2K2AA

Solution structure of the apo c terminal domain of lethocerus troponin c isoform f1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
MQQELREAFRLYDKEGNGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFEEFMGVMTGGDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Apo C-terminal domain of the Lethocerus F1 troponin C isoform.
pubmed doi rcsb
source organism Lethocerus indicus
molecule tags Contractile protein
molecule keywords Troponin C
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k2aA00
3K21A 2LLSA 1J1DA 1BR1B 1NX3A 1QIWA 2HPSA 1WY9A 2I7AA 1MR8A 5BPJA 2JNFA 2LMVA 4DCKA 1NCYA 4AQIA 5ER5A 3ICBA 2H61C 3VROA 2WNDA 3I5IB 2HQWA 2NCOA 2P6BB 2F3ZA 2RGIA 1V1FA 4WRIA 1AHRA 1IH0A 2I94A 3KHEA 2MJWB 4ORCB 1S36A 1JSAA 1M39A 2R2IA 3JVTB 4YGBB 2NXQA 1WDCB 1UWOA 2M97A 2ZKMX 1FBVA 2KQ6A 2EC6C 3I5FC 1S3PA 1N2DA 3BQ3A 4YGAA 4XJKB 2L50A 3M0WA 1SCMB 1CLBA 1SL8A 2M0RA 1YVLA 3ZNIA 2OTGC 2OTGB 1KFUL 4FQOA 2LVJA 5ER4X 2MA2A 4N1FA 1KSOA 1WRZA 1K96A 1SR6B 1CDLA 1IGVA 2IS9A 1JF2A 1TNWA 4BY5A 4ORAB 2EC6B 2KYCA 1A75B 3FWCA 2PASA 3O78A 1S5GY 4GNKB 1W7JB 1WLZA 1RROA 1UURA 1M46A 1LA0A 2AUCA 4OCIA 1Y1XA 3NSKA 1BG1A 3F45A 2MAZA 2KOTA 1YRTB 2BCXA 2JT8A 2QPTA 2KFHA 1IG5A 1NUBA 4MRXA 1XFVO 2JQ6A 3WHUB 2BE6A 4P2YB 2OS8B 2L51A 4MRYA 1LA3A 1J7PA 4F0ZB 1KFXS 1PVAA 5PALA 4YRUA 2KAXA 2M8UA 3CZTX 1GJYA 2NCPA 3TDUA 5HYDA 1JUOA 2I2RE 3I5IC 2JT3A 5J3XA 3EVUA 2HETA 2LVKA 2O60A 2JU0A 5CPVA 2JXLA 1B7TZ 2OS8C 2Y5IA 2LLUA 1U5IA 1F4OA 2G9BA 1L2OB 4ORBB 1MUXA 1CDPA 4MLWA 2LUCA 3BUNB 3IQOA 2LUXA 1B4CA 1YUTA 2PALA 1KWOC 1JFKA 4GGFC 3EK7A 1KFXL 1A4PA 1J55A 2L4IA 1QXPA 1KK7Y 1GGWA 4YGDB 2G2BA 2JTTA 1DJZA 3BUOB 4IL1A 4C0LA 2LVIA 1R2UA 3HCMA 4PHNA 1XFUO 1CNPA 4ICBA 1JBAA 1FI6A 2K61A 4GGNA 1DT7B 4R1EA 1FF1A 1W7IB 1B1GA 1AP4A 1J7OA 4D1EA 2LNKA 1KK8B 3AAKA 2M49B 1NIWA 1OZSA 1YX8A 3O2PA 5IBWA 1QS7A 3NXAA 2V53A 2JULA 1WDCC 1XYDA 1NWDA 2LAPA 2KI6D 4NQGA 1RK9A 1CDNA 1NP8A 4YGEB 3BOWB 1QV0A 1TN4A 1RECA 2ZRSA 2K2AA 2JZIA 1CM1A 2MLFC 1HQVA 2ZN9A 1G4YR 1KK7Z 1TNQA 1XFXO 1PSBA 3CLNA 3TDZA 1IQ5A 4MZJA 2LHLA 3CR5X 1C7VA 4A4BA 1SYMA 5G08A 2BBMA 3PSRA 1B47A 2LM5A 4Q04A 1CKKA 3I5HB 2KBIA 2K2FA 5HKYA 2Y1MA 5CSIA 1TOPA 2WCFA 1ALVA 3JTDC 3ZWHA 3I5FB 4HREE 4JWQA 4ETOA 1SMGA 3A4UB 3SIBA 3TS5C 3CS1A 1UHIA 4NDCA 1F4QA 1UHNA 2M1UA 2Y1NA 2OPOA 2ZN8A 1MQ1A 4AOMA 3OB2B 1QTXA 4U8DA 1S6JA 4PE1A 1S1EA 2CBLA 2BBNA 2M29A 4GPLB 2KFFA 1WLMA 1OOJA 2CT9A 2NZ0A 2K7BA 3GK2A 1IQ3A 2JOJA 4MBEA 2KSPA 2GGMA 3KO0A 5HKZA 2FCEA 1EG3A 1YTZC 1UUSA 1DJYA 1XO5A 5I2LA 1CLMA 2EHBA 1XFYO 1HT9A 5KSZA 2BCAA 3VRRA 1BLQA 1B7TY 2A4JA 2KAYA 4I5JA 4L9MA 2VRGA 2WOSA 1ZUZA 1BODA 1A2XA 4I5KA 2EGDA 4YBHB 3EVRA 1QIVA 2CTNA 3MSEB 1OMVA 4E68A 2BCBA 1YRUB 2F3YA 4QJ4B 4N1GA 5I2QA 3CR4X 1OE9B 3PLFB 3EK8A 4CIDA 3SG6A 2M9GA 1CFDA 3PATA 3OB1B 4WQ2A 4PDZA 2L4HA 3NSLA 1SKTA 3CTNA 1L2OC 3BXKA 3IQQA 5KU1A 1FI5A 1SL9A 1BT6A 3I5GB 1PULA 3SG7A 1KSMA 1TNPA 3DVMA 1OSAA 1SPYA 1CMFA 4PHKA 1B8CA 2JWWA 1CLLA 3D0YA 3JTDB 1K8UA 3CWGA 4OV2A 1PALA 2L98A 2ZRTA 1CFPA 4C0KA 1CFCA 1B9AA 1WRKA 1YR5A 3DD4A 1BMOA 1KCYA 1ZFSA 4HRHA 4JPZB 2LE9B 4YGCB 1KQMC 5F6TA 2MBXA 3LL8B 1RWYA 5CSNA 1QLSA 1C7WA 1YVHA 2JRFA 2BL0B 1K90D 1NCZA 3RM1A 4USLA 1E8AA 1KK8C 2TN4A 4BY4A 1SR6C 2M3WA 1KQVA 2E6WA 1XFZO 2JTZA 1K93D 1SCMC 1M63B 1AJ5A 1IRJA 1EL4A 2CNPA 3BUWB 2LANA 1A75A 1K9UA 2WCEA 2F33A 3QRXA 5DKRA 4C0JA 1DJXA 4M2OA 1S6IA 1XVJA 3C1VA 1XFWO 3OHMB 2DOQA 3SG3A 3DF0A 1F71A 2LLTA 1MF8B 1J7RA 1NX0A 2WC8A 2LMTA 1RFJA 2KFGA 5AERA 3LK1A 3WXAA 2KYFA 3AKBA 4MEWA 4MZKA 1JF0A 2ZFDA 5GQQC 3VRQA 4ZCUA 1NPQA 1YUUA 4FTGA 4M2QA 1SL7A 2BECA 2KI4C 2PSRA 1AUIB 1OQPA 1KWOB 1ZMZA 1LVCD 2SCPA 1PK0D 1QLKA 1DJGA 2H61A 1YURA 1YX7A 3LCPC 1H8BA 1F70A 1LINA 2MHHA 2HQ8A 2HF5A 1QX5B 1DGVA 2ZNDA 3SG2A 3D0YB 1DF0A 2KAVA 1TCFA 1ALWA 3NSIA 2M1KB 5AANA 4GBAA 1GQMA 1K95A 4PHMA 3TUYC 1G8IA 4PHJA 2JXCA 4CFQA 1JFJA 4GAOA 2I18A 4NDDA 2BE4A 2JNXA 1SRAA 1KFUS 3EKHA 4TNCA 4GFTA 3TS5B 2KBMA 4I5NB 1CDMA 1EG4A 5D7FA 2SASA 3EK4A 2LP2A 2QACA 3FWBA 3D10A 4N5XA 2ZNEA 3E3RA 4P5OE 4HSZA 2KHNA 1OZOA 3OX5A 2FJUB 1CTRA 1QVIY 3HX4A 4OR9B 2GV5A 3IF7A 3I5HC 2F2OA 2LVVA 3BUXB 1Y1UA 4A4CA 1KQMB 1M31A 5CSFA 4CFRA 1A29A 1Y6WA 2L0PA 3PN7C 1MXLC 5B8IB 2WCBA 3I5GC 4OKHA 2L2EA 1OMRA 3DVJA 1G33A 2D8NA 1QVIZ 2FCDA 1MHOA 1QV1A 2CCMA 5HLVA 1A03A 4DUQA 1C07A 3O4YA 4JQ0D 4UPGA 3NSOA 3BOWA 5DKQA 3VRPA 1DTLA 1N0YA 2L5XB 1N65A 3JVTC 1OMDA 1JC2A 1PRWA 1QX2A 2AAOA 1AVSA 3OP0A 1DJWA 5CSJA 1ZOTB 2M7LA 2PRUA 5I8NA 1IJ5A 5JJGA 2KGBC 1UHHA 1MXEA 1AJ4A 1XK4C 5DKNA 1F55A 4QJ5B 3EVVA 2F2PA 1BOCA 1UHJA 1K94A 3GK1A 1NX2A 3SIAA 1SW8A 2Q91A 2LV7A 5K89A 2KNEA 4MN0A 2K8MB 1B8RA 1CFFA 4CLNA 5HLOA 1B8LA 1FW4A 3RLZA 3CR2A 1DJHA 2PMYA 3BUMB 4PE0A 4ZCVA 1TCOB 1S6CA 1DF0B 3KPXA 3VRNA 3AAJA 4PE7A 2K7DA 4NDBA 4GGFA 4DIRA 4MVFA 1U5IB 4PALA 1Y0VH 2BKIB 1EH2A 1SK6D 5KTYA 3GOFA 3KF9A 1L7ZA 1UP5A 2PVBA 2COLB 3KEVA 2B1UA 4HRGA 1XK4A 4OVNF 3SG5A 1SBJA 1GGZA 2H2KA 1X02A 1CB1A 2JPTA 3GK4X 2KI4B 1RTP1 2LC5A 4GUKA 1AK8A 2MRDA 2KGRA 3SG4A 1IJ6A 3VGOA 1TIZA 2K0JA 1VRKA 5AEQA 1EJ3A 3LLEA 3TDIA 5HKWA 1J7QA 1JWDA 2LCPA 4MSPA 1PSRA 1LKJA 1EXRA 1LXFC 2E30A 1DGUA 4DS7A 1F8HA 2KI6C 1NSHA 3DVEA 2ISDA 5FYXA 1CM4A 2KQYA 1IWQA 3A8RA 2GGZA 4PCWA 3WHTB 2Q4UA 1CMGA 1BR4B 2Y4QA 3PFVA 1J1EA 2BKHB 1IKUA 3WNXB 1MWNA 1TNXA 5AFPA 3FS7A 1ZACA 1NX1A 1YUSA 4I5LB 1DMOA 1K2HA 3SJSA 3PALA 1WRLA 4YI8A 4M2PA 4XJKA 1DJIA 1BJFA 2F8PA 1SCVA 5JOLA 3BYAA 4MZLA 1R6PA 1H4BA 1TRFA 1UHKA 3O6BA 2LHIA 1NCXA 1SY9A 1QASA 1FPWA 5D69A 5I2OA 1BU3A 1M45A 3EKJA 3PN7B 4AQJA 2M7NA 2BL0C 2K7OA 1NYAA 1S5GZ 1SNLA 1TTXA 3LK0A 2FOTA 4QJ3B 2MLEC 3TZ1A 3AKAA 1Q80A 2K7CA 5TNCA 2WORA 1QJTA 1QATA 3DVKA 1XA5A 1DVIA 1K9PA 2JC2A 1ODBA 3PM8A 2CXJA 3FIAA 1Y1AA 2NLNA 4CPVA 1F54A 1QX7A 3CGAA 3H4SE 3OX6A 1BF5A 2AMIA 2O5GA 4YI9A 3DF0B 2LP3A 2JT0A 1S26D 5AXIA 2LMUA 4XYNA 1K9KA 4WQ3A 1PVBA 4DRWA 1D1OA 3TUYB 2KDHA 1V1GA 4PE4A 1RJVA
