3CTNA

Structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
KDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Calcium-binding protein
molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ctnA00
4YGEB 2WNDA 1XVJA 1MHOA 4GGNA 2WOSA 1CMGA 1N2DA 1M39A 1UHNA 1KK7Z 2PASA 2CBLA 5ER5A 3I5FC 5CSFA 1PRWA 2B1UA 2MJWB 1TNQA 2LUCA 3VRPA 2FJUB 2JQ6A 2L50A 3GK1A 1CFFA 4M2OA 3CR2A 3I5HB 1JFJA 1L2OC 1IJ5A 1AP4A 1KQMC 1TNXA 1ZMZA 1G33A 3I5GB 4I5NB 1CNPA 1XFYO 3TDUA 2OTGB 1GGWA 3KF9A 4HREE 1SCMB 3TS5B 3VROA 1IQ3A 1K9UA 1QVIZ 1WDCB 3IF7A 2CXJA 3AKAA 3ZNIA 2JRFA 2K2AA 1QX5B 2PSRA 4ORCB 1TRFA 1H8BA 4U8DA 1M31A 1J1DA 1B8CA 1BOCA 1ODBA 2O5GA 2VRGA 3DVMA 1R2UA 5HKYA 1QV0A 3A4UB 4ICBA 5AERA 1JSAA 5AXIA 3SG5A 2NZ0A 4ORBB 1ZFSA 1EXRA 1JUOA 4AOMA 4YI9A 4QJ5B 1H4BA 1R6PA 3K21A 3SG6A 2BCXA 3BUOB 5DKQA 2ZNEA 3KPXA 1XFVO 2EC6B 5PALA 3CS1A 4YGDB 1OOJA 1QS7A 1A75A 1IWQA 2RGIA 4YBHB 2BL0B 2KYFA 2ZNDA 4PALA 1PVBA 2PMYA 1J7RA 1CLBA 2MRDA 1KK8C 1XYDA 1GGZA 1K8UA 1TNPA 1TOPA 1U5IA 3FWCA 2JWWA 4HRHA 1YX7A 4C0JA 1IRJA 3VRRA 3I5FB 3LLEA 5FYXA 5HKWA 3GK4X 1J7QA 1KFXS 1W7IB 2KYCA 1L2OB 4CFQA 1KQMB 5I2QA 1DMOA 3AAJA 5K89A 4L9MA 1M46A 4CLNA 2F2PA 1HQVA 3JTDC 1SY9A 3TDZA 1NX2A 4P5OE 1QIVA 2Y5IA 1KK7Y 4MN0A 2KDHA 3VRQA 1WRKA 4R1EA 1K95A 5J3XA 1FI6A 1K96A 1Q80A 2Y1MA 2ISDA 5HLOA 1DJYA 2KFFA 2L4HA 3A8RA 1LA3A 2NCOA 1U5IB 3SG3A 2ZRTA 1SKTA 1F70A 1CTRA 4JWQA 2FCDA 3O6BA 4PHMA 1QLKA 1RTP1 3LK0A 1OZOA 2L2EA 3QRXA 1F4OA 3EKHA 1B4CA 1NIWA 2G2BA 1DJHA 4GUKA 5DKNA 1F8HA 2HETA 3DF0A 4IL1A 2GGMA 2HQ8A 5HYDA 5F6TA 1UHIA 3I5IC 4C0LA 1IQ5A 4TNCA 2JPTA 3JVTC 1MWNA 3F45A 1QASA 1K93D 1KFUS 3GOFA 1ZACA 1MQ1A 3KEVA 3SG4A 4OCIA 1CMFA 3WNXB 1B8LA 1JC2A 2JXCA 1AJ5A 1PSRA 4CFRA 4DS7A 1K2HA 1XK4C 2M49B 2ZN8A 1DTLA 1YRUB 2ZN9A 4YI8A 2LVJA 2LMVA 2M7LA 2KGBC 1KK8B 1NCXA 1PALA 2LLTA 2NXQA 1ALVA 2MA2A 4I5JA 1B8RA 4BY5A 4OR9B 3FWBA 1NX0A 1SPYA 1MXEA 3AAKA 1XA5A 2L4IA 5HKZA 3FS7A 1OE9B 3DF0B 1J55A 1RROA 1RK9A 1YURA 4MRYA 1N0YA 3EVUA 1CDPA 4YGAA 1MR8A 2M1KB 2I18A 2Q4UA 2E6WA 1DF0A 3JTDB 4E68A 1S5GY 4ZCUA 1G8IA 3BOWA 2PVBA 1W7JB 1WRZA 3BXKA 4D1EA 2K2FA 1CLMA 1KFXL 1RJVA 2LV7A 4MEWA 4PE7A 5BPJA 4PHKA 2JT3A 3BUMB 3PFVA 2MLFC 2I2RE 1BT6A 2KNEA 1K9KA 2K7DA 1XK4A 2BBNA 2R2IA 1DJGA 5B8IB 2LC5A 2HQWA 1G4YR 1SK6D 1OMRA 3NSLA 2H61C 1JWDA 3FIAA 4N5XA 4DIRA 2JZIA 1QTXA 1NUBA 5KSZA 1SL8A 3H4SE 3O2PA 2F2OA 3SG2A 1DF0B 1KQVA 1C07A 2I94A 2CTNA 4DUQA 3BOWB 1NX1A 1QIWA 2BE4A 2L0PA 1KCYA 1CFCA 1DVIA 1FPWA 1IGVA 2BBMA 2WORA 2KAVA 1IH0A 2SCPA 1RECA 2AUCA 3BUWB 1XFXO 3C1VA 1MF8B 3AKBA 4JPZB 1XO5A 4HRGA 4N1GA 1AHRA 5D7FA 1XFZO 1QJTA 1JFKA 3VGOA 1QV1A 1DJXA 2BCAA 3OB2B 1KFUL 2MHHA 4MVFA 2M29A 1F55A 2H61A 1Y6WA 4GFTA 2I7AA 2BCBA 1YVLA 2AMIA 1AUIB 1DGVA 2LM5A 2NLNA 3D0YA 1BF5A 2FOTA 3SIAA 1SYMA 2L51A 4FQOA 4PE4A 4A4CA 1C7VA 2F8PA 3TUYC 2G9BA 1S5GZ 1S3PA 3LCPC 3BQ3A 4FTGA 1UUSA 1WLZA 2KFHA 1A2XA 5ER4X 2M97A 4A4BA 1CDNA 2LAPA 3TDIA 3DVJA 1V1GA 4MZKA 4PHNA 4CIDA 1TTXA 1EH2A 1MUXA 2JT0A 3DVKA 1B1GA 3IQQA 4JQ0D 1YVHA 1QATA 1YTZC 4DCKA 1CDMA 1JF2A 1FW4A 1KSMA 3D0YB 2JTZA 1BODA 4GGFC 2M7NA 1F54A 5CSNA 1CKKA 2ZKMX 3CLNA 4AQIA 1CM1A 1Y1AA 2KGRA 1NWDA 2M1UA 3OB1B 1V1FA 4CPVA 2KI6D 1AVSA 4I5KA 3EK7A 2LHLA 4DRWA 5AEQA 3OX5A 3O78A 3WXAA 1NSHA 2KBMA 1WLMA 2HPSA 1Y1UA 4YRUA 1NCZA 1SBJA 2K8MB 2BE6A 2OPOA 2F3YA 1FF1A 1F71A 5CSIA 2LLSA 1DGUA 1QX2A 4MLWA 3NSKA 1BR1B 2MLEC 4MZJA 2OS8C 1SR6C 1SRAA 1QX7A 1PSBA 1S6IA 2M9GA 3RM1A 4GGFA 2PRUA 3CZTX 1JBAA 1S6JA 4USLA 1OZSA 1CLLA 3SIBA 3DVEA 3SJSA 4QJ3B 1LA0A 3M0WA 2K0JA 2F3ZA 2JC2A 5I8NA 3GK2A 2KSPA 1LKJA 1DJIA 5AFPA 1PK0D 2BECA 4OV2A 1BLQA 2KHNA 2PALA 2LCPA 2CNPA 2Y1NA 1NP8A 1YX8A 1CM4A 1S1EA 1Y1XA 3OP0A 2LMTA 3CR4X 1K94A 1K9PA 1IJ6A 2JU0A 3ICBA 1QXPA 1IG5A 1M45A 2COLB 1B7TZ 4M2PA 1VRKA 1KWOC 2Y4QA 3OX6A 1Y0VH 1GJYA 4C0KA 1HT9A 5DKRA 2JNFA 3ZWHA 1UHJA 2K61A 3CWGA 2M0RA 3RLZA 2KOTA 2KAXA 2NCPA 4OKHA 3BUXB 3KO0A 1RWYA 1OSAA 1S26D 2CT9A 2A4JA 2LNKA 3PATA 2WCFA 1PULA 1XFUO 1S36A 1YR5A 5CSJA 1YUUA 4XJKA 4YGCB 3HX4A 4M2QA 1TCOB 1BMOA 3I5IB 2LMUA 2LP2A 3CTNA 3JVTB 3LK1A 4WQ3A 1YUSA 1M63B 1FI5A 2GV5A 4MRXA 2OS8B 1CFPA 1SR6B 2KI4C 3BYAA 1E8AA 2JOJA 1OMDA 2LANA 2EGDA 1J1EA 4MBEA 5IBWA 1NYAA 3EKJA 1QLSA 3PALA 1SNLA 1FBVA 4NDCA 2LE9B 1LVCD 1UWOA 2K7OA 3PSRA 2KQ6A 3VRNA 1LXFC 1JF0A 3EVVA 2D8NA 1BR4B 3O4YA 4XJKB 2JT8A 2BKHB 2DOQA 2M8UA 5JOLA 4PE0A 5I2LA 3PM8A 3NSIA 4XYNA 1A03A 2P6BB 4I5LB 1BJFA 1CDLA 1KSOA 1B47A 2JXLA 1XFWO 1CFDA 2M3WA 4GAOA 3TZ1A 3DD4A 2GGZA 3D10A 2TN4A 3EK4A 1SL9A 5GQQC 1PVAA 4F0ZB 5KU1A 2WCBA 1KWOB 4NDDA 1DT7B 1UHKA 2EHBA 1IKUA 2H2KA 1CB1A 2HF5A 2JNXA 4WRIA 2L5XB 1J7OA 2WC8A 3OHMB 3CGAA 1AJ4A 4NDBA 2ZRSA 5HLVA 2KFGA 4PHJA 1A4PA 2LLUA 4AQJA 1A29A 1OQPA 2KI6C 1MXLC 1OMVA 2K7CA 2IS9A 2SASA 3PN7C 4YGBB 1D1OA 4WQ2A 1B7TY 3HCMA 1TN4A 4P2YB 5G08A 1ZOTB 1B9AA 1LINA 1UHHA 2LVKA 3BUNB 1UP5A 1L7ZA 2LHIA 2MAZA 1EL4A 4Q04A 3PLFB 2KI4B 3WHTB 4PDZA 2LVVA 2O60A 2QACA 1A75B 4PCWA 1SW8A 2JTTA 3CR5X 1BG1A 4OVNF 2CCMA 3I5HC 4GBAA 2LP3A 5KTYA 1SL7A 5CPVA 1AK8A 3I5GC 2JULA 4ETOA 3E3RA 3IQOA 2OTGC 1TIZA 2Q91A 1SCMC 1WRLA 3TS5C 5I2OA 3EK8A 1QVIY 1K90D 1S6CA 1WDCC 2BKIB 3NXAA 3TUYB 2KQYA 2E30A 1ZUZA 1WY9A 3EVRA 4PE1A 1J7PA 2F33A 2KBIA 4ORAB 3NSOA 4N1FA 4UPGA 4BY4A 1YRTB 1NCYA 4GNKB 2LUXA 2WCEA 1UURA 2K7BA 2V53A 3MSEB 1TCFA 1ALWA 2LVIA 1DJWA 1C7WA 2KAYA 5TNCA 3KHEA 5D69A 1NPQA 5AANA 1YUTA 2MBXA 2AAOA 1BU3A 3WHUB 1GQMA 1EG3A 1EG4A 2ZFDA 3LL8B 4ZCVA 4GPLB 1DJZA 4MSPA 1TNWA 4QJ4B 4NQGA 3SG7A 3PN7B 1N65A 2EC6C 1F4QA 1SMGA 4HSZA 1EJ3A 2FCEA 4MZLA 2QPTA 1X02A 2L98A 5JJGA 1SCVA 1NX3A 2BL0C 1RFJA
