3CTNA

Structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
KDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ctnA00
2D8NA 1L2OB 1PULA 3LK1A 3TS5B 3NSIA 4M2OA 4YGCB 1R6PA 3JVTB 1NWDA 1F71A 3WNXB 3BYAA 1JWDA 1L2OC 4JPZB 3FWCA 4MSPA 4DRWA 3TS5C 4DIRA 3JVTC 5CSFA 4OR9B 2FCDA 2LC5A 3NSKA 1CDMA 1J1EA 1ODBA 1HT9A 2KNEA 1DF0A 2I94A 3JTDB 4PHMA 4BY4A 2PVBA 1S26D 3SG2A 3CZTX 2M7NA 1YRUB 2MRDA 1QATA 1BR1B 4ZCUA 4CFQA 1JF0A 5FYXA 2LMUA 1TRFA 1SKTA 2TN4A 4ORCB 4USLA 4C0JA 1QIWA 1KQMB 1NIWA 2KYFA 5AFPA 1LKJA 1EH2A 1XYDA 4N1GA 4JQ0D 2F3YA 4AOMA 1KQMC 1QJTA 5AANA 2K7OA 1TN4A 1JSAA 2KHNA 4ORAB 1FF1A 2V53A 1YURA 1A03A 1OMVA 1DVIA 4PDZA 2LLUA 3VROA 1J1DA 2LVKA 1CDNA 2Y1MA 1IQ3A 1XFVO 3DD4A 1AVSA 2Y1NA 3SIBA 4DCKA 5HYDA 1OMDA 1J55A 3PM8A 2JT8A 1GJYA 2MHHA 3CGAA 1IQ5A 5AERA 3BUXB 4AQJA 2L0PA 2PMYA 2ZKMX 2P6BB 1BMOA 1NX3A 2PALA 1OZOA 1IWQA 1S5GY 2F3ZA 4DS7A 1ZUZA 2K0JA 1NCYA 3CTNA 3I5GB 1FBVA 1K93D 2KI6C 3BUMB 1MR8A 1XVJA 3PALA 5DKNA 1B47A 2LMVA 2CXJA 1WLMA 3I5GC 4XJKA 1FW4A 1V1FA 1S6CA 2KFHA 2QACA 2ISDA 1YX7A 2NCPA 2WNDA 2WORA 4ORBB 1CNPA 5DKQA 4XJKB 1A29A 4YBHB 1YR5A 1BJFA 5F6TA 2LVVA 5JJGA 3EVRA 5JOLA 2MA2A 1TNQA 2MLEC 1KCYA 1QLKA 4GNKB 4OVNF 5I2LA 2WCBA 2GV5A 1ZACA 5KTYA 2L4IA 3CWGA 4GAOA 4NQGA 1WY9A 1Q80A 1YVLA 4C0KA 1G33A 2LUXA 1K96A 2ZN8A 3E3RA 1MWNA 3CR4X 3NSLA 1SL9A 2KFFA 1DJIA 4PE7A 1F54A 1U5IA 4UPGA 2JULA 1N0YA 1OSAA 3O2PA 1LXFC 1CFFA 2R2IA 1IKUA 1TCOB 4YGDB 3EK4A 1TIZA 4I5KA 3M0WA 3TDIA 1DJXA 2OS8B 1U5IB 3KHEA 4NDCA 5HKZA 1CMFA 2O5GA 4MN0A 2KBMA 2JNXA 2OS8C 1OOJA 1MHOA 4I5LB 1XFYO 1QVIY 3BOWA 1BOCA 1J7OA 1CFPA 1RECA 1RJVA 1S5GZ 1UHNA 2M3WA 4QJ3B 1NPQA 4PE0A 1K2HA 2K2AA 1WRLA 2L2EA 1RWYA 2MBXA 2L98A 1NP8A 1XFZO 3BOWB 3BQ3A 4TNCA 1YRTB 1CFCA 2JTTA 2LHLA 1GGZA 2BCBA 1QX2A 2A4JA 1F4OA 1NX2A 4JWQA 2MAZA 4MRXA 1WRZA 1A75B 2HPSA 4CPVA 3D10A 1DJWA 1PVAA 2LE9B 1CM4A 5D7FA 2WOSA 1ALVA 1YTZC 1YVHA 1KFXL 2KGRA 2KI6D 3LL8B 2G9BA 2L50A 1YUSA 2NXQA 1JC2A 1M45A 2AMIA 2MLFC 1QV0A 2O60A 3EK8A 1JFJA 1CB1A 1LA3A 1K9PA 1N65A 1QX5B 2KOTA 2KQYA 1OMRA 2NZ0A 3O6BA 3SG5A 2ZN9A 1SBJA 4MZJA 1AP4A 1J7RA 5ER4X 2BKIB 4GBAA 2BCAA 1B8RA 1QV1A 1LINA 3VRPA 1IRJA 1QIVA 2KYCA 3EKJA 2L5XB 2M1UA 2M29A 3A8RA 3IQQA 2M7LA 1BG1A 3DVJA 4D1EA 5HKWA 4P5OE 2JT0A 3TDZA 1XO5A 3VRRA 1SK6D 3KEVA 1DGVA 1MXLC 3D0YB 2Q4UA 2LNKA 1X02A 2KAXA 1UWOA 1BF5A 2EHBA 1PALA 2BKHB 2M0RA 2WCFA 1S6JA 2KBIA 3DVMA 4R1EA 2FOTA 1KFUS 2H61A 2BE6A 1RROA 1QVIZ 1B4CA 1MXEA 1EXRA 2LLSA 4CLNA 1BU3A 2I7AA 2G2BA 1N2DA 2M9GA 1XFWO 1UUSA 2GGZA 2BBMA 1LA0A 2QPTA 2IS9A 4OV2A 4PE1A 3LCPC 3WXAA 2FCEA 4QJ4B 1DMOA 3EVVA 1S36A 2H61C 4NDDA 1AJ4A 3KO0A 1IH0A 2OPOA 3NSOA 1BR4B 4HSZA 1XK4A 1OZSA 3IQOA 3DVKA 4U8DA 2KI4B 3OX5A 1M63B 1CDPA 2LV7A 1SR6B 4YRUA 1RFJA 1UHKA 2KI4C 3WHUB 1RK9A 2K7CA 1SCVA 1CM1A 2KAVA 1R2UA 1DJHA 1SR6C 4M2PA 3SIAA 1XK4C 4YGBB 1UHJA 2LVIA 3AAJA 1XFUO 1TNPA 1L7ZA 2K61A 4NDBA 1BODA 5CSNA 5I8NA 1C7VA 1QX7A 3I5HB 5GQQC 3GK1A 4AQIA 5BPJA 5AEQA 3C1VA 1D1OA 1DGUA 1S3PA 1TOPA 3I5HC 2CTNA 1H8BA 2ZNEA 4ICBA 2KQ6A 2BBNA 2EC6C 1NX1A 1M46A 3AAKA 2SCPA 4MZKA 1DJGA 2CBLA 1CFDA 4MZLA 2MJWB 4PCWA 4I5NB 1SNLA 4GPLB 2LANA 3EKHA 1KK8B 1F8HA 2F33A 1A2XA 1SCMB 2EGDA 1FI6A 3NXAA 2LAPA 3AKAA 4N1FA 1KK8C 1SCMC 1EG3A 3PLFB 1DT7B 3GK4X 1EL4A 3KF9A 3BUNB 4PHJA 3EVUA 2KFGA 3DF0A 1BLQA 2LCPA 4WQ2A 5ER5A 1JBAA 1OE9B 3TDUA 3HX4A 3A4UB 2JQ6A 1QXPA 1G4YR 2I18A 1A75A 3DF0B 1WRKA 1JF2A 1KQVA 1GGWA 4MRYA 5CSJA 2KGBC 3OP0A 3SJSA 3LK0A 3BXKA 1B1GA 1DJYA 2JTZA 3FS7A 1PSRA 2HF5A 4ZCVA 3ICBA 5HKYA 1Y0VH 3KPXA 1K9UA 2BCXA 3GK2A 2JNFA 2LVJA 4DUQA 2Y4QA 1TNWA 1NUBA 1S1EA 4HRHA 2DOQA 3I5IB 1YUUA 5I2QA 2JOJA 2B1UA 3TZ1A 1RTP1 3I5IC 4QJ5B 2SASA 1KWOB 5K89A 1SL8A 3CR5X 2F2PA 1KSOA 1KWOC 4HRGA 3AKBA 2LMTA 3O4YA 1UHHA 3TUYB 2CNPA 2JRFA 2H2KA 3PSRA 3D0YA 3HCMA 2FJUB 4GFTA 1KFUL 1K90D 2JXLA 2LM5A 4GGFA 3TUYC 4MEWA 1IGVA 1JFKA 3ZWHA 2HQWA 3ZNIA 1SY9A 1CTRA 2F8PA 2WCEA 4YGAA 1J7QA 3FIAA 3VRQA 3BUOB 5KSZA 2LHIA 3RLZA 1SW8A 1DJZA 1JUOA 1KFXS 2KDHA 3BUWB 1PVBA 4IL1A 4GGFC 3JTDC 1XFXO 4BY5A 1CMGA 2JC2A 1DF0B 4XYNA 5PALA 5B8IB 5CSIA 1S6IA 2LLTA 3SG7A 2F2OA 1NSHA 1QASA 3MSEB 4PHKA 2K2FA 4CFRA 4GGNA 1IJ5A 2KAYA 2NCOA 4PALA 4WQ3A 3PATA 1M31A 1V1GA 2I2RE 2PASA 2ZFDA 5AXIA 1NCZA 4L9MA 1MF8B 1DTLA 3CS1A 1ZFSA 1Y6WA 4FQOA 2CCMA 1NX0A 3PFVA 1E8AA 3OB2B 1B8CA 1YX8A 4PE4A 1CLMA 2K7BA 2PRUA 1WDCB 1AUIB 1Y1UA 2ZRTA 2JU0A 1BT6A 5HLOA 2BECA 1NYAA 3DVEA 4FTGA 3GOFA 4WRIA 2GGMA 1WDCC 1H4BA 3F45A 4CIDA 1B7TY 3LLEA 1KK7Y 3I5FB 1W7JB 4YI8A 3IF7A 1F70A 2JZIA 3VGOA 3QRXA 3SG3A 1CLBA 3I5FC 4I5JA 1MUXA 2EC6B 3CLNA 2PSRA 2NLNA 1UP5A 1CDLA 2LP2A 1TCFA 5TNCA 3OX6A 1J7PA 1IG5A 1TTXA 3OHMB 1K95A 1FI5A 1AHRA 2WC8A 5D69A 3O78A 2AUCA 2BE4A 2HQ8A 2JXCA 1AJ5A 2M49B 1PRWA 1EJ3A 3OB1B 1SMGA 4MVFA 1KSMA 3SG4A 1UHIA 2Q91A 1SPYA 3SG6A 4GUKA 1F4QA 2E30A 3EK7A 1MQ1A 1HQVA 4MBEA 1C7WA 1CLLA 2OTGB 2AAOA 2M8UA 2COLB 1K8UA 2VRGA 5J3XA 2RGIA 1OQPA 4YI9A 1SL7A 1G8IA 4MLWA 1K94A 2OTGC 2JPTA 1PSBA 3RM1A 2BL0B 1B8LA 2ZRSA 5DKRA 1B9AA 1M39A 3VRNA 4P2YB 1SRAA 3K21A 1A4PA 2BL0C 4YGEB 2JWWA 4HREE 1C07A 1ZMZA 3CR2A 4ETOA 1YUTA 1Y1XA 2LUCA 1VRKA 5I2OA 2JT3A 1SYMA 4N5XA 1PK0D 4A4CA 4F0ZB 5CPVA 2M1KB 3FWBA 4M2QA 4OCIA 4E68A 5KU1A 1QLSA 2M97A 4C0LA 5HLVA 1FPWA 1ALWA 3PN7B 1F55A 5IBWA 1B7TZ 3H4SE 1QS7A 1GQMA 1K9KA 2L51A 4PHNA 1KK7Z 2L4HA 2K8MB 3PN7C 4OKHA 5G08A 1W7IB 4A4BA 2ZNDA 3WHTB 1WLZA 2LP3A 1CKKA 2Y5IA 1EG4A 2CT9A 1XA5A 2HETA 4Q04A 1Y1AA 1TNXA 1UURA 1ZOTB 2K7DA 2KSPA 1NCXA 1AK8A 1LVCD 1IJ6A 2E6WA 1QTXA