chains in the Genus database with same CATH superfamily
3K21A 4KYNA 2LLSA 1J1DA 1BR1B 1NX3A 1QIWA 2HPSA 1WY9A 2I7AA 4FQTA 1MR8A 4INWA 5FI2A 5BPJA 2JNFA 2LMVA 4DCKA 1NCYA 4AQIA 5ER5A 3ICBA 2H61C 3VROA 2WNDA 3I5IB 2HQWA 2NCOA 2P6BB 2F3ZA 2RGIA 1V1FA 4WRIA 1AHRA 2QEOA 1IH0A 2I94A 3KHEA 2MJWB 4ORCB 1S36A 1JSAA 2L5YA 3NHTA 1M39A 3Q8IA 2R2IA 3JVTB 4YGBB 3BFAA 1TUJA 2NXQA 1WDCB 1UWOA 2M97A 2ZKMX 1FBVA 2KQ6A 2EC6C 3I5FC 1S3PA 1N2DA 1W9ZA 2H8VA 3BQ3A 4YGAA 4XJKB 2L50A 3CZ1A 3M0WA 1SCMB 1CLBA 1SL8A 2M0RA 1YVLA 3ZNIA 2OTGC 2OTGB 3D78A 1KFUL 4FQOA 4INXA 3B88A 2LVJA 5ER4X 2MA2A 4N1FA 1KSOA 1WRZA 1K96A 1SR6B 1CDLA 1IGVA 2IS9A 1JF2A 1TNWA 4BY5A 4ORAB 2EC6B 3DY9A 2KYCA 1A75B 3FWCA 2PASA 3O78A 1S5GY 4GNKB 1W7JB 1WLZA 1RROA 1UURA 1M46A 1LA0A 2AUCA 4OCIA 1Y1XA 3NSKA 1BG1A 3BJHA 3F45A 2MAZA 3EG5B 2KOTA 1YRTB 2BCXA 2JT8A 2QPTA 3B6XA 2KFHA 1IG5A 1NUBA 4MRXA 1XFVO 2JQ6A 3WHUB 2BE6A 4P2YB 2OS8B 2L51A 4MRYA 1LA3A 3S0FA 4F0ZB 1J7PA 1KFXS 1PVAA 5PALA 4YRUA 2KAXA 2M8UA 3CZTX 1GJYA 2NCPA 3DZTA 3TDUA 5HYDA 1JUOA 2I2RE 3I5IC 2JT3A 5J3XA 3EVUA 2WCJA 2HETA 2LVKA 2O60A 2QEHA 2JU0A 3S0DA 5CPVA 2JXLA 1B7TZ 2OS8C 2Y5IA 2LLUA 1U5IA 1F4OA 2G9BA 1L2OB 3QMEA 4ORBB 1MUXA 1CDPA 4MLWA 2LUCA 3BUNB 3IQOA 2LUXA 1B4CA 1YUTA 2PALA 1KWOC 1JFKA 4GGFC 3EK7A 1KFXL 1A4PA 2QEVA 1J55A 2L4IA 1QXPA 1KK7Y 1GGWA 4YGDB 2G2BA 2JTTA 1DJZA 3BUOB 4IL1A 4C0LA 2LVIA 1R2UA 3HCMA 4PHNA 1XFUO 1CNPA 4ICBA 1JBAA 1FI6A 1T14A 2K61A 4GGNA 1DT7B 4R1EA 1FF1A 1W7IB 1B1GA 1AP4A 1J7OA 4D1EA 2LNKA 1KK8B 3AAKA 2M49B 3D74A 1NIWA 1OZSA 1YX8A 3D77A 3O2PA 1QS7A 5IBWA 3NXAA 2V53A 2KLEA 2JULA 1WDCC 1XYDA 1NWDA 2LAPA 2KI6D 4NQGA 1RK9A 1CDNA 1NP8A 4YGEB 3BOWB 1QV0A 1TN4A 1RECA 2ZRSA 2K2AA 2JPOA 2JZIA 1CM1A 2MLFC 1HQVA 2ZN9A 1G4YR 3BFHA 1KK7Z 1TNQA 3B87A 1XFXO 1PSBA 3CLNA 3TDZA 3K1EA 1IQ5A 4MZJA 2LHLA 3CR5X 1C7VA 4A4BA 1SYMA 5G08A 2BBMA 3PSRA 1B47A 2LM5A 4Q04A 1CKKA 3I5HB 2KBIA 2K2FA 5HKYA 2Y1MA 3R72A 5CSIA 1TOPA 2WCFA 1ALVA 3JTDC 4OZDA 3V2LA 3ZWHA 1DQEA 3I5FB 4HREE 4JWQA 4ETOA 1SMGA 2KLDA 2PQLA 3A4UB 3SIBA 3TS5C 3CS1A 1UHIA 4NDCA 1F4QA 1UHNA 2M1UA 2Y1NA 2OPOA 2ZN8A 1MQ1A 5DICA 4AOMA 3OB2B 3SS4A 1QTXA 3B7AA 4U8DA 1S6JA 4PE1A 1S1EA 2CBLA 2BBNA 2M29A 3IVTA 4GPLB 2KFFA 1WLMA 1OW4A 1OOJA 2WCHA 2CT9A 2NZ0A 2K7BA 3GK2A 3FE8A 2JOJA 1IQ3A 4MBEA 2KSPA 2GGMA 2PYQA 3KO0A 5HKZA 2FCEA 3SS5A 1EG3A 1YTZC 1UUSA 1DJYA 1XO5A 5I2LA 1CLMA 2EHBA 1XFYO 1HT9A 5KSZA 2FJYA 2BCAA 3VRRA 1BLQA 1B7TY 1OOFA 2A4JA 2KAYA 4I5JA 4L9MA 2VRGA 2WOSA 1ZUZA 1DEKA 1BODA 1A2XA 4I5KA 2EGDA 3D73A 4YBHB 1OOHA 1QIVA 2CTNA 3EVRA 2WCMA 3MSEB 1OMVA 4E68A 1GM0A 2BCBA 1YRUB 2F3YA 4QJ4B 4N1GA 5I2QA 3CR4X 1OE9B 3PLFB 3EK8A 4CIDA 3SG6A 3CZ2A 2M9GA 1CFDA 3PATA 3OB1B 4WQ2A 4PDZA 2L4HA 3NSLA 3R1PA 1SKTA 3CTNA 1L2OC 3PJIA 3BXKA 3IQQA 5KU1A 3DXLA 1FI5A 1SL9A 1BT6A 3I5GB 1PULA 3DYEA 3SG7A 1KSMA 1TNPA 3DVMA 1OSAA 1SPYA 1CMFA 4PHKA 1B8CA 2JWWA 1CLLA 3D0YA 3JTDB 1K8UA 3CWGA 4OV2A 1PALA 2L98A 2ZRTA 1CFPA 3BFBA 3O4XA 4C0KA 1CFCA 1B9AA 3RZSA 1WRKA 1YR5A 3DD4A 1BMOA 1KCYA 1ZFSA 4HRHA 4JPZB 3L4LA 2LE9B 4YGCB 1KQMC 5F6TA 2MBXA 3LL8B 1RWYA 5CSNA 1QLSA 1C7WA 1YVHA 2ERBA 2BL0B 1K90D 1NCZA 2JRFA 3R1OA 4USLA 3RM1A 1E8AA 1KK8C 2TN4A 2WCKA 2YGUA 1SR6C 4BY4A 2M3WA 1KQVA 2E6WA 1XFZO 2JTZA 1K93D 1SCMC 1M63B 1ORGA 3D75A 3S0AA 1AJ5A 1IRJA 1EL4A 2CNPA 3BUWB 2LANA 5EL2A 1A75A 1K9UA 2WCEA 2F33A 3QRXA 5DKRA 4C0JA 1DJXA 4M2OA 1S6IA 1XVJA 3C1VA 1XFWO 3FE9A 2DOQA 3OHMB 3SG3A 3DF0A 1F71A 2LLTA 1MF8B 1J7RA 1NX0A 2WC8A 2LMTA 3L47A 1RFJA 2KFGA 5AERA 3LK1A 3WXAA 1TUZA 2KYFA 3AKBA 4MEWA 4MZKA 1TWOA 1JF0A 2P70A 2ZFDA 5GQQC 4ZCUA 1NPQA 1YUUA 4FTGA 4M2QA 3VRQA 1SL7A 2BECA 2KI4C 2PSRA 1AUIB 1OQPA 1KWOB 1ZMZA 1LVCD 2GTEA 2SCPA 1PK0D 1QLKA 1DJGA 2H61A 1YURA 1YX7A 3LCPC 1H8BA 1F70A 1LINA 2MHHA 2HQ8A 2HF5A 1QX5B 1DGVA 2ZNDA 3SG2A 3D0YB 1DF0A 2KAVA 1TCFA 1ALWA 3NSIA 2M1KB 5AANA 4GBAA 1GQMA 1K95A 4PHMA 3TUYC 1C3YA 1G8IA 4PHJA 2JXCA 4CFQA 1JFJA 4GAOA 2I18A 4NDDA 2BE4A 2JNXA 1SRAA 1KFUS 3EKHA 2L2CA 4TNCA 4GFTA 3TS5B 2KBMA 4I5NB 1CDMA 1EG4A 5D7FA 2SASA 3EK4A 2LP2A 2QACA 3FWBA 3D10A 4N5XA 2ZNEA 3E3RA 4P5OE 4HSZA 2KHNA 1OZOA 3OX5A 4PT1A 2FJUB 1CTRA 1QVIY 3HX4A 4OR9B 2GV5A 3IF7A 2WCLA 3I5HC 3VB1A 2F2OA 2LVVA 3BUXB 1Y1UA 4A4CA 1KQMB 1M31A 5CSFA 5FI6A 4CFRA 1A29A 1Y6WA 2BAPA 2L0PA 1MXLC 3PN7C 5B8IB 2BNXA 2WCBA 3I5GC 3UO9A 4OKHA 2L2EA 1OMRA 3DVJA 1G33A 1P28A 1QVIZ 2D8NA 2FCDA 1Z4HA 1MHOA 1QV1A 2CCMA 5HLVA 1A03A 3D76A 4DUQA 1C07A 3O4YA 4JQ0D 4UPGA 3NSOA 3BOWA 5DKQA 3VRPA 1DTLA 1N0YA 2L5XB 1N65A 3JVTC 1OMDA 1JC2A 1PRWA 1QX2A 2AAOA 1AVSA 3OP0A 3OGNA 5I94A 1DJWA 3OBVA 5CSJA 1ZOTB 2M7LA 2PRUA 5I8NA 1IJ5A 5JJGA 2KGBC 1UHHA 1MXEA 1AJ4A 1XK4C 5DKNA 1F55A 4QJ5B 1OOGA 3EVVA 2F2PA 1BOCA 1UHJA 2QEBA 1K94A 3GK1A 1NX2A 3SIAA 1SW8A 2Q91A 2LV7A 5K89A 2KNEA 4MN0A 2K8MB 3SS3A 1B8RA 1CFFA 4CLNA 5HLOA 3CYZA 1B8LA 1FW4A 3RLZA 3CR2A 1DJHA 2PMYA 2WC5A 3BUMB 2QDIA 4PE0A 4ZCVA 3UNWA 1TCOB 1S6CA 5D3OA 