2M8UA 4IL1A 2AAOA 3TUYC 1QLSA 1ZACA 2LMVA 2WC8A 1CLBA 1XFYO 2KSPA 4XJKA 3F45A 2LV7A 1DJGA 2CXJA 2NXQA 1B8RA 1V1FA 1WRKA 3KPXA 1ALVA 3GK4X 2BE6A 2F33A 3CGAA 3VRPA 5I2OA 2JTTA 2LVVA 1UHIA 1R6PA 2WCFA 5I8NA 1DVIA 1OMRA 2OPOA 1CKKA 1H8BA 3BOWA 1SYMA 1GGWA 3GK2A 2O5GA 1IG5A 1GGZA 1SY9A 5HKZA 2TN4A 5CSJA 2E6WA 1EH2A 3I5GB 2LAPA 4GAOA 2LLUA 2JNFA 1MUXA 3KF9A 2OTGB 1IQ3A 3LK0A 4NDCA 1BG1A 1A03A 1FPWA 4PHKA 1OOJA 4N1FA 5CPVA 4M2PA 2KFGA 4GGNA 2IS9A 2KI6D 2PRUA 2EHBA 3I5HC 2QACA 1QJTA 1TTXA 1CMFA 2ZN8A 1A29A 1UHJA 4ZCUA 3SJSA 2Q91A 1F71A 1OQPA 1YVLA 5HKWA 2CT9A 3BUNB 1J1DA 3IQOA 3OX6A 1BOCA 2ZRSA 3SG7A 1SL8A 1SL9A 1K93D 4CFQA 1YVHA 1IWQA 2K7BA 3PSRA 5GQQC 1JWDA 1SR6C 1TCOB 1GQMA 3IQQA 1RK9A 1S5GY 2JOJA 1SL7A 1QIVA 2WORA 2JT0A 1XK4A 5KTYA 1YR5A 2JT8A 1XFWO 3CS1A 1DGUA 4MZLA 2I18A 4MZKA 1F70A 1CDMA 2KAVA 2G2BA 4ORCB 1RFJA 4FTGA 2LANA 1QATA 1UWOA 3H4SE 1DTLA 3DVKA 5AANA 1UHNA 4PALA 1YUTA 1MXEA 1LVCD 1DJXA 2BE4A 4PE1A 3EVVA 5AFPA 3TZ1A 1S3PA 1LA3A 2MJWB 2MAZA 1NP8A 1CM4A 3SIAA 1OMVA 4PHNA 1QTXA 1K9KA 2ZNEA 1K9PA 1BT6A 2Y1MA 1K96A 1MR8A 1CFPA 1FW4A 1UP5A 3SG2A 3O2PA 4YGDB 1DGVA 1RECA 1K9UA 3M0WA 3WNXB 3I5HB 4NDDA 1TNQA 3VRQA 3IF7A 1IKUA 1PRWA 1PSBA 3AAJA 1KSOA 3JTDC 2LP2A 2ZN9A 4WQ3A 4MEWA 2KHNA 4U8DA 4DRWA 1AVSA 4HRHA 2LMUA 2LMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  1IGV A;  2CNP A;  1YX7 A;  4UPG A;  2MLE C;  2K2A A;  1RTP 1;  1X02 A;  1B1G A;  2JXL A;  2KI6 C;  1Y1A A;  1J55 A;  4DUQ A;  2KOT A;  1IQ5 A;  2NCP A;  2RGI A;  4ETO A;  1S6C A;  2A4J A;  2FCE A;  1M46 A;  3EVU A;  4OR9 B;  1AP4 A;  1Y6W A;  2K7C A;  2CBL A;  2K7D A;  5JJG A;  1TOP A;  1CDL A;  2M3W A;  2M7N A;  1QX2 A;  2SAS A;  3SG4 A;  4A4B A;  2K2F A;  2R2I A;  1EJ3 A;  1TRF A;  1AJ4 A;  1UUR A;  3ICB A;  1Q80 A;  1PUL A;  2I94 A;  3KEV A;  1XFZ O;  5G08 A;  3PM8 A;  1D1O A;  1EG4 A;  3HX4 A;  1AHR A;  2PVB A;  4R1E A;  1NSH A;  1TNX A;  1OZO A;  1K95 A;  4OVN F;  3QRX A;  3RM1 A;  4E68 A;  3EK8 A;  2K7O A;  3LL8 B;  4I5K A;  3DF0 B;  1BF5 A;  1IRJ A;  4L9M A;  4AQI A;  2H61 C;  4FQO A;  1L2O C;  1DJY A;  1J1E A;  1M31 A;  1PK0 D;  1R2U A;  2HQW A;  2M7L A;  1ZFS A;  3JTD B;  4ORB B;  4D1E A;  5HYD A;  3JVT C;  4NQG A;  1F55 A;  5DKQ A;  2KBM A;  1NX1 A;  1KFX L;  3PAT A;  2JUL A;  2K8M B;  1KK7 Y;  1W7J B;  1BJF A;  3O4Y A;  3TDZ A;  2I2R E;  4OCI A;  4I5L B;  1ODB A;  3AKA A;  2KFF A;  1WDC C;  4QJ3 B;  1BR1 B;  2BBN A;  2CTN A;  4HSZ A;  1K90 D;  1CDP A;  2Q4U A;  1TNW A;  3VGO A;  1CTR A;  1SPY A;  4N5X A;  1KQV A;  3DF0 A;  3HCM A;  1VRK A;  4XYN A;  2K61 A;  4PHM A;  2BL0 B;  1KFU S;  2HQ8 A;  1NWD A;  1NX2 A;  2Y1N A;  1XFX O;  1DJH A;  1CB1 A;  1QS7 A;  4DS7 A;  1FF1 A;  5K89 A;  2FOT A;  2LVI A;  2ZRT A;  4I5N B;  2HPS A;  1BOD A;  2M49 B;  4AQJ A;  1CFF A;  2B1U A;  4P2Y B;  1Y0V H;  1NIW A;  1JF2 A;  1SRA A;  1QLK A;  2LLT A;  4NDB A;  1S36 A;  1FI6 A;  1KQM C;  1DJI A;  3DVE A;  4A4C A;  2FCD A;  5IBW A;  5CSF A;  1WRL A;  2OS8 C;  1L7Z A;  1IJ6 A;  1M39 A;  1L2O B;  1CLL A;  1S6J A;  3FS7 A;  3JVT B;  2LE9 B;  1TN4 A;  3KHE A;  4Q04 A;  4YI9 A;  2V53 A;  1J7R A;  1B8L A;  3WHT B;  2KNE A;  4YGC B;  3RLZ A;  1B7T Z;  1XFU O;  3TS5 C;  1QAS A;  2NLN A;  5JOL A;  1RWY A;  2ZKM X;  1BR4 B;  3VRR A;  1QV1 A;  3VRN A;  5D7F A;  1WDC B;  3SIB A;  2LHL A;  4OV2 A;  4YRU