chains in the Genus database with same CATH superfamily
2D8NA 1L2OB 3D73A 1PULA 3LK1A 3TS5B 3NSIA 4M2OA 4YGCB 1R6PA 3JVTB 1NWDA 1C3YA 1F71A 3WNXB 3BYAA 1JWDA 1L2OC 4JPZB 3FWCA 4MSPA 4DRWA 3TS5C 4DIRA 3JVTC 1DQEA 5CSFA 4OR9B 2FCDA 2LC5A 3NSKA 1CDMA 1J1EA 1ODBA 2K60A 3BFAA 1HT9A 2KNEA 1DF0A 3PJIA 2I94A 3JTDB 4IJ7A 4PHMA 4BY4A 2PVBA 1S26D 3SG2A 3CZTX 2M7NA 1YRUB 4KYNA 2MRDA 1QATA 1BR1B 4ZCUA 4CFQA 1JF0A 5FYXA 2LMUA 1TRFA 1SKTA 2TN4A 4ORCB 4USLA 4C0JA 1QIWA 1KQMB 3CZ1A 1NIWA 2KYFA 5AFPA 1LKJA 1EH2A 1XYDA 4N1GA 1C3ZA 4JQ0D 2F3YA 4AOMA 1KQMC 1QJTA 5AANA 3R72A 2K7OA 1TN4A 1JSAA 2KHNA 4ORAB 1FF1A 2V53A 1YURA 1A03A 1OMVA 3R1VA 1DVIA 4PDZA 2LLUA 3VROA 1J1DA 2LVKA 1CDNA 2Y1MA 1IQ3A 1XFVO 3DZTA 3DD4A 1AVSA 2Y1NA 5DICA 3SIBA 3SS3A 4DCKA 1OMDA 5HYDA 1J55A 3PM8A 2JT8A 1GJYA 3S0EA 2MHHA 3CGAA 1IQ5A 5AERA 3BUXB 1TWOA 4AQJA 2L0PA 2PMYA 2ZKMX 2P6BB 1BMOA 3S0FA 1NX3A 2PALA 1OZOA 1IWQA 1S5GY 2F3ZA 4DS7A 1ZUZA 2K0JA 3DXLA 1NCYA 3CTNA 3I5GB 1FBVA 1K93D 2KI6C 4OZDA 3BUMB 1MR8A 1XVJA 3PALA 3B87A 5DKNA 1B47A 2LMVA 2CXJA 1WLMA 3I5GC 4XJKA 1FW4A 1V1FA 1S6CA 2KFHA 2QACA 2ISDA 1YX7A 1DC1A 2NCPA 2WNDA 2WORA 3L4LA 4FQTA 4ORBB 5DKQA 4XJKB 1A29A 3L47A 1CNPA 1OOIX 1YR5A 3D76A 4YBHB 1BJFA 5F6TA 2LVVA 5JJGA 3EVRA 5JOLA 2MA2A 1TNQA 2MLEC 1KCYA 1QLKA 4GNKB 4OVNF 5I2LA 2WCBA 2GV5A 1ZACA 5KTYA 2FJYA 2L4IA 2QEVA 3CWGA 4GAOA 4NQGA 1WY9A 1Q80A 1YVLA 4C0KA 1G33A 2LUXA 1K96A 2ZN8A 3E3RA 1MWNA 3CR4X 2WCLA 3FE8A 3NSLA 3FE6A 1SL9A 2KFFA 1DJIA 4PE7A 1F54A 1U5IA 4UPGA 2JULA 1DEKA 1N0YA 2QEOA 1OSAA 3O2PA 1LXFC 1CFFA 2R2IA 1IKUA 1TCOB 4YGDB 3EK4A 1TIZA 4I5KA 3M0WA 3TDIA 1DJXA 2OS8B 1U5IB 3KHEA 4NDCA 5HKZA 1CMFA 2O5GA 4MN0A 2WCHA 2KBMA 2WC6A 2JNXA 2OS8C 1OOJA 1MHOA 4I5LB 1XFYO 1QVIY 3BOWA 1BOCA 1J7OA 3D78A 1CFPA 1RECA 1RJVA 1S5GZ 1UHNA 2M3WA 3B88A 4QJ3B 1NPQA 4PE0A 1K2HA 2K2AA 1WRLA 2L2EA 1RWYA 2MBXA 2L98A 1NP8A 1XFZO 3BOWB 3BQ3A 4TNCA 1YRTB 3S0BA 1CFCA 2JTTA 2LHLA 1GGZA 2BCBA 1QX2A 2A4JA 2KLEA 1F4OA 1NX2A 4JWQA 2MAZA 4MRXA 1WRZA 1A75B 2HPSA 4CPVA 3D10A 1DJWA 1PVAA 2LE9B 1CM4A 5D7FA 2WOSA 1ALVA 1YTZC 1YVHA 1KFXL 2KGRA 2KI6D 3LL8B 2G9BA 2L50A 1YUSA 2NXQA 1JC2A 1M45A 2AMIA 2MLFC 1QV0A 2O60A 3EK8A 1JFJA 1CB1A 1LA3A 1K9PA 1N65A 1QX5B 2KOTA 2KQYA 1OMRA 2NZ0A 3IVTA 3O6BA 1Z4HA 3SG5A 2ZN9A 3UO9A 1SBJA 4MZJA 1AP4A 1J7RA 3R1PA 5ER4X 2BKIB 4GBAA 2BCAA 1B8RA 1QV1A 1LINA 3VRPA 1IRJA 1QIVA 2KYCA 3EKJA 2L5XB 2M1UA 2M29A 3A8RA 3IQQA 1XFRA 2M7LA 1BG1A 3DVJA 4D1EA 5HKWA 4P5OE 2JT0A 3TDZA 1XO5A 3VRRA 1SK6D 3KEVA 1DGVA 1MXLC 3D0YB 2Q4UA 3CZ2A 2LNKA 1X02A 2KAXA 4INWA 1UWOA 1BF5A 2EHBA 1PALA 2BKHB 2M0RA 2WCFA 1S6JA 2KBIA 3DVMA 4R1EA 2FOTA 1KFUS 2H61A 2BE6A 1RROA 1QVIZ 1B4CA 1MXEA 1DELA 1EXRA 2LLSA 1BU3A 4CLNA 2I7AA 2G2BA 1N2DA 2M9GA 1XFWO 1UUSA 2GGZA 2BBMA 1LA0A 2QPTA 5I94A 2IS9A 4OV2A 4PE1A 3LCPC 3WXAA 2FCEA 4QJ4B 3K1EA 1DMOA 3EVVA 1S36A 2H61C 4NDDA 1AJ4A 3KO0A 1IH0A 2OPOA 3NSOA 1BR4B 4HSZA 1XK4A 1OZSA 3IQOA 3DVKA 4U8DA 2H8VA 2KI4B 1TUZA 3OX5A 1M63B 1CDPA 2LV7A 1SR6B 4YRUA 1RFJA 3DYEA 1UHKA 2KI4C 3WHUB 3CYZA 1RK9A 2K7CA 1SCVA 1CM1A 2KAVA 1R2UA 1DJHA 1SR6C 4M2PA 3CDNA 3SIAA 1XK4C 4YGBB 1UHJA 2LVIA 3AAJA 1XFUO 1TNPA 1L7ZA 2K61A 3D75A 4NDBA 2WC5A 1BODA 5CSNA 5I8NA 1C7VA 1QX7A 3I5HB 5GQQC 3GK1A 4AQIA 5BPJA 3EG5B 5AEQA 3C1VA 3N7HA 1D1OA 1DGUA 1S3PA 1TOPA 3I5HC 2CTNA 5FI2A 1H8BA 2WCMA 2ZNEA 4ICBA 3L4AA 2KQ6A 3UNWA 2BBNA 2EC6C 1NX1A 1M46A 2YGUA 1IIOA 3CZ0A 3AAKA 2SCPA 3B86A 4MZKA 3QMEA 1DJGA 2WCJA 2CBLA 1CFDA 4MZLA 2MJWB 4PCWA 4I5NB 1SNLA 4GPLB 2LANA 3EKHA 5FI7A 1KK8B 1SSEB 1F8HA 2F33A 1A2XA 1SCMB 2EGDA 1FI6A 3NXAA 2LAPA 3AKAA 4N1FA 1KK8C 1QWVA 1SCMC 4JD9A 1EG3A 3PLFB 1DT7B 3GK4X 1EL4A 2BNXA 4INXA 3KF9A 3BUNB 4PHJA 3EVUA 2KFGA 3DF0A 1BLQA 2LCPA 4WQ2A 5ER5A 1JBAA 1OE9B 3TDUA 2GTEA 3HX4A 3A4UB 2JQ6A 1QXPA 1G4YR 1ORGA 2I18A 1A75A 2JPOA 1WRKA 3DF0B 1JF2A 1KQVA 1GGWA 4MRYA 5CSJA 2KGBC 3OP0A 3SJSA 3LK0A 3SS5A 3BXKA 1B1GA 1DJYA 2JTZA 3FS7A 1PSRA 2HF5A 4ZCVA 3ICBA 5HKYA 1Y0VH 3KPXA 1K9UA 2BCXA 3GK2A 2JNFA 2LVJA 4DUQA 2Y4QA 1TNWA 3B6XA 1NUBA 1S1EA 3B7AA 4HRHA 3FE9A 2DOQA 3I5IB 1YUUA 5I2QA 2QEHA 2JOJA 2B1UA 3TZ1A 1RTP1 3I5IC 4QJ5B 2SASA 1KWOB 5K89A 3DY9A 1GM0A 1SL8A 3CR5X 2F2PA 1KSOA 1KWOC 4HRGA 3AKBA 4PT1A 2LMTA 3O4YA 1UHHA 3TUYB 2CNPA 2JRFA 2H2KA 3PSRA 3D0YA 3HCMA 2FJUB 4GFTA 1KFUL 1K90D 2JXLA 2LM5A 4GGFA 5FI6A 3TUYC 4MEWA 3V2LA 1IGVA 1JFKA 3ZWHA 2HQWA 3ZNIA 1SY9A 1CTRA 2F8PA 2P71A 2WCEA 4YGAA 1J7QA 3FIAA 3VRQA 3BUOB 5KSZA 2L5YA 2LHIA 3RLZA 1SW8A 1DJZA 1JUOA 1KFXS 2KDHA 3BUWB 1PVBA 4F7FA 4JKTA 4IL1A 4GGFC 3JTDC 1OOFA 1XFXO 4BY5A 1CMGA 2JC2A 1DF0B 1LS8A 4XYNA 5PALA 2WCKA 5B8IB 5CSIA 1S6IA 2LLTA 3SG7A 2F2OA 1NSHA 1QASA 3MSEB 4PHKA 2K2FA 4CFRA 4GGNA 1IJ5A 2KAYA 2NCOA 4PALA 4WQ3A 3PATA 1M31A 1V1GA 2I2RE 2PASA 2ZFDA 5AXIA 1NCZA 3NHTA 4L9MA 5HL1A 1MF8B 3OBVA 1DTLA 1OW4A 3CS1A 1ZFSA 2PQLA 2L2CA 1Y6WA 4FQOA 2CCMA 1NX0A 3PFVA 1OOHA 1E8AA 1W9ZA 3OB2B 1B8CA 1YX8A 4PE4A 1CLMA 2K7BA 2PRUA 1WDCB 1AUIB 1Y1UA 2ZRTA 2JU0A 1BT6A 5HLOA 2BECA 1NYAA 3DVEA 4FTGA 3GOFA 4WRIA 2GGMA 3SS4A 1WDCC 1H4BA 3F45A 4CIDA 1B7TY 3LLEA 1KK7Y 3CABA 3I5FB 1W7JB 4YI8A 3IF7A 1F70A 2JZIA 3R1OA 3VGOA 2QEBA 3D77A 3QRXA 3SG3A 1CLBA 3BFBA 3I5FC 4I5JA 1MUXA 2EC6B 3CLNA 2PSRA 1Z2CB 2NLNA 1UP5A 