3NHIA 1DF0B 3KPXA 3L4AA 3VRNA 3AAJA 4PE7A 1C3ZA 2K7DA 4NDBA 4GGFA 4DIRA 4MVFA 1U5IB 4PALA 1Y0VH 2BKIB 1EH2A 3S0EA 1SK6D 5KTYA 3GOFA 3KF9A 1L7ZA 1UP5A 2PVBA 2COLB 3KEVA 2B1UA 4HRGA 1XK4A 4OVNF 3SG5A 1SBJA 1GGZA 2H2KA 1X02A 3CDNA 3S0BA 1CB1A 2JPTA 3GK4X 2KI4B 1RTP1 2LC5A 4GUKA 1AK8A 2MRDA 2KGRA 3PM2A 3SG4A 1IJ6A 1QWVA 3VGOA 1OOIX 1TIZA 2K0JA 1VRKA 5AEQA 1EJ3A 1Z2CB 3LLEA 1LS8A 3TDIA 5HKWA 1J7QA 1JWDA 2LCPA 4MSPA 1PSRA 1LKJA 4F7FA 1EXRA 1LXFC 2E30A 1DGUA 4DS7A 1F8HA 4JKTA 2KI6C 1NSHA 3DVEA 2ISDA 3S0GA 5FYXA 1CM4A 2KQYA 1IWQA 3A8RA 2GGZA 4PCWA 3WHTB 2Q4UA 1CMGA 1BR4B 5FI7A 2Y4QA 3FE6A 1SSEB 1DC1A 3PFVA 1J1EA 2BKHB 1IKUA 3WNXB 1MWNA 1TNXA 5AFPA 3FS7A 1ZACA 1NX1A 1YUSA 4I5LB 1DMOA 1K2HA 3SJSA 3PALA 1WRLA 4YI8A 4M2PA 4XJKA 1DJIA 1BJFA 2F8PA 1SCVA 3N7HA 5JOLA 3BYAA 4MZLA 1R6PA 1H4BA 1TRFA 1UHKA 3O6BA 2LHIA 1NCXA 1SY9A 1QASA 5HL1A 4IJ7A 1FPWA 5D69A 5I2OA 1BU3A 1M45A 3EKJA 3PN7B 4AQJA 3NGVA 2M7NA 3R1VA 2BL0C 2K7OA 1NYAA 1S5GZ 1IIOA 1SNLA 1TTXA 2WC6A 3LK0A 2FOTA 4QJ3B 2MLEC 2KPHA 3TZ1A 3AKAA 4JD9A 1Q80A 2K7CA 1XFRA 5TNCA 2WORA 1QJTA 1QATA 3CZ0A 3DVKA 1XA5A 1DVIA 1K9PA 2JC2A 3CABA 1ODBA 3PM8A 2CXJA 3FIAA 1Y1AA 2NLNA 4CPVA 1F54A 1QX7A 3CGAA 3H4SE 3OX6A 1BF5A 2AMIA 3B86A 2O5GA 4YI9A 3DF0B 2LP3A 2JT0A 1S26D 5AXIA 2LMUA 4XYNA 1K9KA 2P71A 1PVBA 2K60A 4WQ3A 4DRWA 1D1OA 3TUYB 1DELA 2KDHA 1V1GA 4PE4A 1RJVA
chains in the Genus database with same CATH topology
3K21A 2LLSA 1J1DA 1BR1B 1NX3A 1QIWA 2HPSA 1WY9A 2I7AA 1MR8A 5BPJA 2JNFA 2LMVA 4DCKA 1NCYA 4AQIA 5ER5A 3ICBA 2H61C 3VROA 2WNDA 3I5IB 2HQWA 2NCOA 2P6BB 2F3ZA 2RGIA 1V1FA 4WRIA 1AHRA 1IH0A 2I94A 3KHEA 2MJWB 4ORCB 1S36A 1JSAA 1M39A 2R2IA 3JVTB 4YGBB 2NXQA 1WDCB 1UWOA 2M97A 2ZKMX 1FBVA 2KQ6A 2EC6C 3I5FC 1S3PA 1N2DA 3BQ3A 4YGAA 4XJKB 2L50A 3M0WA 1SCMB 1CLBA 1SL8A 2M0RA 1YVLA 3ZNIA 2OTGC 2OTGB 1KFUL 4FQOA 2LVJA 5ER4X 2MA2A 4N1FA 1KSOA 1WRZA 1K96A 1SR6B 1CDLA 1IGVA 2IS9A 1JF2A 1TNWA 4BY5A 4ORAB 2EC6B 2KYCA 1A75B 3FWCA 2PASA 3O78A 1S5GY 4GNKB 1W7JB 1WLZA 1RROA 1UURA 1M46A 1LA0A 2AUCA 4OCIA 1Y1XA 3NSKA 1BG1A 3F45A 2MAZA 2KOTA 1YRTB 2BCXA 2JT8A 2QPTA 2KFHA 1IG5A 1NUBA 4MRXA 1XFVO 2JQ6A 3WHUB 2BE6A 4P2YB 2OS8B 2L51A 4MRYA 1LA3A 1J7PA 4F0ZB 1KFXS 1PVAA 5PALA 4YRUA 2KAXA 2M8UA 3CZTX 1GJYA 2NCPA 3TDUA 5HYDA 1JUOA 2I2RE 3I5IC 2JT3A 5J3XA 3EVUA 2HETA 2LVKA 2O60A 2JU0A 5CPVA 2JXLA 1B7TZ 2OS8C 2Y5IA 2LLUA 1U5IA 1F4OA 2G9BA 1L2OB 4ORBB 1MUXA 1CDPA 4MLWA 2LUCA 3BUNB 3IQOA 2LUXA 1B4CA 1YUTA 2PALA 1KWOC 1JFKA 4GGFC 3EK7A 1KFXL 1A4PA 1J55A 2L4IA 1QXPA 1KK7Y 1GGWA 4YGDB 2G2BA 2JTTA 1DJZA 3BUOB 4IL1A 4C0LA 2LVIA 1R2UA 3HCMA 4PHNA 1XFUO 1CNPA 4ICBA 1JBAA 1FI6A 2K61A 4GGNA 1DT7B 4R1EA 1FF1A 1W7IB 1B1GA 1AP4A 1J7OA 4D1EA 2LNKA 1KK8B 3AAKA 2M49B 1NIWA 1OZSA 1YX8A 3O2PA 5IBWA 1QS7A 3NXAA 2V53A 2JULA 1WDCC 1XYDA 1NWDA 2LAPA 2KI6D 4NQGA 1RK9A 1CDNA 1NP8A 4YGEB 3BOWB 1QV0A 1TN4A 1RECA 2ZRSA 2K2AA 2JZIA 1CM1A 2MLFC 1HQVA 2ZN9A 1G4YR 1KK7Z 1TNQA 1XFXO 1PSBA 3CLNA 3TDZA 1IQ5A 4MZJA 2LHLA 3CR5X 1C7VA 4A4BA 1SYMA 5G08A 2BBMA 3PSRA 1B47A 2LM5A 4Q04A 1CKKA 3I5HB 2KBIA 2K2FA 5HKYA 2Y1MA 5CSIA 1TOPA 2WCFA 1ALVA 3JTDC 3ZWHA 3I5FB 4HREE 4JWQA 4ETOA 1SMGA 3A4UB 3SIBA 3TS5C 3CS1A 1UHIA 4NDCA 1F4QA 1UHNA 2M1UA 2Y1NA 2OPOA 2ZN8A 1MQ1A 4AOMA 3OB2B 1QTXA 4U8DA 1S6JA 4PE1A 1S1EA 2CBLA 2BBNA 2M29A 4GPLB 2KFFA 1WLMA 1OOJA 2CT9A 2NZ0A 2K7BA 3GK2A 1IQ3A 2JOJA 4MBEA 2KSPA 2GGMA 3KO0A 5HKZA 2FCEA 1EG3A 1YTZC 1UUSA 1DJYA 1XO5A 5I2LA 1CLMA 2EHBA 1XFYO 1HT9A 5KSZA 2BCAA 3VRRA 1BLQA 1B7TY 2A4JA 2KAYA 4I5JA 4L9MA 2VRGA 2WOSA 1ZUZA 1BODA 1A2XA 4I5KA 2EGDA 4YBHB 3EVRA 1QIVA 2CTNA 3MSEB 1OMVA 4E68A 2BCBA 1YRUB 2F3YA 4QJ4B 4N1GA 5I2QA 3CR4X 1OE9B 3PLFB 3EK8A 4CIDA 3SG6A 2M9GA 1CFDA 3PATA 3OB1B 4WQ2A 4PDZA 2L4HA 3NSLA 1SKTA 3CTNA 1L2OC 3BXKA 3IQQA 5KU1A 1FI5A 1SL9A 1BT6A 3I5GB 1PULA 3SG7A 1KSMA 1TNPA 3DVMA 1OSAA 1SPYA 1CMFA 4PHKA 1B8CA 2JWWA 1CLLA 3D0YA 3JTDB 1K8UA 3CWGA 4OV2A 1PALA 2L98A 2ZRTA 1CFPA 4C0KA 1CFCA 1B9AA 1WRKA 1YR5A 3DD4A 1BMOA 1KCYA 1ZFSA 4HRHA 4JPZB 2LE9B 4YGCB 1KQMC 5F6TA 2MBXA 3LL8B 1RWYA 5CSNA 1QLSA 1C7WA 1YVHA 2JRFA 2BL0B 1K90D 1NCZA 3RM1A 4USLA 1E8AA 1KK8C 2TN4A 4BY4A 1SR6C 2M3WA 1KQVA 2E6WA 1XFZO 2JTZA 1K93D 1SCMC 1M63B 1AJ5A 1IRJA 1EL4A 2CNPA 3BUWB 2LANA 1A75A 1K9UA 2WCEA 2F33A 3QRXA 5DKRA 4C0JA 1DJXA 4M2OA 1S6IA 1XVJA 3C1VA 1XFWO 3OHMB 2DOQA 3SG3A 3DF0A 1F71A 2LLTA 1MF8B 1J7RA 1NX0A 2WC8A 2LMTA 1RFJA 2KFGA 5AERA 3LK1A 3WXAA 2KYFA 3AKBA 4MEWA 4MZKA 1JF0A 2ZFDA 5GQQC 3VRQA 4ZCUA 1NPQA 1YUUA 4FTGA 4M2QA 1SL7A 2BECA 2KI4C 2PSRA 1AUIB 1OQPA 1KWOB 1ZMZA 1LVCD 2SCPA 1PK0D 1QLKA 1DJGA 2H61A 1YURA 1YX7A 3LCPC 1H8BA 1F70A 1LINA 2MHHA 2HQ8A 2HF5A 1QX5B 1DGVA 2ZNDA 3SG2A 3D0YB 1DF0A 2KAVA 1TCFA 1ALWA 3NSIA 2M1KB 5AANA 4GBAA 1GQMA 1K95A 4PHMA 3TUYC 1G8IA 4PHJA 2JXCA 4CFQA 1JFJA 4GAOA 2I18A 4NDDA 2BE4A 2JNXA 1SRAA 1KFUS 3EKHA 4TNCA 4GFTA 3TS5B 2KBMA 4I5NB 1CDMA 1EG4A 5D7FA 2SASA 3EK4A 2LP2A 2QACA 3FWBA 3D10A 4N5XA 2ZNEA 3E3RA 4P5OE 4HSZA 2KHNA 1OZOA 3OX5A 2FJUB 1CTRA 1QVIY 3HX4A 4OR9B 2GV5A 3IF7A 3I5HC 2F2OA 2LVVA 3BUXB 1Y1UA 4A4CA 1KQMB 1M31A 5CSFA 4CFRA 1A29A 1Y6WA 2L0PA 3PN7C 1MXLC 5B8IB 2WCBA 3I5GC 4OKHA 2L2EA 1OMRA 3DVJA 1G33A 2D8NA 1QVIZ 2FCDA 1MHOA 1QV1A 2CCMA 5HLVA 1A03A 4DUQA 1C07A 3O4YA 4JQ0D 4UPGA 3NSOA 3BOWA 5DKQA 3VRPA 1DTLA 1N0YA 2L5XB 1N65A 3JVTC 1OMDA 1JC2A 1PRWA 1QX2A 2AAOA 1AVSA 3OP0A 1DJWA 5CSJA 1ZOTB 2M7LA 2PRUA 5I8NA 1IJ5A 5JJGA 2KGBC 1UHHA 