3CTNA

Structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'KDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ctnA00
2LLSA 1QV1A 3LL8B 1OMRA 1EXRA 5GQQC 2R2IA 1NSHA 5PALA 2LVKA 3EK8A 2OS8B 4D1EA 1SCMB 2LANA 1LKJA 1QV0A 4DCKA 1G33A 1DF0B 5HLOA 2NLNA 3C1VA 3NSLA 5JJGA 1HQVA 3VROA 4QJ5B 1J7PA 1L7ZA 3OB1B 2LMVA 4C0KA 2KAVA 1X02A 2LUCA 1V1FA 1M31A 1QS7A 2KNEA 1MHOA 2F8PA 2M8UA 4OR9B 4XJKA 1F70A 3WHUB 1YVLA 2H2KA 1FI6A 2AUCA 3FWCA 3PSRA 5TNCA 1QX7A 3AKBA 5DKQA 1S36A 2B1UA 3I5FC 1SL9A 4CPVA 4NQGA 3BUMB 2WORA 2KBIA 1AVSA 2ISDA 3VRRA 1CKKA 1JUOA 1N0YA 1JWDA 4JWQA 5DKNA 1QLKA 5HKYA 2GGZA 1U5IB 4MZJA 1CM1A 4P2YB 1XK4A 1DF0A 1K2HA 1XVJA 2L2EA 1UUSA 2JXCA 1YTZC 4I5NB 4L9MA 2FOTA 1KFUL 2V53A 4WQ2A 4YGBB 3RM1A 1BLQA 3DVMA 3FIAA 1NYAA 3AAJA 1NX0A 1QJTA 2JULA 1FW4A 3AKAA 1M46A 5CPVA 1KK7Z 1OMDA 4YBHB 1WLMA 2L4IA 1YX7A 1DMOA 1QLSA 3I5HB 1FPWA 1MQ1A 4ZCVA 1NIWA 4I5LB 2M3WA 2WC8A 3LK0A 3BUOB 4NDCA 1EJ3A 4E68A 1NX2A 2LVJA 1CB1A 4IL1A 3O78A 2JT3A 1OMVA 1XFWO 5I2OA 1CLBA 1DTLA 2ZNEA 1MR8A 1TIZA 2L98A 4GPLB 1XA5A 3BUWB 1J7RA 5KTYA 2LMTA 4HRHA 3SG3A 4MZKA 1QX2A 3BQ3A 3VRQA 1CFDA 1LA3A 3EKJA 3TUYB 3TDUA 1LXFC 1C07A 1BU3A 1IQ5A 2Q4UA 1SY9A 3KF9A 1RFJA 1MUXA 1NPQA 1WRZA 2WCBA 1YURA 2NZ0A 1WDCB 1K93D 2OS8C 1MXLC 1MF8B 1SCMC 2KFHA 2NCOA 1YR5A 1OSAA 1S6CA 3I5IB 1F71A 1XK4C 3PN7B 5HKZA 5D7FA 1PRWA 1DT7B 2M1UA 3QRXA 1RROA 3KHEA 3A4UB 3BOWA 1RK9A 2M1KB 1K96A 4NDBA 4OV2A 1CLLA 2JNFA 3D0YA 2MLEC 2ZKMX 5I8NA 1UHJA 5B8IB 2LV7A 1Q80A 2ZFDA 4N5XA 1RWYA 2PASA 5DKRA 1QTXA 4M2QA 3TDZA 2Q91A 1B7TZ 3SG6A 2O5GA 4DRWA 1BOCA 3HX4A 1DGUA 1K94A 1K95A 2K8MB 4Q04A 1UURA 2BBNA 4UPGA 5CSIA 5ER4X 2JZIA 2BKIB 2Y1NA 1S6IA 2K7DA 1H8BA 1QXPA 2IS9A 1TN4A 2TN4A 4ZCUA 3SG4A 1AJ4A 1S6JA 4MEWA 4U8DA 4CFQA 1Y1UA 1V1GA 2L50A 4HRGA 2F2PA 4MLWA 3WHTB 4CLNA 1PULA 3BXKA 1J7OA 2K2FA 2LVVA 1ODBA 3VGOA 1M45A 1SKTA 5AANA 2NCPA 1F4QA 3NXAA 1CM4A 1ZACA 3I5HC 1PALA 1W7JB 1GJYA 1WRKA 2LLTA 1B4CA 1OE9B 2GV5A 2MLFC 1B8RA 3FWBA 2F3YA 4AOMA 1EL4A 1DJHA 1OQPA 4FQOA 1KK8B 2M49B 2MAZA 1DJYA 2QACA 1CDPA 1YUSA 4HREE 4N1GA 1JBAA 2HQWA 1DJXA 1F4OA 2WCEA 1RTP1 3O2PA 3SG2A 5HLVA 3TUYC 5IBWA 2K7BA 3GOFA 1KFUS 3K21A 4ORBB 1BODA 2K0JA 1ZOTB 1IJ6A 3PALA 1EG3A 2M7NA 1B1GA 4C0LA 3I5IC 2SCPA 3O4YA 2M7LA 2CTNA 5KSZA 1DJWA 3PN7C 4P5OE 2KGBC 4GGNA 4PHMA 1TRFA 3PM8A 1PSRA 1HT9A 4XYNA 3JTDB 2KFGA 5AERA 5BPJA 4PALA 5D69A 2LMUA 4YGAA 4F0ZB 4BY5A 1GGWA 1SK6D 2H61C 3VRPA 1A75B 4ETOA 4A4BA 1MWNA 1KQMB 2CXJA 1N65A 4DS7A 2LC5A 1KWOB 4WQ3A 5JOLA 1TTXA 3ZNIA 1DVIA 5I2LA 3DF0B 3SG7A 4GNKB 1NWDA 1TNWA 1Y1AA 1K9KA 2KI6C 2K7CA 1IH0A 2KBMA 1NCZA 2CT9A 4M2OA 1KFXS 2LP2A 1F54A 3GK1A 1ZFSA 2LVIA 4ICBA 2NXQA 1U5IA 4MN0A 1A2XA 1BJFA 2BCBA 1F55A 4CIDA 4DUQA 2KDHA 2FJUB 3SJSA 4PE0A 3ZWHA 2WOSA 3EK4A 5AXIA 3E3RA 1S3PA 4C0JA 1FI5A 2LCPA 1CLMA 1PSBA 2GGMA 1A75A 4GGFA 2JTTA 1AJ5A 5G08A 3HCMA 3NSOA 3CWGA 1UHNA 4OVNF 1CFPA 3JVTB 3EK7A 1LVCD 4QJ3B 1BF5A 2BE6A 3DVKA 1DJZA 2CCMA 4DIRA 1OZSA 1AUIB 2KAXA 1IGVA 1KK8C 1NP8A 2I18A 2JXLA 2A4JA 1BR1B 4JQ0D 2JT8A 2OTGB 5KU1A 2I7AA 4MRXA 2KQ6A 1LINA 2DOQA 3EVVA 1XFZO 5AFPA 5ER5A 1B8LA 1XFYO 1QATA 3MSEB 1UHHA 3KO0A 1K9PA 1QASA 1DGVA 3LK1A 2PMYA 1SL7A 4MBEA 2JRFA 1S5GY 2KSPA 4YGCB 3GK2A 1PK0D 1R2UA 2MA2A 3SIAA 4YI9A 1AP4A 4R1EA 5F6TA 5HKWA 3NSIA 3TDIA 4MRYA 5CSFA 3OHMB 3EKHA 2Y1MA 1SRAA 4MZLA 2HQ8A 1SW8A 1RJVA 3OP0A 3OX6A 1TNPA 4GGFC 4I5KA 3CS1A 1J1DA 1TOPA 1J7QA 1XYDA 1KQMC 2BKHB 2BE4A 2Y5IA 3FS7A 3IQQA 1KWOC 2M9GA 1KSOA 2H61A 2PVBA 2JPTA 4GAOA 1CFFA 1OOJA 2O60A 1CDNA 1ZMZA 3I5GB 5HYDA 2BL0B 4PCWA 1R6PA 1UHIA 1S1EA 1QVIY 1Y1XA 1L2OB 2M29A 4GBAA 1KSMA 1TNXA 1S26D 2KHNA 3CGAA 1J1EA 3WXAA 1W7IB 1SYMA 