2K2AA

Solution structure of the apo c terminal domain of lethocerus troponin c isoform f1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
MQQELREAFRLYDKEGNGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFEEFMGVMTGGDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C
publication title Solution structure of the Apo C-terminal domain of the Lethocerus F1 troponin C isoform.
pubmed doi rcsb
source organism Lethocerus indicus
molecule tags Contractile protein
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k2aA00
1J55A 1BLQA 4MRXA 2K0JA 1XFWO 2LLSA 3SIAA 1LVCD 1EXRA 3MSEB 2LAPA 3I5IC 2D8NA 1RECA 3CGAA 2MHHA 2BE6A 3HX4A 1QX7A 1ZOTB 1S36A 4M2OA 3C1VA 2M7LA 1JFJA 2KBMA 3H4SE 1XVJA 3LLEA 4YI8A 2M1UA 2BCBA 2KQ6A 1KFXS 4PHJA 1RTP1 2ZFDA 1JC2A 1N2DA 1NYAA 4GGNA 1DJYA 4AQJA 1IQ5A 1K9KA 1GQMA 2LVVA 1JBAA 1B47A 2M29A 3SG5A 1DGVA 1L2OB 2KFGA 2F3ZA 1CB1A 4DRWA 3LCPC 3FIAA 1BR1B 2JZIA 4NQGA 3TDUA 2SCPA 4C0JA 1Y1AA 2FCEA 2WNDA 2I18A 1JFKA 1K96A 4FQOA 1DF0B 3IQOA 4JWQA 1J7QA 2GGZA 1A03A 1K8UA 1ZACA 1W7IB 1KQMB 3M0WA 4PHKA 2EGDA 4CPVA 4HRGA 1B4CA 4GAOA 1YURA 1OMVA 1PULA 1FI6A 4WQ3A 1JF2A 2ZNDA 3QRXA 4OKHA 2Y1MA 1J7PA 1CLBA 1NPQA 1ODBA 4BY5A 1DJIA 1FW4A 1C7VA 1F4OA 2LUXA 1IRJA 1L7ZA 1QATA 4PE0A 2E6WA 1PRWA 1SW8A 1S6JA 1OOJA 1PALA 5ER4X 3BUWB 2JU0A 4XJKA 2COLB 2JQ6A 4C0KA 5CSJA 2JXCA 1QASA 2AAOA 1TIZA 1KK8C 3OB2B 3SIBA 2JXLA 4YRUA 4OCIA 5I8NA 3NSOA 2DOQA 4ZCUA 1R2UA 1Y1UA 3OB1B 1J1EA 2I94A 2LLUA 2TN4A 3K21A 2KFFA 3PLFB 1EL4A 2ZNEA 5G08A 2I7AA 1UHKA 1EJ3A 1UHHA 1WRKA 1G4YR 5AFPA 3I5GB 4MZLA 1OMDA 1XFZO 1J7RA 1OZSA 2CT9A 1MHOA 2ZN8A 1OQPA 1U5IA 1M63B 4MBEA 2KAVA 3WHUB 2K7BA 4CFRA 2JTTA 1NX1A 1SBJA 1SL7A 3KHEA 1ZUZA 3RM1A 1CKKA 1K93D 2K8MB 5HYDA 1QJTA 1PVAA 1A2XA 1AJ5A 2M49B 3D0YA 3GK4X 1FF1A 5JJGA 1RFJA 3VRPA 2BECA 3FWCA 3JTDB 2LMUA 1PK0D 2LUCA 5HKZA 1DT7B 1B8CA 1J1DA 2PALA 1MXLC 1RWYA 2AUCA 3LK0A 1QV0A 1B8LA 2KI6C 1NSHA 4DIRA 1UHNA 2F3YA 1L2OC 3DF0A 1BU3A 4GFTA 1ZMZA 2LLTA 3CTNA 3E3RA 2KI6D 3PM8A 3BUXB 1SRAA 3FS7A 3CZTX 1SL8A 1XFVO 3WXAA 2JT0A 4NDBA 2OS8C 4PCWA 3TZ1A 4D1EA 2PASA 3EK4A 1PVBA 1MR8A 5CSIA 5JOLA 1XYDA 1G8IA 1RROA 3CR4X 3I5FB 1CNPA 2BCAA 3BOWB 3O2PA 1KQMC 3EKHA 4A4CA 1SK6D 3D0YB 2G9BA 4GUKA 4OV2A 5D69A 5DKNA 1BOCA 1S26D 3EK8A 1IH0A 1YUTA 1DJWA 4MZKA 2LE9B 2JNFA 1YR5A 2K7DA 2H61C 3PFVA 2KDHA 1BT6A 4I5JA 1AUIB 3GK1A 1AVSA 3RLZA 1CM4A 1KSMA 3VGOA 1S3PA 1A4PA 2NXQA 2Q4UA 5K89A 1QV1A 3DVJA 2WCFA 3AKAA 5CPVA 4YGEB 2BL0B 1KFUS 1TNPA 1QVIZ 3I5HB 2PSRA 3TS5B 4NDDA 1MWNA 3BUOB 2F8PA 1WLZA 3NSKA 1KSOA 3SJSA 2MAZA 1K95A 1CLLA 1V1GA 3PATA 2BE4A 1N0YA 3TUYB 2JRFA 1G33A 2L2EA 3I5GC 3KPXA 3O78A 3AAKA 3NSIA 1NX0A 3CS1A 1Y6WA 4CLNA 1IJ6A 1QLSA 1DJHA 1QTXA 1PSRA 4HRHA 1QVIY 1A75A 1AP4A 3JVTB 1XA5A 1CFFA 3NSLA 3BYAA 2LNKA 4JQ0D 2K2FA 4ETOA 1SCVA 1EG3A 4M2QA 2GV5A 2A4JA 2LCPA 1V1FA 2O5GA 2IS9A 1SR6B 1CFCA 4CIDA 1MQ1A 3EK7A 3JTDC 2LP2A 3BUMB 1S6CA 1JSAA 1AHRA 1MUXA 1E8AA 1KFXL 4PALA 1A29A 3CR5X 3GK2A 4YBHB 1GJYA 1BR4B 1F70A 1IGVA 1IWQA 1TNXA 3OX6A 1F4QA 2CBLA 1A75B 2LVJA 4IL1A 5AEQA 4F0ZB 3EKJA 1Y0VH 1CDNA 1CDMA 1KWOB 2AMIA 2QACA 2ZKMX 1AJ4A 2KOTA 3I5FC 2LANA 1R6PA 2H2KA 2LMVA 2L50A 3KEVA 1EH2A 2LC5A 2FOTA 3PALA 4YGCB 4P5OE 4L9MA 2F2OA 1YRUB 1KK7Z 3OX5A 1UWOA 2HQ8A 4YI9A 2KGBC 2Y4QA 1SYMA 1CMGA 2PMYA 2ZRTA 4R1EA 1SNLA 4P2YB 4XYNA 1PSBA 2JNXA 1IKUA 2ZN9A 1NIWA 3HCMA 5KSZA 3WHTB 1WDCB 2MLEC 1K9PA 4XJKB 4YGBB 2P6BB 2SASA 3OHMB 4PDZA 5AANA 1K90D 4I5NB 1YX7A 1H4BA 1B1GA 4GGFC 1HT9A 2K7CA 1GGWA 1KK7Y 3LL8B 1UHIA 2KBIA 3WNXB 3A4UB 2FJUB 2L4HA 2BL0C 4I5KA 3I5HC 3BUNB 4ORBB 3TS5C 3LK1A 2JT8A 2KAXA 1QX2A 1WLMA 1YUUA 2KAYA 1SL9A 1OMRA 2HPSA 4GBAA 3VRNA 1NP8A 3TUYC 1WRZA 1S5GZ 1NCXA 1UP5A 1U5IB 1XFUO 4PE4A 2K7OA 3AAJA 1B9AA 2G2BA 3SG6A 1OZOA 2L98A 4N5XA 2KSPA 2LM5A 5TNCA 3JVTC 1AK8A 1TCFA 2KYFA 5FYXA 1EG4A 3CLNA 3EVVA 2MLFC 2M9GA 4OVNF 5DKRA 5F6TA 1SPYA 1Y1XA 4MEWA 2CCMA 2KGRA 1DGUA 2LP3A 1FI5A 1XK4A 2HF5A 2NLNA 4I5LB 2WORA 2WCBA 1SR6C 1S5GY 4ORAB 4CFQA 1XO5A 2F33A 3NXAA 2WC8A 1OSAA 4ORCB 1LA0A 3AKBA 1B7TZ 1MXEA 4DUQA 1Q80A 2K61A 3EVRA 3KF9A 1DJZA 5I2OA 1BG1A 3DD4A 5BPJA 1NCZA 3DF0B 1K94A 1TOPA 4JPZB 2JT3A 2MBXA 1XFYO 2HQWA 1YUSA 2GGMA 4WQ2A 1NX2A 2F2PA 4PE7A 1KWOC 5HKWA 5KTYA 2LHIA 2KQYA 2L0PA 3BXKA 5IBWA 5I2QA 2LMTA 2KFHA 1YVLA 1M46A 1NX3A 2M7NA 2QPTA 4AQIA 3ICBA 1VRKA 2K2AA 1WY9A 4C0LA 1DF0A 2B1UA 2PRUA 4NDCA 4U8DA 1KQVA 2JTZA 2M97A 2BBMA 3SG2A 1C07A 1CLMA 4MSPA 1WDCC 3OP0A 5HKYA 4MLWA 1DTLA 1QLKA 1F71A 1BMOA 4OR9B 3SG7A 2KHNA 1S1EA 2V53A 2Y1NA 3IF7A 2ZRSA 3VRRA 1OE9B 1K2HA 4M2PA 1RJVA 1M31A 3PN7B 4BY4A 1S6IA 2HETA 2LHLA 1RK9A 5B8IB 3CWGA 2OTGB 2H61A 2M1KB 1H8BA 2LV7A 2KNEA 3IQQA 1KFUL 2EC6B 1N65A 1LKJA 2OS8B 2JULA 2WCEA 2L4IA 2M0RA 2M3WA 3BQ3A 2JOJA 1CFDA 4PHNA 2KI4B 1NUBA 4PHMA 1LXFC 4DS7A 1GGZA 1X02A 2BKIB 1YRTB 1M45A 2CXJA 3DVEA 3GOFA 1TRFA 5I2LA 3CR2A 2JPTA 4TNCA 1SCMB 2O60A 2MA2A 3O4YA 1F55A 4YGDB 3VRQA 2I2RE 1QIVA 3O6BA 1QS7A 4ICBA 5HLVA 3VROA 4N1GA 4HREE 1CMFA 2OPOA 1DMOA 1QIWA 2BKHB 3I5IB 4Q04A 1YX8A 5J3XA 2Q91A 2PVBA 5KU1A 4A4BA 5D7FA 2E30A 2NCPA 3DVMA 3TDIA 5HLOA 1TCOB 1DVIA 4FTGA 1J7OA 1ALVA 2L51A 4PE1A 1LA3A 5ER5A 1CFPA 1SMGA 5AERA 1IJ5A 5AXIA 2FCDA 1UURA 3TDZA 5CSNA 1ALWA 2R2IA 1MF8B 4HSZA 1CDPA 2BCXA 2LVKA 1LINA 4N1FA 1XK4C 1ZFSA 1CM1A 2ISDA 2MRDA 4YGAA 1JWDA 1WRLA 2M8UA 2VRGA 4QJ4B 1F8HA 1CTRA 1DJGA 1BJFA 1JUOA 2JWWA 2CTNA 3KO0A 2LVIA 2BBNA 3PSRA 2JC2A 3BOWA 1F54A 1FPWA 1CDLA 2CNPA 5PALA 1YTZC 2RGIA 1K9UA 1HQVA 1TNWA 2WOSA 3EVUA 1FBVA 1QX5B 1SKTA 1W7JB 4GPLB 5CSFA 4GNKB 3ZWHA 2EHBA 1BODA 3PN7C 1BF5A 4AOMA 3FWBA 4UPGA 1SY9A 1QXPA 3DVKA 4E68A 4MZJA 2NCOA 1JF0A 2OTGC 1D1OA 1NCYA 2NZ0A 1UUSA 2KYCA 4QJ3B 2EC6C 3D10A 1TTXA 1KK8B 1TNQA 2Y5IA 4GGFA 1DJXA 2MJWB 1B8RA 4MN0A 4USLA 3ZNIA 1IQ3A 3A8RA 2L5XB 4MVFA 2KI4C 1YVHA 1UHJA 3SG3A 1KCYA 5DKQA 4DCKA 3SG4A 1IG5A 1XFXO 4ZCVA 4MRYA 4QJ5B 1SCMC 3F45A 1C7WA 1M39A 1TN4A 1B7TY 4WRIA 5GQQC 1NWDA