1CDLA 2LP2A 1TCFA 5TNCA 3OX6A 1J7PA 1IG5A 1TTXA 3O4XA 3OHMB 3S0AA 1K95A 1FI5A 1AHRA 2WC8A 2BAPA 5D69A 3NGVA 2AUCA 3O78A 2BE4A 1TUJA 2HQ8A 2JXCA 1AJ5A 2M49B 1PRWA 1EJ3A 3OB1B 2KLDA 1SMGA 4MVFA 1KSMA 2ERBA 3SG4A 3RZSA 1UHIA 2Q91A 1SPYA 3SG6A 4GUKA 1F4QA 2E30A 3EK7A 1MQ1A 1HQVA 4MBEA 1C7WA 1CLLA 2OTGB 2AAOA 2M8UA 2COLB 1K8UA 2KPHA 2VRGA 2RGIA 5J3XA 1OQPA 3Q8IA 1P28A 1SL7A 1G8IA 4MLWA 4YI9A 1K94A 2OTGC 2JPTA 1PSBA 3RM1A 2BL0B 1B8LA 2ZRSA 5DKRA 1B9AA 1M39A 3VRNA 4P2YB 1SRAA 3K21A 5D3OA 5EL2A 1A4PA 2BL0C 4YGEB 2JWWA 3NHIA 4HREE 1C07A 3VB1A 1ZMZA 3CR2A 3BJHA 4ETOA 1YUTA 1Y1XA 2LUCA 1VRKA 1T14A 5I2OA 2JT3A 1SYMA 4N5XA 1PK0D 3S0DA 4A4CA 4F0ZB 5CPVA 2M1KB 3FWBA 4M2QA 4OCIA 3S0GA 4E68A 2P70A 5KU1A 1QLSA 2QDIA 2M97A 4C0LA 5HLVA 1FPWA 1ALWA 3PN7B 1F55A 5IBWA 1B7TZ 3H4SE 1QS7A 1GQMA 2PYQA 1K9KA 1OOGA 2L51A 4PHNA 1KK7Z 2L4HA 2K8MB 3D74A 3PN7C 4OKHA 5G08A 1W7IB 4A4BA 2ZNDA 3OGNA 3WHTB 3BFHA 1WLZA 2LP3A 1CKKA 2Y5IA 1EG4A 1XA5A 2CT9A 2HETA 3PM2A 4Q04A 1Y1AA 1TNXA 1UURA 1ZOTB 2K7DA 2KSPA 1NCXA 1AK8A 1LVCD 1IJ6A 2E6WA 1QTXA
chains in the Genus database with same CATH topology
2D8NA 1L2OB 1PULA 3LK1A 3TS5B 3NSIA 4M2OA 4YGCB 1R6PA 3JVTB 1NWDA 1F71A 3WNXB 3BYAA 1JWDA 1L2OC 4JPZB 3FWCA 4MSPA 4DRWA 3TS5C 4DIRA 3JVTC 5CSFA 4OR9B 2FCDA 2LC5A 3NSKA 1CDMA 1J1EA 1ODBA 1HT9A 2KNEA 1DF0A 2I94A 3JTDB 4PHMA 4BY4A 2PVBA 1S26D 3SG2A 3CZTX 2M7NA 1YRUB 2MRDA 1QATA 1BR1B 4ZCUA 4CFQA 1JF0A 5FYXA 2LMUA 1TRFA 1SKTA 2TN4A 4ORCB 4USLA 4C0JA 1QIWA 1KQMB 1NIWA 2KYFA 5AFPA 1LKJA 1EH2A 1XYDA 4N1GA 4JQ0D 2F3YA 4AOMA 1KQMC 1QJTA 5AANA 2K7OA 1TN4A 1JSAA 2KHNA 4ORAB 1FF1A 2V53A 1YURA 1A03A 1OMVA 1DVIA 4PDZA 2LLUA 3VROA 1J1DA 2LVKA 1CDNA 2Y1MA 1IQ3A 1XFVO 3DD4A 1AVSA 2Y1NA 3SIBA 4DCKA 5HYDA 1OMDA 1J55A 3PM8A 2JT8A 1GJYA 2MHHA 3CGAA 1IQ5A 5AERA 3BUXB 4AQJA 2L0PA 2PMYA 2ZKMX 2P6BB 1BMOA 1NX3A 2PALA 1OZOA 1IWQA 1S5GY 2F3ZA 4DS7A 1ZUZA 2K0JA 1NCYA 3CTNA 3I5GB 1FBVA 1K93D 2KI6C 3BUMB 1MR8A 1XVJA 3PALA 5DKNA 1B47A 2LMVA 2CXJA 1WLMA 3I5GC 4XJKA 1FW4A 1V1FA 1S6CA 2KFHA 2QACA 2ISDA 1YX7A 2NCPA 2WNDA 2WORA 4ORBB 1CNPA 5DKQA 4XJKB 1A29A 4YBHB 1YR5A 1BJFA 5F6TA 2LVVA 5JJGA 3EVRA 5JOLA 2MA2A 1TNQA 2MLEC 1KCYA 1QLKA 4GNKB 4OVNF 5I2LA 2WCBA 2GV5A 1ZACA 5KTYA 2L4IA 3CWGA 4GAOA 4NQGA 1WY9A 1Q80A 1YVLA 4C0KA 1G33A 2LUXA 1K96A 2ZN8A 3E3RA 1MWNA 3CR4X 3NSLA 1SL9A 2KFFA 1DJIA 4PE7A 1F54A 1U5IA 4UPGA 2JULA 1N0YA 1OSAA 3O2PA 1LXFC 1CFFA 2R2IA 1IKUA 1TCOB 4YGDB 3EK4A 1TIZA 4I5KA 3M0WA 3TDIA 1DJXA 2OS8B 1U5IB 3KHEA 4NDCA 5HKZA 1CMFA 2O5GA 4MN0A 2KBMA 2JNXA 2OS8C 1OOJA 1MHOA 4I5LB 1XFYO 1QVIY 3BOWA 1BOCA 1J7OA 1CFPA 1RECA 1RJVA 1S5GZ 1UHNA 2M3WA 4QJ3B 1NPQA 4PE0A 1K2HA 2K2AA 1WRLA 2L2EA 1RWYA 2MBXA 2L98A 1NP8A 1XFZO 3BOWB 3BQ3A 4TNCA 1YRTB 1CFCA 2JTTA 2LHLA 1GGZA 2BCBA 1QX2A 2A4JA 1F4OA 1NX2A 4JWQA 2MAZA 4MRXA 1WRZA 1A75B 2HPSA 4CPVA 3D10A 1DJWA 1PVAA 2LE9B 1CM4A 5D7FA 2WOSA 1ALVA 1YTZC 1YVHA 1KFXL 2KGRA 2KI6D 3LL8B 2G9BA 2L50A 1YUSA 2NXQA 1JC2A 1M45A 2AMIA 2MLFC 1QV0A 2O60A 3EK8A 1JFJA 1CB1A 1LA3A 1K9PA 1N65A 1QX5B 2KOTA 2KQYA 1OMRA 2NZ0A 3O6BA 3SG5A 2ZN9A 1SBJA 4MZJA 1AP4A 1J7RA 5ER4X 2BKIB 4GBAA 2BCAA 1B8RA 1QV1A 1LINA 3VRPA 1IRJA 1QIVA 2KYCA 3EKJA 2L5XB 2M1UA 2M29A 3A8RA 3IQQA 2M7LA 1BG1A 3DVJA 4D1EA 5HKWA 4P5OE 2JT0A 3TDZA 1XO5A 3VRRA 1SK6D 3KEVA 1DGVA 1MXLC 3D0YB 2Q4UA 2LNKA 1X02A 2KAXA 1UWOA 1BF5A 2EHBA 1PALA 2BKHB 2M0RA 2WCFA 1S6JA 2KBIA 3DVMA 4R1EA 2FOTA 1KFUS 2H61A 2BE6A 1RROA 1QVIZ 1B4CA 1MXEA 1EXRA 2LLSA 4CLNA 1BU3A 2I7AA 2G2BA 1N2DA 2M9GA 1XFWO 1UUSA 2GGZA 2BBMA 1LA0A 2QPTA 2IS9A 4OV2A 4PE1A 3LCPC 3WXAA 2FCEA 4QJ4B 1DMOA 3EVVA 1S36A 2H61C 4NDDA 1AJ4A 3KO0A 1IH0A 2OPOA 3NSOA 1BR4B 4HSZA 1XK4A 1OZSA 3IQOA 3DVKA 4U8DA 2KI4B 3OX5A 1M63B 1CDPA 2LV7A 1SR6B 4YRUA 1RFJA 1UHKA 2KI4C 3WHUB 1RK9A 2K7CA 1SCVA 1CM1A 2KAVA 1R2UA 1DJHA 1SR6C 4M2PA 3SIAA 1XK4C 4YGBB 1UHJA 2LVIA 3AAJA 1XFUO 1TNPA 1L7ZA 2K61A 4NDBA 1BODA 5CSNA 5I8NA 1C7VA 1QX7A 3I5HB 5GQQC 3GK1A 4AQIA 5BPJA 5AEQA 3C1VA 1D1OA 1DGUA 1S3PA 1TOPA 3I5HC 2CTNA 1H8BA 2ZNEA 4ICBA 2KQ6A 2BBNA 2EC6C 1NX1A 1M46A 3AAKA 2SCPA 4MZKA 1DJGA 2CBLA 1CFDA 4MZLA 2MJWB 4PCWA 4I5NB 1SNLA 4GPLB 2LANA 3EKHA 1KK8B 1F8HA 2F33A 1A2XA 1SCMB 2EGDA 1FI6A 3NXAA 2LAPA 3AKAA 4N1FA 1KK8C 1SCMC 1EG3A 3PLFB 1DT7B 3GK4X 1EL4A 3KF9A 3BUNB 4PHJA 3EVUA 2KFGA 3DF0A 1BLQA 2LCPA 4WQ2A 5ER5A 1JBAA 1OE9B 3TDUA 3HX4A 3A4UB 2JQ6A 1QXPA 1G4YR 2I18A 1A75A 3DF0B 1WRKA 1JF2A 1KQVA 1GGWA 4MRYA 5CSJA 2KGBC 3OP0A 3SJSA 3LK0A 3BXKA 1B1GA 1DJYA 2JTZA 3FS7A 1PSRA 2HF5A 4ZCVA 3ICBA 5HKYA 1Y0VH 3KPXA 1K9UA 2BCXA 3GK2A 2JNFA 2LVJA 4DUQA 2Y4QA 1TNWA 1NUBA 1S1EA 4HRHA 2DOQA 3I5IB 1YUUA 5I2QA 2JOJA 2B1UA 3TZ1A 1RTP1 3I5IC 4QJ5B 2SASA 1KWOB 5K89A 1SL8A 3CR5X 2F2PA 1KSOA 1KWOC 4HRGA 3AKBA 2LMTA 3O4YA 1UHHA 3TUYB 2CNPA 2JRFA 2H2KA 3PSRA 3D0YA 3HCMA 2FJUB 4GFTA 1KFUL 1K90D 2JXLA 2LM5A 4GGFA 3TUYC 4MEWA 1IGVA 1JFKA 3ZWHA 2HQWA 3ZNIA 1SY9A 1CTRA 2F8PA 2WCEA 4YGAA 1J7QA 3FIAA 3VRQA 3BUOB 5KSZA 2LHIA 3RLZA 1SW8A 1DJZA 1JUOA 1KFXS 2KDHA 3BUWB 1PVBA 4IL1A 4GGFC 3JTDC 1XFXO 4BY5A 1CMGA 2JC2A 1DF0B 4XYNA 5PALA 5B8IB 5CSIA 1S6IA 2LLTA 3SG7A 2F2OA 1NSHA 1QASA 3MSEB 4PHKA 2K2FA 4CFRA 4GGNA 1IJ5A 2KAYA 2NCOA 4PALA 4WQ3A 3PATA 1M31A 1V1GA 2I2RE 2PASA 2ZFDA 5AXIA 1NCZA 4L9MA 1MF8B 1DTLA 3CS1A 1ZFSA 1Y6WA 4FQOA 2CCMA 1NX0A 3PFVA 1E8AA 3OB2B 1B8CA 1YX8A 4PE4A 1CLMA 2K7BA 2PRUA 1WDCB 1AUIB 