chains in the Genus database with same CATH superfamily
4YGEB 2WNDA 1XVJA 1MHOA 3CABA 4GGNA 2WOSA 1CMGA 1N2DA 1M39A 1UHNA 1KK7Z 2PASA 2CBLA 5ER5A 3SS3A 3I5FC 5CSFA 3CZ2A 1PRWA 2B1UA 2MJWB 1TNQA 2LUCA 3VRPA 2FJUB 2JQ6A 2L50A 5FI2A 3GK1A 3SS5A 1CFFA 2PYQA 3CR2A 3I5HB 4M2OA 1L2OC 1IJ5A 3SS4A 1AP4A 1JFJA 1W9ZA 1KQMC 1TNXA 1ZMZA 1G33A 3I5GB 4I5NB 1CNPA 2QDIA 1XFYO 3TDUA 2OTGB 2WCHA 1GGWA 3KF9A 4HREE 1SCMB 3TS5B 3VROA 1IQ3A 1K9UA 1QVIZ 3DXLA 1WDCB 3IF7A 2CXJA 1QWVA 3AKAA 3ZNIA 2JRFA 2K2AA 1QX5B 2PSRA 4ORCB 1TRFA 1H8BA 4U8DA 1M31A 1J1DA 1DEKA 1B8CA 3UO9A 1BOCA 4JKTA 1ODBA 2O5GA 2VRGA 3DVMA 1R2UA 5HKYA 1QV0A 3A4UB 4ICBA 5AERA 1JSAA 5AXIA 3SG5A 2NZ0A 4ORBB 1DC1A 1OW4A 1ZFSA 1EXRA 1JUOA 4AOMA 4YI9A 4QJ5B 1H4BA 1R6PA 3K21A 3SG6A 2BCXA 3BUOB 2JPOA 5DKQA 2ZNEA 3S0BA 4INWA 2P71A 3KPXA 1XFVO 2EC6B 5PALA 3CS1A 4YGDB 1OOJA 1QS7A 3NHTA 1A75A 3VB1A 1IWQA 2RGIA 4YBHB 2BL0B 2KYFA 3R72A 2ZNDA 4PALA 3IVTA 1PVBA 2PMYA 1J7RA 4IJ7A 1CLBA 2MRDA 1KK8C 1XYDA 3S0GA 1GGZA 1K8UA 1TNPA 1TOPA 1U5IA 3FWCA 2JWWA 4HRHA 1YX7A 4C0JA 1CMFA 1IRJA 1SSEB 3VRRA 3I5FB 1TUZA 3LLEA 5FYXA 5HKWA 3GK4X 3BFBA 1J7QA 1KFXS 1W7IB 2KYCA 1L2OB 4CFQA 1KQMB 5I2QA 1DMOA 3AAJA 5FI7A 5K89A 4L9MA 1M46A 4CLNA 2F2PA 1HQVA 3D74A 1SY9A 3JTDC 3V2LA 3TDZA 2QEBA 1NX2A 4P5OE 1QIVA 2Y5IA 1KK7Y 4MN0A 2KDHA 2KLDA 1WRKA 4R1EA 3VRQA 1K95A 5J3XA 1FI6A 1K96A 1Q80A 2Y1MA 2ISDA 5HLOA 3FE6A 1DJYA 2KFFA 2L4HA 3A8RA 1LA3A 2NCOA 1U5IB 3SG3A 2H8VA 2ZRTA 1SKTA 1F70A 1CTRA 4JWQA 2FCDA 3O6BA 4PHMA 1QLKA 4F7FA 1RTP1 3LK0A 1OZOA 2L2EA 3QRXA 1F4OA 3EKHA 1B4CA 1NIWA 2G2BA 1DJHA 4GUKA 4KYNA 5DKNA 1F8HA 2HETA 3DF0A 4IL1A 2GGMA 5D3OA 1OOGA 2HQ8A 5HYDA 2ERBA 5F6TA 1UHIA 3I5IC 4C0LA 1IQ5A 4TNCA 2JPTA 3D76A 3JVTC 4FQTA 1MWNA 3F45A 1QASA 1K93D 1KFUS 3BFHA 1ZACA 1MQ1A 3GOFA 3KEVA 4OCIA 3SG4A 3WNXB 1B8LA 1JC2A 2JXCA 1AJ5A 1PSRA 4CFRA 4DS7A 1K2HA 1XK4C 2M49B 2ZN8A 1DTLA 1YRUB 2ZN9A 3UNWA 4YI8A 2LVJA 2LMVA 3S0EA 2M7LA 2KGBC 1KK8B 1NCXA 1PALA 2LLTA 2NXQA 3PJIA 1ALVA 2MA2A 4I5JA 1B8RA 4BY5A 4OR9B 3FWBA 1NX0A 1SPYA 1MXEA 3AAKA 2GTEA 1XA5A 2L4IA 5HKZA 3FS7A 1OE9B 3DF0B 1J55A 1RROA 1RK9A 1YURA 1C3YA 4MRYA 1N0YA 3EVUA 1CDPA 2BNXA 4YGAA 2L2CA 1MR8A 2M1KB 2I18A 2Q4UA 2E6WA 1DF0A 3JTDB 4E68A 1S5GY 3B88A 4ZCUA 1G8IA 3BOWA 2PVBA 1W7JB 1WRZA 3BXKA 4D1EA 2K2FA 4INXA 1CLMA 1KFXL 1RJVA 2LV7A 4MEWA 4PE7A 5BPJA 4PHKA 2JT3A 1T14A 3BUMB 3D75A 3PFVA 2MLFC 2I2RE 1BT6A 2KNEA 3B87A 1K9KA 2K7DA 1XK4A 2BBNA 2R2IA 1DJGA 5B8IB 2LC5A 3R1PA 2HQWA 4OZDA 1G4YR 1SK6D 1OMRA 3NSLA 2H61C 1JWDA 3FIAA 4N5XA 4DIRA 2JZIA 1QTXA 1NUBA 1OOIX 1SL8A 5KSZA 3H4SE 3O2PA 2F2OA 3SG2A 1DF0B 1KQVA 2WCLA 2I94A 2CTNA 4DUQA 1C07A 3BOWB 2WCJA 1NX1A 1QIWA 2BE4A 2L0PA 1KCYA 1CFCA 1DVIA 2BAPA 1FPWA 1IGVA 2BBMA 2WORA 2KAVA 1IH0A 3L4AA 2QEVA 2PQLA 2SCPA 1RECA 2AUCA 3BUWB 1ORGA 1XFXO 3C1VA 1MF8B 3AKBA 3CYZA 3CZ0A 4JPZB 1XO5A 4HRGA 4N1GA 1AHRA 5D7FA 1XFZO 1QJTA 1JFKA 3VGOA 1QV1A 1DJXA 2BCAA 3R1OA 3OB2B 5HL1A 1KFUL 2MHHA 4MVFA 2M29A 3K1EA 1F55A 2H61A 1Y6WA 4GFTA 2I7AA 2BCBA 1YVLA 2AMIA 1AUIB 1DGVA 2LM5A 2NLNA 3D0YA 1BF5A 2FOTA 3SIAA 1SYMA 2L51A 4FQOA 4PE4A 4A4CA 1C7VA 2F8PA 3O4XA 3TUYC 2G9BA 1S5GZ 1S3PA 3LCPC 3BQ3A 4FTGA 1UUSA 1WLZA 2KFHA 1A2XA 2FJYA 5ER4X 1GM0A 2M97A 4A4BA 1CDNA 2LAPA 3TDIA 3DVJA 1V1GA 4MZKA 1OOHA 4PHNA 4CIDA 1TTXA 1EH2A 1MUXA 2JT0A 3DVKA 1B1GA 3IQQA 4JQ0D 1YVHA 1QATA 1YTZC 4DCKA 1CDMA 3CZ1A 1JF2A 1FW4A 1KSMA 3D0YB 2JTZA 3D73A 1BODA 4GGFC 2M7NA 1F54A 5CSNA 1CKKA 3DYEA 2ZKMX 3CLNA 4AQIA 1CM1A 4JD9A 1Y1AA 2KGRA 1NWDA 2M1UA 3OB1B 1V1FA 4CPVA 2KI6D 1AVSA 4I5KA 5DICA 3EK7A 3FE8A 3B7AA 3FE9A 2LHLA 4DRWA 2WC5A 3OBVA 3OX5A 3O78A 5AEQA 3WXAA 3B6XA 1NSHA 2KBMA 3BJHA 1WLMA 2HPSA 1Y1UA 4YRUA 1NCZA 1SBJA 2K8MB 2BE6A 2OPOA 2F3YA 1FF1A 1F71A 5CSIA 2LLSA 1DGUA 1QX2A 4MLWA 3NSKA 1BR1B 2MLEC 4MZJA 2OS8C 1SR6C 1SRAA 1QX7A 1PSBA 3PM2A 1S6IA 2M9GA 3RM1A 4GGFA 2PRUA 3CZTX 1JBAA 1S6JA 4USLA 1IIOA 1OZSA 1CLLA 3SIBA 3DVEA 3SJSA 2QEOA 4QJ3B 1LA0A 3M0WA 2K0JA 2F3ZA 2JC2A 5I8NA 3GK2A 4PT1A 2KSPA 1LKJA 3NHIA 1DJIA 1Z2CB 5AFPA 1PK0D 2BECA 4OV2A 1BLQA 2KHNA 3S0FA 2PALA 2LCPA 2CNPA 2Y1NA 1NP8A 1YX8A 1CM4A 1S1EA 1Y1XA 3OP0A 3B86A 2LMTA 3CR4X 1K94A 2WC6A 1K9PA 1IJ6A 2JU0A 3ICBA 1QXPA 1IG5A 1M45A 2COLB 1B7TZ 2K60A 4M2PA 1VRKA 1KWOC 1DELA 2Y4QA 3OX6A 1Y0VH 1GJYA 4C0KA 1HT9A 5DKRA 2JNFA 3ZWHA 1UHJA 3D77A 2K61A 3CWGA 2M0RA 3RLZA 1DQEA 3DY9A 2KOTA 2KAXA 2NCPA 3QMEA 4OKHA 3BUXB 3KO0A 1RWYA 1OSAA 1S26D 2CT9A 2A4JA 2LNKA 3PATA 1Z4HA 2WCFA 1PULA 1XFUO 1S36A 1YR5A 5CSJA 1YUUA 4XJKA 4YGCB 3HX4A 4M2QA 1TCOB 1BMOA 3I5IB 3CDNA 2KLEA 2LMUA 2LP2A 3CTNA 3D78A 3JVTB 1YUSA 1M63B 3LK1A 2GV5A 4MRXA 4WQ3A 1FI5A 2OS8B 1CFPA 1SR6B 2KI4C 3BYAA 1E8AA 2JOJA 1OMDA 2LANA 2EGDA 1J1EA 3N7HA 1XFRA 4MBEA 3BFAA 5IBWA 1NYAA 3EKJA 1QLSA 3PALA 1SNLA 1FBVA 4NDCA 2LE9B 1LVCD 1UWOA 2K7OA 2L5YA 3PSRA 2KQ6A 3VRNA 1C3ZA 1TUJA 1LXFC 1JF0A 3EVVA 2D8NA 1BR4B 1LS8A 3O4YA 2JT8A 4XJKB 2BKHB 2DOQA 2M8UA 5JOLA 4PE0A 5I2LA 3PM8A 3NSIA 4XYNA 3Q8IA 1A03A 2P6BB 4I5LB 1BJFA 1CDLA 1KSOA 1B47A 2JXLA 1XFWO 1CFDA 2M3WA 4GAOA 3TZ1A 3S0AA 3DD4A 2GGZA 3D10A 2TN4A 3EK4A 1SL9A 5GQQC 1PVAA 4F0ZB 5KU1A 2WCBA 1KWOB 4NDDA 1DT7B 1UHKA 2EHBA 1IKUA 