chains in the Genus database with same CATH superfamily
1J55A 1BLQA 4MRXA 2K0JA 1XFWO 2LLSA 3SIAA 1LVCD 1EXRA 3MSEB 2LAPA 3BFHA 3I5IC 2D8NA 1Z4HA 1RECA 3CGAA 2MHHA 2BE6A 3HX4A 1QX7A 3DYEA 1OOIX 1ZOTB 1S36A 4M2OA 3C1VA 2M7LA 1JFJA 2KBMA 3DZTA 3H4SE 1XVJA 3LLEA 4YI8A 2JPOA 2M1UA 2BCBA 2KQ6A 1KFXS 4PHJA 1RTP1 2QEVA 2ZFDA 1N2DA 3BJHA 1JC2A 1NYAA 4GGNA 1DJYA 4AQJA 2PYQA 1IQ5A 1K9KA 1GQMA 2LVVA 1JBAA 1B47A 2M29A 3SG5A 1DGVA 1L2OB 1OOGA 1TUJA 2KFGA 2F3ZA 2QEOA 1CB1A 4DRWA 3LCPC 3FIAA 1BR1B 2JZIA 4NQGA 3TDUA 2SCPA 4C0JA 1Y1AA 2FCEA 2WNDA 3EG5B 1LS8A 2I18A 1JFKA 1K96A 5FI2A 4FQOA 1DF0B 3IQOA 4JWQA 1J7QA 2GGZA 1A03A 1K8UA 3D76A 1ZACA 1W7IB 2QEBA 1KQMB 3M0WA 4PHKA 2L5YA 3L4LA 2EGDA 4CPVA 4HRGA 1B4CA 4GAOA 1DELA 1YURA 1OMVA 1PULA 2YGUA 1FI6A 4WQ3A 1JF2A 2ZNDA 3QRXA 4OKHA 2Y1MA 1J7PA 1CLBA 1NPQA 1ODBA 3NGVA 4BY5A 1DJIA 1FW4A 1C7VA 1F4OA 2LUXA 1IRJA 1L7ZA 1QATA 4PE0A 2E6WA 1PRWA 1SW8A 1S6JA 1OOJA 1PALA 2K60A 3BUWB 5ER4X 2JU0A 4XJKA 2COLB 2JQ6A 4C0KA 3VB1A 5CSJA 2JXCA 1QASA 2AAOA 1TIZA 1KK8C 3OB2B 3SIBA 2JXLA 4YRUA 4OCIA 5I8NA 3NSOA 2DOQA 4ZCUA 1SSEB 3L47A 1R2UA 1XFRA 1Y1UA 3CABA 1J1EA 3OB1B 2I94A 2LLUA 2TN4A 3K21A 2KFFA 3FE9A 3PLFB 1EL4A 2ZNEA 5G08A 2I7AA 1UHKA 1EJ3A 1UHHA 1WRKA 1G4YR 5AFPA 3I5GB 4MZLA 2L2CA 1OMDA 1XFZO 1J7RA 1OZSA 2CT9A 1MHOA 2ZN8A 1OQPA 1U5IA 1M63B 4MBEA 4FQTA 2KAVA 3WHUB 2K7BA 3R1VA 4CFRA 2JTTA 1NX1A 1SBJA 1SL7A 3KHEA 1ZUZA 4JKTA 3RM1A 1CKKA 1TUZA 1K93D 2K8MB 5HYDA 1QJTA 1PVAA 1A2XA 1AJ5A 3SS5A 2M49B 3D0YA 3GK4X 1FF1A 5JJGA 1RFJA 3VRPA 2BECA 3FWCA 3JTDB 2LMUA 1PK0D 2LUCA 5HKZA 1DT7B 2ERBA 1B8CA 1J1DA 2FJYA 2PALA 1MXLC 1RWYA 2AUCA 5HL1A 3LK0A 1QV0A 1B8LA 2KI6C 1NSHA 3D74A 4DIRA 1UHNA 2F3YA 1L2OC 3DF0A 1BU3A 4GFTA 3R1PA 1ZMZA 2LLTA 3CTNA 3E3RA 2KI6D 3PM8A 3BUXB 1SRAA 3FS7A 3CZTX 1SL8A 1XFVO 4KYNA 3WXAA 2JT0A 4NDBA 2OS8C 4PCWA 3TZ1A 3IVTA 2PASA 4D1EA 3EK4A 1PVBA 1MR8A 5CSIA 5JOLA 1XYDA 1G8IA 1RROA 3CR4X 3I5FB 1CNPA 2BCAA 3BOWB 3O2PA 1KQMC 3EKHA 5FI6A 4A4CA 1SK6D 3D0YB 2G9BA 4GUKA 4OV2A 3NHTA 5D69A 1OOFA 2KLEA 5DKNA 1BOCA 1S26D 3EK8A 3SS3A 1IH0A 1YUTA 1DJWA 4MZKA 2LE9B 2JNFA 3PJIA 4F7FA 1YR5A 3B86A 2WCKA 2K7DA 2H61C 3PFVA 2KDHA 1BT6A 4I5JA 1AUIB 5I94A 3GK1A 1AVSA 3RLZA 1CM4A 1KSMA 3VGOA 1S3PA 1A4PA 2NXQA 2Q4UA 5K89A 1QV1A 3DVJA 2WCFA 3AKAA 5CPVA 4YGEB 2BL0B 1KFUS 1TNPA 1QVIZ 3I5HB 2PSRA 3TS5B 1C3YA 4NDDA 1MWNA 3BUOB 2F8PA 1WLZA 3NSKA 1KSOA 3SJSA 2BAPA 1K95A 1CLLA 2MAZA 1V1GA 3BFAA 3PATA 4OZDA 2BE4A 1N0YA 3TUYB 2JRFA 1G33A 1TWOA 2L2EA 3I5GC 3KPXA 3O78A 3AAKA 3NSIA 1NX0A 3CS1A 1Y6WA 4CLNA 1IJ6A 1QLSA 1DJHA 1QTXA 1PSRA 4HRHA 1QVIY 1A75A 1AP4A 3JVTB 1XA5A 3OBVA 1CFFA 3NSLA 3BYAA 2LNKA 4JQ0D 3RZSA 2K2FA 4ETOA 1SCVA 1EG3A 4M2QA 2GV5A 1DEKA 1Z2CB 2A4JA 2LCPA 1V1FA 2O5GA 2IS9A 1SR6B 1CFCA 4CIDA 1MQ1A 3EK7A 3BFBA 3JTDC 2LP2A 3BUMB 1OOHA 1S6CA 1JSAA 1AHRA 1MUXA 1E8AA 1KFXL 4PALA 1A29A 3CR5X 3GK2A 4YBHB 1GJYA 1OW4A 1BR4B 1F70A 1IGVA 1IWQA 1TNXA 3OX6A 1F4QA 2CBLA 1A75B 2LVJA 3UNWA 4IL1A 5AEQA 4F0ZB 3EKJA 1Y0VH 1CDNA 1CDMA 4JD9A 1KWOB 2AMIA 2QACA 2ZKMX 1AJ4A 2KOTA 3I5FC 2LANA 2WC6A 1R6PA 2H2KA 2LMVA 2L50A 3KEVA 1EH2A 2LC5A 2FOTA 3PALA 4YGCB 4P5OE 4L9MA 2F2OA 1YRUB 1KK7Z 3OX5A 1UWOA 2HQ8A 3CZ0A 4YI9A 2KGBC 2Y4QA 1SYMA 1CMGA 2PMYA 2ZRTA 4R1EA 1SNLA 4P2YB 4XYNA 1PSBA 2JNXA 1IKUA 2ZN9A 3K1EA 1QWVA 1NIWA 3B6XA 3HCMA 5KSZA 3WHTB 1WDCB 2MLEC 1K9PA 4XJKB 4YGBB 1IIOA 2P71A 2P6BB 2SASA 3QMEA 3OHMB 4PDZA 5AANA 1K90D 4I5NB 1YX7A 1H4BA 1B1GA 4GGFC 3S0FA 1HT9A 2K7CA 1GGWA 1KK7Y 3LL8B 1UHIA 2KBIA 3WNXB 3A4UB 2FJUB 2L4HA 2BL0C 4I5KA 3I5HC 3BUNB 4ORBB 3TS5C 3LK1A 2JT8A 2KAXA 1QX2A 1WLMA 1YUUA 2KAYA 1SL9A 1OMRA 2HPSA 4GBAA 3VRNA 1NP8A 2PQLA 3TUYC 1WRZA 1S5GZ 1NCXA 1UP5A 1U5IB 1XFUO 4PE4A 2K7OA 3AAJA 1B9AA 2G2BA 3SG6A 1OZOA 2L98A 4N5XA 2KSPA 2LM5A 5TNCA 3JVTC 1AK8A 1TCFA 2KYFA 5FYXA 1EG4A 3CLNA 3EVVA 2MLFC 2M9GA 4OVNF 5DKRA 5F6TA 1SPYA 3S0DA 1Y1XA 4MEWA 2CCMA 2KGRA 1DGUA 2LP3A 1FI5A 3R72A 1XK4A 1GM0A 2HF5A 2NLNA 3OGNA 4I5LB 2WORA 1DQEA 2WCBA 1SR6C 1S5GY 3O4XA 4ORAB 4CFQA 1XO5A 2F33A 3NXAA 2WC8A 1OSAA 4ORCB 1LA0A 3AKBA 3N7HA 1B7TZ 1MXEA 4DUQA 1Q80A 2K61A 3EVRA 3KF9A 1DJZA 5I2OA 1BG1A 3DD4A 5BPJA 1NCZA 3DF0B 1K94A 1DC1A 1TOPA 4JPZB 2JT3A 2WCLA 2MBXA 3S0AA 1W9ZA 1XFYO 2HQWA 1YUSA 2GGMA 4WQ2A 3DY9A 1NX2A 2GTEA 2F2PA 4PE7A 1KWOC 5HKWA 5KTYA 2LHIA 2KQYA 2L0PA 3SS4A 3BXKA 5IBWA 5I2QA 2LMTA 2KFHA 1YVLA 1M46A 1NX3A 2M7NA 2QPTA 4AQIA 3ICBA 1VRKA 2K2AA 1WY9A 4C0LA 1DF0A 2B1UA 2PRUA 4NDCA 2WC5A 4U8DA 1KQVA 3S0GA 2JTZA 2M97A 2BBMA 4PT1A 3SG2A 1CLMA 1C07A 4MSPA 1WDCC 3OP0A 5HKYA 3B7AA 4MLWA 1DTLA 1QLKA 3D75A 1F71A 1BMOA 4OR9B 3SG7A 2H8VA 1T14A 2KHNA 1S1EA 2V53A 2Y1NA 3IF7A 1C3ZA 3D73A 2ZRSA 3PM2A 2QDIA 1OE9B 3VRRA 4M2PA 1RJVA 1K2HA 1M31A 3PN7B 4BY4A 1S6IA 2HETA 2LHLA 1RK9A 5B8IB 3CWGA 2OTGB 2H61A 2M1KB 1H8BA 2WCHA 2LV7A 2KNEA 2QEHA 3IQQA 1KFUL 2EC6B 1N65A 2KLDA 1LKJA 2OS8B 2JULA 2WCEA 2L4IA 2M0RA 2M3WA 3BQ3A 