3CTNA 2F33A 1B8CA 2KAYA 1DJIA 1KQVA 1JSAA 1QIVA 2KFFA 3A8RA 3CR4X 1NUBA 4ORCB 1GQMA 2D8NA 2ZN9A 2MHHA 1EH2A 2EGDA 2JNXA 2LE9B 1K8UA 3F45A 3VRNA 1A4PA 2JOJA 1WDCC 2HF5A 2RGIA 2SASA 1Y6WA 1QIWA 2KOTA 3JVTC 2MJWB 4ORAB 1SPYA 4YRUA 2BBMA 1B9AA 1XFUO 1WRLA 2F3ZA 4GFTA 2LAPA 2LP3A 4FTGA 2OPOA 1SR6B 1IKUA 4PHJA 1PVBA 3TS5B 2M97A 2KYCA 2K2AA 5FYXA 1A29A 4AQJA 1RECA 1OZOA 2EC6B 2OTGC 4QJ4B 2JQ6A 1QX5B 3BYAA 2I94A 4PE7A 1SNLA 2L0PA 4GUKA 2LHIA 1WY9A 1YRUB 2LHLA 1J55A 3DVJA 2BECA 1NCYA 4HSZA 1JF2A 1E8AA 3PFVA 2CNPA 2KQYA 2KGRA 4OKHA 2WCFA 4TNCA 4JPZB 2G2BA 3DD4A 1XFVO 3CZTX 5K89A 3OB2B 1EG4A 1PVAA 3EVRA 1VRKA 1CDLA 3IQOA 1YX8A 4USLA 2KI4B 2MBXA 1M63B 2I2RE 1IWQA 1G4YR 2LM5A 2VRGA 2Y4QA 3SG5A 1YVHA 2JT0A 2K7OA 3H4SE 2KI6D 1SBJA 3PATA 2MRDA 1IRJA 3I5GC 1CNPA 2BL0C 1H4BA 1CDMA 1K90D 1KK7Y 3BOWB 2QPTA 3OX5A 4YGDB 5AEQA 1F8HA 1L2OC 2LUXA 2LLUA 1TNQA 1IG5A 3D0YB 3DF0A 3LCPC 5I2QA 4PE1A 2ZN8A 1LA0A 2PSRA 2L4HA 2M0RA 3CLNA 4NDDA 2LNKA 2AAOA 1IJ5A 1UWOA 2AMIA 1BR4B 3WNXB 1AK8A 2KYFA 2F2OA 3GK4X 3LLEA 2BCAA 1S5GZ 4MSPA 1SCVA 1BT6A 1M39A 2WNDA 3DVEA 1XO5A 3I5FB 1CMGA 4WRIA 1K9UA 3RLZA 1SL8A 3BUXB 4YGEB 1AHRA 1KFXL 2EHBA 4PDZA 1GGZA 2E30A 2HPSA 3O6BA 3PLFB 4N1FA 2P6BB 2JU0A 1UHKA 1IQ3A 1MXEA 5CSNA 2COLB 1SR6C 1B47A 1C7WA 1NX3A 1TCOB 1FBVA 1XFXO 3JTDC 3KPXA 3TS5C 2L51A 1C7VA 4OCIA 3KEVA 1UP5A 2EC6C 2BCXA 4PE4A 1BMOA 3CR5X 2JWWA 1YUTA 2JC2A 4YI8A 2ZRTA 1D1OA 1JF0A 1QVIZ 4I5JA 2K61A 1JC2A 4PHNA 2ZNDA 3CR2A 3M0WA 1CTRA 2PRUA 2G9BA 3BUNB 3EVUA 1JFJA 3D10A 2JTZA 1CFCA 2CBLA 1B7TY 1N2DA 1YUUA 2HETA 2ZRSA 3AAKA 1CMFA 1ZUZA 1WLZA 3IF7A 1G8IA 1DJGA 1A03A 1KCYA 1ALWA 4MVFA 4PHKA 4XJKB 5J3XA 1JFKA 1BG1A 1FF1A 1YRTB 1SMGA 5CSJA 3SIBA 1ALVA 1TCFA 2PALA 4M2PA 4A4CA 2KI4C 4BY4A 2FCDA 1Y0VH 3ICBA 3NSKA 4CFRA 1NCXA 1NX1A 2FCEA 4AQIA 2E6WA 2L5XB 3TZ1A
chains in the Genus database with same CATH superfamily
2LLSA 1QV1A 3LL8B 1P28A 1OMRA 1EXRA 5GQQC 2R2IA 1NSHA 5PALA 2LVKA 3EK8A 2OS8B 5D3OA 4D1EA 1DEKA 1SCMB 2LANA 1LKJA 1QV0A 3V2LA 4DCKA 3S0EA 1G33A 1DF0B 5HLOA 2NLNA 3C1VA 3NSLA 5JJGA 1HQVA 4PT1A 3VROA 4QJ5B 1J7PA 1L7ZA 3OB1B 2LMVA 4C0KA 2KAVA 1X02A 3CZ0A 2LUCA 1V1FA 1M31A 1QS7A 2KNEA 3OBVA 1MHOA 2F8PA 2M8UA 4OR9B 4XJKA 1F70A 3WHUB 1YVLA 2H2KA 1FI6A 2AUCA 3FWCA 3PSRA 5TNCA 1QX7A 3D78A 3AKBA 5DKQA 1S36A 3OGNA 3S0GA 2B1UA 3DZTA 1SL9A 3I5FC 4CPVA 4NQGA 3BUMB 2WORA 2KBIA 1AVSA 2ISDA 5DICA 3VRRA 1JUOA 1N0YA 4JD9A 1CKKA 3SS5A 4JWQA 5DKNA 1QLKA 1JWDA 5HKYA 2GGZA 1U5IB 4MZJA 3CDNA 1CM1A 4P2YB 1XK4A 1DF0A 1K2HA 1XVJA 2L2EA 2QEHA 1UUSA 2BNXA 1YTZC 2JXCA 4I5NB 2FOTA 1KFUL 2V53A 4L9MA 4WQ2A 3IVTA 3RM1A 3SS3A 3DVMA 3FIAA 1NYAA 3AAJA 1NX0A 1QJTA 2JULA 1FW4A 3CABA 3AKAA 1M46A 3BFHA 5CPVA 1KK7Z 1OMDA 4YBHB 1WLMA 2L4IA 1YX7A 5FI2A 1DMOA 1QLSA 3I5HB 1FPWA 1MQ1A 4ZCVA 1NIWA 4I5LB 2M3WA 2WC8A 3LK0A 3BUOB 4NDCA 1EJ3A 4E68A 3PJIA 1NX2A 2LVJA 2WCJA 1CB1A 1QWVA 4IL1A 3O78A 2JT3A 1OMVA 1XFWO 5I2OA 1CLBA 1DTLA 2ZNEA 1MR8A 1TIZA 2L98A 4GPLB 1XA5A 3BUWB 1J7RA 5KTYA 2LMTA 4HRHA 3SG3A 4MZKA 1QX2A 3BQ3A 3VRQA 1CFDA 1LA3A 3R1VA 3EKJA 3TUYB 3TDUA 1LXFC 3NHTA 1C07A 1BU3A 2FJYA 1IQ5A 2Q4UA 1SY9A 3KF9A 1RFJA 1MUXA 1NPQA 1WRZA 2WCBA 1YURA 2NZ0A 3CZ1A 1WDCB 1K93D 3NHIA 2OS8C 1MXLC 1MF8B 1SCMC 2KFHA 2NCOA 1YR5A 1OSAA 1S6CA 3I5IB 1F71A 1XK4C 3PN7B 5HKZA 5D7FA 1PRWA 1DT7B 2M1UA 3QRXA 1RROA 3KHEA 3A4UB 3BOWA 1RK9A 2M1KB 1K96A 4NDBA 4OV2A 3RZSA 1CLLA 2JNFA 3S0AA 3D0YA 2MLEC 2ZKMX 5I8NA 1UHJA 4OZDA 5B8IB 2LV7A 1Q80A 2ZFDA 4N5XA 1RWYA 2PASA 5DKRA 1QTXA 4M2QA 3TDZA 2Q91A 1B7TZ 3BJHA 2O5GA 2P70A 3SG6A 4DRWA 1BOCA 3HX4A 1DGUA 1K94A 1K95A 1C3YA 2K8MB 4Q04A 1DQEA 1UURA 2BBNA 2GTEA 4UPGA 5CSIA 5ER4X 2JZIA 2BKIB 