A;  4TNC A;  2F3Z A;  1YX8 A;  2M0R A;  4PHJ A;  3BXK A;  3EKJ A;  1IH0 A;  1YRU B;  2P6B B;  1CDN A;  1G33 A;  2F8P A;  2JNX A;  2PSR A;  2H61 A;  3FWC A;  1OZS A;  4I5J A;  4BY5 A;  1SBJ A;  1S6I A;  1DF0 B;  2L2E A;  4GGF A;  4CPV A;  2LUC A;  4MVF A;  3WHU B;  3LCP C;  2JT3 A;  1N2D A;  1M63 B;  5D69 A;  1OMD A;  1PSR A;  2WCE A;  1QX7 A;  1XVJ A;  4PCW A;  2BCB A;  2KQY A;  1G4Y R;  1CMG A;  3K21 A;  1EL4 A;  1KQM B;  1OSA A;  2GGZ A;  3NSI A;  4YI8 A;  1QVI Z;  4ICB A;  5I2Q A;  3NSK A;  2OS8 B;  3EK7 A;  1MHO A;  2G9B A;  2LUX A;  1SK6 D;  1NPQ A;  2L5X B;  5AXI A;  3CR2 A;  3OHM B;  2PMY A;  1F8H A;  3DD4 A;  1NCX A;  3NXA A;  2M1U A;  2MLF C;  4MBE A;  2KGR A;  3NSO A;  4PE7 A;  1S1E A;  1DF0 A;  1YUU A;  3TS5 B;  1QVI Y;  3I5I C;  3WXA A;  2FJU B;  1SKT A;  1QIW A;  1LXF C;  3BYA A;  2F2O A;  2AUC A;  2KAX A;  4QJ4 B;  2GGM A;  2M97 A;  1WRZ A;  1C7V A;  4WQ2 A;  1EG3 A;  2BL0 C;  5HLO A;  1XFV O;  2MA2 A;  2MHH A;  4MRX A;  1TCF A;  2JTZ A;  2L98 A;  1JBA A;  2JPT A;  1UUS A;  4MRY A;  3FWB A;  2EC6 C;  5CSN A;  2E30 A;  1UHH A;  4MSP A;  3CR5 X;  2JC2 A;  1JUO A;  2HET A;  1BU3 A;  2KAY A;  2LC5 A;  5BPJ A;  1OE9 B;  1ZOT B;  1XA5 A;  2M9G A;  4MLW A;  5PAL A;  1NUB A;  1SNL A;  2L51 A;  3FIA A;  4GGF C;  1DT7 B;  1BLQ A;  1KFX S;  3BUX B;  1N0Y A;  3PAL A;  2LNK A;  2JRF A;  1NYA A;  1WLZ A;  1PAL A;  1W7I B;  4GNK B;  1CFD A;  1C7W A;  2DOQ A;  2KGB C;  4ORA B;  2BBM A;  2JZI A;  2KYC A;  2LVJ A;  3OB2 B;  4C0K A;  1Y1X A;  1QV0 A;  1EXR A;  5J3X A;  2Y5I A;  2JXC A;  3GOF A;  2M29 A;  1NX3 A;  4OKH A;  1YUR A;  3I5I B;  2CCM A;  4C0J A;  2SCP A;  3PLF B;  1YUS A;  3EVR A;  1A4P A;  1JF0 A;  1SW8 A;  2ZND A;  3I5F C;  1QX5 B;  1AUI B;  2BKH B;  4YBH B;  5I2L A;  3D10 A;  5B8I B;  1MWN A;  1SCM C;  1V1G A;  2H2K A;  1Y1U A;  5FYX A;  2NZ0 A;  1MF8 B;  1YTZ C;  3EK4 A;  4MZJ A;  2Y4Q A;  5TNC A;  2EC6 B;  4WRI A;  1JFJ A;  5KU1 A;  1LA0 A;  2KFH A;  1F54 A;  2BKI B;  3SG6 A;  1F4Q A;  1K8U A;  2L0P A;  1NX0 A;  3CZT X;  2BEC A;  2F2P A;  3GK1 A;  1CM1 A;  3BUO B;  1ZUZ A;  2KQ6 A;  4YGB B;  3C1V A;  1J7Q A;  2EGD A;  3EKH A;  4DCK A;  4JPZ B;  1KFU L;  1B8C A;  5AER A;  1KWO C;  1S5G Z;  1UHK A;  1CNP A;  1SMG A;  2MBX A;  1WLM A;  1A75 B;  1DMO A;  1SCV A;  3DVJ A;  2COL B;  2L4I A;  1HT9 A;  1M45 A;  2BCX A;  3PN7 B;  3OB1 B;  3D0Y B;  5HKY A;  5KSZ A;  5F6T A;  3TUY B;  4HRG A;  1S26 D;  2K0J A;  4AOM A;  2L50 A;  1KCY A;  2JQ6 A;  1K2H A;  2D8N A;  2PAL A;  1KK8 C;  3MSE B;  5DKR A;  4QJ5 B;  3I5F B;  1B4C A;  3DVM A;  1B7T Y;  2PAS A;  3BUW B;  1DJW A;  1N65 A;  4JQ0 D;  3CLN A;  1SCM B;  2AMI A;  2WND A;  3CR4 X;  1XO5 A;  4N1G A;  1E8A A;  2LP3 A;  4CID A;  2F3Y A;  1YRT B;  1KSM A;  3OP0 A;  1AK8 A;  2QPT A;  3E3R A;  1NCY A;  3TDU A;  4ZCV A;  1JSA A;  2JU0 A;  3CTN A;  1XYD A;  1A75 A;  1F4O A;  1RJV A;  2BCA A;  1A2X A;  3AAK A;  3CWG A;  4MN0 A;  3BUM B;  1NCZ A;  1LKJ A;  4GUK A;  4C0L A;  2KDH A;  3D0Y A;  4CLN A;  2L4H A;  2KYF A;  1TNP A;  1HQV A;  3NSL A;  1AJ5 A;  2KI4 C;  3AKB A;  2M1K B;  1RRO A;  3TDI A;  3OX5 A;  4P5O E;  4YGE B;  1KWO B;  4HRE E;  1JFK A;  1ALW A;  1LIN A;  3SG3 A;  2I7A A;  2VRG A;  4M2O A;  2ISD A;  1BMO A;  4USL A;  1U5I B;  1CLM A;  1PVA A;  2MRD A;  1QXP A;  1J7P A;  4GBA A;  2GV5 A;  