2H2KA 1CB1A 2YGUA 2HF5A 2JNXA 4WRIA 2L5XB 5EL2A 1J7OA 2WC8A 3OHMB 3CGAA 1AJ4A 4NDBA 2ZRSA 5HLVA 2KFGA 4PHJA 1A4PA 2LLUA 4AQJA 5FI6A 1A29A 1OQPA 2KI6C 3EG5B 1MXLC 1OMVA 2K7CA 2IS9A 2SASA 3L47A 3PN7C 4YGBB 4WQ2A 1B7TY 3S0DA 1D1OA 3HCMA 1TN4A 4P2YB 1P28A 5G08A 1ZOTB 1B9AA 1LINA 1UHHA 2LVKA 3BUNB 1UP5A 1TWOA 1L7ZA 2LHIA 3RZSA 2MAZA 1EL4A 4Q04A 3PLFB 2KI4B 3WHTB 4PDZA 2LVVA 2O60A 2QACA 1A75B 4PCWA 1SW8A 2JTTA 3CR5X 1OOFA 2QEHA 1BG1A 4OVNF 2CCMA 3I5HC 4GBAA 2LP3A 5KTYA 1SL7A 5CPVA 1AK8A 3I5GC 2JULA 4ETOA 3E3RA 3IQOA 2OTGC 1TIZA 2Q91A 3NGVA 1SCMC 1WRLA 3TS5C 3OGNA 2KPHA 5I2OA 3EK8A 1QVIY 1K90D 1S6CA 1WDCC 2BKIB 3NXAA 3TUYB 2KQYA 2E30A 1ZUZA 1WY9A 3EVRA 4PE1A 3DZTA 1J7PA 2F33A 2KBIA 4ORAB 3NSOA 4N1FA 4UPGA 4BY4A 1YRTB 1NCYA 4GNKB 2LUXA 2WCEA 1UURA 2K7BA 2V53A 3MSEB 1TCFA 2WCKA 1ALWA 2LVIA 1DJWA 1C7WA 2WCMA 2KAYA 3R1VA 5TNCA 3KHEA 5D69A 1NPQA 5AANA 1YUTA 2MBXA 2AAOA 1BU3A 5I94A 3WHUB 1GQMA 1EG3A 1EG4A 2ZFDA 3LL8B 4ZCVA 4GPLB 1DJZA 2P70A 3L4LA 1TNWA 4MSPA 4QJ4B 4NQGA 3SG7A 3PN7B 1N65A 2EC6C 1F4QA 1SMGA 4HSZA 1EJ3A 2FCEA 4MZLA 2QPTA 1X02A 2L98A 5JJGA 1SCVA 1NX3A 2BL0C 1RFJA
chains in the Genus database with same CATH topology
4YGEB 2WNDA 1XVJA 1MHOA 4GGNA 2WOSA 1CMGA 1N2DA 1M39A 1UHNA 1KK7Z 2PASA 2CBLA 5ER5A 3I5FC 5CSFA 1PRWA 2B1UA 2MJWB 1TNQA 2LUCA 3VRPA 2FJUB 2JQ6A 2L50A 3GK1A 1CFFA 4M2OA 3CR2A 3I5HB 1JFJA 1L2OC 1IJ5A 1AP4A 1KQMC 1TNXA 1ZMZA 1G33A 3I5GB 4I5NB 1CNPA 1XFYO 3TDUA 2OTGB 1GGWA 3KF9A 4HREE 1SCMB 3TS5B 3VROA 1IQ3A 1K9UA 1QVIZ 1WDCB 3IF7A 2CXJA 3AKAA 3ZNIA 2JRFA 2K2AA 1QX5B 2PSRA 4ORCB 1TRFA 1H8BA 4U8DA 1M31A 1J1DA 1B8CA 1BOCA 1ODBA 2O5GA 2VRGA 3DVMA 1R2UA 5HKYA 1QV0A 3A4UB 4ICBA 5AERA 1JSAA 5AXIA 3SG5A 2NZ0A 4ORBB 1ZFSA 1EXRA 1JUOA 4AOMA 4YI9A 4QJ5B 1H4BA 1R6PA 3K21A 3SG6A 2BCXA 3BUOB 5DKQA 2ZNEA 3KPXA 1XFVO 2EC6B 5PALA 3CS1A 4YGDB 1OOJA 1QS7A 1A75A 1IWQA 2RGIA 4YBHB 2BL0B 2KYFA 2ZNDA 4PALA 1PVBA 2PMYA 1J7RA 1CLBA 2MRDA 1KK8C 1XYDA 1GGZA 1K8UA 1TNPA 1TOPA 1U5IA 3FWCA 2JWWA 4HRHA 1YX7A 4C0JA 1IRJA 3VRRA 3I5FB 3LLEA 5FYXA 5HKWA 3GK4X 1J7QA 1KFXS 1W7IB 2KYCA 1L2OB 4CFQA 1KQMB 5I2QA 1DMOA 3AAJA 5K89A 4L9MA 1M46A 4CLNA 2F2PA 1HQVA 3JTDC 1SY9A 3TDZA 1NX2A 4P5OE 1QIVA 2Y5IA 1KK7Y 4MN0A 2KDHA 3VRQA 1WRKA 4R1EA 1K95A 5J3XA 1FI6A 1K96A 1Q80A 2Y1MA 2ISDA 5HLOA 1DJYA 2KFFA 2L4HA 3A8RA 1LA3A 2NCOA 1U5IB 3SG3A 2ZRTA 1SKTA 1F70A 1CTRA 4JWQA 2FCDA 3O6BA 4PHMA 1QLKA 1RTP1 3LK0A 1OZOA 2L2EA 3QRXA 1F4OA 3EKHA 1B4CA 1NIWA 2G2BA 1DJHA 4GUKA 5DKNA 1F8HA 2HETA 3DF0A 4IL1A 2GGMA 2HQ8A 5HYDA 5F6TA 1UHIA 3I5IC 4C0LA 1IQ5A 4TNCA 2JPTA 3JVTC 1MWNA 3F45A 1QASA 1K93D 1KFUS 3GOFA 1ZACA 1MQ1A 3KEVA 3SG4A 4OCIA 1CMFA 3WNXB 1B8LA 1JC2A 2JXCA 1AJ5A 1PSRA 4CFRA 4DS7A 1K2HA 1XK4C 2M49B 2ZN8A 1DTLA 1YRUB 2ZN9A 4YI8A 2LVJA 2LMVA 2M7LA 2KGBC 1KK8B 1NCXA 1PALA 2LLTA 2NXQA 1ALVA 2MA2A 4I5JA 1B8RA 4BY5A 4OR9B 3FWBA 1NX0A 1SPYA 1MXEA 3AAKA 1XA5A 2L4IA 5HKZA 3FS7A 1OE9B 3DF0B 1J55A 1RROA 1RK9A 1YURA 4MRYA 1N0YA 3EVUA 1CDPA 4YGAA 1MR8A 2M1KB 2I18A 2Q4UA 2E6WA 1DF0A 3JTDB 4E68A 1S5GY 4ZCUA 1G8IA 3BOWA 2PVBA 1W7JB 1WRZA 3BXKA 4D1EA 2K2FA 1CLMA 1KFXL 1RJVA 2LV7A 4MEWA 4PE7A 5BPJA 4PHKA 2JT3A 3BUMB 3PFVA 2MLFC 2I2RE 1BT6A 2KNEA 1K9KA 2K7DA 1XK4A 2BBNA 2R2IA 1DJGA 5B8IB 2LC5A 2HQWA 1G4YR 1SK6D 1OMRA 3NSLA 2H61C 1JWDA 3FIAA 4N5XA 4DIRA 2JZIA 1QTXA 1NUBA 5KSZA 1SL8A 3H4SE 3O2PA 2F2OA 3SG2A 1DF0B 1KQVA 1C07A 2I94A 2CTNA 4DUQA 3BOWB 1NX1A 1QIWA 2BE4A 2L0PA 1KCYA 1CFCA 1DVIA 1FPWA 1IGVA 2BBMA 2WORA 2KAVA 1IH0A 2SCPA 1RECA 2AUCA 3BUWB 1XFXO 3C1VA 1MF8B 3AKBA 4JPZB 1XO5A 4HRGA 4N1GA 1AHRA 5D7FA 1XFZO 1QJTA 1JFKA 3VGOA 1QV1A 1DJXA 2BCAA 3OB2B 1KFUL 2MHHA 4MVFA 2M29A 1F55A 2H61A 1Y6WA 4GFTA 2I7AA 2BCBA 1YVLA 2AMIA 1AUIB 1DGVA 2LM5A 2NLNA 3D0YA 1BF5A 2FOTA 3SIAA 1SYMA 2L51A 4FQOA 4PE4A 4A4CA 1C7VA 2F8PA 3TUYC 2G9BA 1S5GZ 1S3PA 3LCPC 3BQ3A 4FTGA 1UUSA 1WLZA 2KFHA 1A2XA 5ER4X 2M97A 4A4BA 1CDNA 2LAPA 3TDIA 3DVJA 1V1GA 4MZKA 4PHNA 4CIDA 1TTXA 1EH2A 1MUXA 2JT0A 3DVKA 1B1GA 3IQQA 4JQ0D 1YVHA 1QATA 1YTZC 4DCKA 1CDMA 1JF2A 1FW4A 1KSMA 3D0YB 2JTZA 1BODA 4GGFC 2M7NA 1F54A 5CSNA 1CKKA 2ZKMX 3CLNA 4AQIA 1CM1A 1Y1AA 2KGRA 1NWDA 2M1UA 3OB1B 1V1FA 4CPVA 2KI6D 1AVSA 4I5KA 3EK7A 2LHLA 4DRWA 5AEQA 3OX5A 3O78A 3WXAA 1NSHA 2KBMA 1WLMA 2HPSA 1Y1UA 4YRUA 1NCZA 1SBJA 2K8MB 2BE6A 2OPOA 2F3YA 1FF1A 1F71A 5CSIA 2LLSA 1DGUA 1QX2A 4MLWA 3NSKA 1BR1B 2MLEC 4MZJA 2OS8C 1SR6C 1SRAA 1QX7A 1PSBA 1S6IA 2M9GA 3RM1A 4GGFA 2PRUA 3CZTX 1JBAA 1S6JA 4USLA 1OZSA 1CLLA 3SIBA 3DVEA 3SJSA 4QJ3B 1LA0A 3M0WA 2K0JA 2F3ZA 2JC2A 5I8NA 3GK2A 2KSPA 1LKJA 1DJIA 5AFPA 1PK0D 2BECA 4OV2A 1BLQA 2KHNA 2PALA 2LCPA 2CNPA 2Y1NA 1NP8A 1YX8A 1CM4A 1S1EA 1Y1XA 3OP0A 2LMTA 3CR4X 1K94A 1K9PA 1IJ6A 2JU0A 3ICBA 1QXPA 1IG5A 1M45A 2COLB 1B7TZ 4M2PA 1VRKA 1KWOC 2Y4QA 3OX6A 1Y0VH 1GJYA 4C0KA 1HT9A 5DKRA 2JNFA 3ZWHA 1UHJA 2K61A 3CWGA 2M0RA 3RLZA 2KOTA 2KAXA 2NCPA 4OKHA 3BUXB 3KO0A 1RWYA 1OSAA 1S26D 2CT9A 2A4JA 2LNKA 3PATA 2WCFA 1PULA 1XFUO 1S36A 1YR5A 5CSJA 1YUUA 4XJKA 4YGCB 3HX4A 4M2QA 1TCOB 1BMOA 3I5IB 2LMUA 2LP2A 3CTNA 3JVTB 3LK1A 4WQ3A 1YUSA 1M63B 1FI5A 2GV5A 4MRXA 2OS8B 1CFPA 1SR6B 2KI4C 3BYAA 1E8AA 2JOJA 1OMDA 2LANA 2EGDA 1J1EA 4MBEA 5IBWA 1NYAA 3EKJA 1QLSA 3PALA 1SNLA 1FBVA 4NDCA 2LE9B 1LVCD 1UWOA 2K7OA 3PSRA 2KQ6A 3VRNA 1LXFC 1JF0A 3EVVA 2D8NA 1BR4B 3O4YA 4XJKB 2JT8A 2BKHB 2DOQA 2M8UA 5JOLA 4PE0A 5I2LA 3PM8A 3NSIA 4XYNA 1A03A 