2Y1NA 1S6IA 2K7DA 1H8BA 1QXPA 2IS9A 1TN4A 2TN4A 4ZCUA 3SG4A 1AJ4A 1S6JA 5EL2A 4JKTA 4MEWA 1OW4A 4U8DA 1C3ZA 4CFQA 1Y1UA 1V1GA 2L50A 4HRGA 2F2PA 4MLWA 3WHTB 4CLNA 1PULA 3B86A 3BXKA 3S0DA 1DC1A 1J7OA 3SS4A 2K2FA 2LVVA 1ODBA 3VGOA 1M45A 1SKTA 5AANA 2NCPA 1F4QA 3NXAA 1CM4A 4IJ7A 1ZACA 3I5HC 3O4XA 1PALA 1W7JB 1GJYA 1WRKA 2LLTA 1B4CA 1OE9B 4INWA 1GM0A 2GV5A 2MLFC 3UNWA 1B8RA 3FWBA 2F3YA 4AOMA 1EL4A 1DJHA 1OQPA 4FQOA 1KK8B 2M49B 2MAZA 1DJYA 2QACA 1CDPA 1YUSA 3K1EA 4HREE 4N1GA 1JBAA 2HQWA 1DJXA 1F4OA 2WCEA 1RTP1 3FE8A 3O2PA 3SG2A 5HLVA 3TUYC 5IBWA 2K7BA 3GOFA 1KFUS 1W9ZA 3K21A 4ORBB 1BODA 2K0JA 1ZOTB 1BLQA 1IJ6A 2WC6A 3PALA 1EG3A 2M7NA 1B1GA 4C0LA 2P71A 3I5IC 2SCPA 3O4YA 2M7LA 2CTNA 5KSZA 1DELA 1DJWA 3PN7C 4P5OE 2KGBC 4GGNA 4PHMA 1TRFA 3PM8A 1PSRA 5FI7A 1HT9A 4XYNA 1OOHA 1OOFA 3JTDB 3PM2A 2KFGA 3R72A 5AERA 5BPJA 4PALA 3B88A 5D69A 2LMUA 4YGAA 4F0ZB 4BY5A 1GGWA 1SK6D 2H61C 3VRPA 1A75B 4ETOA 4A4BA 1MWNA 1KQMB 2CXJA 1N65A 4DS7A 2LC5A 1KWOB 4WQ3A 5JOLA 1TTXA 3ZNIA 1DVIA 5I2LA 3DF0B 3SG7A 4GNKB 1NWDA 1TNWA 1Y1AA 1K9KA 2KI6C 2K7CA 1IH0A 2KBMA 1NCZA 2CT9A 4M2OA 1KFXS 2LP2A 1F54A 3GK1A 1ZFSA 2LVIA 4ICBA 2NXQA 1U5IA 4MN0A 1A2XA 1BJFA 2BCBA 1F55A 1OOIX 4CIDA 2KDHA 2FJUB 4DUQA 3SJSA 4PE0A 3ZWHA 2WOSA 3D73A 3EK4A 3E3RA 1S3PA 5AXIA 4C0JA 2LCPA 1FI5A 3B87A 1CLMA 1PSBA 2GGMA 1A75A 5FI6A 4GGFA 2JTTA 1Z2CB 1AJ5A 5G08A 3HCMA 3NSOA 3CWGA 3R1PA 1UHNA 4OVNF 1CFPA 3JVTB 3EK7A 1LVCD 4QJ3B 2BAPA 3VB1A 1BF5A 2BE6A 3DVKA 1DJZA 2CCMA 1SSEB 4DIRA 1OZSA 1AUIB 2KAXA 1IGVA 1KK8C 1NP8A 2I18A 2JXLA 1OOGA 2KLEA 2A4JA 2WCHA 1BR1B 3Q8IA 4JQ0D 2JT8A 2OTGB 5KU1A 2I7AA 3DY9A 4MRXA 2KQ6A 1LINA 2DOQA 3EVVA 1XFZO 5AFPA 5ER5A 1B8LA 1XFYO 1QATA 3MSEB 4FQTA 1UHHA 3KO0A 1K9PA 1QASA 1DGVA 3LK1A 2PMYA 1SL7A 3S0FA 4MBEA 2JRFA 1S5GY 2KSPA 4YGCB 5HL1A 3GK2A 1PK0D 1R2UA 2MA2A 3SIAA 4YI9A 1AP4A 3B6XA 4R1EA 5F6TA 5HKWA 3NSIA 3TDIA 3L47A 4MRYA 5CSFA 3OHMB 3EKHA 1ORGA 2Y1MA 1SRAA 4MZLA 2HQ8A 2K60A 1SW8A 1RJVA 3OP0A 3OX6A 1TNPA 4GGFC 4I5KA 3CS1A 3N7HA 1J1DA 1TOPA 4KYNA 1J7QA 1XYDA 1KQMC 2BKHB 2BE4A 2Y5IA 3FE9A 3FS7A 3IQQA 1KWOC 2M9GA 1KSOA 3QMEA 2H61A 2PVBA 2JPTA 4GAOA 2H8VA 1CFFA 1OOJA 2JPOA 2O60A 1CDNA 1ZMZA 3I5GB 5HYDA 2BL0B 4PCWA 1R6PA 3BFAA 1UHIA 1S1EA 1QVIY 1Y1XA 3FE6A 1L2OB 2M29A 4GBAA 1KSMA 1TNXA 1S26D 2KHNA 4YGBB 3CGAA 1J1EA 3WXAA 1W7IB 1SYMA 3CTNA 2F33A 1B8CA 2KAYA 1DJIA 1KQVA 1JSAA 2L2CA 1QIVA 2KFFA 3A8RA 3DXLA 3CR4X 1NUBA 4ORCB 1GQMA 2D8NA 2ZN9A 2MHHA 1EH2A 2EGDA 2JNXA 2WCMA 2LE9B 1K8UA 3F45A 3VRNA 3B7AA 1A4PA 2JOJA 1WDCC 3R1OA 2HF5A 2RGIA 2SASA 1Y6WA 1QIWA 2KOTA 3JVTC 2MJWB 4ORAB 2L5YA 3EG5B 1SPYA 4YRUA 2BBMA 1IIOA 1B9AA 1XFUO 1WRLA 2F3ZA 4GFTA 2LAPA 2LP3A 4FTGA 2OPOA 1SR6B 1IKUA 4INXA 1PVBA 4PHJA 2M97A 2KYCA 3TS5B 2K2AA 2ERBA 1A29A 3D76A 1RECA 1OZOA 5FYXA 4AQJA 2EC6B 2OTGC 2WC5A 4QJ4B 2JQ6A 1QX5B 3NGVA 3DYEA 3BYAA 3L4AA 2I94A 4PE7A 5I94A 1SNLA 2L0PA 4GUKA 2LHIA 3D75A 1WY9A 1YRUB 2LHLA 1J55A 2YGUA 3DVJA 2BECA 1NCYA 2PYQA 4HSZA 1JF2A 1E8AA 3PFVA 2CNPA 2KQYA 2KGRA 4OKHA 2WCKA 2WCFA 4TNCA 3D74A 4JPZB 2G2BA 3BFBA 3DD4A 1XFVO 3CZTX 5K89A 3OB2B 1EG4A 1PVAA 3EVRA 1VRKA 1CDLA 3IQOA 1YX8A 4USLA 2KI4B 2MBXA 1M63B 2I2RE 1IWQA 1G4YR 1LS8A 2LM5A 2VRGA 2Y4QA 3SG5A 1YVHA 3L4LA 2JT0A 2K7OA 3H4SE 2KI6D 1SBJA 3PATA 2MRDA 1IRJA 1T14A 1TUZA 3I5GC 1CNPA 1Z4HA 2BL0C 1CDMA 1H4BA 1K90D 1KK7Y 3BOWB 2QPTA 3OX5A 4YGDB 5AEQA 1F8HA 1L2OC 2LUXA 2LLUA 1TNQA 1IG5A 3D0YB 3DF0A 3LCPC 5I2QA 4PE1A 2ZN8A 1LA0A 2PSRA 3UO9A 2L4HA 2M0RA 3CLNA 4NDDA 2LNKA 1TUJA 2AAOA 1IJ5A 1UWOA 2AMIA 1BR4B 3WNXB 4F7FA 1AK8A 2KYFA 2F2OA 3GK4X 3LLEA 2BCAA 1S5GZ 4MSPA 1SCVA 1BT6A 1M39A 2WNDA 3DVEA 1XO5A 3I5FB 1CMGA 4WRIA 1K9UA 