2JOJA 1CFDA 4PHNA 2KI4B 1NUBA 4PHMA 1LXFC 4DS7A 1GGZA 1X02A 5DICA 2BKIB 1YRTB 1M45A 2CXJA 3DVEA 2WCJA 1TRFA 3GOFA 5I2LA 3CR2A 2JPTA 4TNCA 1SCMB 2O60A 2MA2A 3O4YA 3S0EA 1F55A 4YGDB 3VRQA 2I2RE 1QIVA 3O6BA 1QS7A 4ICBA 5HLVA 3VROA 1P28A 2BNXA 4N1GA 4HREE 1CMFA 2OPOA 1DMOA 1QIWA 3DXLA 2BKHB 3I5IB 4Q04A 1YX8A 3CZ1A 5J3XA 2Q91A 2PVBA 5KU1A 4A4BA 3B87A 5D7FA 2E30A 2NCPA 3DVMA 3TDIA 5HLOA 5EL2A 1TCOB 1DVIA 4FTGA 1J7OA 1ALVA 2L51A 4PE1A 1LA3A 5ER5A 1CFPA 1SMGA 5AERA 3D77A 1IJ5A 3Q8IA 3S0BA 5AXIA 2FCDA 3D78A 1UURA 3TDZA 5CSNA 1ALWA 2R2IA 1MF8B 4HSZA 1CDPA 2BCXA 2LVKA 1LINA 3L4AA 4N1FA 1XK4C 1ZFSA 1CM1A 2ISDA 2MRDA 1ORGA 4YGAA 1JWDA 3FE6A 1WRLA 2M8UA 2VRGA 4QJ4B 3CDNA 1F8HA 1CTRA 1DJGA 1BJFA 1JUOA 2JWWA 2CTNA 3KO0A 2LVIA 2P70A 2BBNA 3PSRA 5FI7A 2WCMA 2JC2A 3BOWA 1F54A 1FPWA 1CDLA 2CNPA 5PALA 1YTZC 2RGIA 1K9UA 3CZ2A 1HQVA 2KPHA 1TNWA 2WOSA 3EVUA 1FBVA 1QX5B 4INXA 1SKTA 1W7JB 4GPLB 5CSFA 3B88A 4GNKB 3ZWHA 2EHBA 3CYZA 1BODA 3PN7C 1BF5A 4AOMA 3FWBA 4UPGA 1SY9A 1QXPA 3DVKA 4E68A 4MZJA 2NCOA 1JF0A 2OTGC 1D1OA 1NCYA 2NZ0A 1UUSA 2KYCA 4QJ3B 2EC6C 3D10A 1TTXA 1KK8B 3NHIA 1TNQA 2Y5IA 4GGFA 5D3OA 3FE8A 1DJXA 2MJWB 1B8RA 4MN0A 4USLA 3V2LA 3ZNIA 1IQ3A 3A8RA 2L5XB 4MVFA 2KI4C 1YVHA 1UHJA 4INWA 3SG3A 5DKQA 4DCKA 1KCYA 3SG4A 3R1OA 3UO9A 1IG5A 1XFXO 4ZCVA 4MRYA 4QJ5B 4IJ7A 1SCMC 3F45A 1C7WA 1M39A 1TN4A 1B7TY 4WRIA 5GQQC 1NWDA
chains in the Genus database with same CATH topology
1J55A 1BLQA 4MRXA 2K0JA 1XFWO 2LLSA 3SIAA 1LVCD 1EXRA 3MSEB 2LAPA 3I5IC 2D8NA 1RECA 3CGAA 2MHHA 2BE6A 3HX4A 1QX7A 1ZOTB 1S36A 4M2OA 3C1VA 2M7LA 1JFJA 2KBMA 3H4SE 1XVJA 3LLEA 4YI8A 2M1UA 2BCBA 2KQ6A 1KFXS 4PHJA 1RTP1 2ZFDA 1JC2A 1N2DA 1NYAA 4GGNA 1DJYA 4AQJA 1IQ5A 1K9KA 1GQMA 2LVVA 1JBAA 1B47A 2M29A 3SG5A 1DGVA 1L2OB 2KFGA 2F3ZA 1CB1A 4DRWA 3LCPC 3FIAA 1BR1B 2JZIA 4NQGA 3TDUA 2SCPA 4C0JA 1Y1AA 2FCEA 2WNDA 2I18A 1JFKA 1K96A 4FQOA 1DF0B 3IQOA 4JWQA 1J7QA 2GGZA 1A03A 1K8UA 1ZACA 1W7IB 1KQMB 3M0WA 4PHKA 2EGDA 4CPVA 4HRGA 1B4CA 4GAOA 1YURA 1OMVA 1PULA 1FI6A 4WQ3A 1JF2A 2ZNDA 3QRXA 4OKHA 2Y1MA 1J7PA 1CLBA 1NPQA 1ODBA 4BY5A 1DJIA 1FW4A 1C7VA 1F4OA 2LUXA 1IRJA 1L7ZA 1QATA 4PE0A 2E6WA 1PRWA 1SW8A 1S6JA 1OOJA 1PALA 5ER4X 3BUWB 2JU0A 4XJKA 2COLB 2JQ6A 4C0KA 5CSJA 2JXCA 1QASA 2AAOA 1TIZA 1KK8C 3OB2B 3SIBA 2JXLA 4YRUA 4OCIA 5I8NA 3NSOA 2DOQA 4ZCUA 1R2UA 1Y1UA 3OB1B 1J1EA 2I94A 2LLUA 2TN4A 3K21A 2KFFA 3PLFB 1EL4A 2ZNEA 5G08A 2I7AA 1UHKA 1EJ3A 1UHHA 1WRKA 1G4YR 5AFPA 3I5GB 4MZLA 1OMDA 1XFZO 1J7RA 1OZSA 2CT9A 1MHOA 2ZN8A 1OQPA 1U5IA 1M63B 4MBEA 2KAVA 3WHUB 2K7BA 4CFRA 2JTTA 1NX1A 1SBJA 1SL7A 3KHEA 1ZUZA 3RM1A 1CKKA 1K93D 2K8MB 5HYDA 1QJTA 1PVAA 1A2XA 1AJ5A 2M49B 3D0YA 3GK4X 1FF1A 5JJGA 1RFJA 3VRPA 2BECA 3FWCA 3JTDB 2LMUA 1PK0D 2LUCA 5HKZA 1DT7B 1B8CA 1J1DA 2PALA 1MXLC 1RWYA 2AUCA 3LK0A 1QV0A 1B8LA 2KI6C 1NSHA 4DIRA 1UHNA 2F3YA 1L2OC 3DF0A 1BU3A 4GFTA 1ZMZA 2LLTA 3CTNA 3E3RA 2KI6D 3PM8A 3BUXB 1SRAA 3FS7A 3CZTX 1SL8A 1XFVO 3WXAA 2JT0A 4NDBA 2OS8C 4PCWA 3TZ1A 4D1EA 2PASA 3EK4A 1PVBA 1MR8A 5CSIA 5JOLA 1XYDA 1G8IA 1RROA 3CR4X 3I5FB 1CNPA 2BCAA 3BOWB 3O2PA 1KQMC 3EKHA 4A4CA 1SK6D 3D0YB 2G9BA 4GUKA 4OV2A 5D69A 5DKNA 1BOCA 1S26D 3EK8A 1IH0A 1YUTA 1DJWA 4MZKA 2LE9B 2JNFA 1YR5A 2K7DA 2H61C 3PFVA 2KDHA 1BT6A 4I5JA 1AUIB 3GK1A 1AVSA 3RLZA 1CM4A 1KSMA 3VGOA 1S3PA 1A4PA 2NXQA 2Q4UA 5K89A 1QV1A 3DVJA 2WCFA 3AKAA 5CPVA 4YGEB 2BL0B 1KFUS 1TNPA 1QVIZ 3I5HB 2PSRA 3TS5B 4NDDA 1MWNA 3BUOB 2F8PA 1WLZA 3NSKA 1KSOA 3SJSA 2MAZA 1K95A 1CLLA 1V1GA 3PATA 2BE4A 1N0YA 3TUYB 2JRFA 1G33A 2L2EA 3I5GC 3KPXA 3O78A 3AAKA 3NSIA 1NX0A 3CS1A 1Y6WA 4CLNA 1IJ6A 1QLSA 1DJHA 1QTXA 1PSRA 4HRHA 1QVIY 1A75A 1AP4A 3JVTB 1XA5A 1CFFA 3NSLA 3BYAA 2LNKA 4JQ0D 2K2FA 4ETOA 1SCVA 1EG3A 4M2QA 2GV5A 2A4JA 2LCPA 1V1FA 2O5GA 2IS9A 1SR6B 1CFCA 4CIDA 1MQ1A 3EK7A 3JTDC 2LP2A 3BUMB 1S6CA 1JSAA 1AHRA 1MUXA 1E8AA 1KFXL 4PALA 1A29A 3CR5X 3GK2A 4YBHB 1GJYA 1BR4B 1F70A 1IGVA 1IWQA 1TNXA 3OX6A 1F4QA 2CBLA 1A75B 2LVJA 4IL1A 5AEQA 4F0ZB 3EKJA 1Y0VH 1CDNA 1CDMA 1KWOB 2AMIA 2QACA 2ZKMX 1AJ4A 2KOTA 3I5FC 2LANA 1R6PA 2H2KA 2LMVA 2L50A 3KEVA 1EH2A 2LC5A 2FOTA 3PALA 4YGCB 4P5OE 4L9MA 2F2OA 1YRUB 1KK7Z 3OX5A 1UWOA 2HQ8A 4YI9A 2KGBC 2Y4QA 1SYMA 1CMGA 2PMYA 2ZRTA 4R1EA 1SNLA 4P2YB 4XYNA 1PSBA 2JNXA 1IKUA 2ZN9A 1NIWA 3HCMA 5KSZA 3WHTB 1WDCB 2MLEC 1K9PA 4XJKB 4YGBB 2P6BB 2SASA 3OHMB 4PDZA 5AANA 1K90D 4I5NB 1YX7A 1H4BA 1B1GA 4GGFC 1HT9A 2K7CA 1GGWA 1KK7Y 3LL8B 1UHIA 2KBIA 3WNXB 3A4UB 2FJUB 2L4HA 2BL0C 4I5KA 3I5HC 3BUNB 4ORBB 3TS5C 3LK1A 2JT8A 2KAXA 1QX2A 1WLMA 1YUUA 2KAYA 1SL9A 1OMRA 2HPSA 4GBAA 3VRNA 1NP8A 3TUYC 1WRZA 1S5GZ 1NCXA 1UP5A 1U5IB 1XFUO 4PE4A 2K7OA 3AAJA 1B9AA 2G2BA 3SG6A 1OZOA 2L98A 4N5XA 2KSPA 2LM5A 5TNCA 3JVTC 1AK8A 1TCFA 2KYFA 5FYXA 1EG4A 3CLNA 3EVVA 2MLFC 2M9GA 4OVNF 5DKRA 5F6TA 1SPYA 1Y1XA 4MEWA 2CCMA 2KGRA 1DGUA 2LP3A 1FI5A 1XK4A 2HF5A 2NLNA 4I5LB 2WORA 2WCBA 1SR6C 1S5GY 4ORAB 4CFQA 1XO5A 2F33A 3NXAA 2WC8A 1OSAA 4ORCB 1LA0A 3AKBA 1B7TZ 1MXEA 4DUQA 1Q80A 2K61A 3EVRA 3KF9A 1DJZA 5I2OA 1BG1A 3DD4A 5BPJA 1NCZA 3DF0B 1K94A 1TOPA 4JPZB 2JT3A 2MBXA 1XFYO 2HQWA 1YUSA 2GGMA 4WQ2A 1NX2A 2F2PA 4PE7A 1KWOC 5HKWA 5KTYA 2LHIA 2KQYA 2L0PA 3BXKA 5IBWA 5I2QA 2LMTA 2KFHA 1YVLA 1M46A 1NX3A 2M7NA 2QPTA 4AQIA 3ICBA 1VRKA 2K2AA 1WY9A 4C0LA 1DF0A 2B1UA 2PRUA 4NDCA 4U8DA 1KQVA 2JTZA 2M97A 2BBMA 3SG2A 1C07A 1CLMA 4MSPA 1WDCC 3OP0A 5HKYA 4MLWA 1DTLA 1QLKA 1F71A 1BMOA 4OR9B 3SG7A 2KHNA 1S1EA 2V53A 