1MXEA 1AJ4A 1XK4C 5DKNA 1F55A 4QJ5B 3EVVA 2F2PA 1BOCA 1UHJA 1K94A 3GK1A 1NX2A 3SIAA 1SW8A 2Q91A 2LV7A 5K89A 2KNEA 4MN0A 2K8MB 1B8RA 1CFFA 4CLNA 5HLOA 1B8LA 1FW4A 3RLZA 3CR2A 1DJHA 2PMYA 3BUMB 4PE0A 4ZCVA 1TCOB 1S6CA 1DF0B 3KPXA 3VRNA 3AAJA 4PE7A 2K7DA 4NDBA 4GGFA 4DIRA 4MVFA 1U5IB 4PALA 1Y0VH 2BKIB 1EH2A 1SK6D 5KTYA 3GOFA 3KF9A 1L7ZA 1UP5A 2PVBA 2COLB 3KEVA 2B1UA 4HRGA 1XK4A 4OVNF 3SG5A 1SBJA 1GGZA 2H2KA 1X02A 1CB1A 2JPTA 3GK4X 2KI4B 1RTP1 2LC5A 4GUKA 1AK8A 2MRDA 2KGRA 3SG4A 1IJ6A 3VGOA 1TIZA 2K0JA 1VRKA 5AEQA 1EJ3A 3LLEA 3TDIA 5HKWA 1J7QA 1JWDA 2LCPA 4MSPA 1PSRA 1LKJA 1EXRA 1LXFC 2E30A 1DGUA 4DS7A 1F8HA 2KI6C 1NSHA 3DVEA 2ISDA 5FYXA 1CM4A 2KQYA 1IWQA 3A8RA 2GGZA 4PCWA 3WHTB 2Q4UA 1CMGA 1BR4B 2Y4QA 3PFVA 1J1EA 2BKHB 1IKUA 3WNXB 1MWNA 1TNXA 5AFPA 3FS7A 1ZACA 1NX1A 1YUSA 4I5LB 1DMOA 1K2HA 3SJSA 3PALA 1WRLA 4YI8A 4M2PA 4XJKA 1DJIA 1BJFA 2F8PA 1SCVA 5JOLA 3BYAA 4MZLA 1R6PA 1H4BA 1TRFA 1UHKA 3O6BA 2LHIA 1NCXA 1SY9A 1QASA 1FPWA 5D69A 5I2OA 1BU3A 1M45A 3EKJA 3PN7B 4AQJA 2M7NA 2BL0C 2K7OA 1NYAA 1S5GZ 1SNLA 1TTXA 3LK0A 2FOTA 4QJ3B 2MLEC 3TZ1A 3AKAA 1Q80A 2K7CA 5TNCA 2WORA 1QJTA 1QATA 3DVKA 1XA5A 1DVIA 1K9PA 2JC2A 1ODBA 3PM8A 2CXJA 3FIAA 1Y1AA 2NLNA 4CPVA 1F54A 1QX7A 3CGAA 3H4SE 3OX6A 1BF5A 2AMIA 2O5GA 4YI9A 3DF0B 2LP3A 2JT0A 1S26D 5AXIA 2LMUA 4XYNA 1K9KA 4WQ3A 1PVBA 4DRWA 1D1OA 3TUYB 2KDHA 1V1GA 4PE4A 1RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K21 A;  2LLS A;  1J1D A;  1BR1 B;  1NX3 A;  1QIW A;  2HPS A;  1WY9 A;  2I7A A;  1MR8 A;  5BPJ A;  2JNF A;  2LMV A;  4DCK A;  1NCY A;  4AQI A;  5ER5 A;  3ICB A;  2H61 C;  3VRO A;  2WND A;  3I5I B;  2HQW A;  2NCO A;  2P6B B;  2F3Z A;  2RGI A;  1V1F A;  4WRI A;  1AHR A;  1IH0 A;  2I94 A;  3KHE A;  2MJW B;  4ORC B;  1S36 A;  1JSA A;  1M39 A;  2R2I A;  3JVT B;  4YGB B;  2NXQ A;  1WDC B;  1UWO A;  2M97 A;  2ZKM X;  1FBV A;  2KQ6 A;  2EC6 C;  3I5F C;  1S3P A;  1N2D A;  3BQ3 A;  4YGA A;  4XJK B;  2L50 A;  3M0W A;  1SCM B;  1CLB A;  1SL8 A;  2M0R A;  1YVL A;  3ZNI A;  2OTG C;  2OTG B;  1KFU L;  4FQO A;  2LVJ A;  5ER4 X;  2MA2 A;  4N1F A;  1KSO A;  1WRZ A;  1K96 A;  1SR6 B;  1CDL A;  1IGV A;  2IS9 A;  1JF2 A;  1TNW A;  4BY5 A;  4ORA B;  2EC6 B;  2KYC A;  1A75 B;  3FWC A;  2PAS A;  3O78 A;  1S5G Y;  4GNK B;  1W7J B;  1WLZ A;  1RRO A;  1UUR A;  1M46 A;  1LA0 A;  2AUC A;  4OCI A;  1Y1X A;  3NSK A;  1BG1 A;  3F45 A;  2MAZ A;  2KOT A;  1YRT B;  2BCX A;  2JT8 A;  2QPT A;  2KFH A;  1IG5 A;  1NUB A;  4MRX A;  1XFV O;  2JQ6 A;  3WHU B;  2BE6 A;  4P2Y B;  2OS8 B;  2L51 A;  4MRY A;  1LA3 A;  1J7P A;  4F0Z B;  1KFX S;  1PVA A;  5PAL A;  4YRU A;  2KAX A;  2M8U A;  3CZT X;  1GJY A;  2NCP A;  3TDU A;  5HYD A;  1JUO A;  2I2R E;  3I5I C;  2JT3 A;  5J3X A;  3EVU A;  2HET A;  2LVK A;  2O60 A;  2JU0 A;  5CPV A;  2JXL A;  1B7T Z;  2OS8 C;  2Y5I A;  2LLU A;  1U5I A;  1F4O A;  2G9B A;  1L2O B;  4ORB B;  1MUX A;  1CDP A;  4MLW A;  2LUC A;  3BUN B;  3IQO A;  2LUX A;  1B4C A;  1YUT A;  2PAL A;  1KWO C;  1JFK A;  4GGF C;  3EK7 A;  1KFX L;  1A4P A;  1J55 A;  2L4I A;  1QXP A;  1KK7 Y;  1GGW A;  4YGD B;  2G2B A;  2JTT A;  1DJZ A;  3BUO B;  4IL1 A;  4C0L A;  2LVI A;  1R2U A;  3HCM A;  4PHN A;  1XFU O;  1CNP A;  4ICB A;  1JBA A;  1FI6 A;  2K61 A;  4GGN A;  1DT7 B;  4R1E A;  1FF1 A;  1W7I B;  1B1G A;  1AP4 A;  1J7O A;  4D1E A;  2LNK A;  1KK8 B;  3AAK A;  2M49 B;  1NIW A;  1OZS A;  1YX8 A;  3O2P A;  5IBW A;  1QS7 A;  3NXA A;  2V53 A;  2JUL A;  1WDC C;  1XYD A;  1NWD A;  2LAP A;  2KI6 D;  4NQG A;  1RK9 A;  1CDN A;  1NP8 A;  4YGE B;  3BOW B;  1QV0 A;  1TN4 A;  1REC A;  2ZRS A;  2K2A A;  2JZI A;  1CM1 A;  2MLF C;  1HQV A;  2ZN9 A;  1G4Y R;  1KK7 Z;  1TNQ A;  1XFX O;  1PSB A;  3CLN A;  3TDZ A;  1IQ5 A;  4MZJ A;  2LHL A;  3CR5 X;  1C7V A;  4A4B A;  1SYM A;  5G08 A;  2BBM A;  3PSR A;  1B47 A;  2LM5 A;  4Q04 A;  1CKK A;  3I5H B;  2KBI A;  2K2F A;  5HKY A;  2Y1M A;  5CSI A;  1TOP A;  2WCF A;  1ALV A;  3JTD C;  3ZWH A;  3I5F B;  4HRE E;  4JWQ A;  4ETO A;  1SMG A;  3A4U B;  3SIB A;  3TS5 C;  3CS1 A;  1UHI A;  4NDC A;  1F4Q A;  1UHN A;  2M1U A;  2Y1N A;  2OPO A;  2ZN8 A;  1MQ1 A;  4AOM A;  3OB2 B;  1QTX A;  4U8D A;  1S6J A;  4PE1 A;  1S1E A;  2CBL A;  2BBN A;  2M29 A;  4GPL B;  2KFF A;  1WLM A;  1OOJ A;  2CT9 A;  2NZ0 A;  2K7B A;  3GK2 A;  1IQ3 A;  2JOJ A;  4MBE A;  2KSP A;  2GGM A;  3KO0 A;  5HKZ A;  2FCE A;  1EG3 A;  1YTZ C;  1UUS A;  1DJY A;  1XO5 A;  5I2L A;  1CLM A;  2EHB A;  1XFY O;  1HT9 A;  5KSZ A;  2BCA A;  3VRR A;  1BLQ A;  1B7T Y;  2A4J A;  2KAY A;  4I5J A;  4L9M A;  2VRG A;  2WOS A;  1ZUZ A;  1BOD A;  1A2X A;  4I5K A;  2EGD A;  4YBH B;  3EVR A;  1QIV A;  2CTN A;  3MSE B;  1OMV A;  4E68 A;  2BCB A;  1YRU B;  2F3Y A;  4QJ4 B;  4N1G A;  5I2Q A;  3CR4 X;  1OE9 B;  3PLF B;  3EK8 A;  4CID A;  3SG6 A;  2M9G A;  1CFD A;  3PAT A;  3OB1 B;  4WQ2 A;  4PDZ A;  2L4H A;  3NSL A;  1SKT A;  3CTN A;  1L2O C;  3BXK A;  3IQQ A;  5KU1 A;  1FI5 A;  1SL9 A;  1BT6 A;  3I5G B;  1PUL A;  3SG7 A;  1KSM A;  1TNP A;  3DVM A;  1OSA A;  1SPY A;  1CMF A;  4PHK A;  1B8C A;  2JWW A;  1CLL A;  3D0Y A;  3JTD B;  1K8U A;  3CWG A;  4OV2 A;  1PAL A;  2L98 A;  2ZRT A;  1CFP A;  4C0K A;  1CFC A;  1B9A A;  1WRK A;  1YR5 A;  3DD4 A;  1BMO A;  1KCY A;  1ZFS A;  4HRH A;  4JPZ B;  2LE9 B;  4YGC B;  1KQM C;  5F6T A;  2MBX A;  3LL8 B;  1RWY A;  5CSN A;  1QLS A;  1C7W A;  1YVH A;  2JRF