2P6BB 4I5LB 1BJFA 1CDLA 1KSOA 1B47A 2JXLA 1XFWO 1CFDA 2M3WA 4GAOA 3TZ1A 3DD4A 2GGZA 3D10A 2TN4A 3EK4A 1SL9A 5GQQC 1PVAA 4F0ZB 5KU1A 2WCBA 1KWOB 4NDDA 1DT7B 1UHKA 2EHBA 1IKUA 2H2KA 1CB1A 2HF5A 2JNXA 4WRIA 2L5XB 1J7OA 2WC8A 3OHMB 3CGAA 1AJ4A 4NDBA 2ZRSA 5HLVA 2KFGA 4PHJA 1A4PA 2LLUA 4AQJA 1A29A 1OQPA 2KI6C 1MXLC 1OMVA 2K7CA 2IS9A 2SASA 3PN7C 4YGBB 1D1OA 4WQ2A 1B7TY 3HCMA 1TN4A 4P2YB 5G08A 1ZOTB 1B9AA 1LINA 1UHHA 2LVKA 3BUNB 1UP5A 1L7ZA 2LHIA 2MAZA 1EL4A 4Q04A 3PLFB 2KI4B 3WHTB 4PDZA 2LVVA 2O60A 2QACA 1A75B 4PCWA 1SW8A 2JTTA 3CR5X 1BG1A 4OVNF 2CCMA 3I5HC 4GBAA 2LP3A 5KTYA 1SL7A 5CPVA 1AK8A 3I5GC 2JULA 4ETOA 3E3RA 3IQOA 2OTGC 1TIZA 2Q91A 1SCMC 1WRLA 3TS5C 5I2OA 3EK8A 1QVIY 1K90D 1S6CA 1WDCC 2BKIB 3NXAA 3TUYB 2KQYA 2E30A 1ZUZA 1WY9A 3EVRA 4PE1A 1J7PA 2F33A 2KBIA 4ORAB 3NSOA 4N1FA 4UPGA 4BY4A 1YRTB 1NCYA 4GNKB 2LUXA 2WCEA 1UURA 2K7BA 2V53A 3MSEB 1TCFA 1ALWA 2LVIA 1DJWA 1C7WA 2KAYA 5TNCA 3KHEA 5D69A 1NPQA 5AANA 1YUTA 2MBXA 2AAOA 1BU3A 3WHUB 1GQMA 1EG3A 1EG4A 2ZFDA 3LL8B 4ZCVA 4GPLB 1DJZA 4MSPA 1TNWA 4QJ4B 4NQGA 3SG7A 3PN7B 1N65A 2EC6C 1F4QA 1SMGA 4HSZA 1EJ3A 2FCEA 4MZLA 2QPTA 1X02A 2L98A 5JJGA 1SCVA 1NX3A 2BL0C 1RFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGE B;  2WND A;  1XVJ A;  1MHO A;  4GGN A;  2WOS A;  1CMG A;  1N2D A;  1M39 A;  1UHN A;  1KK7 Z;  2PAS A;  2CBL A;  5ER5 A;  3I5F C;  5CSF A;  1PRW A;  2B1U A;  2MJW B;  1TNQ A;  2LUC A;  3VRP A;  2FJU B;  2JQ6 A;  2L50 A;  3GK1 A;  1CFF A;  4M2O A;  3CR2 A;  3I5H B;  1JFJ A;  1L2O C;  1IJ5 A;  1AP4 A;  1KQM C;  1TNX A;  1ZMZ A;  1G33 A;  3I5G B;  4I5N B;  1CNP A;  1XFY O;  3TDU A;  2OTG B;  1GGW A;  3KF9 A;  4HRE E;  1SCM B;  3TS5 B;  3VRO A;  1IQ3 A;  1K9U A;  1QVI Z;  1WDC B;  3IF7 A;  2CXJ A;  3AKA A;  3ZNI A;  2JRF A;  2K2A A;  1QX5 B;  2PSR A;  4ORC B;  1TRF A;  1H8B A;  4U8D A;  1M31 A;  1J1D A;  1B8C A;  1BOC A;  1ODB A;  2O5G A;  2VRG A;  3DVM A;  1R2U A;  5HKY A;  1QV0 A;  3A4U B;  4ICB A;  5AER A;  1JSA A;  5AXI A;  3SG5 A;  2NZ0 A;  4ORB B;  1ZFS A;  1EXR A;  1JUO A;  4AOM A;  4YI9 A;  4QJ5 B;  1H4B A;  1R6P A;  3K21 A;  3SG6 A;  2BCX A;  3BUO B;  5DKQ A;  2ZNE A;  3KPX A;  1XFV O;  2EC6 B;  5PAL A;  3CS1 A;  4YGD B;  1OOJ A;  1QS7 A;  1A75 A;  1IWQ A;  2RGI A;  4YBH B;  2BL0 B;  2KYF A;  2ZND A;  4PAL A;  1PVB A;  2PMY A;  1J7R A;  1CLB A;  2MRD A;  1KK8 C;  1XYD A;  1GGZ A;  1K8U A;  1TNP A;  1TOP A;  1U5I A;  3FWC A;  2JWW A;  4HRH A;  1YX7 A;  4C0J A;  1IRJ A;  3VRR A;  3I5F B;  3LLE A;  5FYX A;  5HKW A;  3GK4 X;  1J7Q A;  1KFX S;  1W7I B;  2KYC A;  1L2O B;  4CFQ A;  1KQM B;  5I2Q A;  1DMO A;  3AAJ A;  5K89 A;  4L9M A;  1M46 A;  4CLN A;  2F2P A;  1HQV A;  3JTD C;  1SY9 A;  3TDZ A;  1NX2 A;  4P5O E;  1QIV A;  2Y5I A;  1KK7 Y;  4MN0 A;  2KDH A;  3VRQ A;  1WRK A;  4R1E A;  1K95 A;  5J3X A;  1FI6 A;  1K96 A;  1Q80 A;  2Y1M A;  2ISD A;  5HLO A;  1DJY A;  2KFF A;  2L4H A;  3A8R A;  1LA3 A;  2NCO A;  1U5I B;  3SG3 A;  2ZRT A;  1SKT A;  1F70 A;  1CTR A;  4JWQ A;  2FCD A;  3O6B A;  4PHM A;  1QLK A;  1RTP 1;  3LK0 A;  1OZO A;  2L2E A;  3QRX A;  1F4O A;  3EKH A;  1B4C A;  1NIW A;  2G2B A;  1DJH A;  4GUK A;  5DKN A;  1F8H A;  2HET A;  3DF0 A;  4IL1 A;  2GGM A;  2HQ8 A;  5HYD A;  5F6T A;  1UHI A;  3I5I C;  4C0L A;  1IQ5 A;  4TNC A;  2JPT A;  3JVT C;  1MWN A;  3F45 A;  1QAS A;  1K93 D;  1KFU S;  3GOF A;  1ZAC A;  1MQ1 A;  3KEV A;  3SG4 A;  4OCI A;  1CMF A;  3WNX B;  1B8L A;  1JC2 A;  2JXC A;  1AJ5 A;  1PSR A;  4CFR A;  4DS7 A;  1K2H A;  1XK4 C;  2M49 B;  2ZN8 A;  1DTL A;  1YRU B;  2ZN9 A;  4YI8 A;  2LVJ A;  2LMV A;  2M7L A;  2KGB C;  1KK8 B;  1NCX A;  1PAL A;  2LLT A;  2NXQ A;  1ALV A;  2MA2 A;  4I5J A;  1B8R A;  4BY5 A;  4OR9 B;  3FWB A;  1NX0 A;  1SPY A;  1MXE A;  3AAK A;  1XA5 A;  2L4I A;  5HKZ A;  3FS7 A;  1OE9 B;  3DF0 B;  1J55 A;  1RRO A;  1RK9 A;  1YUR A;  4MRY A;  1N0Y A;  3EVU A;  1CDP A;  4YGA A;  1MR8 A;  2M1K B;  2I18 A;  2Q4U A;  2E6W A;  1DF0 A;  3JTD B;  4E68 A;  1S5G Y;  4ZCU A;  1G8I A;  3BOW A;  2PVB A;  1W7J B;  1WRZ A;  3BXK A;  4D1E A;  2K2F A;  1CLM A;  1KFX L;  1RJV A;  2LV7 A;  4MEW A;  4PE7 A;  5BPJ A;  4PHK A;  2JT3 A;  3BUM B;  3PFV A;  2MLF C;  2I2R E;  1BT6 A;  2KNE A;  1K9K A;  2K7D A;  1XK4 A;  2BBN A;  2R2I A;  1DJG A;  5B8I B;  2LC5 A;  2HQW A;  1G4Y R;  1SK6 D;  1OMR A;  3NSL A;  2H61 C;  1JWD A;  3FIA A;  4N5X A;  4DIR A;  2JZI A;  1QTX A;  1NUB A;  5KSZ A;  1SL8 A;  3H4S E;  3O2P A;  2F2O A;  3SG2 A;  1DF0 B;  1KQV A;  1C07 A;  2I94 A;  2CTN A;  4DUQ A;  3BOW B;  1NX1 A;  1QIW A;  2BE4 A;  2L0P A;  1KCY A;  1CFC A;  1DVI A;  1FPW A;  1IGV A;  2BBM A;  2WOR A;  2KAV A;  1IH0 A;  2SCP A;  1REC A;  2AUC A;  3BUW B;  1XFX O;  3C1V A;  1MF8 B;  3AKB A;  4JPZ B;  1XO5 A;  4HRG A;  4N1G A;  1AHR A;  5D7F A;  1XFZ O;  1QJT A;  1JFK A;  3VGO A;  1QV1 A;  1DJX A;  2BCA A;  3OB2 B;  1KFU L;  2MHH A;  4MVF A;  2M29 A;  1F55 A;  2H61 A;  1Y6W A;  4GFT A;  2I7A A;  2BCB A;  1YVL A;  2AMI A;  1AUI B;  1DGV A;  2LM5 A;  2NLN A;  3D0Y A;  1BF5 A;  2FOT A;  3SIA A;  1SYM A;  2L51 A;  4FQO A;  4PE4 A;  4A4C A;  1C7V A;  2F8P A;  3TUY C;  2G9B A;  1S5G Z;  1S3P A;  3LCP C;  3BQ3 A;  4FTG A;  1UUS A;  1WLZ A;  2KFH A;  1A2X A;  5ER4 X;  2M97 A;  4A4B A;  1CDN A;  2LAP A;  3TDI A;  3DVJ A;  1V1G A;  4MZK A;  4PHN A;  4CID A;  1TTX A;  