2QEVA 3RLZA 1SL8A 3BUXB 4YGEB 1AHRA 1KFXL 2EHBA 4PDZA 1GGZA 2E30A 2HPSA 3O6BA 3PLFB 4N1FA 2P6BB 2JU0A 1UHKA 1IQ3A 1MXEA 2QEBA 5CSNA 3CYZA 2COLB 1SR6C 1B47A 1C7WA 1NX3A 1TCOB 1FBVA 1XFXO 3JTDC 3KPXA 3TS5C 2L51A 1C7VA 4OCIA 1XFRA 1UP5A 2EC6C 3KEVA 2BCXA 4PE4A 1BMOA 3CR5X 2JWWA 2KLDA 1YUTA 2JC2A 4YI8A 2ZRTA 1D1OA 1JF0A 1QVIZ 4I5JA 2K61A 2QEOA 1JC2A 4PHNA 2ZNDA 3S0BA 3CR2A 3CZ2A 3M0WA 1CTRA 2PRUA 2G9BA 3BUNB 3EVUA 3D77A 1JFJA 3D10A 2JTZA 1CFCA 1B7TY 1N2DA 1TWOA 1YUUA 2CBLA 2HETA 2ZRSA 3AAKA 1CMFA 1ZUZA 1WLZA 3IF7A 1G8IA 1DJGA 1A03A 1KCYA 1ALWA 2KPHA 4MVFA 4PHKA 4XJKB 1JFKA 5J3XA 1BG1A 1FF1A 1YRTB 1SMGA 5CSJA 2QDIA 1ALVA 1TCFA 2PALA 4M2PA 3SIBA 2KI4C 4A4CA 2FCDA 1Y0VH 2PQLA 3ICBA 4BY4A 3NSKA 4CFRA 1NCXA 1NX1A 2FCEA 4AQIA 2E6WA 2WCLA 2L5XB 3TZ1A
chains in the Genus database with same CATH topology
2LLSA 1QV1A 3LL8B 1OMRA 1EXRA 5GQQC 2R2IA 1NSHA 5PALA 2LVKA 3EK8A 2OS8B 4D1EA 1SCMB 2LANA 1LKJA 1QV0A 4DCKA 1G33A 1DF0B 5HLOA 2NLNA 3C1VA 3NSLA 5JJGA 1HQVA 3VROA 4QJ5B 1J7PA 1L7ZA 3OB1B 2LMVA 4C0KA 2KAVA 1X02A 2LUCA 1V1FA 1M31A 1QS7A 2KNEA 1MHOA 2F8PA 2M8UA 4OR9B 4XJKA 1F70A 3WHUB 1YVLA 2H2KA 1FI6A 2AUCA 3FWCA 3PSRA 5TNCA 1QX7A 3AKBA 5DKQA 1S36A 2B1UA 3I5FC 1SL9A 4CPVA 4NQGA 3BUMB 2WORA 2KBIA 1AVSA 2ISDA 3VRRA 1CKKA 1JUOA 1N0YA 1JWDA 4JWQA 5DKNA 1QLKA 5HKYA 2GGZA 1U5IB 4MZJA 1CM1A 4P2YB 1XK4A 1DF0A 1K2HA 1XVJA 2L2EA 1UUSA 2JXCA 1YTZC 4I5NB 4L9MA 2FOTA 1KFUL 2V53A 4WQ2A 4YGBB 3RM1A 1BLQA 3DVMA 3FIAA 1NYAA 3AAJA 1NX0A 1QJTA 2JULA 1FW4A 3AKAA 1M46A 5CPVA 1KK7Z 1OMDA 4YBHB 1WLMA 2L4IA 1YX7A 1DMOA 1QLSA 3I5HB 1FPWA 1MQ1A 4ZCVA 1NIWA 4I5LB 2M3WA 2WC8A 3LK0A 3BUOB 4NDCA 1EJ3A 4E68A 1NX2A 2LVJA 1CB1A 4IL1A 3O78A 2JT3A 1OMVA 1XFWO 5I2OA 1CLBA 1DTLA 2ZNEA 1MR8A 1TIZA 2L98A 4GPLB 1XA5A 3BUWB 1J7RA 5KTYA 2LMTA 4HRHA 3SG3A 4MZKA 1QX2A 3BQ3A 3VRQA 1CFDA 1LA3A 3EKJA 3TUYB 3TDUA 1LXFC 1C07A 1BU3A 1IQ5A 2Q4UA 1SY9A 3KF9A 1RFJA 1MUXA 1NPQA 1WRZA 2WCBA 1YURA 2NZ0A 1WDCB 1K93D 2OS8C 1MXLC 1MF8B 1SCMC 2KFHA 2NCOA 1YR5A 1OSAA 1S6CA 3I5IB 1F71A 1XK4C 3PN7B 5HKZA 5D7FA 1PRWA 1DT7B 2M1UA 3QRXA 1RROA 3KHEA 3A4UB 3BOWA 1RK9A 2M1KB 1K96A 4NDBA 4OV2A 1CLLA 2JNFA 3D0YA 2MLEC 2ZKMX 5I8NA 1UHJA 5B8IB 2LV7A 1Q80A 2ZFDA 4N5XA 1RWYA 2PASA 5DKRA 1QTXA 4M2QA 3TDZA 2Q91A 1B7TZ 3SG6A 2O5GA 4DRWA 1BOCA 3HX4A 1DGUA 1K94A 1K95A 2K8MB 4Q04A 1UURA 2BBNA 4UPGA 5CSIA 5ER4X 2JZIA 2BKIB 2Y1NA 1S6IA 2K7DA 1H8BA 1QXPA 2IS9A 1TN4A 2TN4A 4ZCUA 3SG4A 1AJ4A 1S6JA 4MEWA 4U8DA 4CFQA 1Y1UA 1V1GA 2L50A 4HRGA 2F2PA 4MLWA 3WHTB 4CLNA 1PULA 3BXKA 1J7OA 2K2FA 2LVVA 1ODBA 3VGOA 1M45A 1SKTA 5AANA 2NCPA 1F4QA 3NXAA 1CM4A 1ZACA 3I5HC 1PALA 1W7JB 1GJYA 1WRKA 2LLTA 1B4CA 1OE9B 2GV5A 2MLFC 1B8RA 3FWBA 2F3YA 4AOMA 1EL4A 1DJHA 1OQPA 4FQOA 1KK8B 2M49B 2MAZA 1DJYA 2QACA 1CDPA 1YUSA 4HREE 4N1GA 1JBAA 2HQWA 1DJXA 1F4OA 2WCEA 1RTP1 3O2PA 3SG2A 5HLVA 3TUYC 5IBWA 2K7BA 3GOFA 1KFUS 3K21A 4ORBB 1BODA 2K0JA 1ZOTB 1IJ6A 3PALA 1EG3A 2M7NA 1B1GA 4C0LA 3I5IC 2SCPA 3O4YA 2M7LA 2CTNA 5KSZA 1DJWA 3PN7C 4P5OE 2KGBC 4GGNA 4PHMA 1TRFA 3PM8A 1PSRA 1HT9A 4XYNA 3JTDB 2KFGA 5AERA 5BPJA 4PALA 5D69A 2LMUA 4YGAA 4F0ZB 4BY5A 1GGWA 1SK6D 2H61C 3VRPA 1A75B 4ETOA 4A4BA 1MWNA 1KQMB 2CXJA 1N65A 4DS7A 2LC5A 1KWOB 4WQ3A 5JOLA 1TTXA 3ZNIA 1DVIA 5I2LA 3DF0B 3SG7A 4GNKB 1NWDA 1TNWA 1Y1AA 1K9KA 2KI6C 2K7CA 1IH0A 2KBMA 1NCZA 2CT9A 4M2OA 1KFXS 2LP2A 1F54A 3GK1A 1ZFSA 2LVIA 4ICBA 2NXQA 1U5IA 4MN0A 1A2XA 1BJFA 2BCBA 1F55A 4CIDA 4DUQA 2KDHA 2FJUB 3SJSA 4PE0A 3ZWHA 2WOSA 3EK4A 5AXIA 3E3RA 1S3PA 4C0JA 1FI5A 2LCPA 1CLMA 1PSBA 2GGMA 1A75A 4GGFA 2JTTA 1AJ5A 5G08A 3HCMA 3NSOA 3CWGA 1UHNA 4OVNF 1CFPA 3JVTB 3EK7A 1LVCD 4QJ3B 1BF5A 2BE6A 3DVKA 1DJZA 