2Y1NA 3IF7A 2ZRSA 3VRRA 1OE9B 1K2HA 4M2PA 1RJVA 1M31A 3PN7B 4BY4A 1S6IA 2HETA 2LHLA 1RK9A 5B8IB 3CWGA 2OTGB 2H61A 2M1KB 1H8BA 2LV7A 2KNEA 3IQQA 1KFUL 2EC6B 1N65A 1LKJA 2OS8B 2JULA 2WCEA 2L4IA 2M0RA 2M3WA 3BQ3A 2JOJA 1CFDA 4PHNA 2KI4B 1NUBA 4PHMA 1LXFC 4DS7A 1GGZA 1X02A 2BKIB 1YRTB 1M45A 2CXJA 3DVEA 3GOFA 1TRFA 5I2LA 3CR2A 2JPTA 4TNCA 1SCMB 2O60A 2MA2A 3O4YA 1F55A 4YGDB 3VRQA 2I2RE 1QIVA 3O6BA 1QS7A 4ICBA 5HLVA 3VROA 4N1GA 4HREE 1CMFA 2OPOA 1DMOA 1QIWA 2BKHB 3I5IB 4Q04A 1YX8A 5J3XA 2Q91A 2PVBA 5KU1A 4A4BA 5D7FA 2E30A 2NCPA 3DVMA 3TDIA 5HLOA 1TCOB 1DVIA 4FTGA 1J7OA 1ALVA 2L51A 4PE1A 1LA3A 5ER5A 1CFPA 1SMGA 5AERA 1IJ5A 5AXIA 2FCDA 1UURA 3TDZA 5CSNA 1ALWA 2R2IA 1MF8B 4HSZA 1CDPA 2BCXA 2LVKA 1LINA 4N1FA 1XK4C 1ZFSA 1CM1A 2ISDA 2MRDA 4YGAA 1JWDA 1WRLA 2M8UA 2VRGA 4QJ4B 1F8HA 1CTRA 1DJGA 1BJFA 1JUOA 2JWWA 2CTNA 3KO0A 2LVIA 2BBNA 3PSRA 2JC2A 3BOWA 1F54A 1FPWA 1CDLA 2CNPA 5PALA 1YTZC 2RGIA 1K9UA 1HQVA 1TNWA 2WOSA 3EVUA 1FBVA 1QX5B 1SKTA 1W7JB 4GPLB 5CSFA 4GNKB 3ZWHA 2EHBA 1BODA 3PN7C 1BF5A 4AOMA 3FWBA 4UPGA 1SY9A 1QXPA 3DVKA 4E68A 4MZJA 2NCOA 1JF0A 2OTGC 1D1OA 1NCYA 2NZ0A 1UUSA 2KYCA 4QJ3B 2EC6C 3D10A 1TTXA 1KK8B 1TNQA 2Y5IA 4GGFA 1DJXA 2MJWB 1B8RA 4MN0A 4USLA 3ZNIA 1IQ3A 3A8RA 2L5XB 4MVFA 2KI4C 1YVHA 1UHJA 3SG3A 1KCYA 5DKQA 4DCKA 3SG4A 1IG5A 1XFXO 4ZCVA 4MRYA 4QJ5B 1SCMC 3F45A 1C7WA 1M39A 1TN4A 1B7TY 4WRIA 5GQQC 1NWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J55 A;  1BLQ A;  4MRX A;  2K0J A;  1XFW O;  2LLS A;  3SIA A;  1LVC D;  1EXR A;  3MSE B;  2LAP A;  3I5I C;  2D8N A;  1REC A;  3CGA A;  2MHH A;  2BE6 A;  3HX4 A;  1QX7 A;  1ZOT B;  1S36 A;  4M2O A;  3C1V A;  2M7L A;  1JFJ A;  2KBM A;  3H4S E;  1XVJ A;  3LLE A;  4YI8 A;  2M1U A;  2BCB A;  2KQ6 A;  1KFX S;  4PHJ A;  1RTP 1;  2ZFD A;  1JC2 A;  1N2D A;  1NYA A;  4GGN A;  1DJY A;  4AQJ A;  1IQ5 A;  1K9K A;  1GQM A;  2LVV A;  1JBA A;  1B47 A;  2M29 A;  3SG5 A;  1DGV A;  1L2O B;  2KFG A;  2F3Z A;  1CB1 A;  4DRW A;  3LCP C;  3FIA A;  1BR1 B;  2JZI A;  4NQG A;  3TDU A;  2SCP A;  4C0J A;  1Y1A A;  2FCE A;  2WND A;  2I18 A;  1JFK A;  1K96 A;  4FQO A;  1DF0 B;  3IQO A;  4JWQ A;  1J7Q A;  2GGZ A;  1A03 A;  1K8U A;  1ZAC A;  1W7I B;  1KQM B;  3M0W A;  4PHK A;  2EGD A;  4CPV A;  4HRG A;  1B4C A;  4GAO A;  1YUR A;  1OMV A;  1PUL A;  1FI6 A;  4WQ3 A;  1JF2 A;  2ZND A;  3QRX A;  4OKH A;  2Y1M A;  1J7P A;  1CLB A;  1NPQ A;  1ODB A;  4BY5 A;  1DJI A;  1FW4 A;  1C7V A;  1F4O A;  2LUX A;  1IRJ A;  1L7Z A;  1QAT A;  4PE0 A;  2E6W A;  1PRW A;  1SW8 A;  1S6J A;  1OOJ A;  1PAL A;  5ER4 X;  3BUW B;  2JU0 A;  4XJK A;  2COL B;  2JQ6 A;  4C0K A;  5CSJ A;  2JXC A;  1QAS A;  2AAO A;  1TIZ A;  1KK8 C;  3OB2 B;  3SIB A;  2JXL A;  4YRU A;  4OCI A;  5I8N A;  3NSO A;  2DOQ A;  4ZCU A;  1R2U A;  1Y1U A;  3OB1 B;  1J1E A;  2I94 A;  2LLU A;  2TN4 A;  3K21 A;  2KFF A;  3PLF B;  1EL4 A;  2ZNE A;  5G08 A;  2I7A A;  1UHK A;  1EJ3 A;  1UHH A;  1WRK A;  1G4Y R;  5AFP A;  3I5G B;  4MZL A;  1OMD A;  1XFZ O;  1J7R A;  1OZS A;  2CT9 A;  1MHO A;  2ZN8 A;  1OQP A;  1U5I A;  1M63 B;  4MBE A;  2KAV A;  3WHU B;  2K7B A;  4CFR A;  2JTT A;  1NX1 A;  1SBJ A;  1SL7 A;  3KHE A;  1ZUZ A;  3RM1 A;  1CKK A;  1K93 D;  2K8M B;  5HYD A;  1QJT A;  1PVA A;  1A2X A;  1AJ5 A;  2M49 B;  3D0Y A;  3GK4 X;  1FF1 A;  5JJG A;  1RFJ A;  3VRP A;  2BEC A;  3FWC A;  3JTD B;  2LMU A;  1PK0 D;  2LUC A;  5HKZ A;  1DT7 B;  1B8C A;  1J1D A;  2PAL A;  1MXL C;  1RWY A;  2AUC A;  3LK0 A;  1QV0 A;  1B8L A;  2KI6 C;  1NSH A;  4DIR A;  1UHN A;  2F3Y A;  1L2O C;  3DF0 A;  1BU3 A;  4GFT A;  1ZMZ A;  2LLT A;  3CTN A;  3E3R A;  2KI6 D;  3PM8 A;  3BUX B;  1SRA A;  3FS7 A;  3CZT X;  1SL8 A;  1XFV O;  3WXA A;  2JT0 A;  4NDB A;  2OS8 C;  4PCW A;  3TZ1 A;  4D1E A;  2PAS A;  3EK4 A;  1PVB A;  1MR8 A;  5CSI A;  5JOL A;  1XYD A;  1G8I A;  1RRO A;  3CR4 X;  3I5F B;  1CNP A;  2BCA A;  3BOW B;  3O2P A;  1KQM C;  3EKH A;  4A4C A;  1SK6 D;  3D0Y B;  2G9B A;  4GUK A;  4OV2 A;  5D69 A;  5DKN A;  1BOC A;  1S26 D;  3EK8 A;  1IH0 A;  1YUT A;  1DJW A;  4MZK A;  2LE9 B;  2JNF A;  1YR5 A;  2K7D A;  2H61 C;  3PFV A;  2KDH A;  1BT6 A;  4I5J A;  1AUI B;  3GK1 A;  1AVS A;  3RLZ A;  1CM4 A;  1KSM A;  3VGO A;  1S3P A;  1A4P A;  2NXQ A;  2Q4U A;  5K89 A;  1QV1 A;  3DVJ A;  2WCF A;  3AKA A;  5CPV A;  4YGE B;  2BL0 B;  1KFU S;  1TNP A;  1QVI Z;  3I5H B;  2PSR A;  3TS5 B;  4NDD A;  1MWN A;  3BUO B;  2F8P A;  1WLZ A;  3NSK A;  1KSO A;  3SJS A;  2MAZ A;  1K95 A;  1CLL A;  1V1G A;  3PAT A;  2BE4 A;  1N0Y A;  3TUY B;  2JRF A;  1G33 A;  2L2E A;  3I5G C;  3KPX A;  3O78 A;  3AAK A;  3NSI A;  1NX0 A;  3CS1 A;  1Y6W A;  4CLN A;  1IJ6 A;  1QLS A;  1DJH A;  1QTX A;  1PSR A;  4HRH A;  1QVI Y;  1A75 A;  1AP4 A;  3JVT B;  1XA5 A;  1CFF A;  3NSL A;  3BYA A;  2LNK A;  4JQ0 D;  2K2F A;  4ETO A;  1SCV A;  1EG3 A;  4M2Q A;  2GV5 A;  2A4J A;  2LCP A;  1V1F A;  2O5G A;  2IS9 A;  1SR6 B;  1CFC A;  4CID A;  1MQ1 A;  3EK7 A;  3JTD C;  2LP2 A;  3BUM B;  1S6C A;  1JSA A;  1AHR A;  1MUX A;  1E8A A;  1KFX L;  4PAL A;  1A29 A;  3CR5 X;  3GK2 A;  4YBH B;  1GJY A;  1BR4 B;  1F70 A;  1IGV A;  1IWQ A;  1TNX A;  3OX6 A;  1F4Q A;  2CBL A;  1A75 B;  2LVJ A;  4IL1 A;  5AEQ A;  4F0Z B;  3EKJ A;  1Y0V H;  1CDN A;  1CDM A;  1KWO B;  2AMI A;  2QAC A;  2ZKM X;  1AJ4 A;  2KOT A;  3I5F C;  2LAN A;  1R6P A;  2H2K A;  2LMV A;  2L50 A;  3KEV A;  1EH2 A;  2LC5 