1Y1UA 2ZRTA 2JU0A 1BT6A 5HLOA 2BECA 1NYAA 3DVEA 4FTGA 3GOFA 4WRIA 2GGMA 1WDCC 1H4BA 3F45A 4CIDA 1B7TY 3LLEA 1KK7Y 3I5FB 1W7JB 4YI8A 3IF7A 1F70A 2JZIA 3VGOA 3QRXA 3SG3A 1CLBA 3I5FC 4I5JA 1MUXA 2EC6B 3CLNA 2PSRA 2NLNA 1UP5A 1CDLA 2LP2A 1TCFA 5TNCA 3OX6A 1J7PA 1IG5A 1TTXA 3OHMB 1K95A 1FI5A 1AHRA 2WC8A 5D69A 3O78A 2AUCA 2BE4A 2HQ8A 2JXCA 1AJ5A 2M49B 1PRWA 1EJ3A 3OB1B 1SMGA 4MVFA 1KSMA 3SG4A 1UHIA 2Q91A 1SPYA 3SG6A 4GUKA 1F4QA 2E30A 3EK7A 1MQ1A 1HQVA 4MBEA 1C7WA 1CLLA 2OTGB 2AAOA 2M8UA 2COLB 1K8UA 2VRGA 5J3XA 2RGIA 1OQPA 4YI9A 1SL7A 1G8IA 4MLWA 1K94A 2OTGC 2JPTA 1PSBA 3RM1A 2BL0B 1B8LA 2ZRSA 5DKRA 1B9AA 1M39A 3VRNA 4P2YB 1SRAA 3K21A 1A4PA 2BL0C 4YGEB 2JWWA 4HREE 1C07A 1ZMZA 3CR2A 4ETOA 1YUTA 1Y1XA 2LUCA 1VRKA 5I2OA 2JT3A 1SYMA 4N5XA 1PK0D 4A4CA 4F0ZB 5CPVA 2M1KB 3FWBA 4M2QA 4OCIA 4E68A 5KU1A 1QLSA 2M97A 4C0LA 5HLVA 1FPWA 1ALWA 3PN7B 1F55A 5IBWA 1B7TZ 3H4SE 1QS7A 1GQMA 1K9KA 2L51A 4PHNA 1KK7Z 2L4HA 2K8MB 3PN7C 4OKHA 5G08A 1W7IB 4A4BA 2ZNDA 3WHTB 1WLZA 2LP3A 1CKKA 2Y5IA 1EG4A 2CT9A 1XA5A 2HETA 4Q04A 1Y1AA 1TNXA 1UURA 1ZOTB 2K7DA 2KSPA 1NCXA 1AK8A 1LVCD 1IJ6A 2E6WA 1QTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8N A;  1L2O B;  1PUL A;  3LK1 A;  3TS5 B;  3NSI A;  4M2O A;  4YGC B;  1R6P A;  3JVT B;  1NWD A;  1F71 A;  3WNX B;  3BYA A;  1JWD A;  1L2O C;  4JPZ B;  3FWC A;  4MSP A;  4DRW A;  3TS5 C;  4DIR A;  3JVT C;  5CSF A;  4OR9 B;  2FCD A;  2LC5 A;  3NSK A;  1CDM A;  1J1E A;  1ODB A;  1HT9 A;  2KNE A;  1DF0 A;  2I94 A;  3JTD B;  4PHM A;  4BY4 A;  2PVB A;  1S26 D;  3SG2 A;  3CZT X;  2M7N A;  1YRU B;  2MRD A;  1QAT A;  1BR1 B;  4ZCU A;  4CFQ A;  1JF0 A;  5FYX A;  2LMU A;  1TRF A;  1SKT A;  2TN4 A;  4ORC B;  4USL A;  4C0J A;  1QIW A;  1KQM B;  1NIW A;  2KYF A;  5AFP A;  1LKJ A;  1EH2 A;  1XYD A;  4N1G A;  4JQ0 D;  2F3Y A;  4AOM A;  1KQM C;  1QJT A;  5AAN A;  2K7O A;  1TN4 A;  1JSA A;  2KHN A;  4ORA B;  1FF1 A;  2V53 A;  1YUR A;  1A03 A;  1OMV A;  1DVI A;  4PDZ A;  2LLU A;  3VRO A;  1J1D A;  2LVK A;  1CDN A;  2Y1M A;  1IQ3 A;  1XFV O;  3DD4 A;  1AVS A;  2Y1N A;  3SIB A;  4DCK A;  5HYD A;  1OMD A;  1J55 A;  3PM8 A;  2JT8 A;  1GJY A;  2MHH A;  3CGA A;  1IQ5 A;  5AER A;  3BUX B;  4AQJ A;  2L0P A;  2PMY A;  2ZKM X;  2P6B B;  1BMO A;  1NX3 A;  2PAL A;  1OZO A;  1IWQ A;  1S5G Y;  2F3Z A;  4DS7 A;  1ZUZ A;  2K0J A;  1NCY A;  3CTN A;  3I5G B;  1FBV A;  1K93 D;  2KI6 C;  3BUM B;  1MR8 A;  1XVJ A;  3PAL A;  5DKN A;  1B47 A;  2LMV A;  2CXJ A;  1WLM A;  3I5G C;  4XJK A;  1FW4 A;  1V1F A;  1S6C A;  2KFH A;  2QAC A;  2ISD A;  1YX7 A;  2NCP A;  2WND A;  2WOR A;  4ORB B;  1CNP A;  5DKQ A;  4XJK B;  1A29 A;  4YBH B;  1YR5 A;  1BJF A;  5F6T A;  2LVV A;  5JJG A;  3EVR A;  5JOL A;  2MA2 A;  1TNQ A;  2MLE C;  1KCY A;  1QLK A;  4GNK B;  4OVN F;  5I2L A;  2WCB A;  2GV5 A;  1ZAC A;  5KTY A;  2L4I A;  3CWG A;  4GAO A;  4NQG A;  1WY9 A;  1Q80 A;  1YVL A;  4C0K A;  1G33 A;  2LUX A;  1K96 A;  2ZN8 A;  3E3R A;  1MWN A;  3CR4 X;  3NSL A;  1SL9 A;  2KFF A;  1DJI A;  4PE7 A;  1F54 A;  1U5I A;  4UPG A;  2JUL A;  1N0Y A;  1OSA A;  3O2P A;  1LXF C;  1CFF A;  2R2I A;  1IKU A;  1TCO B;  4YGD B;  3EK4 A;  1TIZ A;  4I5K A;  3M0W A;  3TDI A;  1DJX A;  2OS8 B;  1U5I B;  3KHE A;  4NDC A;  5HKZ A;  1CMF A;  2O5G A;  4MN0 A;  2KBM A;  2JNX A;  2OS8 C;  1OOJ A;  1MHO A;  4I5L B;  1XFY O;  1QVI Y;  3BOW A;  1BOC A;  1J7O A;  1CFP A;  1REC A;  1RJV A;  1S5G Z;  1UHN A;  2M3W A;  4QJ3 B;  1NPQ A;  4PE0 A;  1K2H A;  2K2A A;  1WRL A;  2L2E A;  1RWY A;  2MBX A;  2L98 A;  1NP8 A;  1XFZ O;  3BOW B;  3BQ3 A;  4TNC A;  1YRT B;  1CFC A;  2JTT A;  2LHL A;  1GGZ A;  2BCB A;  1QX2 A;  2A4J A;  1F4O A;  1NX2 A;  4JWQ A;  2MAZ A;  4MRX A;  1WRZ A;  1A75 B;  2HPS A;  4CPV A;  3D10 A;  1DJW A;  1PVA A;  2LE9 B;  1CM4 A;  5D7F A;  2WOS A;  1ALV A;  1YTZ C;  1YVH A;  1KFX L;  2KGR A;  2KI6 D;  3LL8 B;  2G9B A;  2L50 A;  1YUS A;  2NXQ A;  1JC2 A;  1M45 A;  2AMI A;  2MLF C;  1QV0 A;  2O60 A;  3EK8 A;  1JFJ A;  1CB1 A;  1LA3 A;  1K9P A;  1N65 A;  1QX5 B;  2KOT A;  2KQY A;  1OMR A;  2NZ0 A;  3O6B A;  3SG5 A;  2ZN9 A;  1SBJ A;  4MZJ A;  1AP4 A;  1J7R A;  5ER4 X;  2BKI B;  4GBA A;  2BCA A;  1B8R A;  1QV1 A;  1LIN A;  3VRP A;  1IRJ A;  1QIV A;  2KYC A;  3EKJ A;  2L5X B;  2M1U A;  2M29 A;  3A8R A;  3IQQ A;  2M7L A;  1BG1 A;  3DVJ A;  4D1E A;  5HKW A;  4P5O E;  2JT0 A;  3TDZ A;  1XO5 A;  3VRR A;  1SK6 D;  3KEV A;  1DGV A;  1MXL C;  3D0Y B;  2Q4U A;  2LNK A;  1X02 A;  2KAX A;  1UWO A;  1BF5 A;  2EHB A;  1PAL A;  2BKH B;  2M0R A;  2WCF A;  1S6J A;  2KBI A;  3DVM A;  4R1E A;  2FOT A;  1KFU S;  2H61 A;  2BE6 A;  1RRO A;  1QVI Z;  1B4C A;  1MXE A;  1EXR A;  2LLS A;  4CLN A;  1BU3 A;  2I7A A;  2G2B A;  1N2D A;  2M9G A;  1XFW O;  1UUS A;  2GGZ A;  2BBM A;  1LA0 A;  2QPT A;  2IS9 A;  4OV2 A;  4PE1 A;  3LCP C;  3WXA A;  2FCE A;  4QJ4 B;  1DMO A;  3EVV A;  1S36 A;  2H61 C;  4NDD A;  1AJ4 A;  3KO0 A;  1IH0 A;  2OPO A;  3NSO A;  1BR4 B;  4HSZ A;  1XK4 A;  1OZS A;  3IQO A;  3DVK A;  4U8D A;  2KI4 B;  3OX5 A;  1M63 B;  1CDP A;  2LV7 A;  1SR6 B;  4YRU A;  1RFJ A;  1UHK A;  2KI4 C;  3WHU B;  1RK9 A;  2K7C A;  1SCV A;  1CM1 A;  2KAV A;  1R2U A;  1DJH A;  1SR6 C;  4M2P A;  3SIA A;  1XK4 C;  4YGB B;  1UHJ A;  2LVI A;  3AAJ A;  1XFU O;  1TNP A;  1L7Z A;  2K61 A;  4NDB A;  1BOD A;  5CSN A;  5I8N