2CCMA 4DIRA 1OZSA 1AUIB 2KAXA 1IGVA 1KK8C 1NP8A 2I18A 2JXLA 2A4JA 1BR1B 4JQ0D 2JT8A 2OTGB 5KU1A 2I7AA 4MRXA 2KQ6A 1LINA 2DOQA 3EVVA 1XFZO 5AFPA 5ER5A 1B8LA 1XFYO 1QATA 3MSEB 1UHHA 3KO0A 1K9PA 1QASA 1DGVA 3LK1A 2PMYA 1SL7A 4MBEA 2JRFA 1S5GY 2KSPA 4YGCB 3GK2A 1PK0D 1R2UA 2MA2A 3SIAA 4YI9A 1AP4A 4R1EA 5F6TA 5HKWA 3NSIA 3TDIA 4MRYA 5CSFA 3OHMB 3EKHA 2Y1MA 1SRAA 4MZLA 2HQ8A 1SW8A 1RJVA 3OP0A 3OX6A 1TNPA 4GGFC 4I5KA 3CS1A 1J1DA 1TOPA 1J7QA 1XYDA 1KQMC 2BKHB 2BE4A 2Y5IA 3FS7A 3IQQA 1KWOC 2M9GA 1KSOA 2H61A 2PVBA 2JPTA 4GAOA 1CFFA 1OOJA 2O60A 1CDNA 1ZMZA 3I5GB 5HYDA 2BL0B 4PCWA 1R6PA 1UHIA 1S1EA 1QVIY 1Y1XA 1L2OB 2M29A 4GBAA 1KSMA 1TNXA 1S26D 2KHNA 3CGAA 1J1EA 3WXAA 1W7IB 1SYMA 3CTNA 2F33A 1B8CA 2KAYA 1DJIA 1KQVA 1JSAA 1QIVA 2KFFA 3A8RA 3CR4X 1NUBA 4ORCB 1GQMA 2D8NA 2ZN9A 2MHHA 1EH2A 2EGDA 2JNXA 2LE9B 1K8UA 3F45A 3VRNA 1A4PA 2JOJA 1WDCC 2HF5A 2RGIA 2SASA 1Y6WA 1QIWA 2KOTA 3JVTC 2MJWB 4ORAB 1SPYA 4YRUA 2BBMA 1B9AA 1XFUO 1WRLA 2F3ZA 4GFTA 2LAPA 2LP3A 4FTGA 2OPOA 1SR6B 1IKUA 4PHJA 1PVBA 3TS5B 2M97A 2KYCA 2K2AA 5FYXA 1A29A 4AQJA 1RECA 1OZOA 2EC6B 2OTGC 4QJ4B 2JQ6A 1QX5B 3BYAA 2I94A 4PE7A 1SNLA 2L0PA 4GUKA 2LHIA 1WY9A 1YRUB 2LHLA 1J55A 3DVJA 2BECA 1NCYA 4HSZA 1JF2A 1E8AA 3PFVA 2CNPA 2KQYA 2KGRA 4OKHA 2WCFA 4TNCA 4JPZB 2G2BA 3DD4A 1XFVO 3CZTX 5K89A 3OB2B 1EG4A 1PVAA 3EVRA 1VRKA 1CDLA 3IQOA 1YX8A 4USLA 2KI4B 2MBXA 1M63B 2I2RE 1IWQA 1G4YR 2LM5A 2VRGA 2Y4QA 3SG5A 1YVHA 2JT0A 2K7OA 3H4SE 2KI6D 1SBJA 3PATA 2MRDA 1IRJA 3I5GC 1CNPA 2BL0C 1H4BA 1CDMA 1K90D 1KK7Y 3BOWB 2QPTA 3OX5A 4YGDB 5AEQA 1F8HA 1L2OC 2LUXA 2LLUA 1TNQA 1IG5A 3D0YB 3DF0A 3LCPC 5I2QA 4PE1A 2ZN8A 1LA0A 2PSRA 2L4HA 2M0RA 3CLNA 4NDDA 2LNKA 2AAOA 1IJ5A 1UWOA 2AMIA 1BR4B 3WNXB 1AK8A 2KYFA 2F2OA 3GK4X 3LLEA 2BCAA 1S5GZ 4MSPA 1SCVA 1BT6A 1M39A 2WNDA 3DVEA 1XO5A 3I5FB 1CMGA 4WRIA 1K9UA 3RLZA 1SL8A 3BUXB 4YGEB 1AHRA 1KFXL 2EHBA 4PDZA 1GGZA 2E30A 2HPSA 3O6BA 3PLFB 4N1FA 2P6BB 2JU0A 1UHKA 1IQ3A 1MXEA 5CSNA 2COLB 1SR6C 1B47A 1C7WA 1NX3A 1TCOB 1FBVA 1XFXO 3JTDC 3KPXA 3TS5C 2L51A 1C7VA 4OCIA 3KEVA 1UP5A 2EC6C 2BCXA 4PE4A 1BMOA 3CR5X 2JWWA 1YUTA 2JC2A 4YI8A 2ZRTA 1D1OA 1JF0A 1QVIZ 4I5JA 2K61A 1JC2A 4PHNA 2ZNDA 3CR2A 3M0WA 1CTRA 2PRUA 2G9BA 3BUNB 3EVUA 1JFJA 3D10A 2JTZA 1CFCA 2CBLA 1B7TY 1N2DA 1YUUA 2HETA 2ZRSA 3AAKA 1CMFA 1ZUZA 1WLZA 3IF7A 1G8IA 1DJGA 1A03A 1KCYA 1ALWA 4MVFA 4PHKA 4XJKB 5J3XA 1JFKA 1BG1A 1FF1A 1YRTB 1SMGA 5CSJA 3SIBA 1ALVA 1TCFA 2PALA 4M2PA 4A4CA 2KI4C 4BY4A 2FCDA 1Y0VH 3ICBA 3NSKA 4CFRA 1NCXA 1NX1A 2FCEA 4AQIA 2E6WA 2L5XB 3TZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLS A;  1QV1 A;  3LL8 B;  1OMR A;  1EXR A;  5GQQ C;  2R2I A;  1NSH A;  5PAL A;  2LVK A;  3EK8 A;  2OS8 B;  4D1E A;  1SCM B;  2LAN A;  1LKJ A;  1QV0 A;  4DCK A;  1G33 A;  1DF0 B;  5HLO A;  2NLN A;  3C1V A;  3NSL A;  5JJG A;  1HQV A;  3VRO A;  4QJ5 B;  1J7P A;  1L7Z A;  3OB1 B;  2LMV A;  4C0K A;  2KAV A;  1X02 A;  2LUC A;  1V1F A;  1M31 A;  1QS7 A;  2KNE A;  1MHO A;  2F8P A;  2M8U A;  4OR9 B;  4XJK A;  1F70 A;  3WHU B;  1YVL A;  2H2K A;  1FI6 A;  2AUC A;  3FWC A;  3PSR A;  5TNC A;  1QX7 A;  3AKB A;  5DKQ A;  1S36 A;  2B1U A;  3I5F C;  1SL9 A;  4CPV A;  4NQG A;  3BUM B;  2WOR A;  2KBI A;  1AVS A;  2ISD A;  3VRR A;  1CKK A;  1JUO A;  1N0Y A;  1JWD A;  4JWQ A;  5DKN A;  1QLK A;  5HKY A;  2GGZ A;  1U5I B;  4MZJ A;  1CM1 A;  4P2Y B;  1XK4 A;  1DF0 A;  1K2H A;  1XVJ A;  2L2E A;  1UUS A;  2JXC A;  1YTZ C;  4I5N B;  4L9M A;  2FOT A;  1KFU L;  2V53 A;  4WQ2 A;  4YGB B;  3RM1 A;  1BLQ A;  3DVM A;  3FIA A;  1NYA A;  3AAJ A;  1NX0 A;  1QJT A;  2JUL A;  1FW4 A;  3AKA A;  1M46 A;  5CPV A;  1KK7 Z;  1OMD A;  4YBH B;  