3SG5 A;  4PDZ A;  5DKN A;  1G8I A;  3A8R A;  1MXL C;  3BQ3 A;  2LLS A;  1C07 A;  1J7O A;  3LK1 A;  1GJY A;  1SR6 B;  1FI5 A;  1KK8 B;  3VRO A;  4M2Q A;  1IJ5 A;  5CSI A;  2LM5 A;  2LCP A;  2WOS A;  1H4B A;  1B9A A;  2LVK A;  5HLV A;  3LLE A;  2WCB A;  4CFR A;  1K94 A;  2ZFD A;  2KBI A;  3I5G C;  4PE4 A;  5ER5 A;  5ER4 X;  4XJK B;  2NCO A;  4GFT A;  1DJZ A;  2OTG C;  3PFV A;  3ZNI A;  5AEQ A;  1XK4 C;  1MQ1 A;  2HF5 A;  1JC2 A;  1U5I A;  2O60 A;  4BY4 A;  1TIZ A;  3KO0 A;  3O6B A;  2JWW A;  1CFC A;  4JWQ A;  3BOW B;  3A4U B;  3O78 A;  2KI4 B;  1ZMZ A;  4PE0 A;  4YGA A;  2LHI A;  4GPL B;  1PVB A;  4F0Z B;  3ZWH A;  1KK7 Z;  1B47 A;  3PN7 C;  4DIR A;  1WY9 A;  2M8U A;  4IL1 A;  2AAO A;  3TUY C;  1QLS A;  1ZAC A;  2LMV A;  2WC8 A;  1CLB A;  1XFY O;  2KSP A;  4XJK A;  3F45 A;  2LV7 A;  1DJG A;  2CXJ A;  2NXQ A;  1B8R A;  1V1F A;  1WRK A;  3KPX A;  1ALV A;  3GK4 X;  2BE6 A;  2F33 A;  3CGA A;  3VRP A;  5I2O A;  2JTT A;  2LVV A;  1UHI A;  1R6P A;  2WCF A;  5I8N A;  1DVI A;  1OMR A;  2OPO A;  1CKK A;  1H8B A;  3BOW A;  1SYM A;  1GGW A;  3GK2 A;  2O5G A;  1IG5 A;  1GGZ A;  1SY9 A;  5HKZ A;  2TN4 A;  5CSJ A;  2E6W A;  1EH2 A;  3I5G B;  2LAP A;  4GAO A;  2LLU A;  2JNF A;  1MUX A;  3KF9 A;  2OTG B;  1IQ3 A;  3LK0 A;  4NDC A;  1BG1 A;  1A03 A;  1FPW A;  4PHK A;  1OOJ A;  4N1F A;  5CPV A;  4M2P A;  2KFG A;  4GGN A;  2IS9 A;  2KI6 D;  2PRU A;  2EHB A;  3I5H C;  2QAC A;  1QJT A;  1TTX A;  1CMF A;  2ZN8 A;  1A29 A;  1UHJ A;  4ZCU A;  3SJS A;  2Q91 A;  1F71 A;  1OQP A;  1YVL A;  5HKW A;  2CT9 A;  3BUN B;  1J1D A;  3IQO A;  3OX6 A;  1BOC A;  2ZRS A;  3SG7 A;  1SL8 A;  1SL9 A;  1K93 D;  4CFQ A;  1YVH A;  1IWQ A;  2K7B A;  3PSR A;  5GQQ C;  1JWD A;  1SR6 C;  1TCO B;  1GQM A;  3IQQ A;  1RK9 A;  1S5G Y;  2JOJ A;  1SL7 A;  1QIV A;  2WOR A;  2JT0 A;  1XK4 A;  5KTY A;  1YR5 A;  2JT8 A;  1XFW O;  3CS1 A;  1DGU A;  4MZL A;  2I18 A;  4MZK A;  1F70 A;  1CDM A;  2KAV A;  2G2B A;  4ORC B;  1RFJ A;  4FTG A;  2LAN A;  1QAT A;  1UWO A;  3H4S E;  1DTL A;  3DVK A;  5AAN A;  1UHN A;  4PAL A;  1YUT A;  1MXE A;  1LVC D;  1DJX A;  2BE4 A;  4PE1 A;  3EVV A;  5AFP A;  3TZ1 A;  1S3P A;  1LA3 A;  2MJW B;  2MAZ A;  1NP8 A;  1CM4 A;  3SIA A;  1OMV A;  4PHN A;  1QTX A;  1K9K A;  2ZNE A;  1K9P A;  1BT6 A;  2Y1M A;  1K96 A;  1MR8 A;  1CFP A;  1FW4 A;  1UP5 A;  3SG2 A;  3O2P A;  4YGD B;  1DGV A;  1REC A;  1K9U A;  3M0W A;  3WNX B;  3I5H B;  4NDD A;  1TNQ A;  3VRQ A;  3IF7 A;  1IKU A;  1PRW A;  1PSB A;  3AAJ A;  1KSO A;  3JTD C;  2LP2 A;  2ZN9 A;  4WQ3 A;  4MEW A;  2KHN A;  4U8D A;  4DRW A;  1AVS A;  4HRH A;  2LMU A;  2LMT A; 
#chains in the Genus database with same CATH topology
 1FBV A;  1IGV A;  2CNP A;  1YX7 A;  4UPG A;  2MLE C;  3B87 A;  2H8V A;  2K2A A;  1RTP 1;  1X02 A;  1B1G A;  2JXL A;  2KI6 C;  1Y1A A;  1J55 A;  4DUQ A;  2KOT A;  1IQ5 A;  2NCP A;  2RGI A;  4ETO A;  1S6C A;  2A4J A;  2FCE A;  1M46 A;  3EVU A;  4OR9 B;  1AP4 A;  1Y6W A;  2K7C A;  2CBL A;  1GM0 A;  3OBV A;  2K7D A;  5JJG A;  1TOP A;  1CDL A;  2M3W A;  2M7N A;  2PYQ A;  1QX2 A;  2SAS A;  4JD9 A;  3SG4 A;  4A4B A;  2K2F A;  2R2I A;  1EJ3 A;  1TRF A;  1AJ4 A;  1UUR A;  3ICB A;  3S0B A;  1Q80 A;  1PUL A;  2I94 A;  3D74 A;  3KEV A;  1XFZ O;  5G08 A;  2WCM A;  3BJH A;  3PM8 A;  1D1O A;  3FE9 A;  1EG4 A;  3HX4 A;  1AHR A;  