1EH2 A;  1MUX A;  2JT0 A;  3DVK A;  1B1G A;  3IQQ A;  4JQ0 D;  1YVH A;  1QAT A;  1YTZ C;  4DCK A;  1CDM A;  1JF2 A;  1FW4 A;  1KSM A;  3D0Y B;  2JTZ A;  1BOD A;  4GGF C;  2M7N A;  1F54 A;  5CSN A;  1CKK A;  2ZKM X;  3CLN A;  4AQI A;  1CM1 A;  1Y1A A;  2KGR A;  1NWD A;  2M1U A;  3OB1 B;  1V1F A;  4CPV A;  2KI6 D;  1AVS A;  4I5K A;  3EK7 A;  2LHL A;  4DRW A;  5AEQ A;  3OX5 A;  3O78 A;  3WXA A;  1NSH A;  2KBM A;  1WLM A;  2HPS A;  1Y1U A;  4YRU A;  1NCZ A;  1SBJ A;  2K8M B;  2BE6 A;  2OPO A;  2F3Y A;  1FF1 A;  1F71 A;  5CSI A;  2LLS A;  1DGU A;  1QX2 A;  4MLW A;  3NSK A;  1BR1 B;  2MLE C;  4MZJ A;  2OS8 C;  1SR6 C;  1SRA A;  1QX7 A;  1PSB A;  1S6I A;  2M9G A;  3RM1 A;  4GGF A;  2PRU A;  3CZT X;  1JBA A;  1S6J A;  4USL A;  1OZS A;  1CLL A;  3SIB A;  3DVE A;  3SJS A;  4QJ3 B;  1LA0 A;  3M0W A;  2K0J A;  2F3Z A;  2JC2 A;  5I8N A;  3GK2 A;  2KSP A;  1LKJ A;  1DJI A;  5AFP A;  1PK0 D;  2BEC A;  4OV2 A;  1BLQ A;  2KHN A;  2PAL A;  2LCP A;  2CNP A;  2Y1N A;  1NP8 A;  1YX8 A;  1CM4 A;  1S1E A;  1Y1X A;  3OP0 A;  2LMT A;  3CR4 X;  1K94 A;  1K9P A;  1IJ6 A;  2JU0 A;  3ICB A;  1QXP A;  1IG5 A;  1M45 A;  2COL B;  1B7T Z;  4M2P A;  1VRK A;  1KWO C;  2Y4Q A;  3OX6 A;  1Y0V H;  1GJY A;  4C0K A;  1HT9 A;  5DKR A;  2JNF A;  3ZWH A;  1UHJ A;  2K61 A;  3CWG A;  2M0R A;  3RLZ A;  2KOT A;  2KAX A;  2NCP A;  4OKH A;  3BUX B;  3KO0 A;  1RWY A;  1OSA A;  1S26 D;  2CT9 A;  2A4J A;  2LNK A;  3PAT A;  2WCF A;  1PUL A;  1XFU O;  1S36 A;  1YR5 A;  5CSJ A;  1YUU A;  4XJK A;  4YGC B;  3HX4 A;  4M2Q A;  1TCO B;  1BMO A;  3I5I B;  2LMU A;  2LP2 A;  3CTN A;  3JVT B;  3LK1 A;  4WQ3 A;  1YUS A;  1M63 B;  1FI5 A;  2GV5 A;  4MRX A;  2OS8 B;  1CFP A;  1SR6 B;  2KI4 C;  3BYA A;  1E8A A;  2JOJ A;  1OMD A;  2LAN A;  2EGD A;  1J1E A;  4MBE A;  5IBW A;  1NYA A;  3EKJ A;  1QLS A;  3PAL A;  1SNL A;  1FBV A;  4NDC A;  2LE9 B;  1LVC D;  1UWO A;  2K7O A;  3PSR A;  2KQ6 A;  3VRN A;  1LXF C;  1JF0 A;  3EVV A;  2D8N A;  1BR4 B;  3O4Y A;  4XJK B;  2JT8 A;  2BKH B;  2DOQ A;  2M8U A;  5JOL A;  4PE0 A;  5I2L A;  3PM8 A;  3NSI A;  4XYN A;  1A03 A;  2P6B B;  4I5L B;  1BJF A;  1CDL A;  1KSO A;  1B47 A;  2JXL A;  1XFW O;  1CFD A;  2M3W A;  4GAO A;  3TZ1 A;  3DD4 A;  2GGZ A;  3D10 A;  2TN4 A;  3EK4 A;  1SL9 A;  5GQQ C;  1PVA A;  4F0Z B;  5KU1 A;  2WCB A;  1KWO B;  4NDD A;  1DT7 B;  1UHK A;  2EHB A;  1IKU A;  2H2K A;  1CB1 A;  2HF5 A;  2JNX A;  4WRI A;  2L5X B;  1J7O A;  2WC8 A;  3OHM B;  3CGA A;  1AJ4 A;  4NDB A;  2ZRS A;  5HLV A;  2KFG A;  4PHJ A;  1A4P A;  2LLU A;  4AQJ A;  1A29 A;  1OQP A;  2KI6 C;  1MXL C;  1OMV A;  2K7C A;  2IS9 A;  2SAS A;  3PN7 C;  4YGB B;  1D1O A;  4WQ2 A;  1B7T Y;  3HCM A;  1TN4 A;  4P2Y B;  5G08 A;  1ZOT B;  1B9A A;  1LIN A;  1UHH A;  2LVK A;  3BUN B;  1UP5 A;  1L7Z A;  2LHI A;  2MAZ A;  1EL4 A;  4Q04 A;  3PLF B;  2KI4 B;  3WHT B;  4PDZ A;  2LVV A;  2O60 A;  2QAC A;  1A75 B;  4PCW A;  1SW8 A;  2JTT A;  3CR5 X;  1BG1 A;  4OVN F;  2CCM A;  3I5H C;  4GBA A;  2LP3 A;  5KTY A;  1SL7 A;  5CPV A;  1AK8 A;  3I5G C;  2JUL A;  4ETO A;  3E3R A;  3IQO A;  2OTG C;  1TIZ A;  2Q91 A;  1SCM C;  1WRL A;  3TS5 C;  5I2O A;  3EK8 A;  1QVI Y;  1K90 D;  1S6C A;  1WDC C;  2BKI B;  3NXA A;  3TUY B;  2KQY A;  2E30 A;  1ZUZ A;  1WY9 A;  3EVR A;  4PE1 A;  1J7P A;  2F33 A;  2KBI A;  4ORA B;  3NSO A;  4N1F A;  4UPG A;  4BY4 A;  1YRT B;  1NCY A;  4GNK B;  2LUX A;  2WCE A;  1UUR A;  2K7B A;  2V53 A;  3MSE B;  1TCF A;  1ALW A;  2LVI A;  1DJW A;  1C7W A;  2KAY A;  5TNC A;  3KHE A;  5D69 A;  1NPQ A;  5AAN A;  1YUT A;  2MBX A;  2AAO A;  1BU3 A;  3WHU B;  1GQM A;  1EG3 A;  1EG4 A;  2ZFD A;  3LL8 B;  4ZCV A;  4GPL B;  1DJZ A;  4MSP A;  1TNW A;  4QJ4 B;  4NQG A;  3SG7 A;  3PN7 B;  1N65 A;  2EC6 C;  1F4Q A;  1SMG A;  4HSZ A;  1EJ3 A;  2FCE A;  4MZL A;  2QPT A;  1X02 A;  2L98 A;  5JJG A;  1SCV A;  1NX3 A;  2BL0 C;  1RFJ A; 
#chains in the Genus database with same CATH topology
 4YGE B;  2WND A;  1XVJ A;  1MHO A;  3CAB A;  4GGN A;  2WOS A;  1CMG A;  1N2D A;  1M39 A;  1UHN A;  1KK7 Z;  2PAS A;  2CBL A;  5ER5 A;  3SS3 A;  3I5F C;  5CSF A;  3CZ2 A;  1PRW A;  2B1U A;  2MJW B;  1TNQ A;  2LUC A;  3VRP A;  2FJU B;  2JQ6 A;  2L50 A;  5FI2 A;  3GK1 A;  3SS5 A;  1CFF A;  2PYQ A;  3CR2 A;  3I5H B;  4M2O A;  1L2O C;  1IJ5 A;  3SS4 A;  1AP4 A;  1JFJ A;  1W9Z A;  1KQM C;  1TNX A;  1ZMZ A;  1G33 A;  3I5G B;  4I5N B;  1CNP A;  2QDI A;  1XFY O;  3TDU A;  2OTG B;  2WCH A;  1GGW A;  3KF9 A;  4HRE E;  1SCM B;  3TS5 B;  3VRO A;  1IQ3 A;  1K9U A;  1QVI Z;  3DXL A;  1WDC B;  3IF7 A;  2CXJ A;  1QWV A;  3AKA A;  3ZNI A;  2JRF A;  2K2A A;  1QX5 B;  2PSR A;  4ORC B;  1TRF A;  1H8B A;  4U8D A;  1M31 A;  1J1D A;  1DEK A;  1B8C A;  3UO9 A;  1BOC A;  4JKT A;  1ODB A;  2O5G A;  2VRG A;  3DVM A;  1R2U A;  5HKY A;  1QV0 A;  3A4U B;  4ICB A;  5AER A;  1JSA A;  5AXI A;  3SG5 A;  2NZ0 A;  4ORB B;  1DC1 A;  1OW4 A;  1ZFS A;  1EXR A;  1JUO A;  4AOM A;  4YI9 A;  4QJ5 B;  1H4B A;  1R6P A;  3K21 A;  3SG6 A;  2BCX A;  3BUO B;  2JPO A;  5DKQ A;  2ZNE A;  3S0B A;  4INW A;  2P71 A;  3KPX A;  1XFV O;  2EC6 B;  5PAL A;  3CS1 A;  4YGD B;  1OOJ A;  1QS7 A;  3NHT A;  1A75 A;  3VB1 A;  1IWQ A;  2RGI A;  4YBH B;  2BL0 B;  2KYF A;  3R72 A;  2ZND A;  4PAL A;  3IVT A;  1PVB A;  2PMY A;  1J7R A;  4IJ7 A;  1CLB A;  2MRD A;  1KK8 C;  