A;  2BL0 B;  1K90 D;  1NCZ A;  3RM1 A;  4USL A;  1E8A A;  1KK8 C;  2TN4 A;  4BY4 A;  1SR6 C;  2M3W A;  1KQV A;  2E6W A;  1XFZ O;  2JTZ A;  1K93 D;  1SCM C;  1M63 B;  1AJ5 A;  1IRJ A;  1EL4 A;  2CNP A;  3BUW B;  2LAN A;  1A75 A;  1K9U A;  2WCE A;  2F33 A;  3QRX A;  5DKR A;  4C0J A;  1DJX A;  4M2O A;  1S6I A;  1XVJ A;  3C1V A;  1XFW O;  3OHM B;  2DOQ A;  3SG3 A;  3DF0 A;  1F71 A;  2LLT A;  1MF8 B;  1J7R A;  1NX0 A;  2WC8 A;  2LMT A;  1RFJ A;  2KFG A;  5AER A;  3LK1 A;  3WXA A;  2KYF A;  3AKB A;  4MEW A;  4MZK A;  1JF0 A;  2ZFD A;  5GQQ C;  3VRQ A;  4ZCU A;  1NPQ A;  1YUU A;  4FTG A;  4M2Q A;  1SL7 A;  2BEC A;  2KI4 C;  2PSR A;  1AUI B;  1OQP A;  1KWO B;  1ZMZ A;  1LVC D;  2SCP A;  1PK0 D;  1QLK A;  1DJG A;  2H61 A;  1YUR A;  1YX7 A;  3LCP C;  1H8B A;  1F70 A;  1LIN A;  2MHH A;  2HQ8 A;  2HF5 A;  1QX5 B;  1DGV A;  2ZND A;  3SG2 A;  3D0Y B;  1DF0 A;  2KAV A;  1TCF A;  1ALW A;  3NSI A;  2M1K B;  5AAN A;  4GBA A;  1GQM A;  1K95 A;  4PHM A;  3TUY C;  1G8I A;  4PHJ A;  2JXC A;  4CFQ A;  1JFJ A;  4GAO A;  2I18 A;  4NDD A;  2BE4 A;  2JNX A;  1SRA A;  1KFU S;  3EKH A;  4TNC A;  4GFT A;  3TS5 B;  2KBM A;  4I5N B;  1CDM A;  1EG4 A;  5D7F A;  2SAS A;  3EK4 A;  2LP2 A;  2QAC A;  3FWB A;  3D10 A;  4N5X A;  2ZNE A;  3E3R A;  4P5O E;  4HSZ A;  2KHN A;  1OZO A;  3OX5 A;  2FJU B;  1CTR A;  1QVI Y;  3HX4 A;  4OR9 B;  2GV5 A;  3IF7 A;  3I5H C;  2F2O A;  2LVV A;  3BUX B;  1Y1U A;  4A4C A;  1KQM B;  1M31 A;  5CSF A;  4CFR A;  1A29 A;  1Y6W A;  2L0P A;  3PN7 C;  1MXL C;  5B8I B;  2WCB A;  3I5G C;  4OKH A;  2L2E A;  1OMR A;  3DVJ A;  1G33 A;  2D8N A;  1QVI Z;  2FCD A;  1MHO A;  1QV1 A;  2CCM A;  5HLV A;  1A03 A;  4DUQ A;  1C07 A;  3O4Y A;  4JQ0 D;  4UPG A;  3NSO A;  3BOW A;  5DKQ A;  3VRP A;  1DTL A;  1N0Y A;  2L5X B;  1N65 A;  3JVT C;  1OMD A;  1JC2 A;  1PRW A;  1QX2 A;  2AAO A;  1AVS A;  3OP0 A;  1DJW A;  5CSJ A;  1ZOT B;  2M7L A;  2PRU A;  5I8N A;  1IJ5 A;  5JJG A;  2KGB C;  1UHH A;  1MXE A;  1AJ4 A;  1XK4 C;  5DKN A;  1F55 A;  4QJ5 B;  3EVV A;  2F2P A;  1BOC A;  1UHJ A;  1K94 A;  3GK1 A;  1NX2 A;  3SIA A;  1SW8 A;  2Q91 A;  2LV7 A;  5K89 A;  2KNE A;  4MN0 A;  2K8M B;  1B8R A;  1CFF A;  4CLN A;  5HLO A;  1B8L A;  1FW4 A;  3RLZ A;  3CR2 A;  1DJH A;  2PMY A;  3BUM B;  4PE0 A;  4ZCV A;  1TCO B;  1S6C A;  1DF0 B;  3KPX A;  3VRN A;  3AAJ A;  4PE7 A;  2K7D A;  4NDB A;  4GGF A;  4DIR A;  4MVF A;  1U5I B;  4PAL A;  1Y0V H;  2BKI B;  1EH2 A;  1SK6 D;  5KTY A;  3GOF A;  3KF9 A;  1L7Z A;  1UP5 A;  2PVB A;  2COL B;  3KEV A;  2B1U A;  4HRG A;  1XK4 A;  4OVN F;  3SG5 A;  1SBJ A;  1GGZ A;  2H2K A;  1X02 A;  1CB1 A;  2JPT A;  3GK4 X;  2KI4 B;  1RTP 1;  2LC5 A;  4GUK A;  1AK8 A;  2MRD A;  2KGR A;  3SG4 A;  1IJ6 A;  3VGO A;  1TIZ A;  2K0J A;  1VRK A;  5AEQ A;  1EJ3 A;  3LLE A;  3TDI A;  5HKW A;  1J7Q A;  1JWD A;  2LCP A;  4MSP A;  1PSR A;  1LKJ A;  1EXR A;  1LXF C;  2E30 A;  1DGU A;  4DS7 A;  1F8H A;  2KI6 C;  1NSH A;  3DVE A;  2ISD A;  5FYX A;  1CM4 A;  2KQY A;  1IWQ A;  3A8R A;  2GGZ A;  4PCW A;  3WHT B;  2Q4U A;  1CMG A;  1BR4 B;  2Y4Q A;  3PFV A;  1J1E A;  2BKH B;  1IKU A;  3WNX B;  1MWN A;  1TNX A;  5AFP A;  3FS7 A;  1ZAC A;  1NX1 A;  1YUS A;  4I5L B;  1DMO A;  1K2H A;  3SJS A;  3PAL A;  1WRL A;  4YI8 A;  4M2P A;  4XJK A;  1DJI A;  1BJF A;  2F8P A;  1SCV A;  5JOL A;  3BYA A;  4MZL A;  1R6P A;  1H4B A;  1TRF A;  1UHK A;  3O6B A;  2LHI A;  1NCX A;  1SY9 A;  1QAS A;  1FPW A;  5D69 A;  5I2O A;  1BU3 A;  1M45 A;  3EKJ A;  3PN7 B;  4AQJ A;  2M7N A;  2BL0 C;  2K7O A;  1NYA A;  1S5G Z;  1SNL A;  1TTX A;  3LK0 A;  2FOT A;  4QJ3 B;  2MLE C;  3TZ1 A;  3AKA A;  1Q80 A;  2K7C A;  5TNC A;  2WOR A;  1QJT A;  1QAT A;  3DVK A;  1XA5 A;  1DVI A;  1K9P A;  2JC2 A;  1ODB A;  3PM8 A;  2CXJ A;  3FIA A;  1Y1A A;  2NLN A;  4CPV A;  1F54 A;  1QX7 A;  3CGA A;  3H4S E;  3OX6 A;  1BF5 A;  2AMI A;  2O5G A;  4YI9 A;  3DF0 B;  2LP3 A;  2JT0 A;  1S26 D;  5AXI A;  2LMU A;  4XYN A;  1K9K A;  4WQ3 A;  1PVB A;  4DRW A;  1D1O A;  3TUY B;  2KDH A;  1V1G A;  4PE4 A;  1RJV A; 
#chains in the Genus database with same CATH topology
 3K21 A;  4KYN A;  2LLS A;  1J1D A;  1BR1 B;  1NX3 A;  1QIW A;  2HPS A;  1WY9 A;  2I7A A;  4FQT A;  1MR8 A;  4INW A;  5FI2 A;  5BPJ A;  2JNF A;  2LMV A;  4DCK A;  1NCY A;  4AQI A;  5ER5 A;  3ICB A;  2H61 C;  3VRO A;  2WND A;  3I5I B;  2HQW A;  2NCO A;  2P6B B;  2F3Z A;  2RGI A;  1V1F A;  4WRI A;  1AHR A;  2QEO A;  1IH0 A;  2I94 A;  3KHE A;  2MJW B;  4ORC B;  1S36 A;  1JSA A;  2L5Y A;  3NHT A;  1M39 A;  3Q8I A;  2R2I A;  3JVT B;  4YGB B;  3BFA A;  1TUJ A;  2NXQ A;  1WDC B;  1UWO A;  2M97 A;  2ZKM X;  1FBV A;  2KQ6 A;  2EC6 C;  3I5F C;  1S3P A;  1N2D A;  1W9Z A;  2H8V A;  3BQ3 A;  4YGA A;  4XJK B;  2L50 A;  3CZ1 A;  3M0W A;  1SCM B;  1CLB A;  1SL8 A;  2M0R A;  1YVL A;  3ZNI A;  2OTG C;  2OTG B;  3D78 A;  1KFU L;  4FQO A;  4INX A;  3B88 A;  2LVJ A;  5ER4 X;  2MA2 A;  4N1F A;  1KSO A;  1WRZ A;  1K96 A;  1SR6 B;  1CDL A;  1IGV A;  2IS9 A;  1JF2 A;  1TNW A;  4BY5 A;  4ORA B;  2EC6 B;  3DY9 A;  2KYC A;  1A75 B;  3FWC A;  2PAS A;  3O78 A;  1S5G Y;  4GNK B;  1W7J B;  1WLZ A;  1RRO A;  1UUR A;  1M46 A;  1LA0 A;  2AUC A;  4OCI A;  1Y1X A;  3NSK A;  1BG1 A;  3BJH A;  3F45 A;  2MAZ A;  3EG5 B;  2KOT A;  1YRT B;  2BCX A;  2JT8 A;  2QPT A;  3B6X A;  2KFH A;  1IG5 A;  1NUB A;  4MRX A;  1XFV O;  2JQ6 A;  3WHU