2PVB A;  4R1E A;  1NSH A;  3EG5 B;  1TNX A;  1DC1 A;  1OZO A;  1K95 A;  2WCH A;  3QRX A;  4OVN F;  3RM1 A;  4E68 A;  3EK8 A;  2K7O A;  3LL8 B;  4I5K A;  3DF0 B;  1BF5 A;  1IRJ A;  1OOG A;  4L9M A;  4AQI A;  2H61 C;  4FQO A;  1L2O C;  1DJY A;  1J1E A;  1M31 A;  1PK0 D;  1R2U A;  2HQW A;  2M7L A;  1ZFS A;  3JTD B;  4ORB B;  4D1E A;  5HYD A;  3JVT C;  4NQG A;  1F55 A;  5DKQ A;  2KBM A;  1OOF A;  1NX1 A;  1KFX L;  3PAT A;  2JUL A;  2K8M B;  1KK7 Y;  1W7J B;  5FI2 A;  1BJF A;  2L2C A;  3B88 A;  3O4Y A;  3TDZ A;  2I2R E;  4OCI A;  4I5L B;  3DXL A;  1ODB A;  3AKA A;  2KFF A;  1WDC C;  3D73 A;  1BR1 B;  4QJ3 B;  2BBN A;  2CTN A;  4HSZ A;  1K90 D;  1CDP A;  2Q4U A;  1TNW A;  1SSE B;  2P71 A;  1CTR A;  3VGO A;  1SPY A;  4N5X A;  1KQV A;  3DF0 A;  3D77 A;  3HCM A;  1VRK A;  4XYN A;  2K61 A;  4PHM A;  2BL0 B;  1KFU S;  2HQ8 A;  1NWD A;  1NX2 A;  2Y1N A;  1XFX O;  1DJH A;  1C3Y A;  1CB1 A;  1QS7 A;  4DS7 A;  1FF1 A;  5K89 A;  2FOT A;  2LVI A;  2ZRT A;  4I5N B;  2HPS A;  1BOD A;  1Z4H A;  2M49 B;  4AQJ A;  1CFF A;  2B1U A;  4P2Y B;  1Y0V H;  1NIW A;  1IIO A;  1JF2 A;  1SRA A;  1QLK A;  2LLT A;  3Q8I A;  1S36 A;  4NDB A;  1KQM C;  1DJI A;  1FI6 A;  2BAP A;  3DVE A;  4A4C A;  2FCD A;  5IBW A;  5CSF A;  1WRL A;  2OS8 C;  3SS5 A;  1L7Z A;  1IJ6 A;  1M39 A;  1L2O B;  1CLL A;  2ERB A;  1S6J A;  3FS7 A;  3FE6 A;  3JVT B;  2LE9 B;  1TN4 A;  3KHE A;  3N7H A;  4Q04 A;  3D76 A;  4YI9 A;  2V53 A;  1J7R A;  1B8L A;  3WHT B;  2KNE A;  4YGC B;  3RLZ A;  1B7T Z;  1XFU O;  5FI7 A;  3TS5 C;  1QAS A;  3FE8 A;  2NLN A;  5JOL A;  1RWY A;  3SS4 A;  2ZKM X;  1BR4 B;  3L47 A;  1QV1 A;  3VRR A;  3VRN A;  1OW4 A;  5D7F A;  1WDC B;  4OZD A;  3SIB A;  2LHL A;  4OV2 A;  4YRU A;  4TNC A;  2F3Z A;  1TWO A;  1YX8 A;  2M0R A;  3S0D A;  4PHJ A;  3BXK A;  3EKJ A;  1IH0 A;  1YRU B;  2P6B B;  1CDN A;  1OOI X;  1G33 A;  2F8P A;  2JNX A;  2PSR A;  2H61 A;  3FWC A;  1OZS A;  4I5J A;  4BY5 A;  5I94 A;  1SBJ A;  1S6I A;  1DF0 B;  2L2E A;  3B6X A;  4GGF A;  4CPV A;  2LUC A;  4MVF A;  3WHU B;  3LCP C;  2JT3 A;  1N2D A;  1M63 B;  5D69 A;  1OMD A;  1PSR A;  2WCE A;  1QX7 A;  1XVJ A;  4PCW A;  2BCB A;  2KQY A;  1G4Y R;  1CMG A;  3K21 A;  1EL4 A;  1KQM B;  1OSA A;  2GGZ A;  2KLE A;  3NSI A;  4YI8 A;  1QVI Z;  4ICB A;  5I2Q A;  3NSK A;  2OS8 B;  3EK7 A;  1MHO A;  2G9B A;  2LUX A;  1SK6 D;  2PQL A;  1NPQ A;  2L5X B;  5AXI A;  3CR2 A;  3OHM B;  2PMY A;  1F8H A;  3DD4 A;  1NCX A;  1T14 A;  3L4A A;  3NXA A;  2M1U A;  2MLF C;  4MBE A;  2KGR A;  3NSO A;  4PE7 A;  1S1E A;  1DF0 A;  1YUU A;  2YGU A;  1QVI Y;  3I5I C;  3TS5 B;  2FJU B;  3WXA A;  1SKT A;  1QIW A;  1LXF C;  2WC5 A;  3BYA A;  2F2O A;  2AUC A;  2KAX A;  4QJ4 B;  2GGM A;  2M97 A;  1WRZ A;  1Z2C B;  3R72 A;  1C7V A;  4WQ2 A;  1EG3 A;  2GTE A;  2BL0 C;  5HLO A;  1XFV O;  2MA2 A;  2MHH A;  4MRX A;  5FI6 A;  1TCF A;  2JTZ A;  2L98 A;  4IJ7 A;  1JBA A;  2JPT A;  1UUS A;  4MRY A;  3FWB A;  2EC6 C;  5CSN A;  2E30 A;  1UHH A;  4MSP A;  3SS3 A;  3CR5 X;  2JC2 A;  1JUO A;  2HET A;  1BU3 A;  2KAY A;  2LC5 A;  5BPJ A;  3K1E A;  1OE9 B;  1ZOT B;  1XA5 A;  2M9G A;  4MLW A;  3S0E A;  5PAL A;  1NUB A;  1SNL A;  2L51 A;  3FIA A;  4GGF C;  1DT7 B;  1BLQ A;  1KFX S;  3BUX B;  1N0Y A;  3PAL A;  2LNK A;  2JRF A;  1NYA A;  1WLZ A;  1PAL A;  1W7I B;  4GNK B;  1CFD A;  1C7W