1XYD A;  3S0G A;  1GGZ A;  1K8U A;  1TNP A;  1TOP A;  1U5I A;  3FWC A;  2JWW A;  4HRH A;  1YX7 A;  4C0J A;  1CMF A;  1IRJ A;  1SSE B;  3VRR A;  3I5F B;  1TUZ A;  3LLE A;  5FYX A;  5HKW A;  3GK4 X;  3BFB A;  1J7Q A;  1KFX S;  1W7I B;  2KYC A;  1L2O B;  4CFQ A;  1KQM B;  5I2Q A;  1DMO A;  3AAJ A;  5FI7 A;  5K89 A;  4L9M A;  1M46 A;  4CLN A;  2F2P A;  1HQV A;  3D74 A;  1SY9 A;  3JTD C;  3V2L A;  3TDZ A;  2QEB A;  1NX2 A;  4P5O E;  1QIV A;  2Y5I A;  1KK7 Y;  4MN0 A;  2KDH A;  2KLD A;  1WRK A;  4R1E A;  3VRQ A;  1K95 A;  5J3X A;  1FI6 A;  1K96 A;  1Q80 A;  2Y1M A;  2ISD A;  5HLO A;  3FE6 A;  1DJY A;  2KFF A;  2L4H A;  3A8R A;  1LA3 A;  2NCO A;  1U5I B;  3SG3 A;  2H8V A;  2ZRT A;  1SKT A;  1F70 A;  1CTR A;  4JWQ A;  2FCD A;  3O6B A;  4PHM A;  1QLK A;  4F7F A;  1RTP 1;  3LK0 A;  1OZO A;  2L2E A;  3QRX A;  1F4O A;  3EKH A;  1B4C A;  1NIW A;  2G2B A;  1DJH A;  4GUK A;  4KYN A;  5DKN A;  1F8H A;  2HET A;  3DF0 A;  4IL1 A;  2GGM A;  5D3O A;  1OOG A;  2HQ8 A;  5HYD A;  2ERB A;  5F6T A;  1UHI A;  3I5I C;  4C0L A;  1IQ5 A;  4TNC A;  2JPT A;  3D76 A;  3JVT C;  4FQT A;  1MWN A;  3F45 A;  1QAS A;  1K93 D;  1KFU S;  3BFH A;  1ZAC A;  1MQ1 A;  3GOF A;  3KEV A;  4OCI A;  3SG4 A;  3WNX B;  1B8L A;  1JC2 A;  2JXC A;  1AJ5 A;  1PSR A;  4CFR A;  4DS7 A;  1K2H A;  1XK4 C;  2M49 B;  2ZN8 A;  1DTL A;  1YRU B;  2ZN9 A;  3UNW A;  4YI8 A;  2LVJ A;  2LMV A;  3S0E A;  2M7L A;  2KGB C;  1KK8 B;  1NCX A;  1PAL A;  2LLT A;  2NXQ A;  3PJI A;  1ALV A;  2MA2 A;  4I5J A;  1B8R A;  4BY5 A;  4OR9 B;  3FWB A;  1NX0 A;  1SPY A;  1MXE A;  3AAK A;  2GTE A;  1XA5 A;  2L4I A;  5HKZ A;  3FS7 A;  1OE9 B;  3DF0 B;  1J55 A;  1RRO A;  1RK9 A;  1YUR A;  1C3Y A;  4MRY A;  1N0Y A;  3EVU A;  1CDP A;  2BNX A;  4YGA A;  2L2C A;  1MR8 A;  2M1K B;  2I18 A;  2Q4U A;  2E6W A;  1DF0 A;  3JTD B;  4E68 A;  1S5G Y;  3B88 A;  4ZCU A;  1G8I A;  3BOW A;  2PVB A;  1W7J B;  1WRZ A;  3BXK A;  4D1E A;  2K2F A;  4INX A;  1CLM A;  1KFX L;  1RJV A;  2LV7 A;  4MEW A;  4PE7 A;  5BPJ A;  4PHK A;  2JT3 A;  1T14 A;  3BUM B;  3D75 A;  3PFV A;  2MLF C;  2I2R E;  1BT6 A;  2KNE A;  3B87 A;  1K9K A;  2K7D A;  1XK4 A;  2BBN A;  2R2I A;  1DJG A;  5B8I B;  2LC5 A;  3R1P A;  2HQW A;  4OZD A;  1G4Y R;  1SK6 D;  1OMR A;  3NSL A;  2H61 C;  1JWD A;  3FIA A;  4N5X A;  4DIR A;  2JZI A;  1QTX A;  1NUB A;  1OOI X;  1SL8 A;  5KSZ A;  3H4S E;  3O2P A;  2F2O A;  3SG2 A;  1DF0 B;  1KQV A;  2WCL A;  2I94 A;  2CTN A;  4DUQ A;  1C07 A;  3BOW B;  2WCJ A;  1NX1 A;  1QIW A;  2BE4 A;  2L0P A;  1KCY A;  1CFC A;  1DVI A;  2BAP A;  1FPW A;  1IGV A;  2BBM A;  2WOR A;  2KAV A;  1IH0 A;  3L4A A;  2QEV A;  2PQL A;  2SCP A;  1REC A;  2AUC A;  3BUW B;  1ORG A;  1XFX O;  3C1V A;  1MF8 B;  3AKB A;  3CYZ A;  3CZ0 A;  4JPZ B;  1XO5 A;  4HRG A;  4N1G A;  1AHR A;  5D7F A;  1XFZ O;  1QJT A;  1JFK A;  3VGO A;  1QV1 A;  1DJX A;  2BCA A;  3R1O A;  3OB2 B;  5HL1 A;  1KFU L;  2MHH A;  4MVF A;  2M29 A;  3K1E A;  1F55 A;  2H61 A;  1Y6W A;  4GFT A;  2I7A A;  2BCB A;  1YVL A;  2AMI A;  1AUI B;  1DGV A;  2LM5 A;  2NLN A;  3D0Y A;  1BF5 A;  2FOT A;  3SIA A;  1SYM A;  2L51 A;  4FQO A;  4PE4 A;  4A4C A;  1C7V A;  2F8P A;  3O4X A;  3TUY C;  2G9B A;  1S5G Z;  1S3P A;  3LCP C;  3BQ3 A;  4FTG A;  1UUS A;  1WLZ A;  2KFH A;  1A2X A;  2FJY A;  5ER4 X;  1GM0 A;  2M97 A;  4A4B A;  1CDN A;  2LAP A;  3TDI A;  3DVJ A;  1V1G A;  4MZK A;  1OOH A;  4PHN A;  4CID A;  1TTX A;  1EH2 A;  1MUX A;  2JT0 A;  3DVK A;  1B1G A;  3IQQ A;  4JQ0 D;  1YVH A;  1QAT A;  1YTZ C;  4DCK A;  1CDM A;  3CZ1 A;  1JF2 A;  1FW4 A;  1KSM A;  3D0Y B;  2JTZ A;  3D73 A;  1BOD A;  4GGF C;  2M7N A;  1F54 A;  5CSN A;  1CKK A;  3DYE A;  2ZKM X;  3CLN A;  4AQI A;  1CM1 A;  4JD9 A;  1Y1A A;  2KGR A;  1NWD A;  2M1U A;  3OB1 B;  1V1F A;  4CPV A;  2KI6 D;  1AVS A;  4I5K A;  5DIC A;  3EK7 A;  3FE8 A;  3B7A A;  3FE9 A;  2LHL A;  4DRW A;  2WC5 A;  3OBV A;  3OX5 A;  3O78 A;  5AEQ A;  3WXA A;  3B6X A;  1NSH A;  2KBM A;  3BJH A;  1WLM A;  2HPS A;  1Y1U A;  4YRU A;  1NCZ A;  1SBJ A;  2K8M B;  2BE6 A;  2OPO A;  2F3Y A;  1FF1 A;  1F71 A;  5CSI A;  2LLS A;  1DGU A;  1QX2 A;  4MLW A;  3NSK A;  1BR1 B;  2MLE C;  4MZJ A;  2OS8 C;  1SR6 C;  1SRA A;  1QX7 A;  1PSB A;  3PM2 A;  1S6I A;  2M9G A;  3RM1 A;  4GGF A;  2PRU A;  3CZT X;  1JBA A;  1S6J A;  4USL A;  1IIO A;  1OZS A;  1CLL A;  3SIB A;  3DVE A;  3SJS A;  2QEO A;  4QJ3 B;  1LA0 A;  3M0W A;  2K0J A;  2F3Z A;  2JC2 A;  5I8N A;  3GK2 A;  4PT1 A;  2KSP A;  1LKJ A;  3NHI A;  1DJI A;  1Z2C B;  5AFP A;  1PK0 D;  2BEC A;  4OV2 A;  1BLQ A;  2KHN A;  3S0F A;  2PAL A;  2LCP A;  2CNP A;  2Y1N A;  1NP8 A;  1YX8 A;  1CM4 A;  1S1E A;  1Y1X A;  3OP0 A;  3B86 A;  2LMT A;  3CR4 X;  1K94 A;  2WC6 A;  1K9P A;  1IJ6 A;  2JU0 A;  3ICB A;  1QXP A;  1IG5 A;  1M45 A;  2COL B;  1B7T Z;  2K60 A;  4M2P A;  1VRK A;  1KWO C;  1DEL A;  2Y4Q A;  3OX6 A;  1Y0V H;  1GJY A;  4C0K A;  1HT9 A;  5DKR A;  2JNF A;  3ZWH A;  1UHJ A;  3D77 A;  2K61 A;  3CWG A;  2M0R A;  3RLZ A;  1DQE A;  3DY9 A;  2KOT A;  2KAX A;  2NCP A;  3QME A;  4OKH A;  3BUX B;  3KO0 A;  1RWY A;  1OSA A;  1S26 D;  2CT9 A;  2A4J A;  2LNK A;  3PAT A;  1Z4H A;  2WCF A;  1PUL A;  1XFU O;  1S36 A;  1YR5 A;  5CSJ A;  1YUU A;  4XJK A;  4YGC B;  3HX4 A;  4M2Q A;  1TCO B;  1BMO A;  3I5I B;  3CDN A;  2KLE A;  2LMU A;  2LP2 A;  3CTN