B;  2BE6 A;  4P2Y B;  2OS8 B;  2L51 A;  4MRY A;  1LA3 A;  3S0F A;  4F0Z B;  1J7P A;  1KFX S;  1PVA A;  5PAL A;  4YRU A;  2KAX A;  2M8U A;  3CZT X;  1GJY A;  2NCP A;  3DZT A;  3TDU A;  5HYD A;  1JUO A;  2I2R E;  3I5I C;  2JT3 A;  5J3X A;  3EVU A;  2WCJ A;  2HET A;  2LVK A;  2O60 A;  2QEH A;  2JU0 A;  3S0D A;  5CPV A;  2JXL A;  1B7T Z;  2OS8 C;  2Y5I A;  2LLU A;  1U5I A;  1F4O A;  2G9B A;  1L2O B;  3QME A;  4ORB B;  1MUX A;  1CDP A;  4MLW A;  2LUC A;  3BUN B;  3IQO A;  2LUX A;  1B4C A;  1YUT A;  2PAL A;  1KWO C;  1JFK A;  4GGF C;  3EK7 A;  1KFX L;  1A4P A;  2QEV A;  1J55 A;  2L4I A;  1QXP A;  1KK7 Y;  1GGW A;  4YGD B;  2G2B A;  2JTT A;  1DJZ A;  3BUO B;  4IL1 A;  4C0L A;  2LVI A;  1R2U A;  3HCM A;  4PHN A;  1XFU O;  1CNP A;  4ICB A;  1JBA A;  1FI6 A;  1T14 A;  2K61 A;  4GGN A;  1DT7 B;  4R1E A;  1FF1 A;  1W7I B;  1B1G A;  1AP4 A;  1J7O A;  4D1E A;  2LNK A;  1KK8 B;  3AAK A;  2M49 B;  3D74 A;  1NIW A;  1OZS A;  1YX8 A;  3D77 A;  3O2P A;  1QS7 A;  5IBW A;  3NXA A;  2V53 A;  2KLE A;  2JUL A;  1WDC C;  1XYD A;  1NWD A;  2LAP A;  2KI6 D;  4NQG A;  1RK9 A;  1CDN A;  1NP8 A;  4YGE B;  3BOW B;  1QV0 A;  1TN4 A;  1REC A;  2ZRS A;  2K2A A;  2JPO A;  2JZI A;  1CM1 A;  2MLF C;  1HQV A;  2ZN9 A;  1G4Y R;  3BFH A;  1KK7 Z;  1TNQ A;  3B87 A;  1XFX O;  1PSB A;  3CLN A;  3TDZ A;  3K1E A;  1IQ5 A;  4MZJ A;  2LHL A;  3CR5 X;  1C7V A;  4A4B A;  1SYM A;  5G08 A;  2BBM A;  3PSR A;  1B47 A;  2LM5 A;  4Q04 A;  1CKK A;  3I5H B;  2KBI A;  2K2F A;  5HKY A;  2Y1M A;  3R72 A;  5CSI A;  1TOP A;  2WCF A;  1ALV A;  3JTD C;  4OZD A;  3V2L A;  3ZWH A;  1DQE A;  3I5F B;  4HRE E;  4JWQ A;  4ETO A;  1SMG A;  2KLD A;  2PQL A;  3A4U B;  3SIB A;  3TS5 C;  3CS1 A;  1UHI A;  4NDC A;  1F4Q A;  1UHN A;  2M1U A;  2Y1N A;  2OPO A;  2ZN8 A;  1MQ1 A;  5DIC A;  4AOM A;  3OB2 B;  3SS4 A;  1QTX A;  3B7A A;  4U8D A;  1S6J A;  4PE1 A;  1S1E A;  2CBL A;  2BBN A;  2M29 A;  3IVT A;  4GPL B;  2KFF A;  1WLM A;  1OW4 A;  1OOJ A;  2WCH A;  2CT9 A;  2NZ0 A;  2K7B A;  3GK2 A;  3FE8 A;  2JOJ A;  1IQ3 A;  4MBE A;  2KSP A;  2GGM A;  2PYQ A;  3KO0 A;  5HKZ A;  2FCE A;  3SS5 A;  1EG3 A;  1YTZ C;  1UUS A;  1DJY A;  1XO5 A;  5I2L A;  1CLM A;  2EHB A;  1XFY O;  1HT9 A;  5KSZ A;  2FJY A;  2BCA A;  3VRR A;  1BLQ A;  1B7T Y;  1OOF A;  2A4J A;  2KAY A;  4I5J A;  4L9M A;  2VRG A;  2WOS A;  1ZUZ A;  1DEK A;  1BOD A;  1A2X A;  4I5K A;  2EGD A;  3D73 A;  4YBH B;  1OOH A;  1QIV A;  2CTN A;  3EVR A;  2WCM A;  3MSE B;  1OMV A;  4E68 A;  1GM0 A;  2BCB A;  1YRU B;  2F3Y A;  4QJ4 B;  4N1G A;  5I2Q A;  3CR4 X;  1OE9 B;  3PLF B;  3EK8 A;  4CID A;  3SG6 A;  3CZ2 A;  2M9G A;  1CFD A;  3PAT A;  3OB1 B;  4WQ2 A;  4PDZ A;  2L4H A;  3NSL A;  3R1P A;  1SKT A;  3CTN A;  1L2O C;  3PJI A;  3BXK A;  3IQQ A;  5KU1 A;  3DXL A;  1FI5 A;  1SL9 A;  1BT6 A;  3I5G B;  1PUL A;  3DYE A;  3SG7 A;  1KSM A;  1TNP A;  3DVM A;  1OSA A;  1SPY A;  1CMF A;  4PHK A;  1B8C A;  2JWW A;  1CLL A;  3D0Y A;  3JTD B;  1K8U A;  3CWG A;  4OV2 A;  1PAL A;  2L98 A;  2ZRT A;  1CFP A;  3BFB A;  3O4X A;  4C0K A;  1CFC A;  1B9A A;  3RZS A;  1WRK A;  1YR5 A;  3DD4 A;  1BMO A;  1KCY A;  1ZFS A;  4HRH A;  4JPZ B;  3L4L A;  2LE9 B;  4YGC B;  1KQM C;  5F6T A;  2MBX A;  3LL8 B;  1RWY A;  5CSN A;  1QLS A;  1C7W A;  1YVH A;  2ERB A;  2BL0 B;  1K90 D;  1NCZ A;  2JRF A;  3R1O A;  4USL A;  3RM1 A;  1E8A A;  1KK8 C;  2TN4 A;  2WCK A;  2YGU A;  1SR6 C;  4BY4 A;  2M3W A;  1KQV A;  2E6W A;  1XFZ O;  2JTZ A;  1K93 D;  1SCM C;  1M63 B;  1ORG A;  3D75 A;  3S0A A;  1AJ5 A;  1IRJ A;  1EL4 A;  2CNP A;  3BUW B;  2LAN A;  5EL2 A;  1A75 A;  1K9U A;  2WCE A;  2F33 A;  3QRX A;  5DKR A;  4C0J A;  1DJX A;  4M2O A;  1S6I A;  1XVJ A;  3C1V A;  1XFW O;  3FE9 A;  2DOQ A;  3OHM B;  3SG3 A;  3DF0 A;  1F71 A;  2LLT A;  1MF8 B;  1J7R A;  1NX0 A;  2WC8 A;  2LMT A;  3L47 A;  1RFJ A;  2KFG A;  5AER A;  3LK1 A;  3WXA A;  1TUZ A;  2KYF A;  3AKB A;  4MEW A;  4MZK A;  1TWO A;  1JF0 A;  2P70 A;  2ZFD A;  5GQQ C;  4ZCU A;  1NPQ A;  1YUU A;  4FTG A;  4M2Q A;  3VRQ A;  1SL7 A;  2BEC A;  2KI4 C;  2PSR A;  1AUI B;  1OQP A;  1KWO B;  1ZMZ A;  1LVC D;  2GTE A;  2SCP A;  1PK0 D;  1QLK A;  1DJG A;  2H61 A;  1YUR A;  1YX7 A;  3LCP C;  1H8B A;  1F70 A;  1LIN A;  2MHH A;  2HQ8 A;  2HF5 A;  1QX5 B;  1DGV A;  2ZND A;  3SG2 A;  3D0Y B;  1DF0 A;  2KAV A;  1TCF A;  1ALW A;  3NSI A;  2M1K B;  5AAN A;  4GBA A;  1GQM A;  1K95 A;  4PHM A;  3TUY C;  1C3Y A;  1G8I A;  4PHJ A;  2JXC A;  4CFQ A;  1JFJ A;  4GAO A;  2I18 A;  4NDD A;  2BE4 A;  2JNX A;  1SRA A;  1KFU S;  3EKH A;  2L2C A;  4TNC A;  4GFT A;  3TS5 B;  2KBM A;  4I5N B;  1CDM A;  1EG4 A;  5D7F A;  2SAS A;  3EK4 A;  2LP2 A;  2QAC A;  3FWB A;  3D10 A;  4N5X A;  2ZNE A;  3E3R A;  4P5O E;  4HSZ A;  2KHN A;  1OZO A;  3OX5 A;  4PT1 A;  2FJU B;  1CTR A;  1QVI Y;  3HX4 A;  4OR9 B;  2GV5 A;  3IF7 A;  2WCL A;  3I5H C;  3VB1 A;  2F2O A;  2LVV A;  3BUX B;  1Y1U A;  4A4C A;  1KQM B;  1M31 A;  5CSF A;  5FI6 A;  4CFR A;  1A29 A;  1Y6W A;  2BAP A;  2L0P A;  1MXL C;  3PN7 C;  5B8I B;  2BNX A;  2WCB A;  3I5G C;  3UO9 A;  4OKH A;  2L2E A;  1OMR A;  3DVJ A;  1G33 A;  1P28 A;  1QVI Z;  2D8N A;  2FCD A;  1Z4H A;  1MHO A;  1QV1 A;  2CCM A;  5HLV A;  1A03 A;  3D76 A;  4DUQ A;  1C07 A;  3O4Y A;  4JQ0 D;  4UPG A;  3NSO A;  3BOW A;  5DKQ A;  3VRP A;  1DTL A;  1N0Y A;  2L5X B;  1N65 A;  3JVT C;  1OMD A;  