A;  2FOT A;  3PAL A;  4YGC B;  4P5O E;  4L9M A;  2F2O A;  1YRU B;  1KK7 Z;  3OX5 A;  1UWO A;  2HQ8 A;  4YI9 A;  2KGB C;  2Y4Q A;  1SYM A;  1CMG A;  2PMY A;  2ZRT A;  4R1E A;  1SNL A;  4P2Y B;  4XYN A;  1PSB A;  2JNX A;  1IKU A;  2ZN9 A;  1NIW A;  3HCM A;  5KSZ A;  3WHT B;  1WDC B;  2MLE C;  1K9P A;  4XJK B;  4YGB B;  2P6B B;  2SAS A;  3OHM B;  4PDZ A;  5AAN A;  1K90 D;  4I5N B;  1YX7 A;  1H4B A;  1B1G A;  4GGF C;  1HT9 A;  2K7C A;  1GGW A;  1KK7 Y;  3LL8 B;  1UHI A;  2KBI A;  3WNX B;  3A4U B;  2FJU B;  2L4H A;  2BL0 C;  4I5K A;  3I5H C;  3BUN B;  4ORB B;  3TS5 C;  3LK1 A;  2JT8 A;  2KAX A;  1QX2 A;  1WLM A;  1YUU A;  2KAY A;  1SL9 A;  1OMR A;  2HPS A;  4GBA A;  3VRN A;  1NP8 A;  3TUY C;  1WRZ A;  1S5G Z;  1NCX A;  1UP5 A;  1U5I B;  1XFU O;  4PE4 A;  2K7O A;  3AAJ A;  1B9A A;  2G2B A;  3SG6 A;  1OZO A;  2L98 A;  4N5X A;  2KSP A;  2LM5 A;  5TNC A;  3JVT C;  1AK8 A;  1TCF A;  2KYF A;  5FYX A;  1EG4 A;  3CLN A;  3EVV A;  2MLF C;  2M9G A;  4OVN F;  5DKR A;  5F6T A;  1SPY A;  1Y1X A;  4MEW A;  2CCM A;  2KGR A;  1DGU A;  2LP3 A;  1FI5 A;  1XK4 A;  2HF5 A;  2NLN A;  4I5L B;  2WOR A;  2WCB A;  1SR6 C;  1S5G Y;  4ORA B;  4CFQ A;  1XO5 A;  2F33 A;  3NXA A;  2WC8 A;  1OSA A;  4ORC B;  1LA0 A;  3AKB A;  1B7T Z;  1MXE A;  4DUQ A;  1Q80 A;  2K61 A;  3EVR A;  3KF9 A;  1DJZ A;  5I2O A;  1BG1 A;  3DD4 A;  5BPJ A;  1NCZ A;  3DF0 B;  1K94 A;  1TOP A;  4JPZ B;  2JT3 A;  2MBX A;  1XFY O;  2HQW A;  1YUS A;  2GGM A;  4WQ2 A;  1NX2 A;  2F2P A;  4PE7 A;  1KWO C;  5HKW A;  5KTY A;  2LHI A;  2KQY A;  2L0P A;  3BXK A;  5IBW A;  5I2Q A;  2LMT A;  2KFH A;  1YVL A;  1M46 A;  1NX3 A;  2M7N A;  2QPT A;  4AQI A;  3ICB A;  1VRK A;  2K2A A;  1WY9 A;  4C0L A;  1DF0 A;  2B1U A;  2PRU A;  4NDC A;  4U8D A;  1KQV A;  2JTZ A;  2M97 A;  2BBM A;  3SG2 A;  1C07 A;  1CLM A;  4MSP A;  1WDC C;  3OP0 A;  5HKY A;  4MLW A;  1DTL A;  1QLK A;  1F71 A;  1BMO A;  4OR9 B;  3SG7 A;  2KHN A;  1S1E A;  2V53 A;  2Y1N A;  3IF7 A;  2ZRS A;  3VRR A;  1OE9 B;  1K2H A;  4M2P A;  1RJV A;  1M31 A;  3PN7 B;  4BY4 A;  1S6I A;  2HET A;  2LHL A;  1RK9 A;  5B8I B;  3CWG A;  2OTG B;  2H61 A;  2M1K B;  1H8B A;  2LV7 A;  2KNE A;  3IQQ A;  1KFU L;  2EC6 B;  1N65 A;  1LKJ A;  2OS8 B;  2JUL A;  2WCE A;  2L4I A;  2M0R A;  2M3W A;  3BQ3 A;  2JOJ A;  1CFD A;  4PHN A;  2KI4 B;  1NUB A;  4PHM A;  1LXF C;  4DS7 A;  1GGZ A;  1X02 A;  2BKI B;  1YRT B;  1M45 A;  2CXJ A;  3DVE A;  3GOF A;  1TRF A;  5I2L A;  3CR2 A;  2JPT A;  4TNC A;  1SCM B;  2O60 A;  2MA2 A;  3O4Y A;  1F55 A;  4YGD B;  3VRQ A;  2I2R E;  1QIV A;  3O6B A;  1QS7 A;  4ICB A;  5HLV A;  3VRO A;  4N1G A;  4HRE E;  1CMF A;  2OPO A;  1DMO A;  1QIW A;  2BKH B;  3I5I B;  4Q04 A;  1YX8 A;  5J3X A;  2Q91 A;  2PVB A;  5KU1 A;  4A4B A;  5D7F A;  2E30 A;  2NCP A;  3DVM A;  3TDI A;  5HLO A;  1TCO B;  1DVI A;  4FTG A;  1J7O A;  1ALV A;  2L51 A;  4PE1 A;  1LA3 A;  5ER5 A;  1CFP A;  1SMG A;  5AER A;  1IJ5 A;  5AXI A;  2FCD A;  1UUR A;  3TDZ A;  5CSN A;  1ALW A;  2R2I A;  1MF8 B;  4HSZ A;  1CDP A;  2BCX A;  2LVK A;  1LIN A;  4N1F A;  1XK4 C;  1ZFS A;  1CM1 A;  2ISD A;  2MRD A;  4YGA A;  1JWD A;  1WRL A;  2M8U A;  2VRG A;  4QJ4 B;  1F8H A;  1CTR A;  1DJG A;  1BJF A;  1JUO A;  2JWW A;  2CTN A;  3KO0 A;  2LVI A;  2BBN A;  3PSR A;  2JC2 A;  3BOW A;  1F54 A;  1FPW A;  1CDL A;  2CNP A;  5PAL A;  1YTZ C;  2RGI A;  1K9U A;  1HQV A;  1TNW A;  2WOS A;  3EVU A;  1FBV A;  1QX5 B;  1SKT A;  1W7J B;  4GPL B;  5CSF A;  4GNK B;  3ZWH A;  2EHB A;  1BOD A;  3PN7 C;  1BF5 A;  4AOM A;  3FWB A;  4UPG A;  1SY9 A;  1QXP A;  3DVK A;  4E68 A;  4MZJ A;  2NCO A;  1JF0 A;  2OTG C;  1D1O A;  1NCY A;  2NZ0 A;  1UUS A;  2KYC A;  4QJ3 B;  2EC6 C;  3D10 A;  1TTX A;  1KK8 B;  1TNQ A;  2Y5I A;  4GGF A;  1DJX A;  2MJW B;  1B8R A;  4MN0 A;  4USL A;  3ZNI A;  1IQ3 A;  3A8R A;  2L5X B;  4MVF A;  2KI4 C;  1YVH A;  1UHJ A;  3SG3 A;  1KCY A;  5DKQ A;  4DCK A;  3SG4 A;  1IG5 A;  1XFX O;  4ZCV A;  4MRY A;  4QJ5 B;  1SCM C;  3F45 A;  1C7W A;  1M39 A;  1TN4 A;  1B7T Y;  4WRI A;  5GQQ C;  1NWD A; 
#chains in the Genus database with same CATH topology
 1J55 A;  1BLQ A;  4MRX A;  2K0J A;  1XFW O;  2LLS A;  3SIA A;  1LVC D;  1EXR A;  3MSE B;  2LAP A;  3BFH A;  3I5I C;  2D8N A;  1Z4H A;  1REC A;  3CGA A;  2MHH A;  2BE6 A;  3HX4 A;  1QX7 A;  3DYE A;  1OOI X;  1ZOT B;  1S36 A;  4M2O A;  3C1V A;  2M7L A;  1JFJ A;  2KBM A;  3DZT A;  3H4S E;  1XVJ A;  3LLE A;  4YI8 A;  2JPO A;  2M1U A;  2BCB A;  2KQ6 A;  1KFX S;  4PHJ A;  1RTP 1;  2QEV A;  2ZFD A;  1N2D A;  3BJH A;  1JC2 A;  1NYA A;  4GGN A;  1DJY A;  4AQJ A;  2PYQ A;  1IQ5 A;  1K9K A;  1GQM A;  2LVV A;  1JBA A;  1B47 A;  2M29 A;  3SG5 A;  1DGV A;  1L2O B;  1OOG A;  1TUJ A;  2KFG A;  2F3Z A;  2QEO A;  1CB1 A;  4DRW A;  3LCP C;  3FIA A;  1BR1 B;  2JZI A;  4NQG A;  3TDU A;  2SCP A;  4C0J A;  1Y1A A;  2FCE A;  2WND A;  3EG5 B;  1LS8 A;  2I18 A;  1JFK A;  1K96 A;  5FI2 A;  4FQO A;  1DF0 B;  3IQO A;  4JWQ A;  1J7Q A;  2GGZ A;  1A03 A;  1K8U A;  3D76 A;  1ZAC A;  1W7I B;  2QEB A;  1KQM B;  3M0W A;  4PHK A;  2L5Y A;  3L4L A;  2EGD A;  4CPV A;  4HRG A;  1B4C A;  4GAO A;  1DEL A;  1YUR A;  1OMV A;  1PUL A;  2YGU A;  1FI6 A;  4WQ3 A;  1JF2 A;  2ZND A;  3QRX A;  4OKH A;  2Y1M A;  1J7P A;  1CLB A;  1NPQ A;  1ODB A;  3NGV A;  4BY5 A;  1DJI A;  1FW4 A;  1C7V A;  1F4O A;  2LUX A;  1IRJ A;  1L7Z A;  1QAT