A;  1C7V A;  1QX7 A;  3I5H B;  5GQQ C;  3GK1 A;  4AQI A;  5BPJ A;  5AEQ A;  3C1V A;  1D1O A;  1DGU A;  1S3P A;  1TOP A;  3I5H C;  2CTN A;  1H8B A;  2ZNE A;  4ICB A;  2KQ6 A;  2BBN A;  2EC6 C;  1NX1 A;  1M46 A;  3AAK A;  2SCP A;  4MZK A;  1DJG A;  2CBL A;  1CFD A;  4MZL A;  2MJW B;  4PCW A;  4I5N B;  1SNL A;  4GPL B;  2LAN A;  3EKH A;  1KK8 B;  1F8H A;  2F33 A;  1A2X A;  1SCM B;  2EGD A;  1FI6 A;  3NXA A;  2LAP A;  3AKA A;  4N1F A;  1KK8 C;  1SCM C;  1EG3 A;  3PLF B;  1DT7 B;  3GK4 X;  1EL4 A;  3KF9 A;  3BUN B;  4PHJ A;  3EVU A;  2KFG A;  3DF0 A;  1BLQ A;  2LCP A;  4WQ2 A;  5ER5 A;  1JBA A;  1OE9 B;  3TDU A;  3HX4 A;  3A4U B;  2JQ6 A;  1QXP A;  1G4Y R;  2I18 A;  1A75 A;  3DF0 B;  1WRK A;  1JF2 A;  1KQV A;  1GGW A;  4MRY A;  5CSJ A;  2KGB C;  3OP0 A;  3SJS A;  3LK0 A;  3BXK A;  1B1G A;  1DJY A;  2JTZ A;  3FS7 A;  1PSR A;  2HF5 A;  4ZCV A;  3ICB A;  5HKY A;  1Y0V H;  3KPX A;  1K9U A;  2BCX A;  3GK2 A;  2JNF A;  2LVJ A;  4DUQ A;  2Y4Q A;  1TNW A;  1NUB A;  1S1E A;  4HRH A;  2DOQ A;  3I5I B;  1YUU A;  5I2Q A;  2JOJ A;  2B1U A;  3TZ1 A;  1RTP 1;  3I5I C;  4QJ5 B;  2SAS A;  1KWO B;  5K89 A;  1SL8 A;  3CR5 X;  2F2P A;  1KSO A;  1KWO C;  4HRG A;  3AKB A;  2LMT A;  3O4Y A;  1UHH A;  3TUY B;  2CNP A;  2JRF A;  2H2K A;  3PSR A;  3D0Y A;  3HCM A;  2FJU B;  4GFT A;  1KFU L;  1K90 D;  2JXL A;  2LM5 A;  4GGF A;  3TUY C;  4MEW A;  1IGV A;  1JFK A;  3ZWH A;  2HQW A;  3ZNI A;  1SY9 A;  1CTR A;  2F8P A;  2WCE A;  4YGA A;  1J7Q A;  3FIA A;  3VRQ A;  3BUO B;  5KSZ A;  2LHI A;  3RLZ A;  1SW8 A;  1DJZ A;  1JUO A;  1KFX S;  2KDH A;  3BUW B;  1PVB A;  4IL1 A;  4GGF C;  3JTD C;  1XFX O;  4BY5 A;  1CMG A;  2JC2 A;  1DF0 B;  4XYN A;  5PAL A;  5B8I B;  5CSI A;  1S6I A;  2LLT A;  3SG7 A;  2F2O A;  1NSH A;  1QAS A;  3MSE B;  4PHK A;  2K2F A;  4CFR A;  4GGN A;  1IJ5 A;  2KAY A;  2NCO A;  4PAL A;  4WQ3 A;  3PAT A;  1M31 A;  1V1G A;  2I2R E;  2PAS A;  2ZFD A;  5AXI A;  1NCZ A;  4L9M A;  1MF8 B;  1DTL A;  3CS1 A;  1ZFS A;  1Y6W A;  4FQO A;  2CCM A;  1NX0 A;  3PFV A;  1E8A A;  3OB2 B;  1B8C A;  1YX8 A;  4PE4 A;  1CLM A;  2K7B A;  2PRU A;  1WDC B;  1AUI B;  1Y1U A;  2ZRT A;  2JU0 A;  1BT6 A;  5HLO A;  2BEC A;  1NYA A;  3DVE A;  4FTG A;  3GOF A;  4WRI A;  2GGM A;  1WDC C;  1H4B A;  3F45 A;  4CID A;  1B7T Y;  3LLE A;  1KK7 Y;  3I5F B;  1W7J B;  4YI8 A;  3IF7 A;  1F70 A;  2JZI A;  3VGO A;  3QRX A;  3SG3 A;  1CLB A;  3I5F C;  4I5J A;  1MUX A;  2EC6 B;  3CLN A;  2PSR A;  2NLN A;  1UP5 A;  1CDL A;  2LP2 A;  1TCF A;  5TNC A;  3OX6 A;  1J7P A;  1IG5 A;  1TTX A;  3OHM B;  1K95 A;  1FI5 A;  1AHR A;  2WC8 A;  5D69 A;  3O78 A;  2AUC A;  2BE4 A;  2HQ8 A;  2JXC A;  1AJ5 A;  2M49 B;  1PRW A;  1EJ3 A;  3OB1 B;  1SMG A;  4MVF A;  1KSM A;  3SG4 A;  1UHI A;  2Q91 A;  1SPY A;  3SG6 A;  4GUK A;  1F4Q A;  2E30 A;  3EK7 A;  1MQ1 A;  1HQV A;  4MBE A;  1C7W A;  1CLL A;  2OTG B;  2AAO A;  2M8U A;  2COL B;  1K8U A;  2VRG A;  5J3X A;  2RGI A;  1OQP A;  4YI9 A;  1SL7 A;  1G8I A;  4MLW A;  1K94 A;  2OTG C;  2JPT A;  1PSB A;  3RM1 A;  2BL0 B;  1B8L A;  2ZRS A;  5DKR A;  1B9A A;  1M39 A;  3VRN A;  4P2Y B;  1SRA A;  3K21 A;  1A4P A;  2BL0 C;  4YGE B;  2JWW A;  4HRE E;  1C07 A;  1ZMZ A;  3CR2 A;  4ETO A;  1YUT A;  1Y1X A;  2LUC A;  1VRK A;  5I2O A;  2JT3 A;  1SYM A;  4N5X A;  1PK0 D;  4A4C A;  4F0Z B;  5CPV A;  2M1K B;  3FWB A;  4M2Q A;  4OCI A;  4E68 A;  5KU1 A;  1QLS A;  2M97 A;  4C0L A;  5HLV A;  1FPW A;  1ALW A;  3PN7 B;  1F55 A;  5IBW A;  1B7T Z;  3H4S E;  1QS7 A;  1GQM A;  1K9K A;  2L51 A;  4PHN A;  1KK7 Z;  2L4H A;  2K8M B;  3PN7 C;  4OKH A;  5G08 A;  1W7I B;  4A4B A;  2ZND A;  3WHT B;  1WLZ A;  2LP3 A;  1CKK A;  2Y5I A;  1EG4 A;  2CT9 A;  1XA5 A;  2HET A;  4Q04 A;  1Y1A A;  1TNX A;  1UUR A;  1ZOT B;  2K7D A;  2KSP A;  1NCX A;  1AK8 A;  1LVC D;  1IJ6 A;  2E6W A;  1QTX A; 
#chains in the Genus database with same CATH topology
 2D8N A;  1L2O B;  3D73 A;  1PUL A;  3LK1 A;  3TS5 B;  3NSI A;  4M2O A;  4YGC B;  1R6P A;  3JVT B;  1NWD A;  1C3Y A;  1F71 A;  3WNX B;  3BYA A;  1JWD A;  1L2O C;  4JPZ B;  3FWC A;  4MSP A;  4DRW A;  3TS5 C;  4DIR A;  3JVT C;  1DQE A;  5CSF A;  4OR9 B;  2FCD A;  2LC5 A;  3NSK A;  1CDM A;  1J1E A;  1ODB A;  2K60 A;  3BFA A;  1HT9 A;  2KNE A;  1DF0 A;  3PJI A;  2I94 A;  3JTD B;  4IJ7 A;  4PHM A;  4BY4 A;  2PVB A;  1S26 D;  3SG2 A;  3CZT X;  2M7N A;  1YRU B;  4KYN A;  2MRD A;  1QAT A;  1BR1 B;  4ZCU A;  4CFQ A;  1JF0 A;  5FYX A;  2LMU A;  1TRF A;  1SKT A;  2TN4 A;  4ORC B;  4USL A;  4C0J A;  1QIW A;  1KQM B;  3CZ1 A;  1NIW A;  2KYF A;  5AFP A;  1LKJ A;  1EH2 A;  1XYD A;  4N1G A;  1C3Z A;  4JQ0 D;  2F3Y A;  4AOM A;  1KQM C;  1QJT A;  5AAN A;  3R72 A;  2K7O A;  1TN4 A;  1JSA A;  2KHN A;  4ORA B;  1FF1 A;  2V53 A;  1YUR A;  1A03 A;  1OMV A;  3R1V A;  1DVI A;  4PDZ A;  2LLU A;  3VRO A;  1J1D A;  2LVK A;  1CDN A;  2Y1M A;  1IQ3 A;  1XFV O;  3DZT A;  3DD4 A;  1AVS A;  2Y1N A;  5DIC A;  3SIB A;  3SS3 A;  4DCK A;  1OMD A;  5HYD A;  1J55 A;  3PM8 A;  2JT8 A;  1GJY A;  3S0E A;  2MHH A;  3CGA A;  1IQ5 A;  5AER A;  3BUX B;  1TWO A;  4AQJ A;  2L0P A;  2PMY A;  2ZKM X;  2P6B B;  1BMO A;  3S0F A;  1NX3 A;  2PAL A;  1OZO A;  1IWQ A;  1S5G Y;  2F3Z A;  4DS7 A;  1ZUZ A;  2K0J A;  3DXL A;  1NCY A;  3CTN A;  3I5G B;  1FBV A;  1K93 D;  2KI6 C;  4OZD A;  3BUM