1JC2 A;  1PRW A;  1QX2 A;  2AAO A;  1AVS A;  3OP0 A;  3OGN A;  5I94 A;  1DJW A;  3OBV A;  5CSJ A;  1ZOT B;  2M7L A;  2PRU A;  5I8N A;  1IJ5 A;  5JJG A;  2KGB C;  1UHH A;  1MXE A;  1AJ4 A;  1XK4 C;  5DKN A;  1F55 A;  4QJ5 B;  1OOG A;  3EVV A;  2F2P A;  1BOC A;  1UHJ A;  2QEB A;  1K94 A;  3GK1 A;  1NX2 A;  3SIA A;  1SW8 A;  2Q91 A;  2LV7 A;  5K89 A;  2KNE A;  4MN0 A;  2K8M B;  3SS3 A;  1B8R A;  1CFF A;  4CLN A;  5HLO A;  3CYZ A;  1B8L A;  1FW4 A;  3RLZ A;  3CR2 A;  1DJH A;  2PMY A;  2WC5 A;  3BUM B;  2QDI A;  4PE0 A;  4ZCV A;  3UNW A;  1TCO B;  1S6C A;  5D3O A;  3NHI A;  1DF0 B;  3KPX A;  3L4A A;  3VRN A;  3AAJ A;  4PE7 A;  1C3Z A;  2K7D A;  4NDB A;  4GGF A;  4DIR A;  4MVF A;  1U5I B;  4PAL A;  1Y0V H;  2BKI B;  1EH2 A;  3S0E A;  1SK6 D;  5KTY A;  3GOF A;  3KF9 A;  1L7Z A;  1UP5 A;  2PVB A;  2COL B;  3KEV A;  2B1U A;  4HRG A;  1XK4 A;  4OVN F;  3SG5 A;  1SBJ A;  1GGZ A;  2H2K A;  1X02 A;  3CDN A;  3S0B A;  1CB1 A;  2JPT A;  3GK4 X;  2KI4 B;  1RTP 1;  2LC5 A;  4GUK A;  1AK8 A;  2MRD A;  2KGR A;  3PM2 A;  3SG4 A;  1IJ6 A;  1QWV A;  3VGO A;  1OOI X;  1TIZ A;  2K0J A;  1VRK A;  5AEQ A;  1EJ3 A;  1Z2C B;  3LLE A;  1LS8 A;  3TDI A;  5HKW A;  1J7Q A;  1JWD A;  2LCP A;  4MSP A;  1PSR A;  1LKJ A;  4F7F A;  1EXR A;  1LXF C;  2E30 A;  1DGU A;  4DS7 A;  1F8H A;  4JKT A;  2KI6 C;  1NSH A;  3DVE A;  2ISD A;  3S0G A;  5FYX A;  1CM4 A;  2KQY A;  1IWQ A;  3A8R A;  2GGZ A;  4PCW A;  3WHT B;  2Q4U A;  1CMG A;  1BR4 B;  5FI7 A;  2Y4Q A;  3FE6 A;  1SSE B;  1DC1 A;  3PFV A;  1J1E A;  2BKH B;  1IKU A;  3WNX B;  1MWN A;  1TNX A;  5AFP A;  3FS7 A;  1ZAC A;  1NX1 A;  1YUS A;  4I5L B;  1DMO A;  1K2H A;  3SJS A;  3PAL A;  1WRL A;  4YI8 A;  4M2P A;  4XJK A;  1DJI A;  1BJF A;  2F8P A;  1SCV A;  3N7H A;  5JOL A;  3BYA A;  4MZL A;  1R6P A;  1H4B A;  1TRF A;  1UHK A;  3O6B A;  2LHI A;  1NCX A;  1SY9 A;  1QAS A;  5HL1 A;  4IJ7 A;  1FPW A;  5D69 A;  5I2O A;  1BU3 A;  1M45 A;  3EKJ A;  3PN7 B;  4AQJ A;  3NGV A;  2M7N A;  3R1V A;  2BL0 C;  2K7O A;  1NYA A;  1S5G Z;  1IIO A;  1SNL A;  1TTX A;  2WC6 A;  3LK0 A;  2FOT A;  4QJ3 B;  2MLE C;  2KPH A;  3TZ1 A;  3AKA A;  4JD9 A;  1Q80 A;  2K7C A;  1XFR A;  5TNC A;  2WOR A;  1QJT A;  1QAT A;  3CZ0 A;  3DVK A;  1XA5 A;  1DVI A;  1K9P A;  2JC2 A;  3CAB A;  1ODB A;  3PM8 A;  2CXJ A;  3FIA A;  1Y1A A;  2NLN A;  4CPV A;  1F54 A;  1QX7 A;  3CGA A;  3H4S E;  3OX6 A;  1BF5 A;  2AMI A;  3B86 A;  2O5G A;  4YI9 A;  3DF0 B;  2LP3 A;  2JT0 A;  1S26 D;  5AXI A;  2LMU A;  4XYN A;  1K9K A;  2P71 A;  1PVB A;  2K60 A;  4WQ3 A;  4DRW A;  1D1O A;  3TUY B;  1DEL A;  2KDH A;  1V1G A;  4PE4 A;  1RJV A; 
#chains in the Genus database with same CATH homology
 3K21 A;  2LLS A;  1J1D A;  1BR1 B;  1NX3 A;  1QIW A;  2HPS A;  1WY9 A;  2I7A A;  1MR8 A;  5BPJ A;  2JNF A;  2LMV A;  4DCK A;  1NCY A;  4AQI A;  5ER5 A;  3ICB A;  2H61 C;  3VRO A;  2WND A;  3I5I B;  2HQW A;  2NCO A;  2P6B B;  2F3Z A;  2RGI A;  1V1F A;  4WRI A;  1AHR A;  1IH0 A;  2I94 A;  3KHE A;  2MJW B;  4ORC B;  1S36 A;  1JSA A;  1M39 A;  2R2I A;  3JVT B;  4YGB B;  2NXQ A;  1WDC B;  1UWO A;  2M97 A;  2ZKM X;  1FBV A;  2KQ6 A;  2EC6 C;  3I5F C;  1S3P A;  1N2D A;  3BQ3 A;  4YGA A;  4XJK B;  2L50 A;  3M0W A;  1SCM B;  1CLB A;  1SL8 A;  2M0R A;  1YVL A;  3ZNI A;  2OTG C;  2OTG B;  1KFU L;  4FQO A;  2LVJ A;  5ER4 X;  2MA2 A;  4N1F A;  1KSO A;  1WRZ A;  1K96 A;  1SR6 B;  1CDL A;  1IGV A;  2IS9 A;  1JF2 A;  1TNW A;  4BY5 A;  4ORA B;  2EC6 B;  2KYC A;  1A75 B;  3FWC A;  2PAS A;  3O78 A;  1S5G Y;  4GNK B;  1W7J B;  1WLZ A;  1RRO A;  1UUR A;  1M46 A;  1LA0 A;  2AUC A;  4OCI A;  1Y1X A;  3NSK A;  1BG1 A;  3F45 A;  2MAZ A;  2KOT A;  1YRT B;  2BCX A;  2JT8 A;  2QPT A;  2KFH A;  1IG5 A;  1NUB A;  4MRX A;  1XFV O;  2JQ6 A;  3WHU B;  2BE6 A;  4P2Y B;  2OS8 B;  2L51 A;  4MRY A;  1LA3 A;  1J7P A;  4F0Z B;  1KFX S;  1PVA A;  5PAL A;  4YRU A;  2KAX A;  2M8U A;  3CZT X;  1GJY A;  2NCP A;  3TDU A;  5HYD A;  1JUO A;  2I2R E;  3I5I C;  2JT3 A;  5J3X A;  3EVU A;  2HET A;  2LVK A;  2O60 A;  2JU0 A;  5CPV A;  2JXL A;  1B7T Z;  2OS8 C;  2Y5I A;  2LLU A;  1U5I A;  1F4O A;  2G9B A;  1L2O B;  4ORB B;  1MUX A;  1CDP A;  4MLW A;  2LUC A;  3BUN B;  3IQO A;  2LUX A;  1B4C A;  1YUT A;  2PAL A;  1KWO C;  1JFK A;  4GGF C;  3EK7 A;  1KFX L;  1A4P A;  1J55 A;  2L4I A;  1QXP A;  1KK7 Y;  1GGW A;  4YGD B;  2G2B A;  2JTT A;  1DJZ A;  3BUO B;  4IL1 A;  4C0L A;  2LVI A;  1R2U A;  3HCM A;  4PHN A;  1XFU O;  1CNP A;  4ICB A;  1JBA A;  1FI6 A;  2K61 A;  4GGN A;  1DT7 B;  4R1E A;  1FF1 A;  1W7I B;  1B1G A;  1AP4 A;  1J7O A;  4D1E A;  2LNK A;  1KK8 B;  3AAK A;  2M49 B;  1NIW A;  1OZS A;  1YX8 A;  3O2P A;  5IBW A;  1QS7 A;  3NXA A;  2V53 A;  2JUL A;  1WDC C;  1XYD A;  1NWD A;  2LAP A;  2KI6 D;  4NQG A;  1RK9 A;  1CDN A;  1NP8 A;  4YGE B;  3BOW B;  1QV0 A;  1TN4 A;  1REC A;  2ZRS A;  2K2A A;  2JZI A;  1CM1 A;  2MLF C;  1HQV A;  2ZN9 A;  1G4Y R;  1KK7 Z;  1TNQ A;  1XFX O;  1PSB A;  3CLN A;  3TDZ A;  1IQ5 A;  4MZJ A;  2LHL A;  3CR5 X;  1C7V A;  4A4B A;  1SYM A;  5G08 A;  2BBM A;  3PSR A;  1B47 A;  2LM5 A;  4Q04 A;  1CKK A;  3I5H B;  2KBI A;  2K2F A;  5HKY A;  2Y1M A;  5CSI A;  1TOP A;  2WCF A;  1ALV A;  3JTD C;  3ZWH A;  3I5F B;  4HRE E;  4JWQ A;  4ETO A;  1SMG A;  3A4U B;  3SIB A;  3TS5 C;  3CS1 A;  1UHI A;  4NDC A;  1F4Q A;  1UHN A;  2M1U A;  2Y1N A;  2OPO