A;  4PE0 A;  2E6W A;  1PRW A;  1SW8 A;  1S6J A;  1OOJ A;  1PAL A;  2K60 A;  3BUW B;  5ER4 X;  2JU0 A;  4XJK A;  2COL B;  2JQ6 A;  4C0K A;  3VB1 A;  5CSJ A;  2JXC A;  1QAS A;  2AAO A;  1TIZ A;  1KK8 C;  3OB2 B;  3SIB A;  2JXL A;  4YRU A;  4OCI A;  5I8N A;  3NSO A;  2DOQ A;  4ZCU A;  1SSE B;  3L47 A;  1R2U A;  1XFR A;  1Y1U A;  3CAB A;  1J1E A;  3OB1 B;  2I94 A;  2LLU A;  2TN4 A;  3K21 A;  2KFF A;  3FE9 A;  3PLF B;  1EL4 A;  2ZNE A;  5G08 A;  2I7A A;  1UHK A;  1EJ3 A;  1UHH A;  1WRK A;  1G4Y R;  5AFP A;  3I5G B;  4MZL A;  2L2C A;  1OMD A;  1XFZ O;  1J7R A;  1OZS A;  2CT9 A;  1MHO A;  2ZN8 A;  1OQP A;  1U5I A;  1M63 B;  4MBE A;  4FQT A;  2KAV A;  3WHU B;  2K7B A;  3R1V A;  4CFR A;  2JTT A;  1NX1 A;  1SBJ A;  1SL7 A;  3KHE A;  1ZUZ A;  4JKT A;  3RM1 A;  1CKK A;  1TUZ A;  1K93 D;  2K8M B;  5HYD A;  1QJT A;  1PVA A;  1A2X A;  1AJ5 A;  3SS5 A;  2M49 B;  3D0Y A;  3GK4 X;  1FF1 A;  5JJG A;  1RFJ A;  3VRP A;  2BEC A;  3FWC A;  3JTD B;  2LMU A;  1PK0 D;  2LUC A;  5HKZ A;  1DT7 B;  2ERB A;  1B8C A;  1J1D A;  2FJY A;  2PAL A;  1MXL C;  1RWY A;  2AUC A;  5HL1 A;  3LK0 A;  1QV0 A;  1B8L A;  2KI6 C;  1NSH A;  3D74 A;  4DIR A;  1UHN A;  2F3Y A;  1L2O C;  3DF0 A;  1BU3 A;  4GFT A;  3R1P A;  1ZMZ A;  2LLT A;  3CTN A;  3E3R A;  2KI6 D;  3PM8 A;  3BUX B;  1SRA A;  3FS7 A;  3CZT X;  1SL8 A;  1XFV O;  4KYN A;  3WXA A;  2JT0 A;  4NDB A;  2OS8 C;  4PCW A;  3TZ1 A;  3IVT A;  2PAS A;  4D1E A;  3EK4 A;  1PVB A;  1MR8 A;  5CSI A;  5JOL A;  1XYD A;  1G8I A;  1RRO A;  3CR4 X;  3I5F B;  1CNP A;  2BCA A;  3BOW B;  3O2P A;  1KQM C;  3EKH A;  5FI6 A;  4A4C A;  1SK6 D;  3D0Y B;  2G9B A;  4GUK A;  4OV2 A;  3NHT A;  5D69 A;  1OOF A;  2KLE A;  5DKN A;  1BOC A;  1S26 D;  3EK8 A;  3SS3 A;  1IH0 A;  1YUT A;  1DJW A;  4MZK A;  2LE9 B;  2JNF A;  3PJI A;  4F7F A;  1YR5 A;  3B86 A;  2WCK A;  2K7D A;  2H61 C;  3PFV A;  2KDH A;  1BT6 A;  4I5J A;  1AUI B;  5I94 A;  3GK1 A;  1AVS A;  3RLZ A;  1CM4 A;  1KSM A;  3VGO A;  1S3P A;  1A4P A;  2NXQ A;  2Q4U A;  5K89 A;  1QV1 A;  3DVJ A;  2WCF A;  3AKA A;  5CPV A;  4YGE B;  2BL0 B;  1KFU S;  1TNP A;  1QVI Z;  3I5H B;  2PSR A;  3TS5 B;  1C3Y A;  4NDD A;  1MWN A;  3BUO B;  2F8P A;  1WLZ A;  3NSK A;  1KSO A;  3SJS A;  2BAP A;  1K95 A;  1CLL A;  2MAZ A;  1V1G A;  3BFA A;  3PAT A;  4OZD A;  2BE4 A;  1N0Y A;  3TUY B;  2JRF A;  1G33 A;  1TWO A;  2L2E A;  3I5G C;  3KPX A;  3O78 A;  3AAK A;  3NSI A;  1NX0 A;  3CS1 A;  1Y6W A;  4CLN A;  1IJ6 A;  1QLS A;  1DJH A;  1QTX A;  1PSR A;  4HRH A;  1QVI Y;  1A75 A;  1AP4 A;  3JVT B;  1XA5 A;  3OBV A;  1CFF A;  3NSL A;  3BYA A;  2LNK A;  4JQ0 D;  3RZS A;  2K2F A;  4ETO A;  1SCV A;  1EG3 A;  4M2Q A;  2GV5 A;  1DEK A;  1Z2C B;  2A4J A;  2LCP A;  1V1F A;  2O5G A;  2IS9 A;  1SR6 B;  1CFC A;  4CID A;  1MQ1 A;  3EK7 A;  3BFB A;  3JTD C;  2LP2 A;  3BUM B;  1OOH A;  1S6C A;  1JSA A;  1AHR A;  1MUX A;  1E8A A;  1KFX L;  4PAL A;  1A29 A;  3CR5 X;  3GK2 A;  4YBH B;  1GJY A;  1OW4 A;  1BR4 B;  1F70 A;  1IGV A;  1IWQ A;  1TNX A;  3OX6 A;  1F4Q A;  2CBL A;  1A75 B;  2LVJ A;  3UNW A;  4IL1 A;  5AEQ A;  4F0Z B;  3EKJ A;  1Y0V H;  1CDN A;  1CDM A;  4JD9 A;  1KWO B;  2AMI A;  2QAC A;  2ZKM X;  1AJ4 A;  2KOT A;  3I5F C;  2LAN A;  2WC6 A;  1R6P A;  2H2K A;  2LMV A;  2L50 A;  3KEV A;  1EH2 A;  2LC5 A;  2FOT A;  3PAL A;  4YGC B;  4P5O E;  4L9M A;  2F2O A;  1YRU B;  1KK7 Z;  3OX5 A;  1UWO A;  2HQ8 A;  3CZ0 A;  4YI9 A;  2KGB C;  2Y4Q A;  1SYM A;  1CMG A;  2PMY A;  2ZRT A;  4R1E A;  1SNL A;  4P2Y B;  4XYN A;  1PSB A;  2JNX A;  1IKU A;  2ZN9 A;  3K1E A;  1QWV A;  1NIW A;  3B6X A;  3HCM A;  5KSZ A;  3WHT B;  1WDC B;  2MLE C;  1K9P A;  4XJK B;  4YGB B;  1IIO A;  2P71 A;  2P6B B;  2SAS A;  3QME A;  3OHM B;  4PDZ A;  5AAN A;  1K90 D;  4I5N B;  1YX7 A;  1H4B A;  1B1G A;  4GGF C;  3S0F A;  1HT9 A;  2K7C A;  1GGW A;  1KK7 Y;  3LL8 B;  1UHI A;  2KBI A;  3WNX B;  3A4U B;  2FJU B;  2L4H A;  2BL0 C;  4I5K A;  3I5H C;  3BUN B;  4ORB B;  3TS5 C;  3LK1 A;  2JT8 A;  2KAX A;  1QX2 A;  1WLM A;  1YUU A;  2KAY A;  1SL9 A;  1OMR A;  2HPS A;  4GBA A;  3VRN A;  1NP8 A;  2PQL A;  3TUY C;  1WRZ A;  1S5G Z;  1NCX A;  1UP5 A;  1U5I B;  1XFU O;  4PE4 A;  2K7O A;  3AAJ A;  1B9A A;  2G2B A;  3SG6 A;  1OZO A;  2L98 A;  4N5X A;  2KSP A;  2LM5 A;  5TNC A;  3JVT C;  1AK8 A;  1TCF A;  2KYF A;  5FYX A;  1EG4 A;  3CLN A;  3EVV A;  2MLF C;  2M9G A;  4OVN F;  5DKR A;  5F6T A;  1SPY A;  3S0D A;  1Y1X A;  4MEW A;  2CCM A;  2KGR A;  1DGU A;  2LP3 A;  1FI5 A;  3R72 A;  1XK4 A;  1GM0 A;  2HF5 A;  2NLN A;  3OGN A;  4I5L B;  2WOR A;  1DQE A;  2WCB A;  1SR6 C;  1S5G Y;  3O4X A;  4ORA B;  4CFQ A;  1XO5 A;  2F33 A;  3NXA A;  2WC8 A;  1OSA A;  4ORC B;  1LA0 A;  3AKB A;  3N7H A;  1B7T Z;  1MXE A;  4DUQ A;  1Q80 A;  2K61 A;  3EVR A;  3KF9 A;  1DJZ A;  5I2O A;  1BG1 A;  3DD4 A;  5BPJ A;  1NCZ A;  3DF0 B;  1K94 A;  1DC1 A;  1TOP A;  4JPZ B;  2JT3 A;  2WCL A;  2MBX A;  3S0A A;  1W9Z A;  1XFY O;  2HQW A;  1YUS A;  2GGM A;  4WQ2 A;  3DY9 A;  1NX2 A;  2GTE A;  2F2P A;  4PE7 A;  1KWO C;  5HKW A;  5KTY A;  2LHI A;  2KQY A;  2L0P A;  3SS4 A;  3BXK A;  5IBW A;  5I2Q A;  2LMT A;  2KFH A;  1YVL A;  1M46 A;  1NX3 A;  2M7N A;  2QPT A;  4AQI A;  3ICB A;  1VRK A;  2K2A A;  1WY9 A;  4C0L A;  1DF0 A;  2B1U A;  2PRU A;  4NDC A;  2WC5 A;  4U8D A;  1KQV A;  3S0G A;  2JTZ A;  2M97 A;  2BBM A;  4PT1 A;  3SG2 A;  1CLM