B;  1MR8 A;  1XVJ A;  3PAL A;  3B87 A;  5DKN A;  1B47 A;  2LMV A;  2CXJ A;  1WLM A;  3I5G C;  4XJK A;  1FW4 A;  1V1F A;  1S6C A;  2KFH A;  2QAC A;  2ISD A;  1YX7 A;  1DC1 A;  2NCP A;  2WND A;  2WOR A;  3L4L A;  4FQT A;  4ORB B;  5DKQ A;  4XJK B;  1A29 A;  3L47 A;  1CNP A;  1OOI X;  1YR5 A;  3D76 A;  4YBH B;  1BJF A;  5F6T A;  2LVV A;  5JJG A;  3EVR A;  5JOL A;  2MA2 A;  1TNQ A;  2MLE C;  1KCY A;  1QLK A;  4GNK B;  4OVN F;  5I2L A;  2WCB A;  2GV5 A;  1ZAC A;  5KTY A;  2FJY A;  2L4I A;  2QEV A;  3CWG A;  4GAO A;  4NQG A;  1WY9 A;  1Q80 A;  1YVL A;  4C0K A;  1G33 A;  2LUX A;  1K96 A;  2ZN8 A;  3E3R A;  1MWN A;  3CR4 X;  2WCL A;  3FE8 A;  3NSL A;  3FE6 A;  1SL9 A;  2KFF A;  1DJI A;  4PE7 A;  1F54 A;  1U5I A;  4UPG A;  2JUL A;  1DEK A;  1N0Y A;  2QEO A;  1OSA A;  3O2P A;  1LXF C;  1CFF A;  2R2I A;  1IKU A;  1TCO B;  4YGD B;  3EK4 A;  1TIZ A;  4I5K A;  3M0W A;  3TDI A;  1DJX A;  2OS8 B;  1U5I B;  3KHE A;  4NDC A;  5HKZ A;  1CMF A;  2O5G A;  4MN0 A;  2WCH A;  2KBM A;  2WC6 A;  2JNX A;  2OS8 C;  1OOJ A;  1MHO A;  4I5L B;  1XFY O;  1QVI Y;  3BOW A;  1BOC A;  1J7O A;  3D78 A;  1CFP A;  1REC A;  1RJV A;  1S5G Z;  1UHN A;  2M3W A;  3B88 A;  4QJ3 B;  1NPQ A;  4PE0 A;  1K2H A;  2K2A A;  1WRL A;  2L2E A;  1RWY A;  2MBX A;  2L98 A;  1NP8 A;  1XFZ O;  3BOW B;  3BQ3 A;  4TNC A;  1YRT B;  3S0B A;  1CFC A;  2JTT A;  2LHL A;  1GGZ A;  2BCB A;  1QX2 A;  2A4J A;  2KLE A;  1F4O A;  1NX2 A;  4JWQ A;  2MAZ A;  4MRX A;  1WRZ A;  1A75 B;  2HPS A;  4CPV A;  3D10 A;  1DJW A;  1PVA A;  2LE9 B;  1CM4 A;  5D7F A;  2WOS A;  1ALV A;  1YTZ C;  1YVH A;  1KFX L;  2KGR A;  2KI6 D;  3LL8 B;  2G9B A;  2L50 A;  1YUS A;  2NXQ A;  1JC2 A;  1M45 A;  2AMI A;  2MLF C;  1QV0 A;  2O60 A;  3EK8 A;  1JFJ A;  1CB1 A;  1LA3 A;  1K9P A;  1N65 A;  1QX5 B;  2KOT A;  2KQY A;  1OMR A;  2NZ0 A;  3IVT A;  3O6B A;  1Z4H A;  3SG5 A;  2ZN9 A;  3UO9 A;  1SBJ A;  4MZJ A;  1AP4 A;  1J7R A;  3R1P A;  5ER4 X;  2BKI B;  4GBA A;  2BCA A;  1B8R A;  1QV1 A;  1LIN A;  3VRP A;  1IRJ A;  1QIV A;  2KYC A;  3EKJ A;  2L5X B;  2M1U A;  2M29 A;  3A8R A;  3IQQ A;  1XFR A;  2M7L A;  1BG1 A;  3DVJ A;  4D1E A;  5HKW A;  4P5O E;  2JT0 A;  3TDZ A;  1XO5 A;  3VRR A;  1SK6 D;  3KEV A;  1DGV A;  1MXL C;  3D0Y B;  2Q4U A;  3CZ2 A;  2LNK A;  1X02 A;  2KAX A;  4INW A;  1UWO A;  1BF5 A;  2EHB A;  1PAL A;  2BKH B;  2M0R A;  2WCF A;  1S6J A;  2KBI A;  3DVM A;  4R1E A;  2FOT A;  1KFU S;  2H61 A;  2BE6 A;  1RRO A;  1QVI Z;  1B4C A;  1MXE A;  1DEL A;  1EXR A;  2LLS A;  1BU3 A;  4CLN A;  2I7A A;  2G2B A;  1N2D A;  2M9G A;  1XFW O;  1UUS A;  2GGZ A;  2BBM A;  1LA0 A;  2QPT A;  5I94 A;  2IS9 A;  4OV2 A;  4PE1 A;  3LCP C;  3WXA A;  2FCE A;  4QJ4 B;  3K1E A;  1DMO A;  3EVV A;  1S36 A;  2H61 C;  4NDD A;  1AJ4 A;  3KO0 A;  1IH0 A;  2OPO A;  3NSO A;  1BR4 B;  4HSZ A;  1XK4 A;  1OZS A;  3IQO A;  3DVK A;  4U8D A;  2H8V A;  2KI4 B;  1TUZ A;  3OX5 A;  1M63 B;  1CDP A;  2LV7 A;  1SR6 B;  4YRU A;  1RFJ A;  3DYE A;  1UHK A;  2KI4 C;  3WHU B;  3CYZ A;  1RK9 A;  2K7C A;  1SCV A;  1CM1 A;  2KAV A;  1R2U A;  1DJH A;  1SR6 C;  4M2P A;  3CDN A;  3SIA A;  1XK4 C;  4YGB B;  1UHJ A;  2LVI A;  3AAJ A;  1XFU O;  1TNP A;  1L7Z A;  2K61 A;  3D75 A;  4NDB A;  2WC5 A;  1BOD A;  5CSN A;  5I8N A;  1C7V A;  1QX7 A;  3I5H B;  5GQQ C;  3GK1 A;  4AQI A;  5BPJ A;  3EG5 B;  5AEQ A;  3C1V A;  3N7H A;  1D1O A;  1DGU A;  1S3P A;  1TOP A;  3I5H C;  2CTN A;  5FI2 A;  1H8B A;  2WCM A;  2ZNE A;  4ICB A;  3L4A A;  2KQ6 A;  3UNW A;  2BBN A;  2EC6 C;  1NX1 A;  1M46 A;  2YGU A;  1IIO A;  3CZ0 A;  3AAK A;  2SCP A;  3B86 A;  4MZK A;  3QME A;  1DJG A;  2WCJ A;  2CBL A;  1CFD A;  4MZL A;  2MJW B;  4PCW A;  4I5N B;  1SNL A;  4GPL B;  2LAN A;  3EKH A;  5FI7 A;  1KK8 B;  1SSE B;  1F8H A;  2F33 A;  1A2X A;  1SCM B;  2EGD A;  1FI6 A;  3NXA A;  2LAP A;  3AKA A;  4N1F A;  1KK8 C;  1QWV A;  1SCM C;  4JD9 A;  1EG3 A;  3PLF B;  1DT7 B;  3GK4 X;  1EL4 A;  2BNX A;  4INX A;  3KF9 A;  3BUN B;  4PHJ A;  3EVU A;  2KFG A;  3DF0 A;  1BLQ A;  2LCP A;  4WQ2 A;  5ER5 A;  1JBA A;  1OE9 B;  3TDU A;  2GTE A;  3HX4 A;  3A4U B;  2JQ6 A;  1QXP A;  1G4Y R;  1ORG A;  2I18 A;  1A75 A;  2JPO A;  1WRK A;  3DF0 B;  1JF2 A;  1KQV A;  1GGW A;  4MRY A;  5CSJ A;  2KGB C;  3OP0 A;  3SJS A;  3LK0 A;  3SS5 A;  3BXK A;  1B1G A;  1DJY A;  2JTZ A;  3FS7 A;  1PSR A;  2HF5 A;  4ZCV A;  3ICB A;  5HKY A;  1Y0V H;  3KPX A;  1K9U A;  2BCX A;  3GK2 A;  2JNF A;  2LVJ A;  4DUQ A;  2Y4Q A;  1TNW A;  3B6X A;  1NUB A;  1S1E A;  3B7A A;  4HRH A;  3FE9 A;  2DOQ A;  3I5I B;  1YUU A;  5I2Q A;  2QEH A;  2JOJ A;  2B1U A;  3TZ1 A;  1RTP 1;  3I5I C;  4QJ5 B;  2SAS A;  1KWO B;  5K89 A;  3DY9 A;  1GM0 A;  1SL8 A;  3CR5 X;  2F2P A;  1KSO A;  1KWO C;  4HRG A;  3AKB A;  4PT1 A;  2LMT A;  3O4Y A;  1UHH A;  3TUY B;  2CNP A;  2JRF A;  2H2K A;  3PSR A;  3D0Y A;  3HCM A;  2FJU B;  4GFT A;  1KFU L;  1K90 D;  2JXL A;  2LM5 A;  4GGF A;  5FI6 A;  3TUY C;  4MEW A;  3V2L A;  1IGV A;  1JFK A;  3ZWH A;  2HQW A;  3ZNI A;  1SY9 A;  1CTR A;  2F8P A;  2P71 A;  2WCE A;  4YGA A;  1J7Q A;  3FIA A;  3VRQ A;  3BUO B;  5KSZ A;  2L5Y A;  2LHI A;  3RLZ A;  1SW8 A;  1DJZ A;  1JUO A;  1KFX S;  2KDH A;  3BUW B;  1PVB A;  4F7F A;  4JKT A;  4IL1 A;  4GGF C;  3JTD C;  1OOF A;  1XFX O;  4BY5 A;  1CMG A;  2JC2 A;  1DF0 B;  1LS8 A;  4XYN A;  