1WLM A;  2L4I A;  1YX7 A;  1DMO A;  1QLS A;  3I5H B;  1FPW A;  1MQ1 A;  4ZCV A;  1NIW A;  4I5L B;  2M3W A;  2WC8 A;  3LK0 A;  3BUO B;  4NDC A;  1EJ3 A;  4E68 A;  1NX2 A;  2LVJ A;  1CB1 A;  4IL1 A;  3O78 A;  2JT3 A;  1OMV A;  1XFW O;  5I2O A;  1CLB A;  1DTL A;  2ZNE A;  1MR8 A;  1TIZ A;  2L98 A;  4GPL B;  1XA5 A;  3BUW B;  1J7R A;  5KTY A;  2LMT A;  4HRH A;  3SG3 A;  4MZK A;  1QX2 A;  3BQ3 A;  3VRQ A;  1CFD A;  1LA3 A;  3EKJ A;  3TUY B;  3TDU A;  1LXF C;  1C07 A;  1BU3 A;  1IQ5 A;  2Q4U A;  1SY9 A;  3KF9 A;  1RFJ A;  1MUX A;  1NPQ A;  1WRZ A;  2WCB A;  1YUR A;  2NZ0 A;  1WDC B;  1K93 D;  2OS8 C;  1MXL C;  1MF8 B;  1SCM C;  2KFH A;  2NCO A;  1YR5 A;  1OSA A;  1S6C A;  3I5I B;  1F71 A;  1XK4 C;  3PN7 B;  5HKZ A;  5D7F A;  1PRW A;  1DT7 B;  2M1U A;  3QRX A;  1RRO A;  3KHE A;  3A4U B;  3BOW A;  1RK9 A;  2M1K B;  1K96 A;  4NDB A;  4OV2 A;  1CLL A;  2JNF A;  3D0Y A;  2MLE C;  2ZKM X;  5I8N A;  1UHJ A;  5B8I B;  2LV7 A;  1Q80 A;  2ZFD A;  4N5X A;  1RWY A;  2PAS A;  5DKR A;  1QTX A;  4M2Q A;  3TDZ A;  2Q91 A;  1B7T Z;  3SG6 A;  2O5G A;  4DRW A;  1BOC A;  3HX4 A;  1DGU A;  1K94 A;  1K95 A;  2K8M B;  4Q04 A;  1UUR A;  2BBN A;  4UPG A;  5CSI A;  5ER4 X;  2JZI A;  2BKI B;  2Y1N A;  1S6I A;  2K7D A;  1H8B A;  1QXP A;  2IS9 A;  1TN4 A;  2TN4 A;  4ZCU A;  3SG4 A;  1AJ4 A;  1S6J A;  4MEW A;  4U8D A;  4CFQ A;  1Y1U A;  1V1G A;  2L50 A;  4HRG A;  2F2P A;  4MLW A;  3WHT B;  4CLN A;  1PUL A;  3BXK A;  1J7O A;  2K2F A;  2LVV A;  1ODB A;  3VGO A;  1M45 A;  1SKT A;  5AAN A;  2NCP A;  1F4Q A;  3NXA A;  1CM4 A;  1ZAC A;  3I5H C;  1PAL A;  1W7J B;  1GJY A;  1WRK A;  2LLT A;  1B4C A;  1OE9 B;  2GV5 A;  2MLF C;  1B8R A;  3FWB A;  2F3Y A;  4AOM A;  1EL4 A;  1DJH A;  1OQP A;  4FQO A;  1KK8 B;  2M49 B;  2MAZ A;  1DJY A;  2QAC A;  1CDP A;  1YUS A;  4HRE E;  4N1G A;  1JBA A;  2HQW A;  1DJX A;  1F4O A;  2WCE A;  1RTP 1;  3O2P A;  3SG2 A;  5HLV A;  3TUY C;  5IBW A;  2K7B A;  3GOF A;  1KFU S;  3K21 A;  4ORB B;  1BOD A;  2K0J A;  1ZOT B;  1IJ6 A;  3PAL A;  1EG3 A;  2M7N A;  1B1G A;  4C0L A;  3I5I C;  2SCP A;  3O4Y A;  2M7L A;  2CTN A;  5KSZ A;  1DJW A;  3PN7 C;  4P5O E;  2KGB C;  4GGN A;  4PHM A;  1TRF A;  3PM8 A;  1PSR A;  1HT9 A;  4XYN A;  3JTD B;  2KFG A;  5AER A;  5BPJ A;  4PAL A;  5D69 A;  2LMU A;  4YGA A;  4F0Z B;  4BY5 A;  1GGW A;  1SK6 D;  2H61 C;  3VRP A;  1A75 B;  4ETO A;  4A4B A;  1MWN A;  1KQM B;  2CXJ A;  1N65 A;  4DS7 A;  2LC5 A;  1KWO B;  4WQ3 A;  5JOL A;  1TTX A;  3ZNI A;  1DVI A;  5I2L A;  3DF0 B;  3SG7 A;  4GNK B;  1NWD A;  1TNW A;  1Y1A A;  1K9K A;  2KI6 C;  2K7C A;  1IH0 A;  2KBM A;  1NCZ A;  2CT9 A;  4M2O A;  1KFX S;  2LP2 A;  1F54 A;  3GK1 A;  1ZFS A;  2LVI A;  4ICB A;  2NXQ A;  1U5I A;  4MN0 A;  1A2X A;  1BJF A;  2BCB A;  1F55 A;  4CID A;  4DUQ A;  2KDH A;  2FJU B;  3SJS A;  4PE0 A;  3ZWH A;  2WOS A;  3EK4 A;  5AXI A;  3E3R A;  1S3P A;  4C0J A;  1FI5 A;  2LCP A;  1CLM A;  1PSB A;  2GGM A;  1A75 A;  4GGF A;  2JTT A;  1AJ5 A;  5G08 A;  3HCM A;  3NSO A;  3CWG A;  1UHN A;  4OVN F;  1CFP A;  3JVT B;  3EK7 A;  1LVC D;  4QJ3 B;  1BF5 A;  2BE6 A;  3DVK A;  1DJZ A;  2CCM A;  4DIR A;  1OZS A;  1AUI B;  2KAX A;  1IGV A;  1KK8 C;  1NP8 A;  2I18 A;  2JXL A;  2A4J A;  1BR1 B;  4JQ0 D;  2JT8 A;  2OTG B;  5KU1 A;  2I7A A;  4MRX A;  2KQ6 A;  1LIN A;  2DOQ A;  3EVV A;  1XFZ O;  5AFP A;  5ER5 A;  1B8L A;  1XFY O;  1QAT A;  3MSE B;  1UHH A;  3KO0 A;  1K9P A;  1QAS A;  1DGV A;  3LK1 A;  2PMY A;  1SL7 A;  4MBE A;  2JRF A;  1S5G Y;  2KSP A;  4YGC B;  3GK2 A;  1PK0 D;  1R2U A;  2MA2 A;  3SIA A;  4YI9 A;  1AP4 A;  4R1E A;  5F6T A;  5HKW A;  3NSI A;  3TDI