A;  3D78 A;  3JVT B;  1YUS A;  1M63 B;  3LK1 A;  2GV5 A;  4MRX A;  4WQ3 A;  1FI5 A;  2OS8 B;  1CFP A;  1SR6 B;  2KI4 C;  3BYA A;  1E8A A;  2JOJ A;  1OMD A;  2LAN A;  2EGD A;  1J1E A;  3N7H A;  1XFR A;  4MBE A;  3BFA A;  5IBW A;  1NYA A;  3EKJ A;  1QLS A;  3PAL A;  1SNL A;  1FBV A;  4NDC A;  2LE9 B;  1LVC D;  1UWO A;  2K7O A;  2L5Y A;  3PSR A;  2KQ6 A;  3VRN A;  1C3Z A;  1TUJ A;  1LXF C;  1JF0 A;  3EVV A;  2D8N A;  1BR4 B;  1LS8 A;  3O4Y A;  2JT8 A;  4XJK B;  2BKH B;  2DOQ A;  2M8U A;  5JOL A;  4PE0 A;  5I2L A;  3PM8 A;  3NSI A;  4XYN A;  3Q8I A;  1A03 A;  2P6B B;  4I5L B;  1BJF A;  1CDL A;  1KSO A;  1B47 A;  2JXL A;  1XFW O;  1CFD A;  2M3W A;  4GAO A;  3TZ1 A;  3S0A A;  3DD4 A;  2GGZ A;  3D10 A;  2TN4 A;  3EK4 A;  1SL9 A;  5GQQ C;  1PVA A;  4F0Z B;  5KU1 A;  2WCB A;  1KWO B;  4NDD A;  1DT7 B;  1UHK A;  2EHB A;  1IKU A;  2H2K A;  1CB1 A;  2YGU A;  2HF5 A;  2JNX A;  4WRI A;  2L5X B;  5EL2 A;  1J7O A;  2WC8 A;  3OHM B;  3CGA A;  1AJ4 A;  4NDB A;  2ZRS A;  5HLV A;  2KFG A;  4PHJ A;  1A4P A;  2LLU A;  4AQJ A;  5FI6 A;  1A29 A;  1OQP A;  2KI6 C;  3EG5 B;  1MXL C;  1OMV A;  2K7C A;  2IS9 A;  2SAS A;  3L47 A;  3PN7 C;  4YGB B;  4WQ2 A;  1B7T Y;  3S0D A;  1D1O A;  3HCM A;  1TN4 A;  4P2Y B;  1P28 A;  5G08 A;  1ZOT B;  1B9A A;  1LIN A;  1UHH A;  2LVK A;  3BUN B;  1UP5 A;  1TWO A;  1L7Z A;  2LHI A;  3RZS A;  2MAZ A;  1EL4 A;  4Q04 A;  3PLF B;  2KI4 B;  3WHT B;  4PDZ A;  2LVV A;  2O60 A;  2QAC A;  1A75 B;  4PCW A;  1SW8 A;  2JTT A;  3CR5 X;  1OOF A;  2QEH A;  1BG1 A;  4OVN F;  2CCM A;  3I5H C;  4GBA A;  2LP3 A;  5KTY A;  1SL7 A;  5CPV A;  1AK8 A;  3I5G C;  2JUL A;  4ETO A;  3E3R A;  3IQO A;  2OTG C;  1TIZ A;  2Q91 A;  3NGV A;  1SCM C;  1WRL A;  3TS5 C;  3OGN A;  2KPH A;  5I2O A;  3EK8 A;  1QVI Y;  1K90 D;  1S6C A;  1WDC C;  2BKI B;  3NXA A;  3TUY B;  2KQY A;  2E30 A;  1ZUZ A;  1WY9 A;  3EVR A;  4PE1 A;  3DZT A;  1J7P A;  2F33 A;  2KBI A;  4ORA B;  3NSO A;  4N1F A;  4UPG A;  4BY4 A;  1YRT B;  1NCY A;  4GNK B;  2LUX A;  2WCE A;  1UUR A;  2K7B A;  2V53 A;  3MSE B;  1TCF A;  2WCK A;  1ALW A;  2LVI A;  1DJW A;  1C7W A;  2WCM A;  2KAY A;  3R1V A;  5TNC A;  3KHE A;  5D69 A;  1NPQ A;  5AAN A;  1YUT A;  2MBX A;  2AAO A;  1BU3 A;  5I94 A;  3WHU B;  1GQM A;  1EG3 A;  1EG4 A;  2ZFD A;  3LL8 B;  4ZCV A;  4GPL B;  1DJZ A;  2P70 A;  3L4L A;  1TNW A;  4MSP A;  4QJ4 B;  4NQG A;  3SG7 A;  3PN7 B;  1N65 A;  2EC6 C;  1F4Q A;  1SMG A;  4HSZ A;  1EJ3 A;  2FCE A;  4MZL A;  2QPT A;  1X02 A;  2L98 A;  5JJG A;  1SCV A;  1NX3 A;  2BL0 C;  1RFJ A; 
#chains in the Genus database with same CATH homology
 4YGE B;  2WND A;  1XVJ A;  1MHO A;  4GGN A;  2WOS A;  1CMG A;  1N2D A;  1M39 A;  1UHN A;  1KK7 Z;  2PAS A;  2CBL A;  5ER5 A;  3I5F C;  5CSF A;  1PRW A;  2B1U A;  2MJW B;  1TNQ A;  2LUC A;  3VRP A;  2FJU B;  2JQ6 A;  2L50 A;  3GK1 A;  1CFF A;  4M2O A;  3CR2 A;  3I5H B;  1JFJ A;  1L2O C;  1IJ5 A;  1AP4 A;  1KQM C;  1TNX A;  1ZMZ A;  1G33 A;  3I5G B;  4I5N B;  1CNP A;  1XFY O;  3TDU A;  2OTG B;  1GGW A;  3KF9 A;  4HRE E;  1SCM B;  3TS5 B;  3VRO A;  1IQ3 A;  1K9U A;  1QVI Z;  1WDC B;  3IF7 A;  2CXJ A;  3AKA A;  3ZNI A;  2JRF A;  2K2A A;  1QX5 B;  2PSR A;  4ORC B;  1TRF A;  1H8B A;  4U8D A;  1M31 A;  1J1D A;  1B8C A;  1BOC A;  1ODB A;  2O5G A;  2VRG A;  3DVM A;  1R2U A;  5HKY A;  1QV0 A;  3A4U B;  4ICB A;  5AER A;  1JSA A;  5AXI A;  3SG5 A;  2NZ0 A;  4ORB B;  1ZFS A;  1EXR A;  1JUO A;  4AOM A;  4YI9 A;  4QJ5 B;  1H4B A;  1R6P A;  3K21 A;  3SG6 A;  2BCX A;  3BUO B;  5DKQ A;  2ZNE A;  3KPX A;  1XFV O;  2EC6 B;  5PAL A;  3CS1 A;  4YGD B;  1OOJ A;  1QS7 A;  1A75 A;  1IWQ A;  2RGI A;  4YBH B;  2BL0 B;  2KYF A;  2ZND A;  4PAL A;  1PVB A;  2PMY A;  1J7R A;  1CLB A;  2MRD A;  1KK8 C;  1XYD A;  1GGZ A;  1K8U A;  1TNP A;  1TOP A;  1U5I A;  3FWC A;  2JWW A;  4HRH A;  1YX7 A;  4C0J A;  1IRJ A;  3VRR A;  3I5F B;  3LLE A;  5FYX A;  5HKW A;  3GK4 X;  1J7Q A;  1KFX S;  1W7I B;  2KYC A;  1L2O B;  4CFQ A;  1KQM B;  5I2Q A;  1DMO A;  3AAJ A;  5K89 A;  4L9M A;  1M46 A;  4CLN A;  2F2P A;  1HQV A;  3JTD C;  1SY9 A;  3TDZ A;  1NX2 A;  4P5O E;  1QIV A;  2Y5I A;  1KK7 Y;  4MN0 A;  2KDH A;  3VRQ A;  1WRK A;  4R1E A;  1K95 A;  5J3X A;  1FI6 A;  1K96 A;  1Q80 A;  2Y1M A;  2ISD A;  5HLO A;  1DJY A;  2KFF A;  2L4H A;  3A8R A;  1LA3 A;  2NCO A;  1U5I B;  3SG3 A;  2ZRT A;  1SKT A;  1F70 A;  1CTR A;  4JWQ A;  2FCD A;  3O6B A;  4PHM A;  1QLK A;  1RTP 1;  3LK0 A;  1OZO A;  2L2E A;  3QRX A;  1F4O A;  3EKH A;  1B4C A;  1NIW A;  2G2B A;  1DJH A;  4GUK A;  5DKN A;  1F8H A;  2HET A;  3DF0 A;  4IL1 A;  2GGM A;  2HQ8 A;  5HYD A;  5F6T A;  1UHI A;  3I5I C;  4C0L A;  1IQ5 A;  4TNC A;  2JPT A;  3JVT C;  1MWN A;  3F45 A;  1QAS A;  1K93 D;  1KFU S;  3GOF A;  1ZAC A;  1MQ1 A;  3KEV A;  3SG4 A;  4OCI A;  1CMF A;  3WNX B;  1B8L A;  1JC2 A;  2JXC A;  1AJ5 A;  1PSR A;  4CFR A;  4DS7 A;  1K2H A;  1XK4 C;  2M49 B;  2ZN8 A;  1DTL A;  1YRU B;  2ZN9 A;  4YI8 A;  2LVJ A;  2LMV A;  2M7L A;  2KGB C;  1KK8 B;  1NCX A;  1PAL A;  2LLT A;  2NXQ A;  1ALV A;  2MA2 A;  4I5J A;  1B8R A;  4BY5 A;  4OR9 B;  3FWB A;  1NX0 A;  1SPY A;  1MXE A;  3AAK A;  1XA5 A;  2L4I A;  5HKZ A;  3FS7 A;  1OE9 B;  3DF0 B;  1J55 A;  1RRO A;  1RK9 A;  1YUR A;  4MRY A;  1N0Y A;  3EVU A;  1CDP A;  4YGA A;  1MR8 A;  2M1K B;  2I18 A;  2Q4U A;  