5PAL A;  2WCK A;  5B8I B;  5CSI A;  1S6I A;  2LLT A;  3SG7 A;  2F2O A;  1NSH A;  1QAS A;  3MSE B;  4PHK A;  2K2F A;  4CFR A;  4GGN A;  1IJ5 A;  2KAY A;  2NCO A;  4PAL A;  4WQ3 A;  3PAT A;  1M31 A;  1V1G A;  2I2R E;  2PAS A;  2ZFD A;  5AXI A;  1NCZ A;  3NHT A;  4L9M A;  5HL1 A;  1MF8 B;  3OBV A;  1DTL A;  1OW4 A;  3CS1 A;  1ZFS A;  2PQL A;  2L2C A;  1Y6W A;  4FQO A;  2CCM A;  1NX0 A;  3PFV A;  1OOH A;  1E8A A;  1W9Z A;  3OB2 B;  1B8C A;  1YX8 A;  4PE4 A;  1CLM A;  2K7B A;  2PRU A;  1WDC B;  1AUI B;  1Y1U A;  2ZRT A;  2JU0 A;  1BT6 A;  5HLO A;  2BEC A;  1NYA A;  3DVE A;  4FTG A;  3GOF A;  4WRI A;  2GGM A;  3SS4 A;  1WDC C;  1H4B A;  3F45 A;  4CID A;  1B7T Y;  3LLE A;  1KK7 Y;  3CAB A;  3I5F B;  1W7J B;  4YI8 A;  3IF7 A;  1F70 A;  2JZI A;  3R1O A;  3VGO A;  2QEB A;  3D77 A;  3QRX A;  3SG3 A;  1CLB A;  3BFB A;  3I5F C;  4I5J A;  1MUX A;  2EC6 B;  3CLN A;  2PSR A;  1Z2C B;  2NLN A;  1UP5 A;  1CDL A;  2LP2 A;  1TCF A;  5TNC A;  3OX6 A;  1J7P A;  1IG5 A;  1TTX A;  3O4X A;  3OHM B;  3S0A A;  1K95 A;  1FI5 A;  1AHR A;  2WC8 A;  2BAP A;  5D69 A;  3NGV A;  2AUC A;  3O78 A;  2BE4 A;  1TUJ A;  2HQ8 A;  2JXC A;  1AJ5 A;  2M49 B;  1PRW A;  1EJ3 A;  3OB1 B;  2KLD A;  1SMG A;  4MVF A;  1KSM A;  2ERB A;  3SG4 A;  3RZS A;  1UHI A;  2Q91 A;  1SPY A;  3SG6 A;  4GUK A;  1F4Q A;  2E30 A;  3EK7 A;  1MQ1 A;  1HQV A;  4MBE A;  1C7W A;  1CLL A;  2OTG B;  2AAO A;  2M8U A;  2COL B;  1K8U A;  2KPH A;  2VRG A;  2RGI A;  5J3X A;  1OQP A;  3Q8I A;  1P28 A;  1SL7 A;  1G8I A;  4MLW A;  4YI9 A;  1K94 A;  2OTG C;  2JPT A;  1PSB A;  3RM1 A;  2BL0 B;  1B8L A;  2ZRS A;  5DKR A;  1B9A A;  1M39 A;  3VRN A;  4P2Y B;  1SRA A;  3K21 A;  5D3O A;  5EL2 A;  1A4P A;  2BL0 C;  4YGE B;  2JWW A;  3NHI A;  4HRE E;  1C07 A;  3VB1 A;  1ZMZ A;  3CR2 A;  3BJH A;  4ETO A;  1YUT A;  1Y1X A;  2LUC A;  1VRK A;  1T14 A;  5I2O A;  2JT3 A;  1SYM A;  4N5X A;  1PK0 D;  3S0D A;  4A4C A;  4F0Z B;  5CPV A;  2M1K B;  3FWB A;  4M2Q A;  4OCI A;  3S0G A;  4E68 A;  2P70 A;  5KU1 A;  1QLS A;  2QDI A;  2M97 A;  4C0L A;  5HLV A;  1FPW A;  1ALW A;  3PN7 B;  1F55 A;  5IBW A;  1B7T Z;  3H4S E;  1QS7 A;  1GQM A;  2PYQ A;  1K9K A;  1OOG A;  2L51 A;  4PHN A;  1KK7 Z;  2L4H A;  2K8M B;  3D74 A;  3PN7 C;  4OKH A;  5G08 A;  1W7I B;  4A4B A;  2ZND A;  3OGN A;  3WHT B;  3BFH A;  1WLZ A;  2LP3 A;  1CKK A;  2Y5I A;  1EG4 A;  1XA5 A;  2CT9 A;  2HET A;  3PM2 A;  4Q04 A;  1Y1A A;  1TNX A;  1UUR A;  1ZOT B;  2K7D A;  2KSP A;  1NCX A;  1AK8 A;  1LVC D;  1IJ6 A;  2E6W A;  1QTX A; 
#chains in the Genus database with same CATH homology
 2D8N A;  1L2O B;  1PUL A;  3LK1 A;  3TS5 B;  3NSI A;  4M2O A;  4YGC B;  1R6P A;  3JVT B;  1NWD A;  1F71 A;  3WNX B;  3BYA A;  1JWD A;  1L2O C;  4JPZ B;  3FWC A;  4MSP A;  4DRW A;  3TS5 C;  4DIR A;  3JVT C;  5CSF A;  4OR9 B;  2FCD A;  2LC5 A;  3NSK A;  1CDM A;  1J1E A;  1ODB A;  1HT9 A;  2KNE A;  1DF0 A;  2I94 A;  3JTD B;  4PHM A;  4BY4 A;  2PVB A;  1S26 D;  3SG2 A;  3CZT X;  2M7N A;  1YRU B;  2MRD A;  1QAT A;  1BR1 B;  4ZCU A;  4CFQ A;  1JF0 A;  5FYX A;  2LMU A;  1TRF A;  1SKT A;  2TN4 A;  4ORC B;  4USL A;  4C0J A;  1QIW A;  1KQM B;  1NIW A;  2KYF A;  5AFP A;  1LKJ A;  1EH2 A;  1XYD A;  4N1G A;  4JQ0 D;  2F3Y A;  4AOM A;  1KQM C;  1QJT A;  5AAN A;  2K7O A;  1TN4 A;  1JSA A;  2KHN A;  4ORA B;  1FF1 A;  2V53 A;  1YUR A;  1A03 A;  1OMV A;  1DVI A;  4PDZ A;  2LLU A;  3VRO A;  1J1D A;  2LVK A;  1CDN A;  2Y1M A;  1IQ3 A;  1XFV O;  3DD4 A;  1AVS A;  2Y1N A;  3SIB A;  4DCK A;  5HYD A;  1OMD A;  1J55 A;  3PM8 A;  2JT8 A;  1GJY A;  2MHH A;  3CGA A;  1IQ5 A;  5AER A;  3BUX B;  4AQJ A;  2L0P A;  2PMY A;  2ZKM X;  2P6B B;  1BMO A;  1NX3 A;  2PAL A;  1OZO A;  1IWQ A;  1S5G Y;  2F3Z A;  4DS7 A;  1ZUZ A;  2K0J A;  1NCY A;  3CTN A;  3I5G B;  1FBV A;  1K93 D;  2KI6 C;  3BUM B;  1MR8 A;  1XVJ A;  3PAL A;  5DKN A;  1B47 A;  2LMV A;  2CXJ A;  1WLM A;  3I5G C;  4XJK A;  1FW4 A;  1V1F A;  1S6C A;  2KFH A;  2QAC A;  2ISD A;  1YX7 A;  2NCP A;  2WND A;  2WOR A;  4ORB B;  1CNP A;  5DKQ A;  4XJK B;  1A29 A;  4YBH B;  1YR5 A;  1BJF A;  5F6T A;  2LVV A;  5JJG A;  3EVR A;  5JOL A;  2MA2 A;  1TNQ A;  2MLE C;  1KCY A;  1QLK A;  4GNK B;  4OVN F;  5I2L A;  2WCB A;  2GV5 A;  1ZAC A;  5KTY A;  2L4I A;  3CWG A;  4GAO A;  4NQG A;  1WY9 A;  1Q80 A;  1YVL A;  4C0K A;  1G33 A;  2LUX A;  1K96 A;  2ZN8 A;  3E3R A;  1MWN A;  3CR4 X;  3NSL A;  1SL9 A;  2KFF A;  1DJI A;  4PE7 A;  1F54 A;  1U5I A;  4UPG A;  2JUL A;  1N0Y A;  1OSA A;  3O2P A;  1LXF C;  1CFF A;  2R2I A;  1IKU A;  1TCO B;  4YGD B;  3EK4 A;  1TIZ A;  4I5K A;  3M0W A;  3TDI A;  1DJX A;  2OS8 B;  1U5I B;  3KHE A;  4NDC A;  5HKZ A;  1CMF A;  2O5G A;  4MN0 A;  2KBM A;  2JNX A;  2OS8 C;  1OOJ A;  1MHO A;  4I5L B;  1XFY O;  1QVI Y;  3BOW A;  1BOC A;  1J7O A;  1CFP A;  1REC A;  1RJV A;  1S5G Z;  1UHN A;  2M3W A;  4QJ3 B;  1NPQ A;  4PE0 A;  1K2H A;  2K2A A;  1WRL A;  2L2E A;  1RWY A;  2MBX A;  2L98 A;  1NP8 A;  1XFZ O;  3BOW B;  3BQ3 A;  4TNC A;  1YRT B;  1CFC A;  2JTT A;  2LHL A;  1GGZ A;  2BCB A;  1QX2 A;  2A4J A;  1F4O A;  1NX2 A;  4JWQ A;  2MAZ A;  4MRX A;  1WRZ A;  1A75 B;  2HPS A;  4CPV A;  3D10 A;  1DJW A;  1PVA A;  2LE9 B;  1CM4 A;  5D7F A;  2WOS A;  1ALV A;  1YTZ C;  1YVH A;  1KFX L;  2KGR A;  2KI6 D;  3LL8 B;  2G9B A;  2L50 A;  1YUS A;  