A;  2DOQ A;  2KGB C;  4ORA B;  2BBM A;  2JZI A;  2KYC A;  2LVJ A;  3OB2 B;  4C0K A;  1Y1X A;  1QV0 A;  1EXR A;  5J3X A;  2P70 A;  2Y5I A;  2JXC A;  3GOF A;  3S0F A;  1ORG A;  2M29 A;  1NX3 A;  4OKH A;  1YUR A;  3I5I B;  2CCM A;  4C0J A;  2SCP A;  3UNW A;  3PLF B;  2JPO A;  1YUS A;  3EVR A;  1A4P A;  1JF0 A;  1SW8 A;  2ZND A;  3UO9 A;  3I5F C;  1QX5 B;  1AUI B;  2BKH B;  4YBH B;  5I2L A;  3D10 A;  5B8I B;  1MWN A;  3PM2 A;  1SCM C;  1V1G A;  2H2K A;  3NHT A;  4JKT A;  1Y1U A;  5FYX A;  1TUZ A;  2NZ0 A;  1MF8 B;  1YTZ C;  2WC6 A;  1W9Z A;  3EK4 A;  4MZJ A;  2Y4Q A;  5TNC A;  2EC6 B;  4WRI A;  1JFJ A;  2WCJ A;  5KU1 A;  1LA0 A;  3CZ2 A;  2KFH A;  1F54 A;  2BKI B;  3SG6 A;  1F4Q A;  1K8U A;  2L0P A;  1NX0 A;  3CZT X;  2BEC A;  2F2P A;  3S0G A;  3GK1 A;  1CM1 A;  3BUO B;  1ZUZ A;  2KQ6 A;  4YGB B;  3C1V A;  1J7Q A;  2EGD A;  3EKH A;  4DCK A;  4JPZ B;  1KFU L;  1B8C A;  2L5Y A;  5AER A;  1KWO C;  1S5G Z;  1UHK A;  1CNP A;  1SMG A;  2MBX A;  1WLM A;  1XFR A;  1OOH A;  1A75 B;  3OGN A;  1DMO A;  1SCV A;  3DVJ A;  2COL B;  2L4I A;  1HT9 A;  1M45 A;  2BCX A;  3PN7 B;  3OB1 B;  3D0Y B;  5HKY A;  3B7A A;  5F6T A;  3TUY B;  4HRG A;  1S26 D;  2K0J A;  3BFB A;  4AOM A;  2L50 A;  2WCL A;  2JQ6 A;  1K2H A;  1KCY A;  2D8N A;  2PAL A;  3CZ1 A;  1KK8 C;  3MSE B;  5DKR A;  4QJ5 B;  3I5F B;  1B4C A;  3DVM A;  1B7T Y;  2QEV A;  2PAS A;  3BUW B;  1DJW A;  1N65 A;  2WCK A;  4JQ0 D;  3CLN A;  1SCM B;  2AMI A;  2WND A;  3CR4 X;  3R1P A;  1XO5 A;  4N1G A;  1E8A A;  2LP3 A;  4CID A;  2F3Y A;  1YRT B;  1KSM A;  3OP0 A;  1AK8 A;  2QPT A;  3E3R A;  1NCY A;  3TDU A;  4ZCV A;  1JSA A;  2JU0 A;  3CTN A;  1XYD A;  1A75 A;  1F4O A;  1RJV A;  2BCA A;  1A2X A;  3AAK A;  3CWG A;  3R1O A;  4MN0 A;  3BUM B;  1NCZ A;  1LKJ A;  4GUK A;  4C0L A;  2KDH A;  3D0Y A;  4CLN A;  2L4H A;  2KYF A;  1TNP A;  1HQV A;  3NSL A;  3PJI A;  1AJ5 A;  2KI4 C;  3AKB A;  2M1K B;  4FQT A;  1RRO A;  2BNX A;  3TDI A;  3OX5 A;  4P5O E;  4YGE B;  1KWO B;  4HRE E;  1JFK A;  1ALW A;  1LIN A;  3SG3 A;  3CAB A;  2I7A A;  3VB1 A;  2VRG A;  5KSZ A;  4M2O A;  2ISD A;  1BMO A;  4USL A;  3RZS A;  1U5I B;  1CLM A;  1PVA A;  2MRD A;  1QXP A;  5DIC A;  1J7P A;  4GBA A;  2GV5 A;  3SG5 A;  4PDZ A;  5DKN A;  1P28 A;  1G8I A;  3A8R A;  1MXL C;  3BQ3 A;  2LLS A;  1C07 A;  1J7O A;  3LK1 A;  1GJY A;  1SR6 B;  1FI5 A;  1KK8 B;  3VRO A;  4M2Q A;  1IJ5 A;  5CSI A;  2LM5 A;  2LCP A;  2WOS A;  3S0A A;  1H4B A;  1B9A A;  2LVK A;  3DZT A;  5HLV A;  3LLE A;  2WCB A;  4CFR A;  1K94 A;  2ZFD A;  2KBI A;  3I5G C;  4PE4 A;  5ER5 A;  5ER4 X;  4XJK B;  2NCO A;  4GFT A;  1DJZ A;  2OTG C;  3PFV A;  3ZNI A;  5AEQ A;  1XK4 C;  1MQ1 A;  2HF5 A;  1JC2 A;  1U5I A;  2O60 A;  4BY4 A;  1TIZ A;  3KO0 A;  3O6B A;  2JWW A;  1CFC A;  4JWQ A;  3BOW B;  3A4U B;  1DEK A;  3O78 A;  2KI4 B;  1ZMZ A;  4PE0 A;  4YGA A;  2LHI A;  4GPL B;  1PVB A;  4F0Z B;  3ZWH A;  1KK7 Z;  2KPH A;  5EL2 A;  3NHI A;  1B47 A;  3PN7 C;  2K60 A;  1WY9 A;  2M8U A;  4DIR A;  4IL1 A;  2AAO A;  3TUY C;  1QLS A;  1ZAC A;  2LMV A;  2WC8 A;  1CLB A;  1XFY O;  2KSP A;  2FJY A;  3F45 A;  2LV7 A;  4XJK A;  1DJG A;  2CXJ A;  2NXQ A;  1B8R A;  3DYE A;  3CDN A;  1V1F A;  1WRK A;  3KPX A;  1ALV A;  3QME A;  3CYZ A;  3GK4 X;  2BE6 A;  1C3Z A;  2F33 A;  3CGA A;  3VRP A;  5I2O A;  2JTT A;  2LVV A;  