A;  4MRY A;  5CSF A;  3OHM B;  3EKH A;  2Y1M A;  1SRA A;  4MZL A;  2HQ8 A;  1SW8 A;  1RJV A;  3OP0 A;  3OX6 A;  1TNP A;  4GGF C;  4I5K A;  3CS1 A;  1J1D A;  1TOP A;  1J7Q A;  1XYD A;  1KQM C;  2BKH B;  2BE4 A;  2Y5I A;  3FS7 A;  3IQQ A;  1KWO C;  2M9G A;  1KSO A;  2H61 A;  2PVB A;  2JPT A;  4GAO A;  1CFF A;  1OOJ A;  2O60 A;  1CDN A;  1ZMZ A;  3I5G B;  5HYD A;  2BL0 B;  4PCW A;  1R6P A;  1UHI A;  1S1E A;  1QVI Y;  1Y1X A;  1L2O B;  2M29 A;  4GBA A;  1KSM A;  1TNX A;  1S26 D;  2KHN A;  3CGA A;  1J1E A;  3WXA A;  1W7I B;  1SYM A;  3CTN A;  2F33 A;  1B8C A;  2KAY A;  1DJI A;  1KQV A;  1JSA A;  1QIV A;  2KFF A;  3A8R A;  3CR4 X;  1NUB A;  4ORC B;  1GQM A;  2D8N A;  2ZN9 A;  2MHH A;  1EH2 A;  2EGD A;  2JNX A;  2LE9 B;  1K8U A;  3F45 A;  3VRN A;  1A4P A;  2JOJ A;  1WDC C;  2HF5 A;  2RGI A;  2SAS A;  1Y6W A;  1QIW A;  2KOT A;  3JVT C;  2MJW B;  4ORA B;  1SPY A;  4YRU A;  2BBM A;  1B9A A;  1XFU O;  1WRL A;  2F3Z A;  4GFT A;  2LAP A;  2LP3 A;  4FTG A;  2OPO A;  1SR6 B;  1IKU A;  4PHJ A;  1PVB A;  3TS5 B;  2M97 A;  2KYC A;  2K2A A;  5FYX A;  1A29 A;  4AQJ A;  1REC A;  1OZO A;  2EC6 B;  2OTG C;  4QJ4 B;  2JQ6 A;  1QX5 B;  3BYA A;  2I94 A;  4PE7 A;  1SNL A;  2L0P A;  4GUK A;  2LHI A;  1WY9 A;  1YRU B;  2LHL A;  1J55 A;  3DVJ A;  2BEC A;  1NCY A;  4HSZ A;  1JF2 A;  1E8A A;  3PFV A;  2CNP A;  2KQY A;  2KGR A;  4OKH A;  2WCF A;  4TNC A;  4JPZ B;  2G2B A;  3DD4 A;  1XFV O;  3CZT X;  5K89 A;  3OB2 B;  1EG4 A;  1PVA A;  3EVR A;  1VRK A;  1CDL A;  3IQO A;  1YX8 A;  4USL A;  2KI4 B;  2MBX A;  1M63 B;  2I2R E;  1IWQ A;  1G4Y R;  2LM5 A;  2VRG A;  2Y4Q A;  3SG5 A;  1YVH A;  2JT0 A;  2K7O A;  3H4S E;  2KI6 D;  1SBJ A;  3PAT A;  2MRD A;  1IRJ A;  3I5G C;  1CNP A;  2BL0 C;  1H4B A;  1CDM A;  1K90 D;  1KK7 Y;  3BOW B;  2QPT A;  3OX5 A;  4YGD B;  5AEQ A;  1F8H A;  1L2O C;  2LUX A;  2LLU A;  1TNQ A;  1IG5 A;  3D0Y B;  3DF0 A;  3LCP C;  5I2Q A;  4PE1 A;  2ZN8 A;  1LA0 A;  2PSR A;  2L4H A;  2M0R A;  3CLN A;  4NDD A;  2LNK A;  2AAO A;  1IJ5 A;  1UWO A;  2AMI A;  1BR4 B;  3WNX B;  1AK8 A;  2KYF A;  2F2O A;  3GK4 X;  3LLE A;  2BCA A;  1S5G Z;  4MSP A;  1SCV A;  1BT6 A;  1M39 A;  2WND A;  3DVE A;  1XO5 A;  3I5F B;  1CMG A;  4WRI A;  1K9U A;  3RLZ A;  1SL8 A;  3BUX B;  4YGE B;  1AHR A;  1KFX L;  2EHB A;  4PDZ A;  1GGZ A;  2E30 A;  2HPS A;  3O6B A;  3PLF B;  4N1F A;  2P6B B;  2JU0 A;  1UHK A;  1IQ3 A;  1MXE A;  5CSN A;  2COL B;  1SR6 C;  1B47 A;  1C7W A;  1NX3 A;  1TCO B;  1FBV A;  1XFX O;  3JTD C;  3KPX A;  3TS5 C;  2L51 A;  1C7V A;  4OCI A;  3KEV A;  1UP5 A;  2EC6 C;  2BCX A;  4PE4 A;  1BMO A;  3CR5 X;  2JWW A;  1YUT A;  2JC2 A;  4YI8 A;  2ZRT A;  1D1O A;  1JF0 A;  1QVI Z;  4I5J A;  2K61 A;  1JC2 A;  4PHN A;  2ZND A;  3CR2 A;  3M0W A;  1CTR A;  2PRU A;  2G9B A;  3BUN B;  3EVU A;  1JFJ A;  3D10 A;  2JTZ A;  1CFC A;  2CBL A;  1B7T Y;  1N2D A;  1YUU A;  2HET A;  2ZRS A;  3AAK A;  1CMF A;  1ZUZ A;  1WLZ A;  3IF7 A;  1G8I A;  1DJG A;  1A03 A;  1KCY A;  1ALW A;  4MVF A;  4PHK A;  4XJK B;  5J3X A;  1JFK A;  1BG1 A;  1FF1 A;  1YRT B;  1SMG A;  5CSJ A;  3SIB A;  1ALV A;  1TCF A;  2PAL A;  4M2P A;  4A4C A;  2KI4 C;  4BY4 A;  2FCD A;  1Y0V H;  3ICB A;  3NSK A;  4CFR A;  1NCX A;  1NX1 A;  2FCE A;  4AQI A;  2E6W A;  2L5X B;  3TZ1 A; 
#chains in the Genus database with same CATH topology