A;  2ZN8 A;  1MQ1 A;  4AOM A;  3OB2 B;  1QTX A;  4U8D A;  1S6J A;  4PE1 A;  1S1E A;  2CBL A;  2BBN A;  2M29 A;  4GPL B;  2KFF A;  1WLM A;  1OOJ A;  2CT9 A;  2NZ0 A;  2K7B A;  3GK2 A;  1IQ3 A;  2JOJ A;  4MBE A;  2KSP A;  2GGM A;  3KO0 A;  5HKZ A;  2FCE A;  1EG3 A;  1YTZ C;  1UUS A;  1DJY A;  1XO5 A;  5I2L A;  1CLM A;  2EHB A;  1XFY O;  1HT9 A;  5KSZ A;  2BCA A;  3VRR A;  1BLQ A;  1B7T Y;  2A4J A;  2KAY A;  4I5J A;  4L9M A;  2VRG A;  2WOS A;  1ZUZ A;  1BOD A;  1A2X A;  4I5K A;  2EGD A;  4YBH B;  3EVR A;  1QIV A;  2CTN A;  3MSE B;  1OMV A;  4E68 A;  2BCB A;  1YRU B;  2F3Y A;  4QJ4 B;  4N1G A;  5I2Q A;  3CR4 X;  1OE9 B;  3PLF B;  3EK8 A;  4CID A;  3SG6 A;  2M9G A;  1CFD A;  3PAT A;  3OB1 B;  4WQ2 A;  4PDZ A;  2L4H A;  3NSL A;  1SKT A;  3CTN A;  1L2O C;  3BXK A;  3IQQ A;  5KU1 A;  1FI5 A;  1SL9 A;  1BT6 A;  3I5G B;  1PUL A;  3SG7 A;  1KSM A;  1TNP A;  3DVM A;  1OSA A;  1SPY A;  1CMF A;  4PHK A;  1B8C A;  2JWW A;  1CLL A;  3D0Y A;  3JTD B;  1K8U A;  3CWG A;  4OV2 A;  1PAL A;  2L98 A;  2ZRT A;  1CFP A;  4C0K A;  1CFC A;  1B9A A;  1WRK A;  1YR5 A;  3DD4 A;  1BMO A;  1KCY A;  1ZFS A;  4HRH A;  4JPZ B;  2LE9 B;  4YGC B;  1KQM C;  5F6T A;  2MBX A;  3LL8 B;  1RWY A;  5CSN A;  1QLS A;  1C7W A;  1YVH A;  2JRF A;  2BL0 B;  1K90 D;  1NCZ A;  3RM1 A;  4USL A;  1E8A A;  1KK8 C;  2TN4 A;  4BY4 A;  1SR6 C;  2M3W A;  1KQV A;  2E6W A;  1XFZ O;  2JTZ A;  1K93 D;  1SCM C;  1M63 B;  1AJ5 A;  1IRJ A;  1EL4 A;  2CNP A;  3BUW B;  2LAN A;  1A75 A;  1K9U A;  2WCE A;  2F33 A;  3QRX A;  5DKR A;  4C0J A;  1DJX A;  4M2O A;  1S6I A;  1XVJ A;  3C1V A;  1XFW O;  3OHM B;  2DOQ A;  3SG3 A;  3DF0 A;  1F71 A;  2LLT A;  1MF8 B;  1J7R A;  1NX0 A;  2WC8 A;  2LMT A;  1RFJ A;  2KFG A;  5AER A;  3LK1 A;  3WXA A;  2KYF A;  3AKB A;  4MEW A;  4MZK A;  1JF0 A;  2ZFD A;  5GQQ C;  3VRQ A;  4ZCU A;  1NPQ A;  1YUU A;  4FTG A;  4M2Q A;  1SL7 A;  2BEC A;  2KI4 C;  2PSR A;  1AUI B;  1OQP A;  1KWO B;  1ZMZ A;  1LVC D;  2SCP A;  1PK0 D;  1QLK A;  1DJG A;  2H61 A;  1YUR A;  1YX7 A;  3LCP C;  1H8B A;  1F70 A;  1LIN A;  2MHH A;  2HQ8 A;  2HF5 A;  1QX5 B;  1DGV A;  2ZND A;  3SG2 A;  3D0Y B;  1DF0 A;  2KAV A;  1TCF A;  1ALW A;  3NSI A;  2M1K B;  5AAN A;  4GBA A;  1GQM A;  1K95 A;  4PHM A;  3TUY C;  1G8I A;  4PHJ A;  2JXC A;  4CFQ A;  1JFJ A;  4GAO A;  2I18 A;  4NDD A;  2BE4 A;  2JNX A;  1SRA A;  1KFU S;  3EKH A;  4TNC A;  4GFT A;  3TS5 B;  2KBM A;  4I5N B;  1CDM A;  1EG4 A;  5D7F A;  2SAS A;  3EK4 A;  2LP2 A;  2QAC A;  3FWB A;  3D10 A;  4N5X A;  2ZNE A;  3E3R A;  4P5O E;  4HSZ A;  2KHN A;  1OZO A;  3OX5 A;  2FJU B;  1CTR A;  1QVI Y;  3HX4 A;  4OR9 B;  2GV5 A;  3IF7 A;  3I5H C;  2F2O A;  2LVV A;  3BUX B;  1Y1U A;  4A4C A;  1KQM B;  1M31 A;  5CSF A;  4CFR A;  1A29 A;  1Y6W A;  2L0P A;  3PN7 C;  1MXL C;  5B8I B;  2WCB A;  3I5G C;  4OKH A;  2L2E A;  1OMR A;  3DVJ A;  1G33 A;  2D8N A;  1QVI Z;  2FCD A;  1MHO A;  1QV1 A;  2CCM A;  5HLV A;  1A03 A;  4DUQ A;  1C07 A;  3O4Y A;  4JQ0 D;  4UPG A;  3NSO A;  3BOW A;  5DKQ A;  3VRP A;  1DTL A;  1N0Y A;  2L5X B;  1N65 A;  3JVT C;  1OMD A;  1JC2 A;  1PRW A;  1QX2 A;  2AAO A;  1AVS A;  3OP0 A;  1DJW A;  5CSJ A;  1ZOT B;  2M7L A;  2PRU A;  5I8N A;  1IJ5 A;  5JJG A;  2KGB C;  1UHH A;  1MXE A;  1AJ4 A;  1XK4 C;  5DKN A;  1F55 A;  4QJ5 B;  3EVV A;  2F2P A;  1BOC A;  1UHJ A;  1K94 A;  3GK1 A;  1NX2 A;  3SIA A;  1SW8 A;  2Q91 A;  2LV7 A;  5K89 A;  2KNE A;  4MN0 A;  2K8M B;  1B8R A;  1CFF A;  4CLN A;  5HLO A;  1B8L A;  1FW4 A;  3RLZ A;  3CR2 A;  1DJH A;  2PMY A;  3BUM B;  4PE0 A;  4ZCV A;  1TCO B;  1S6C A;  1DF0 B;  3KPX A;  3VRN A;  3AAJ A;  4PE7 A;  2K7D A;  4NDB A;  4GGF A;  4DIR A;  4MVF A;  1U5I B;  4PAL A;  1Y0V H;  2BKI B;  1EH2 A;  1SK6 D;  5KTY A;  3GOF A;  3KF9 A;  1L7Z A;  1UP5 A;  2PVB A;  2COL B;  3KEV A;  2B1U A;  4HRG A;  1XK4 A;  4OVN F;  3SG5 A;  1SBJ A;  1GGZ A;  2H2K A;  1X02 A;  1CB1 A;  2JPT A;  3GK4 X;  2KI4 B;  1RTP 1;  2LC5 A;  4GUK A;  1AK8 A;  2MRD A;  2KGR A;  3SG4 A;  1IJ6 A;  3VGO A;  1TIZ A;  2K0J A;  1VRK A;  5AEQ A;  1EJ3 A;  3LLE A;  3TDI A;  5HKW A;  1J7Q A;  1JWD A;  2LCP A;  4MSP A;  1PSR A;  1LKJ A;  1EXR A;  1LXF C;  2E30 A;  1DGU A;  4DS7 A;  1F8H A;  2KI6 C;  1NSH A;  3DVE A;  2ISD A;  5FYX A;  1CM4 A;  2KQY A;  1IWQ A;  3A8R A;  2GGZ A;  4PCW A;  3WHT B;  2Q4U A;  1CMG A;  1BR4 B;  2Y4Q A;  3PFV A;  1J1E A;  2BKH B;  1IKU A;  3WNX B;  1MWN A;  1TNX A;  5AFP A;  3FS7 A;  1ZAC A;  1NX1 A;  1YUS A;  4I5L B;  1DMO A;  1K2H A;  3SJS A;  3PAL A;  1WRL A;  4YI8 A;  4M2P A;  4XJK A;  1DJI A;  1BJF A;  2F8P A;  1SCV A;  5JOL A;  3BYA A;  4MZL A;  1R6P A;  1H4B A;  1TRF A;  1UHK A;  3O6B A;  2LHI A;  1NCX A;  1SY9 A;  1QAS A;  1FPW A;  5D69 A;  5I2O A;  1BU3 A;  1M45 A;  3EKJ A;  3PN7 B;  4AQJ A;  2M7N A;  2BL0 C;  2K7O A;  1NYA A;  1S5G Z;  1SNL A;  1TTX A;  3LK0 A;  2FOT A;  4QJ3 B;  2MLE C;  3TZ1 A;  3AKA A;  1Q80 A;  2K7C A;  5TNC A;  2WOR A;  1QJT A;  1QAT A;  3DVK A;  1XA5 A;  1DVI A;  1K9P A;  2JC2 A;  1ODB A;  3PM8 A;  2CXJ A;  3FIA A;  1Y1A A;  2NLN A;  4CPV A;  1F54 A;  1QX7 A;  3CGA A;  3H4S E;  3OX6 A;  1BF5 A;  2AMI A;  2O5G A;  4YI9 A;  3DF0 B;  2LP3 A;  2JT0 A;  1S26 D;  5AXI A;  2LMU A;  4XYN A;  1K9K A;  4WQ3 A;  1PVB A;  4DRW A;  1D1O A;  3TUY B;  2KDH A;  1V1G A;  4PE4 A;  1RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...