3L4L A;  1UHI A;  1R6P A;  2WCF A;  5I8N A;  1DVI A;  1OMR A;  2OPO A;  5HL1 A;  1CKK A;  1H8B A;  3BOW A;  1SYM A;  3D75 A;  1GGW A;  3GK2 A;  2O5G A;  1IG5 A;  1GGZ A;  1SY9 A;  5HKZ A;  2TN4 A;  5CSJ A;  2KLD A;  2E6W A;  1EH2 A;  3I5G B;  2LAP A;  4GAO A;  4PT1 A;  5D3O A;  2LLU A;  2JNF A;  1MUX A;  3KF9 A;  2OTG B;  1IQ3 A;  3R1V A;  3LK0 A;  4NDC A;  1BG1 A;  1A03 A;  1FPW A;  4PHK A;  1OOJ A;  4N1F A;  5CPV A;  1TUJ A;  3O4X A;  4M2P A;  2QEH A;  2KFG A;  4GGN A;  2IS9 A;  2QEB A;  2KI6 D;  2PRU A;  2EHB A;  3I5H C;  2QAC A;  1QJT A;  1TTX A;  1CMF A;  3CZ0 A;  2ZN8 A;  1A29 A;  1UHJ A;  4ZCU A;  3SJS A;  2Q91 A;  1F71 A;  1OQP A;  1YVL A;  4INX A;  5HKW A;  2CT9 A;  3BUN B;  1J1D A;  3IQO A;  3OX6 A;  1BOC A;  2ZRS A;  3SG7 A;  1SL8 A;  3IVT A;  1SL9 A;  1K93 D;  1QWV A;  3BFH A;  4CFQ A;  1YVH A;  1IWQ A;  1DEL A;  2K7B A;  3PSR A;  4INW A;  3V2L A;  5GQQ C;  1JWD A;  1SR6 C;  3DY9 A;  1TCO B;  3D78 A;  1GQM A;  3IQQ A;  1RK9 A;  1S5G Y;  2JOJ A;  1SL7 A;  1QIV A;  2WOR A;  2JT0 A;  1XK4 A;  5KTY A;  1YR5 A;  2JT8 A;  1XFW O;  3CS1 A;  1DGU A;  4MZL A;  2I18 A;  4MZK A;  1F70 A;  1CDM A;  2KAV A;  2G2B A;  1LS8 A;  4ORC B;  1RFJ A;  4FTG A;  2LAN A;  1QAT A;  1UWO A;  3H4S E;  1DQE A;  1DTL A;  3DVK A;  5AAN A;  4F7F A;  1UHN A;  4PAL A;  1YUT A;  3B86 A;  1MXE A;  1LVC D;  1DJX A;  2BE4 A;  4PE1 A;  3EVV A;  5AFP A;  2QEO A;  1S3P A;  3NGV A;  1LA3 A;  3TZ1 A;  2MJW B;  2MAZ A;  1NP8 A;  1CM4 A;  3SIA A;  1OMV A;  4PHN A;  1QTX A;  1K9K A;  2ZNE A;  1K9P A;  1BT6 A;  2QDI A;  2Y1M A;  1K96 A;  1MR8 A;  1CFP A;  1FW4 A;  1UP5 A;  3SG2 A;  3O2P A;  4YGD B;  1DGV A;  1REC A;  1K9U A;  3M0W A;  3WNX B;  3I5H B;  4NDD A;  1TNQ A;  3VRQ A;  3IF7 A;  1IKU A;  1PRW A;  1PSB A;  3AAJ A;  1KSO A;  3BFA A;  3JTD C;  2LP2 A;  4KYN A;  2ZN9 A;  4WQ3 A;  4MEW A;  2KHN A;  4U8D A;  4DRW A;  1AVS A;  4HRH A;  2LMU A;  2LMT A; 
#chains in the Genus database with same CATH homology
 1FBV A;  1IGV A;  2CNP A;  1YX7 A;  4UPG A;  2MLE C;  2K2A A;  1RTP 1;  1X02 A;  1B1G A;  2JXL A;  2KI6 C;  1Y1A A;  1J55 A;  4DUQ A;  2KOT A;  1IQ5 A;  2NCP A;  2RGI A;  4ETO A;  1S6C A;  2A4J A;  2FCE A;  1M46 A;  3EVU A;  4OR9 B;  1AP4 A;  1Y6W A;  2K7C A;  2CBL A;  2K7D A;  5JJG A;  1TOP A;  1CDL A;  2M3W A;  2M7N A;  1QX2 A;  2SAS A;  3SG4 A;  4A4B A;  2K2F A;  2R2I A;  1EJ3 A;  1TRF A;  1AJ4 A;  1UUR A;  3ICB A;  1Q80 A;  1PUL A;  2I94 A;  3KEV A;  1XFZ O;  5G08 A;  3PM8 A;  1D1O A;  1EG4 A;  3HX4 A;  1AHR A;  2PVB A;  4R1E A;  1NSH A;  1TNX A;  1OZO A;  1K95 A;  4OVN F;  3QRX A;  3RM1 A;  4E68 A;  3EK8 A;  2K7O A;  3LL8 B;  4I5K A;  3DF0 B;  1BF5 A;  1IRJ A;  4L9M A;  4AQI A;  2H61 C;  4FQO A;  1L2O C;  1DJY A;  1J1E A;  1M31 A;  1PK0 D;  1R2U A;  2HQW A;  2M7L A;  1ZFS A;  3JTD B;  4ORB B;  4D1E A;  5HYD A;  3JVT C;  4NQG A;  1F55 A;  5DKQ A;  2KBM A;  1NX1 A;  1KFX L;  3PAT A;  2JUL A;  2K8M B;  1KK7 Y;  1W7J B;  1BJF A;  3O4Y A;  3TDZ A;  2I2R E;  4OCI A;  4I5L B;  1ODB A;  3AKA A;  2KFF A;  1WDC C;  4QJ3 B;  1BR1 B;  2BBN A;  2CTN A;  4HSZ A;  1K90 D;  1CDP A;  2Q4U A;  1TNW A;  3VGO A;  1CTR A;  1SPY A;  4N5X A;  1KQV A;  3DF0 A;  3HCM A;  1VRK A;  4XYN A;  2K61 A;  4PHM A;  2BL0 B;  1KFU S;  2HQ8 A;  1NWD A;  1NX2 A;  2Y1N A;  1XFX O;  1DJH A;  1CB1 A;  1QS7 