2NXQ A;  1JC2 A;  1M45 A;  2AMI A;  2MLF C;  1QV0 A;  2O60 A;  3EK8 A;  1JFJ A;  1CB1 A;  1LA3 A;  1K9P A;  1N65 A;  1QX5 B;  2KOT A;  2KQY A;  1OMR A;  2NZ0 A;  3O6B A;  3SG5 A;  2ZN9 A;  1SBJ A;  4MZJ A;  1AP4 A;  1J7R A;  5ER4 X;  2BKI B;  4GBA A;  2BCA A;  1B8R A;  1QV1 A;  1LIN A;  3VRP A;  1IRJ A;  1QIV A;  2KYC A;  3EKJ A;  2L5X B;  2M1U A;  2M29 A;  3A8R A;  3IQQ A;  2M7L A;  1BG1 A;  3DVJ A;  4D1E A;  5HKW A;  4P5O E;  2JT0 A;  3TDZ A;  1XO5 A;  3VRR A;  1SK6 D;  3KEV A;  1DGV A;  1MXL C;  3D0Y B;  2Q4U A;  2LNK A;  1X02 A;  2KAX A;  1UWO A;  1BF5 A;  2EHB A;  1PAL A;  2BKH B;  2M0R A;  2WCF A;  1S6J A;  2KBI A;  3DVM A;  4R1E A;  2FOT A;  1KFU S;  2H61 A;  2BE6 A;  1RRO A;  1QVI Z;  1B4C A;  1MXE A;  1EXR A;  2LLS A;  4CLN A;  1BU3 A;  2I7A A;  2G2B A;  1N2D A;  2M9G A;  1XFW O;  1UUS A;  2GGZ A;  2BBM A;  1LA0 A;  2QPT A;  2IS9 A;  4OV2 A;  4PE1 A;  3LCP C;  3WXA A;  2FCE A;  4QJ4 B;  1DMO A;  3EVV A;  1S36 A;  2H61 C;  4NDD A;  1AJ4 A;  3KO0 A;  1IH0 A;  2OPO A;  3NSO A;  1BR4 B;  4HSZ A;  1XK4 A;  1OZS A;  3IQO A;  3DVK A;  4U8D A;  2KI4 B;  3OX5 A;  1M63 B;  1CDP A;  2LV7 A;  1SR6 B;  4YRU A;  1RFJ A;  1UHK A;  2KI4 C;  3WHU B;  1RK9 A;  2K7C A;  1SCV A;  1CM1 A;  2KAV A;  1R2U A;  1DJH A;  1SR6 C;  4M2P A;  3SIA A;  1XK4 C;  4YGB B;  1UHJ A;  2LVI A;  3AAJ A;  1XFU O;  1TNP A;  1L7Z A;  2K61 A;  4NDB A;  1BOD A;  5CSN A;  5I8N A;  1C7V A;  1QX7 A;  3I5H B;  5GQQ C;  3GK1 A;  4AQI A;  5BPJ A;  5AEQ A;  3C1V A;  1D1O A;  1DGU A;  1S3P A;  1TOP A;  3I5H C;  2CTN A;  1H8B A;  2ZNE A;  4ICB A;  2KQ6 A;  2BBN A;  2EC6 C;  1NX1 A;  1M46 A;  3AAK A;  2SCP A;  4MZK A;  1DJG A;  2CBL A;  1CFD A;  4MZL A;  2MJW B;  4PCW A;  4I5N B;  1SNL A;  4GPL B;  2LAN A;  3EKH A;  1KK8 B;  1F8H A;  2F33 A;  1A2X A;  1SCM B;  2EGD A;  1FI6 A;  3NXA A;  2LAP A;  3AKA A;  4N1F A;  1KK8 C;  1SCM C;  1EG3 A;  3PLF B;  1DT7 B;  3GK4 X;  1EL4 A;  3KF9 A;  3BUN B;  4PHJ A;  3EVU A;  2KFG A;  3DF0 A;  1BLQ A;  2LCP A;  4WQ2 A;  5ER5 A;  1JBA A;  1OE9 B;  3TDU A;  3HX4 A;  3A4U B;  2JQ6 A;  1QXP A;  1G4Y R;  2I18 A;  1A75 A;  3DF0 B;  1WRK A;  1JF2 A;  1KQV A;  1GGW A;  4MRY A;  5CSJ A;  2KGB C;  3OP0 A;  3SJS A;  3LK0 A;  3BXK A;  1B1G A;  1DJY A;  2JTZ A;  3FS7 A;  1PSR A;  2HF5 A;  4ZCV A;  3ICB A;  5HKY A;  1Y0V H;  3KPX A;  1K9U A;  2BCX A;  3GK2 A;  2JNF A;  2LVJ A;  4DUQ A;  2Y4Q A;  1TNW A;  1NUB A;  1S1E A;  4HRH A;  2DOQ A;  3I5I B;  1YUU A;  5I2Q A;  2JOJ A;  2B1U A;  3TZ1 A;  1RTP 1;  3I5I C;  4QJ5 B;  2SAS A;  1KWO B;  5K89 A;  1SL8 A;  3CR5 X;  2F2P A;  1KSO A;  1KWO C;  4HRG A;  3AKB A;  2LMT A;  3O4Y A;  1UHH A;  3TUY B;  2CNP A;  2JRF A;  2H2K A;  3PSR A;  3D0Y A;  3HCM A;  2FJU B;  4GFT A;  1KFU L;  1K90 D;  2JXL A;  2LM5 A;  4GGF A;  3TUY C;  4MEW A;  1IGV A;  1JFK A;  3ZWH A;  2HQW A;  3ZNI A;  1SY9 A;  1CTR A;  2F8P A;  2WCE A;  4YGA A;  1J7Q A;  3FIA A;  3VRQ A;  3BUO B;  5KSZ A;  2LHI A;  3RLZ A;  1SW8 A;  1DJZ A;  1JUO A;  1KFX S;  2KDH A;  3BUW B;  1PVB A;  4IL1 A;  4GGF C;  3JTD C;  1XFX O;  4BY5 A;  1CMG A;  2JC2 A;  1DF0 B;  4XYN A;  5PAL A;  5B8I B;  5CSI A;  1S6I A;  2LLT A;  3SG7 A;  2F2O A;  1NSH A;  1QAS A;  3MSE B;  4PHK A;  2K2F A;  4CFR A;  4GGN A;  1IJ5 A;  2KAY A;  2NCO A;  4PAL A;  4WQ3 A;  3PAT A;  1M31 A;  1V1G A;  2I2R E;  2PAS A;  2ZFD A;  5AXI A;  1NCZ A;  4L9M A;  1MF8 B;  1DTL A;  3CS1 A;  1ZFS A;  1Y6W A;  4FQO A;  2CCM A;  1NX0 A;  3PFV A;  1E8A A;  3OB2 B;  1B8C A;  1YX8 A;  4PE4 A;  1CLM A;  2K7B A;  2PRU A;  1WDC B;  1AUI B;  1Y1U A;  2ZRT A;  2JU0 A;  1BT6 A;  5HLO A;  2BEC A;  1NYA A;  3DVE A;  4FTG A;  3GOF A;  4WRI A;  2GGM A;  1WDC C;  1H4B A;  3F45 A;  4CID A;  1B7T Y;  3LLE A;  1KK7 Y;  3I5F B;  1W7J B;  4YI8 A;  3IF7 A;  1F70 A;  2JZI A;  3VGO A;  3QRX A;  3SG3 A;  1CLB A;  3I5F C;  4I5J A;  1MUX A;  2EC6 B;  3CLN A;  2PSR A;  2NLN A;  1UP5 A;  1CDL A;  2LP2 A;  1TCF A;  5TNC A;  3OX6 A;  1J7P A;  1IG5 A;  1TTX A;  3OHM B;  1K95 A;  1FI5 A;  1AHR A;  2WC8 A;  5D69 A;  3O78 A;  2AUC A;  2BE4 A;  2HQ8 A;  2JXC A;  1AJ5 A;  2M49 B;  1PRW A;  1EJ3 A;  3OB1 B;  1SMG A;  4MVF A;  1KSM A;  3SG4 A;  1UHI A;  2Q91 A;  1SPY A;  3SG6 A;  4GUK A;  1F4Q A;  2E30 A;  3EK7 A;  1MQ1 A;  1HQV A;  4MBE A;  1C7W A;  1CLL A;  2OTG B;  2AAO A;  2M8U A;  2COL B;  1K8U A;  2VRG A;  5J3X A;  2RGI A;  1OQP A;  4YI9 A;  1SL7 A;  1G8I A;  4MLW A;  1K94 A;  2OTG C;  2JPT A;  1PSB A;  3RM1 A;  2BL0 B;  1B8L A;  2ZRS A;  5DKR A;  1B9A A;  1M39 A;  3VRN A;  4P2Y B;  1SRA A;  3K21 A;  1A4P A;  2BL0 C;  4YGE B;  2JWW A;  4HRE E;  1C07 A;  1ZMZ A;  3CR2 A;  4ETO A;  1YUT A;  1Y1X A;  2LUC A;  1VRK A;  5I2O A;  2JT3 A;  1SYM A;  4N5X A;  1PK0 D;  4A4C A;  4F0Z B;  5CPV A;  2M1K B;  3FWB A;  4M2Q A;  4OCI A;  4E68 A;  5KU1 A;  1QLS A;  2M97 A;  4C0L A;  5HLV A;  1FPW A;  1ALW A;  3PN7 B;  1F55 A;  5IBW A;  1B7T Z;  3H4S E;  1QS7 A;  1GQM A;  1K9K A;  2L51 A;  4PHN A;  1KK7 Z;  2L4H A;  2K8M B;  3PN7 C;  4OKH A;  5G08 A;  1W7I B;  4A4B A;  2ZND A;  3WHT B;  1WLZ A;  2LP3 A;  1CKK A;  2Y5I A;  1EG4 A;  2CT9 A;  1XA5 A;  2HET A;  4Q04 A;  1Y1A A;  1TNX A;  1UUR A;  1ZOT B;  2K7D A;  2KSP A;  1NCX A;  1AK8 A;  1LVC D;  1IJ6 A;  2E6W A;  1QTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...