2E6W A;  1DF0 A;  3JTD B;  4E68 A;  1S5G Y;  4ZCU A;  1G8I A;  3BOW A;  2PVB A;  1W7J B;  1WRZ A;  3BXK A;  4D1E A;  2K2F A;  1CLM A;  1KFX L;  1RJV A;  2LV7 A;  4MEW A;  4PE7 A;  5BPJ A;  4PHK A;  2JT3 A;  3BUM B;  3PFV A;  2MLF C;  2I2R E;  1BT6 A;  2KNE A;  1K9K A;  2K7D A;  1XK4 A;  2BBN A;  2R2I A;  1DJG A;  5B8I B;  2LC5 A;  2HQW A;  1G4Y R;  1SK6 D;  1OMR A;  3NSL A;  2H61 C;  1JWD A;  3FIA A;  4N5X A;  4DIR A;  2JZI A;  1QTX A;  1NUB A;  5KSZ A;  1SL8 A;  3H4S E;  3O2P A;  2F2O A;  3SG2 A;  1DF0 B;  1KQV A;  1C07 A;  2I94 A;  2CTN A;  4DUQ A;  3BOW B;  1NX1 A;  1QIW A;  2BE4 A;  2L0P A;  1KCY A;  1CFC A;  1DVI A;  1FPW A;  1IGV A;  2BBM A;  2WOR A;  2KAV A;  1IH0 A;  2SCP A;  1REC A;  2AUC A;  3BUW B;  1XFX O;  3C1V A;  1MF8 B;  3AKB A;  4JPZ B;  1XO5 A;  4HRG A;  4N1G A;  1AHR A;  5D7F A;  1XFZ O;  1QJT A;  1JFK A;  3VGO A;  1QV1 A;  1DJX A;  2BCA A;  3OB2 B;  1KFU L;  2MHH A;  4MVF A;  2M29 A;  1F55 A;  2H61 A;  1Y6W A;  4GFT A;  2I7A A;  2BCB A;  1YVL A;  2AMI A;  1AUI B;  1DGV A;  2LM5 A;  2NLN A;  3D0Y A;  1BF5 A;  2FOT A;  3SIA A;  1SYM A;  2L51 A;  4FQO A;  4PE4 A;  4A4C A;  1C7V A;  2F8P A;  3TUY C;  2G9B A;  1S5G Z;  1S3P A;  3LCP C;  3BQ3 A;  4FTG A;  1UUS A;  1WLZ A;  2KFH A;  1A2X A;  5ER4 X;  2M97 A;  4A4B A;  1CDN A;  2LAP A;  3TDI A;  3DVJ A;  1V1G A;  4MZK A;  4PHN A;  4CID A;  1TTX A;  1EH2 A;  1MUX A;  2JT0 A;  3DVK A;  1B1G A;  3IQQ A;  4JQ0 D;  1YVH A;  1QAT A;  1YTZ C;  4DCK A;  1CDM A;  1JF2 A;  1FW4 A;  1KSM A;  3D0Y B;  2JTZ A;  1BOD A;  4GGF C;  2M7N A;  1F54 A;  5CSN A;  1CKK A;  2ZKM X;  3CLN A;  4AQI A;  1CM1 A;  1Y1A A;  2KGR A;  1NWD A;  2M1U A;  3OB1 B;  1V1F A;  4CPV A;  2KI6 D;  1AVS A;  4I5K A;  3EK7 A;  2LHL A;  4DRW A;  5AEQ A;  3OX5 A;  3O78 A;  3WXA A;  1NSH A;  2KBM A;  1WLM A;  2HPS A;  1Y1U A;  4YRU A;  1NCZ A;  1SBJ A;  2K8M B;  2BE6 A;  2OPO A;  2F3Y A;  1FF1 A;  1F71 A;  5CSI A;  2LLS A;  1DGU A;  1QX2 A;  4MLW A;  3NSK A;  1BR1 B;  2MLE C;  4MZJ A;  2OS8 C;  1SR6 C;  1SRA A;  1QX7 A;  1PSB A;  1S6I A;  2M9G A;  3RM1 A;  4GGF A;  2PRU A;  3CZT X;  1JBA A;  1S6J A;  4USL A;  1OZS A;  1CLL A;  3SIB A;  3DVE A;  3SJS A;  4QJ3 B;  1LA0 A;  3M0W A;  2K0J A;  2F3Z A;  2JC2 A;  5I8N A;  3GK2 A;  2KSP A;  1LKJ A;  1DJI A;  5AFP A;  1PK0 D;  2BEC A;  4OV2 A;  1BLQ A;  2KHN A;  2PAL A;  2LCP A;  2CNP A;  2Y1N A;  1NP8 A;  1YX8 A;  1CM4 A;  1S1E A;  1Y1X A;  3OP0 A;  2LMT A;  3CR4 X;  1K94 A;  1K9P A;  1IJ6 A;  2JU0 A;  3ICB A;  1QXP A;  1IG5 A;  1M45 A;  2COL B;  1B7T Z;  4M2P A;  1VRK A;  1KWO C;  2Y4Q A;  3OX6 A;  1Y0V H;  1GJY A;  4C0K A;  1HT9 A;  5DKR A;  2JNF A;  3ZWH A;  1UHJ A;  2K61 A;  3CWG A;  2M0R A;  3RLZ A;  2KOT A;  2KAX A;  2NCP A;  4OKH A;  3BUX B;  3KO0 A;  1RWY A;  1OSA A;  1S26 D;  2CT9 A;  2A4J A;  2LNK A;  3PAT A;  2WCF A;  1PUL A;  1XFU O;  1S36 A;  1YR5 A;  5CSJ A;  1YUU A;  4XJK A;  4YGC B;  3HX4 A;  4M2Q A;  1TCO B;  1BMO A;  3I5I B;  2LMU A;  2LP2 A;  3CTN A;  3JVT B;  3LK1 A;  4WQ3 A;  1YUS A;  1M63 B;  1FI5 A;  2GV5 A;  4MRX A;  2OS8 B;  1CFP A;  1SR6 B;  2KI4 C;  3BYA A;  1E8A A;  2JOJ A;  1OMD A;  2LAN A;  2EGD A;  1J1E A;  4MBE A;  5IBW A;  1NYA A;  3EKJ A;  1QLS A;  3PAL A;  1SNL A;  1FBV A;  4NDC A;  2LE9 B;  1LVC D;  1UWO A;  2K7O A;  3PSR A;  2KQ6 A;  3VRN A;  1LXF C;  1JF0 A;  3EVV A;  2D8N A;  1BR4 B;  3O4Y A;  4XJK B;  2JT8 A;  2BKH B;  2DOQ A;  2M8U A;  5JOL A;  4PE0 A;  5I2L A;  3PM8 A;  3NSI A;  4XYN A;  1A03 A;  2P6B B;  4I5L B;  1BJF A;  1CDL A;  1KSO A;  1B47 A;  2JXL A;  1XFW O;  1CFD A;  2M3W A;  4GAO A;  3TZ1 A;  3DD4 A;  2GGZ A;  3D10 A;  2TN4 A;  3EK4 A;  1SL9 A;  5GQQ C;  1PVA A;  4F0Z B;  5KU1 A;  2WCB A;  1KWO B;  4NDD A;  1DT7 B;  1UHK A;  2EHB A;  1IKU A;  2H2K A;  1CB1 A;  2HF5 A;  2JNX A;  4WRI A;  2L5X B;  1J7O A;  2WC8 A;  3OHM B;  3CGA A;  1AJ4 A;  4NDB A;  2ZRS A;  5HLV A;  2KFG A;  4PHJ A;  1A4P A;  2LLU A;  4AQJ A;  1A29 A;  1OQP A;  2KI6 C;  1MXL C;  1OMV A;  2K7C A;  2IS9 A;  2SAS A;  3PN7 C;  4YGB B;  1D1O A;  4WQ2 A;  1B7T Y;  3HCM A;  1TN4 A;  4P2Y B;  5G08 A;  1ZOT B;  1B9A A;  1LIN A;  1UHH A;  2LVK A;  3BUN B;  1UP5 A;  1L7Z A;  2LHI A;  2MAZ A;  1EL4 A;  4Q04 A;  3PLF B;  2KI4 B;  3WHT B;  4PDZ A;  2LVV A;  2O60 A;  2QAC A;  1A75 B;  4PCW A;  1SW8 A;  2JTT A;  3CR5 X;  1BG1 A;  4OVN F;  2CCM A;  3I5H C;  4GBA A;  2LP3 A;  5KTY A;  1SL7 A;  5CPV A;  1AK8 A;  3I5G C;  2JUL A;  4ETO A;  3E3R A;  3IQO A;  2OTG C;  1TIZ A;  2Q91 A;  1SCM C;  1WRL A;  3TS5 C;  5I2O A;  3EK8 A;  1QVI Y;  1K90 D;  1S6C A;  1WDC C;  2BKI B;  3NXA A;  3TUY B;  2KQY A;  2E30 A;  1ZUZ A;  1WY9 A;  3EVR A;  4PE1 A;  1J7P A;  2F33 A;  2KBI A;  4ORA B;  3NSO A;  4N1F A;  4UPG A;  4BY4 A;  1YRT B;  1NCY A;  4GNK B;  2LUX A;  2WCE A;  1UUR A;  2K7B A;  2V53 A;  3MSE B;  1TCF A;  1ALW A;  2LVI A;  1DJW A;  1C7W A;  2KAY A;  5TNC A;  3KHE A;  5D69 A;  1NPQ A;  5AAN A;  1YUT A;  2MBX A;  2AAO A;  1BU3 A;  3WHU B;  1GQM A;  1EG3 A;  1EG4 A;  2ZFD A;  3LL8 B;  4ZCV A;  4GPL B;  1DJZ A;  4MSP A;  1TNW A;  4QJ4 B;  4NQG A;  3SG7 A;  3PN7 B;  1N65 A;  2EC6 C;  1F4Q A;  1SMG A;  4HSZ A;  1EJ3 A;  2FCE A;  4MZL A;  2QPT A;  1X02 A;  2L98 A;  5JJG A;  1SCV A;  1NX3 A;  2BL0 C;  1RFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...