A;  4DS7 A;  1FF1 A;  5K89 A;  2FOT A;  2LVI A;  2ZRT A;  4I5N B;  2HPS A;  1BOD A;  2M49 B;  4AQJ A;  1CFF A;  2B1U A;  4P2Y B;  1Y0V H;  1NIW A;  1JF2 A;  1SRA A;  1QLK A;  2LLT A;  4NDB A;  1S36 A;  1FI6 A;  1KQM C;  1DJI A;  3DVE A;  4A4C A;  2FCD A;  5IBW A;  5CSF A;  1WRL A;  2OS8 C;  1L7Z A;  1IJ6 A;  1M39 A;  1L2O B;  1CLL A;  1S6J A;  3FS7 A;  3JVT B;  2LE9 B;  1TN4 A;  3KHE A;  4Q04 A;  4YI9 A;  2V53 A;  1J7R A;  1B8L A;  3WHT B;  2KNE A;  4YGC B;  3RLZ A;  1B7T Z;  1XFU O;  3TS5 C;  1QAS A;  2NLN A;  5JOL A;  1RWY A;  2ZKM X;  1BR4 B;  3VRR A;  1QV1 A;  3VRN A;  5D7F A;  1WDC B;  3SIB A;  2LHL A;  4OV2 A;  4YRU A;  4TNC A;  2F3Z A;  1YX8 A;  2M0R A;  4PHJ A;  3BXK A;  3EKJ A;  1IH0 A;  1YRU B;  2P6B B;  1CDN A;  1G33 A;  2F8P A;  2JNX A;  2PSR A;  2H61 A;  3FWC A;  1OZS A;  4I5J A;  4BY5 A;  1SBJ A;  1S6I A;  1DF0 B;  2L2E A;  4GGF A;  4CPV A;  2LUC A;  4MVF A;  3WHU B;  3LCP C;  2JT3 A;  1N2D A;  1M63 B;  5D69 A;  1OMD A;  1PSR A;  2WCE A;  1QX7 A;  1XVJ A;  4PCW A;  2BCB A;  2KQY A;  1G4Y R;  1CMG A;  3K21 A;  1EL4 A;  1KQM B;  1OSA A;  2GGZ A;  3NSI A;  4YI8 A;  1QVI Z;  4ICB A;  5I2Q A;  3NSK A;  2OS8 B;  3EK7 A;  1MHO A;  2G9B A;  2LUX A;  1SK6 D;  1NPQ A;  2L5X B;  5AXI A;  3CR2 A;  3OHM B;  2PMY A;  1F8H A;  3DD4 A;  1NCX A;  3NXA A;  2M1U A;  2MLF C;  4MBE A;  2KGR A;  3NSO A;  4PE7 A;  1S1E A;  1DF0 A;  1YUU A;  3TS5 B;  1QVI Y;  3I5I C;  3WXA A;  2FJU B;  1SKT A;  1QIW A;  1LXF C;  3BYA A;  2F2O A;  2AUC A;  2KAX A;  4QJ4 B;  2GGM A;  2M97 A;  1WRZ A;  1C7V A;  4WQ2 A;  1EG3 A;  2BL0 C;  5HLO A;  1XFV O;  2MA2 A;  2MHH A;  4MRX A;  1TCF A;  2JTZ A;  2L98 A;  1JBA A;  2JPT A;  1UUS A;  4MRY A;  3FWB A;  2EC6 C;  5CSN A;  2E30 A;  1UHH A;  4MSP A;  3CR5 X;  2JC2 A;  1JUO A;  2HET A;  1BU3 A;  2KAY A;  2LC5 A;  5BPJ A;  1OE9 B;  1ZOT B;  1XA5 A;  2M9G A;  4MLW A;  5PAL A;  1NUB A;  1SNL A;  2L51 A;  3FIA A;  4GGF C;  1DT7 B;  1BLQ A;  1KFX S;  3BUX B;  1N0Y A;  3PAL A;  2LNK A;  2JRF A;  1NYA A;  1WLZ A;  1PAL A;  1W7I B;  4GNK B;  1CFD A;  1C7W A;  2DOQ A;  2KGB C;  4ORA B;  2BBM A;  2JZI A;  2KYC A;  2LVJ A;  3OB2 B;  4C0K A;  1Y1X A;  1QV0 A;  1EXR A;  5J3X A;  2Y5I A;  2JXC A;  3GOF A;  2M29 A;  1NX3 A;  4OKH A;  1YUR A;  3I5I B;  2CCM A;  4C0J A;  2SCP A;  3PLF B;  1YUS A;  3EVR A;  1A4P A;  1JF0 A;  1SW8 A;  2ZND A;  3I5F C;  1QX5 B;  1AUI B;  2BKH B;  4YBH B;  5I2L A;  3D10 A;  5B8I B;  1MWN A;  1SCM C;  1V1G A;  2H2K A;  1Y1U A;  5FYX A;  2NZ0 A;  1MF8 B;  1YTZ C;  3EK4 A;  4MZJ A;  2Y4Q A;  5TNC A;  2EC6 B;  4WRI A;  1JFJ A;  5KU1 A;  1LA0 A;  2KFH A;  1F54 A;  2BKI B;  3SG6 A;  1F4Q A;  1K8U A;  2L0P A;  1NX0 A;  3CZT X;  2BEC A;  2F2P A;  3GK1 A;  1CM1 A;  3BUO B;  1ZUZ A;  2KQ6 A;  4YGB B;  3C1V A;  1J7Q A;  2EGD A;  3EKH A;  4DCK A;  4JPZ B;  1KFU L;  1B8C A;  5AER A;  1KWO C;  1S5G Z;  1UHK A;  1CNP A;  1SMG A;  2MBX A;  1WLM A;  1A75 B;  1DMO A;  1SCV A;  3DVJ A;  2COL B;  2L4I A;  1HT9 A;  1M45 A;  2BCX A;  3PN7 B;  3OB1 B;  3D0Y B;  5HKY A;  5KSZ A;  5F6T A;  3TUY B;  4HRG A;  1S26 D;  2K0J A;  4AOM A;  2L50 A;  1KCY A;  2JQ6 A;  1K2H A;  2D8N A;  2PAL A;  1KK8 C;  3MSE B;  5DKR A;  4QJ5 B;  3I5F B;  1B4C A;  3DVM A;  1B7T Y;  2PAS A;  3BUW B;  1DJW A;  1N65 A;  4JQ0 D;  3CLN A;  1SCM B;  2AMI A;  2WND A;  