A;  1C07 A;  4MSP A;  1WDC C;  3OP0 A;  5HKY A;  3B7A A;  4MLW A;  1DTL A;  1QLK A;  3D75 A;  1F71 A;  1BMO A;  4OR9 B;  3SG7 A;  2H8V A;  1T14 A;  2KHN A;  1S1E A;  2V53 A;  2Y1N A;  3IF7 A;  1C3Z A;  3D73 A;  2ZRS A;  3PM2 A;  2QDI A;  1OE9 B;  3VRR A;  4M2P A;  1RJV A;  1K2H A;  1M31 A;  3PN7 B;  4BY4 A;  1S6I A;  2HET A;  2LHL A;  1RK9 A;  5B8I B;  3CWG A;  2OTG B;  2H61 A;  2M1K B;  1H8B A;  2WCH A;  2LV7 A;  2KNE A;  2QEH A;  3IQQ A;  1KFU L;  2EC6 B;  1N65 A;  2KLD A;  1LKJ A;  2OS8 B;  2JUL A;  2WCE A;  2L4I A;  2M0R A;  2M3W A;  3BQ3 A;  2JOJ A;  1CFD A;  4PHN A;  2KI4 B;  1NUB A;  4PHM A;  1LXF C;  4DS7 A;  1GGZ A;  1X02 A;  5DIC A;  2BKI B;  1YRT B;  1M45 A;  2CXJ A;  3DVE A;  2WCJ A;  1TRF A;  3GOF A;  5I2L A;  3CR2 A;  2JPT A;  4TNC A;  1SCM B;  2O60 A;  2MA2 A;  3O4Y A;  3S0E A;  1F55 A;  4YGD B;  3VRQ A;  2I2R E;  1QIV A;  3O6B A;  1QS7 A;  4ICB A;  5HLV A;  3VRO A;  1P28 A;  2BNX A;  4N1G A;  4HRE E;  1CMF A;  2OPO A;  1DMO A;  1QIW A;  3DXL A;  2BKH B;  3I5I B;  4Q04 A;  1YX8 A;  3CZ1 A;  5J3X A;  2Q91 A;  2PVB A;  5KU1 A;  4A4B A;  3B87 A;  5D7F A;  2E30 A;  2NCP A;  3DVM A;  3TDI A;  5HLO A;  5EL2 A;  1TCO B;  1DVI A;  4FTG A;  1J7O A;  1ALV A;  2L51 A;  4PE1 A;  1LA3 A;  5ER5 A;  1CFP A;  1SMG A;  5AER A;  3D77 A;  1IJ5 A;  3Q8I A;  3S0B A;  5AXI A;  2FCD A;  3D78 A;  1UUR A;  3TDZ A;  5CSN A;  1ALW A;  2R2I A;  1MF8 B;  4HSZ A;  1CDP A;  2BCX A;  2LVK A;  1LIN A;  3L4A A;  4N1F A;  1XK4 C;  1ZFS A;  1CM1 A;  2ISD A;  2MRD A;  1ORG A;  4YGA A;  1JWD A;  3FE6 A;  1WRL A;  2M8U A;  2VRG A;  4QJ4 B;  3CDN A;  1F8H A;  1CTR A;  1DJG A;  1BJF A;  1JUO A;  2JWW A;  2CTN A;  3KO0 A;  2LVI A;  2P70 A;  2BBN A;  3PSR A;  5FI7 A;  2WCM A;  2JC2 A;  3BOW A;  1F54 A;  1FPW A;  1CDL A;  2CNP A;  5PAL A;  1YTZ C;  2RGI A;  1K9U A;  3CZ2 A;  1HQV A;  2KPH A;  1TNW A;  2WOS A;  3EVU A;  1FBV A;  1QX5 B;  4INX A;  1SKT A;  1W7J B;  4GPL B;  5CSF A;  3B88 A;  4GNK B;  3ZWH A;  2EHB A;  3CYZ A;  1BOD A;  3PN7 C;  1BF5 A;  4AOM A;  3FWB A;  4UPG A;  1SY9 A;  1QXP A;  3DVK A;  4E68 A;  4MZJ A;  2NCO A;  1JF0 A;  2OTG C;  1D1O A;  1NCY A;  2NZ0 A;  1UUS A;  2KYC A;  4QJ3 B;  2EC6 C;  3D10 A;  1TTX A;  1KK8 B;  3NHI A;  1TNQ A;  2Y5I A;  4GGF A;  5D3O A;  3FE8 A;  1DJX A;  2MJW B;  1B8R A;  4MN0 A;  4USL A;  3V2L A;  3ZNI A;  1IQ3 A;  3A8R A;  2L5X B;  4MVF A;  2KI4 C;  1YVH A;  1UHJ A;  4INW A;  3SG3 A;  5DKQ A;  4DCK A;  1KCY A;  3SG4 A;  3R1O A;  3UO9 A;  1IG5 A;  1XFX O;  4ZCV A;  4MRY A;  4QJ5 B;  4IJ7 A;  1SCM C;  3F45 A;  1C7W A;  1M39 A;  1TN4 A;  1B7T Y;  4WRI A;  5GQQ C;  1NWD A; 
#chains in the Genus database with same CATH homology
 1J55 A;  1BLQ A;  4MRX A;  2K0J A;  1XFW O;  2LLS A;  3SIA A;  1LVC D;  1EXR A;  3MSE B;  2LAP A;  3I5I C;  2D8N A;  1REC A;  3CGA A;  2MHH A;  2BE6 A;  3HX4 A;  1QX7 A;  1ZOT B;  1S36 A;  4M2O A;  3C1V A;  2M7L A;  1JFJ A;  2KBM A;  3H4S E;  1XVJ A;  3LLE A;  4YI8 A;  2M1U A;  2BCB A;  2KQ6 A;  1KFX S;  4PHJ A;  1RTP 1;  2ZFD A;  1JC2 A;  1N2D A;  1NYA A;  4GGN A;  1DJY A;  4AQJ A;  1IQ5 A;  1K9K A;  1GQM A;  2LVV A;  1JBA A;  1B47 A;  2M29 A;  3SG5 A;  1DGV A;  1L2O B;  2KFG A;  2F3Z A;  1CB1 A;  4DRW A;  3LCP C;  3FIA A;  1BR1 B;  2JZI A;  4NQG A;  3TDU A;  2SCP A;  4C0J A;  1Y1A A;  2FCE A;  2WND A;  2I18 A;  1JFK A;  1K96 A;  4FQO A;  1DF0 B;  3IQO A;  4JWQ A;  1J7Q A;  2GGZ A;  1A03 A;  1K8U A;  1ZAC A;  1W7I B;  1KQM B;  3M0W A;  4PHK A;  2EGD A;  4CPV A;  4HRG A;  1B4C A;  4GAO A;  1YUR A;  1OMV A;  1PUL A;  1FI6 A;  4WQ3 A;  1JF2 A;  2ZND A;  3QRX A;  4OKH A;  2Y1M A;  1J7P A;  1CLB A;  1NPQ A;  1ODB A;  4BY5 A;  1DJI A;  1FW4 A;  1C7V A;  1F4O A;  2LUX A;  1IRJ A;  1L7Z A;  1QAT A;  4PE0 A;  2E6W A;  1PRW A;  1SW8 A;  1S6J A;  1OOJ A;  1PAL A;  5ER4 X;  3BUW B;  2JU0 A;  4XJK A;  2COL B;  2JQ6 A;  4C0K A;  5CSJ A;  2JXC A;  1QAS A;  2AAO A;  1TIZ A;  1KK8 C;  3OB2 B;  3SIB A;  2JXL A;  4YRU A;  4OCI A;  5I8N A;  3NSO A;  2DOQ A;  4ZCU A;  1R2U A;  1Y1U A;  3OB1 B;  1J1E A;  2I94 A;  2LLU A;  2TN4 A;  3K21 A;  2KFF A;  3PLF B;  1EL4 A;  2ZNE A;  5G08 A;  2I7A A;  1UHK A;  1EJ3 A;  1UHH A;  1WRK A;  1G4Y R;  5AFP A;  3I5G B;  4MZL A;  1OMD A;  1XFZ O;  1J7R A;  1OZS A;  2CT9 A;  1MHO A;  2ZN8 A;  1OQP A;  1U5I A;  1M63 B;  4MBE A;  2KAV A;  3WHU B;  2K7B A;  4CFR A;  2JTT A;  1NX1 A;  1SBJ A;  1SL7 A;  3KHE A;  1ZUZ A;  3RM1 A;  1CKK A;  1K93 D;  2K8M B;  5HYD A;  1QJT A;  1PVA A;  1A2X A;  1AJ5 A;  2M49 B;  3D0Y A;  3GK4 X;  1FF1 A;  5JJG A;  1RFJ A;  3VRP A;  2BEC A;  3FWC A;  3JTD B;  2LMU A;  1PK0 D;  2LUC A;  5HKZ A;  1DT7 B;  1B8C A;  1J1D A;  2PAL A;  1MXL C;  1RWY A;  2AUC A;  3LK0 A;  1QV0 A;  1B8L A;  2KI6 C;  1NSH A;  4DIR A;  1UHN A;  2F3Y A;  1L2O C;  3DF0 A;  1BU3 A;  4GFT A;  1ZMZ A;  2LLT A;  3CTN A;  3E3R A;  2KI6 D;  3PM8 A;  3BUX B;  1SRA A;  3FS7 A;  3CZT X;  1SL8 A;  1XFV O;  3WXA A;  2JT0 A;  4NDB A;  2OS8 C;  4PCW A;  3TZ1 A;  4D1E A;  2PAS A;  3EK4 A;  1PVB A;  1MR8 A;  5CSI A;  5JOL A;  1XYD A;  1G8I A;  1RRO A;  3CR4 X;  3I5F B;  1CNP A;  2BCA A;  3BOW B;  3O2P A;  1KQM C;  3EKH A;  4A4C A;  1SK6 D;  3D0Y B;  2G9B A;  4GUK A;  4OV2 A;  5D69 A;  5DKN A;  1BOC A;  1S26 D;  3EK8 A;  1IH0 A;  1YUT A;  1DJW A;  4MZK A;  2LE9 B;  2JNF A;  1YR5 A;  2K7D A;  2H61 C;  3PFV A;  2KDH A;  1BT6 A;  4I5J A;  1AUI B;  3GK1 A;  1AVS A;  3RLZ A;  1CM4 A;  1KSM A;  3VGO A;  1S3P A;  1A4P A;  2NXQ A;  2Q4U A;  5K89 A;  1QV1 A;  3DVJ A;  2WCF A;  3AKA A;  5CPV A;  4YGE B;  2BL0 B;  1KFU S;  1TNP A;  1QVI Z;  3I5H B;  2PSR A;  3TS5 B;  4NDD A;  1MWN A;  3BUO B;  2F8P A;  1WLZ A;  3NSK A;  1KSO A;  3SJS A;  2MAZ A;  1K95 A;  1CLL A;  1V1G A;  3PAT A;  2BE4 A;  1N0Y A;  3TUY B;  2JRF A;  1G33 A;  2L2E A;  3I5G C;  3KPX A;  3O78 A;  3AAK A;  3NSI A;  1NX0 A;  3CS1 A;  1Y6W A;  4CLN A;  1IJ6 A;  1QLS A;  1DJH A;  1QTX A;  1PSR A;  4HRH A;  1QVI Y;  1A75 A;  1AP4 A;  3JVT B;  1XA5 A;  1CFF A;  3NSL A;  3BYA A;  2LNK A;  4JQ0 D;  2K2F A;  4ETO A;  1SCV A;  1EG3 A;  4M2Q A;  2GV5 A;  2A4J A;  2LCP A;  1V1F A;  2O5G A;  2IS9 A;  1SR6 B;  1CFC A;  4CID A;  1MQ1 A;  3EK7 A;  3JTD C;  2LP2 A;  3BUM B;  1S6C A;  1JSA A;  1AHR A;  1MUX A;  1E8A A;  1KFX L;  4PAL A;  1A29 A;  3CR5 X;  3GK2 A;  4YBH B;  1GJY A;  1BR4 B;  1F70 A;  1IGV A;  1IWQ A;  1TNX A;  3OX6 A;  1F4Q A;  2CBL A;  1A75 B;  2LVJ A;  4IL1 A;  5AEQ A;  4F0Z B;  3EKJ A;  1Y0V H;  1CDN A;  1CDM A;  1KWO B;  2AMI A;  2QAC A;  2ZKM X;  1AJ4 A;  2KOT A;  3I5F C;  2LAN A;  1R6P A;  2H2K A;  2LMV A;  2L50 A;  3KEV A;  1EH2 A;  2LC5 A;  2FOT A;  3PAL A;  4YGC B;  4P5O E;  4L9M A;  2F2O A;  1YRU B;  1KK7 Z;  3OX5 A;  1UWO A;  2HQ8 A;  4YI9 A;  2KGB C;  2Y4Q A;  1SYM A;  1CMG A;  2PMY A;  2ZRT A;  4R1E A;  1SNL A;  4P2Y B;  4XYN A;  1PSB A;  2JNX A;  1IKU A;  2ZN9 A;  1NIW A;  3HCM A;  5KSZ A;  3WHT B;  1WDC B;  2MLE C;  1K9P A;  4XJK B;  4YGB B;  2P6B B;  2SAS A;  3OHM B;  4PDZ A;  5AAN A;  1K90 D;  4I5N B;  1YX7 A;  1H4B A;  1B1G A;  4GGF C;  1HT9 A;  2K7C A;  1GGW A;  1KK7 Y;  3LL8 B;  1UHI A;  2KBI A;  3WNX B;  3A4U B;  2FJU B;  2L4H A;  2BL0 C;  4I5K A;  3I5H C;  3BUN B;  4ORB B;  3TS5 C;  3LK1 A;  2JT8 A;  2KAX A;  1QX2 A;  1WLM A;  1YUU A;  2KAY A;  1SL9 A;  1OMR A;  2HPS A;  4GBA A;  3VRN A;  1NP8 A;  3TUY C;  1WRZ A;  1S5G Z;  1NCX A;  1UP5 A;  1U5I B;  1XFU O;  4PE4 A;  2K7O A;  3AAJ A;  1B9A A;  2G2B A;  3SG6 A;  1OZO A;  2L98 A;  4N5X A;  2KSP A;  2LM5 A;  5TNC A;  3JVT C;  1AK8 A;  1TCF A;  2KYF A;  5FYX A;  1EG4 A;  3CLN A;  3EVV A;  2MLF C;  2M9G A;  4OVN F;  5DKR A;  5F6T A;  1SPY A;  1Y1X A;  4MEW A;  2CCM A;  2KGR A;  1DGU A;  2LP3 A;  1FI5 A;  1XK4 A;  2HF5 A;  2NLN A;  4I5L B;  2WOR A;  2WCB A;  1SR6 C;  1S5G Y;  4ORA B;  4CFQ A;  1XO5 A;  2F33 A;  3NXA A;  2WC8 A;  1OSA A;  4ORC B;  1LA0 A;  3AKB A;  1B7T Z;  1MXE A;  4DUQ A;  1Q80 A;  2K61 A;  3EVR A;  3KF9 A;  1DJZ A;  5I2O A;  1BG1 A;  3DD4 A;  5BPJ A;  1NCZ A;  3DF0 B;  1K94 A;  1TOP A;  4JPZ B;  2JT3 A;  2MBX A;  1XFY O;  2HQW A;  1YUS A;  2GGM A;  4WQ2 A;  1NX2 A;  2F2P A;  4PE7 A;  1KWO C;  5HKW A;  5KTY A;  2LHI A;  2KQY A;  2L0P A;  3BXK A;  5IBW A;  5I2Q A;  2LMT A;  2KFH A;  1YVL A;  1M46 A;  1NX3 A;  2M7N A;  2QPT A;  4AQI A;  3ICB A;  1VRK A;  2K2A A;  1WY9 A;  4C0L A;  1DF0 A;  2B1U A;  2PRU A;  4NDC A;  4U8D A;  1KQV A;  2JTZ A;  2M97 A;  2BBM A;  3SG2 A;  1C07 A;  1CLM A;  4MSP A;  1WDC C;  3OP0 A;  5HKY A;  4MLW A;  1DTL A;  1QLK A;  1F71 A;  1BMO A;  4OR9 B;  3SG7 A;  2KHN A;  1S1E A;  2V53 A;  2Y1N A;  3IF7 A;  2ZRS A;  3VRR A;  1OE9 B;  1K2H A;  4M2P A;  1RJV A;  1M31 A;  3PN7 B;  4BY4 A;  1S6I A;  2HET A;  2LHL A;  1RK9 A;  5B8I B;  3CWG A;  2OTG B;  2H61 A;  2M1K B;  1H8B A;  2LV7 A;  2KNE A;  3IQQ A;  1KFU L;  2EC6 B;  1N65 A;  1LKJ A;  2OS8 B;  2JUL A;  2WCE A;  2L4I A;  2M0R A;  2M3W A;  3BQ3 A;  2JOJ A;  1CFD A;  4PHN A;  2KI4 B;  1NUB A;  4PHM A;  1LXF C;  4DS7 A;  1GGZ A;  1X02 A;  2BKI B;  1YRT B;  1M45 A;  2CXJ A;  3DVE A;  3GOF A;  1TRF A;  5I2L A;  3CR2 A;  2JPT A;  4TNC A;  1SCM B;  2O60 A;  2MA2 A;  3O4Y A;  1F55 A;  4YGD B;  3VRQ A;  2I2R E;  1QIV A;  3O6B A;  1QS7 A;  4ICB A;  5HLV A;  3VRO A;  4N1G A;  4HRE E;  1CMF A;  2OPO A;  1DMO A;  1QIW A;  2BKH B;  3I5I B;  4Q04 A;  1YX8 A;  5J3X A;  2Q91 A;  2PVB A;  5KU1 A;  4A4B A;  5D7F A;  2E30 A;  2NCP A;  3DVM A;  3TDI A;  5HLO A;  1TCO B;  1DVI A;  4FTG A;  1J7O A;  1ALV A;  2L51 A;  4PE1 A;  1LA3 A;  5ER5 A;  1CFP A;  1SMG A;  5AER A;  1IJ5 A;  5AXI A;  2FCD A;  1UUR A;  3TDZ A;  5CSN A;  1ALW A;  2R2I A;  1MF8 B;  4HSZ A;  1CDP A;  2BCX A;  2LVK A;  1LIN A;  4N1F A;  1XK4 C;  1ZFS A;  1CM1 A;  2ISD A;  2MRD A;  4YGA A;  1JWD A;  1WRL A;  2M8U A;  2VRG A;  4QJ4 B;  1F8H A;  1CTR A;  1DJG A;  1BJF A;  1JUO A;  2JWW A;  2CTN A;  3KO0 A;  2LVI A;  2BBN A;  3PSR A;  2JC2 A;  3BOW A;  1F54 A;  1FPW A;  1CDL A;  2CNP A;  5PAL A;  1YTZ C;  2RGI A;  1K9U A;  1HQV A;  1TNW A;  2WOS A;  3EVU A;  1FBV A;  1QX5 B;  1SKT A;  1W7J B;  4GPL B;  5CSF A;  4GNK B;  3ZWH A;  2EHB A;  1BOD A;  3PN7 C;  1BF5 A;  4AOM A;  3FWB A;  4UPG A;  1SY9 A;  1QXP A;  3DVK A;  4E68 A;  4MZJ A;  2NCO A;  1JF0 A;  2OTG C;  1D1O A;  1NCY A;  2NZ0 A;  1UUS A;  2KYC A;  4QJ3 B;  2EC6 C;  3D10 A;  1TTX A;  1KK8 B;  1TNQ A;  2Y5I A;  4GGF A;  1DJX A;  2MJW B;  1B8R A;  4MN0 A;  4USL A;  3ZNI A;  1IQ3 A;  3A8R A;  2L5X B;  4MVF A;  2KI4 C;  1YVH A;  1UHJ A;  3SG3 A;  1KCY A;  5DKQ A;  4DCK A;  3SG4 A;  1IG5 A;  1XFX O;  4ZCV A;  4MRY A;  4QJ5 B;  1SCM C;  3F45 A;  1C7W A;  1M39 A;  1TN4 A;  1B7T Y;  4WRI A;  5GQQ C;  1NWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...