3CR4 X;  1XO5 A;  4N1G A;  1E8A A;  2LP3 A;  4CID A;  2F3Y A;  1YRT B;  1KSM A;  3OP0 A;  1AK8 A;  2QPT A;  3E3R A;  1NCY A;  3TDU A;  4ZCV A;  1JSA A;  2JU0 A;  3CTN A;  1XYD A;  1A75 A;  1F4O A;  1RJV A;  2BCA A;  1A2X A;  3AAK A;  3CWG A;  4MN0 A;  3BUM B;  1NCZ A;  1LKJ A;  4GUK A;  4C0L A;  2KDH A;  3D0Y A;  4CLN A;  2L4H A;  2KYF A;  1TNP A;  1HQV A;  3NSL A;  1AJ5 A;  2KI4 C;  3AKB A;  2M1K B;  1RRO A;  3TDI A;  3OX5 A;  4P5O E;  4YGE B;  1KWO B;  4HRE E;  1JFK A;  1ALW A;  1LIN A;  3SG3 A;  2I7A A;  2VRG A;  4M2O A;  2ISD A;  1BMO A;  4USL A;  1U5I B;  1CLM A;  1PVA A;  2MRD A;  1QXP A;  1J7P A;  4GBA A;  2GV5 A;  3SG5 A;  4PDZ A;  5DKN A;  1G8I A;  3A8R A;  1MXL C;  3BQ3 A;  2LLS A;  1C07 A;  1J7O A;  3LK1 A;  1GJY A;  1SR6 B;  1FI5 A;  1KK8 B;  3VRO A;  4M2Q A;  1IJ5 A;  5CSI A;  2LM5 A;  2LCP A;  2WOS A;  1H4B A;  1B9A A;  2LVK A;  5HLV A;  3LLE A;  2WCB A;  4CFR A;  1K94 A;  2ZFD A;  2KBI A;  3I5G C;  4PE4 A;  5ER5 A;  5ER4 X;  4XJK B;  2NCO A;  4GFT A;  1DJZ A;  2OTG C;  3PFV A;  3ZNI A;  5AEQ A;  1XK4 C;  1MQ1 A;  2HF5 A;  1JC2 A;  1U5I A;  2O60 A;  4BY4 A;  1TIZ A;  3KO0 A;  3O6B A;  2JWW A;  1CFC A;  4JWQ A;  3BOW B;  3A4U B;  3O78 A;  2KI4 B;  1ZMZ A;  4PE0 A;  4YGA A;  2LHI A;  4GPL B;  1PVB A;  4F0Z B;  3ZWH A;  1KK7 Z;  1B47 A;  3PN7 C;  4DIR A;  1WY9 A;  2M8U A;  4IL1 A;  2AAO A;  3TUY C;  1QLS A;  1ZAC A;  2LMV A;  2WC8 A;  1CLB A;  1XFY O;  2KSP A;  4XJK A;  3F45 A;  2LV7 A;  1DJG A;  2CXJ A;  2NXQ A;  1B8R A;  1V1F A;  1WRK A;  3KPX A;  1ALV A;  3GK4 X;  2BE6 A;  2F33 A;  3CGA A;  3VRP A;  5I2O A;  2JTT A;  2LVV A;  1UHI A;  1R6P A;  2WCF A;  5I8N A;  1DVI A;  1OMR A;  2OPO A;  1CKK A;  1H8B A;  3BOW A;  1SYM A;  1GGW A;  3GK2 A;  2O5G A;  1IG5 A;  1GGZ A;  1SY9 A;  5HKZ A;  2TN4 A;  5CSJ A;  2E6W A;  1EH2 A;  3I5G B;  2LAP A;  4GAO A;  2LLU A;  2JNF A;  1MUX A;  3KF9 A;  2OTG B;  1IQ3 A;  3LK0 A;  4NDC A;  1BG1 A;  1A03 A;  1FPW A;  4PHK A;  1OOJ A;  4N1F A;  5CPV A;  4M2P A;  2KFG A;  4GGN A;  2IS9 A;  2KI6 D;  2PRU A;  2EHB A;  3I5H C;  2QAC A;  1QJT A;  1TTX A;  1CMF A;  2ZN8 A;  1A29 A;  1UHJ A;  4ZCU A;  3SJS A;  2Q91 A;  1F71 A;  1OQP A;  1YVL A;  5HKW A;  2CT9 A;  3BUN B;  1J1D A;  3IQO A;  3OX6 A;  1BOC A;  2ZRS A;  3SG7 A;  1SL8 A;  1SL9 A;  1K93 D;  4CFQ A;  1YVH A;  1IWQ A;  2K7B A;  3PSR A;  5GQQ C;  1JWD A;  1SR6 C;  1TCO B;  1GQM A;  3IQQ A;  1RK9 A;  1S5G Y;  2JOJ A;  1SL7 A;  1QIV A;  2WOR A;  2JT0 A;  1XK4 A;  5KTY A;  1YR5 A;  2JT8 A;  1XFW O;  3CS1 A;  1DGU A;  4MZL A;  2I18 A;  4MZK A;  1F70 A;  1CDM A;  2KAV A;  2G2B A;  4ORC B;  1RFJ A;  4FTG A;  2LAN A;  1QAT A;  1UWO A;  3H4S E;  1DTL A;  3DVK A;  5AAN A;  1UHN A;  4PAL A;  1YUT A;  1MXE A;  1LVC D;  1DJX A;  2BE4 A;  4PE1 A;  3EVV A;  5AFP A;  3TZ1 A;  1S3P A;  1LA3 A;  2MJW B;  2MAZ A;  1NP8 A;  1CM4 A;  3SIA A;  1OMV A;  4PHN A;  1QTX A;  1K9K A;  2ZNE A;  1K9P A;  1BT6 A;  2Y1M A;  1K96 A;  1MR8 A;  1CFP A;  1FW4 A;  1UP5 A;  3SG2 A;  3O2P A;  4YGD B;  1DGV A;  1REC A;  1K9U A;  3M0W A;  3WNX B;  3I5H B;  4NDD A;  1TNQ A;  3VRQ A;  3IF7 A;  1IKU A;  1PRW A;  1PSB A;  3AAJ A;  1KSO A;  3JTD C;  2LP2 A;  2ZN9 A;  4WQ3 A;  4MEW A;  2KHN A;  4U8D A;  4DRW A;  1AVS A;  4HRH A;  2LMU A;  2LMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...