 2LLS A;  1QV1 A;  3LL8 B;  1P28 A;  1OMR A;  1EXR A;  5GQQ C;  2R2I A;  1NSH A;  5PAL A;  2LVK A;  3EK8 A;  2OS8 B;  5D3O A;  4D1E A;  1DEK A;  1SCM B;  2LAN A;  1LKJ A;  1QV0 A;  3V2L A;  4DCK A;  3S0E A;  1G33 A;  1DF0 B;  5HLO A;  2NLN A;  3C1V A;  3NSL A;  5JJG A;  1HQV A;  4PT1 A;  3VRO A;  4QJ5 B;  1J7P A;  1L7Z A;  3OB1 B;  2LMV A;  4C0K A;  2KAV A;  1X02 A;  3CZ0 A;  2LUC A;  1V1F A;  1M31 A;  1QS7 A;  2KNE A;  3OBV A;  1MHO A;  2F8P A;  2M8U A;  4OR9 B;  4XJK A;  1F70 A;  3WHU B;  1YVL A;  2H2K A;  1FI6 A;  2AUC A;  3FWC A;  3PSR A;  5TNC A;  1QX7 A;  3D78 A;  3AKB A;  5DKQ A;  1S36 A;  3OGN A;  3S0G A;  2B1U A;  3DZT A;  1SL9 A;  3I5F C;  4CPV A;  4NQG A;  3BUM B;  2WOR A;  2KBI A;  1AVS A;  2ISD A;  5DIC A;  3VRR A;  1JUO A;  1N0Y A;  4JD9 A;  1CKK A;  3SS5 A;  4JWQ A;  5DKN A;  1QLK A;  1JWD A;  5HKY A;  2GGZ A;  1U5I B;  4MZJ A;  3CDN A;  1CM1 A;  4P2Y B;  1XK4 A;  1DF0 A;  1K2H A;  1XVJ A;  2L2E A;  2QEH A;  1UUS A;  2BNX A;  1YTZ C;  2JXC A;  4I5N B;  2FOT A;  1KFU L;  2V53 A;  4L9M A;  4WQ2 A;  3IVT A;  3RM1 A;  3SS3 A;  3DVM A;  3FIA A;  1NYA A;  3AAJ A;  1NX0 A;  1QJT A;  2JUL A;  1FW4 A;  3CAB A;  3AKA A;  1M46 A;  3BFH A;  5CPV A;  1KK7 Z;  1OMD A;  4YBH B;  1WLM A;  2L4I A;  1YX7 A;  5FI2 A;  1DMO A;  1QLS A;  3I5H B;  1FPW A;  1MQ1 A;  4ZCV A;  1NIW A;  4I5L B;  2M3W A;  2WC8 A;  3LK0 A;  3BUO B;  4NDC A;  1EJ3 A;  4E68 A;  3PJI A;  1NX2 A;  2LVJ A;  2WCJ A;  1CB1 A;  1QWV A;  4IL1 A;  3O78 A;  2JT3 A;  1OMV A;  1XFW O;  5I2O A;  1CLB A;  1DTL A;  2ZNE A;  1MR8 A;  1TIZ A;  2L98 A;  4GPL B;  1XA5 A;  3BUW B;  1J7R A;  5KTY A;  2LMT A;  4HRH A;  3SG3 A;  4MZK A;  1QX2 A;  3BQ3 A;  3VRQ A;  1CFD A;  1LA3 A;  3R1V A;  3EKJ A;  3TUY B;  3TDU A;  1LXF C;  3NHT A;  1C07 A;  1BU3 A;  2FJY A;  1IQ5 A;  2Q4U A;  1SY9 A;  3KF9 A;  1RFJ A;  1MUX A;  1NPQ A;  1WRZ A;  2WCB A;  1YUR A;  2NZ0 A;  3CZ1 A;  1WDC B;  1K93 D;  3NHI A;  2OS8 C;  1MXL C;  1MF8 B;  1SCM C;  2KFH A;  2NCO A;  1YR5 A;  1OSA A;  1S6C A;  3I5I B;  1F71 A;  1XK4 C;  3PN7 B;  5HKZ A;  5D7F A;  1PRW A;  1DT7 B;  2M1U A;  3QRX A;  1RRO A;  3KHE A;  3A4U B;  3BOW A;  1RK9 A;  2M1K B;  1K96 A;  4NDB A;  4OV2 A;  3RZS A;  1CLL A;  2JNF A;  3S0A A;  3D0Y A;  2MLE C;  2ZKM X;  5I8N A;  1UHJ A;  4OZD A;  5B8I B;  2LV7 A;  1Q80 A;  2ZFD A;  4N5X A;  1RWY A;  2PAS A;  5DKR A;  1QTX A;  4M2Q A;  3TDZ A;  2Q91 A;  1B7T Z;  3BJH A;  2O5G A;  2P70 A;  3SG6 A;  4DRW A;  1BOC A;  3HX4 A;  1DGU A;  1K94 A;  1K95 A;  1C3Y A;  2K8M B;  4Q04 A;  1DQE A;  1UUR A;  2BBN A;  2GTE A;  4UPG A;  5CSI A;  5ER4 X;  2JZI A;  2BKI B;  2Y1N A;  1S6I A;  2K7D A;  1H8B A;  1QXP A;  2IS9 A;  1TN4 A;  2TN4 A;  4ZCU A;  3SG4 A;  1AJ4 A;  1S6J A;  5EL2 A;  4JKT A;  4MEW A;  1OW4 A;  4U8D A;  1C3Z A;  4CFQ A;  1Y1U A;  1V1G A;  2L50 A;  4HRG A;  2F2P A;  4MLW A;  3WHT B;  4CLN A;  1PUL A;  3B86 A;  3BXK A;  3S0D A;  1DC1 A;  1J7O A;  3SS4 A;  2K2F A;  2LVV A;  1ODB A;  3VGO A;  1M45 A;  1SKT A;  5AAN A;  2NCP A;  1F4Q A;  3NXA A;  1CM4 A;  4IJ7 A;  1ZAC A;  3I5H C;  3O4X A;  1PAL A;  1W7J B;  1GJY A;  1WRK A;  2LLT A;  1B4C A;  1OE9 B;  4INW A;  1GM0 A;  2GV5 A;  2MLF C;  3UNW A;  1B8R A;  3FWB A;  2F3Y A;  4AOM A;  1EL4 A;  1DJH A;  1OQP A;  4FQO A;  1KK8 B;  2M49 B;  2MAZ A;  1DJY A;  2QAC A;  1CDP A;  1YUS A;  3K1E A;  4HRE E;  4N1G A;  1JBA A;  2HQW A;  1DJX A;  1F4O A;  2WCE A;  1RTP 1;  3FE8 A;  3O2P A;  3SG2 A;  5HLV A;  3TUY C;  5IBW A;  2K7B A;  3GOF A;  1KFU S;  1W9Z A;  3K21 A;  4ORB B;  1BOD A;  2K0J A;  1ZOT B;  1BLQ A;  1IJ6 A;  2WC6 A;  3PAL A;  1EG3 A;  2M7N A;  1B1G A;  4C0L A;  2P71 A;  3I5I C;  2SCP A;  3O4Y A;  2M7L A;  2CTN A;  5KSZ A;  1DEL A;  1DJW A;  3PN7 C;  4P5O E;  2KGB C;  4GGN A;  4PHM A;  1TRF A;  3PM8 A;  1PSR A;  5FI7 A;  1HT9 A;  4XYN A;  1OOH A;  1OOF A;  3JTD B;  3PM2 A;  2KFG A;  3R72 A;  5AER A;  5BPJ A;  4PAL A;  3B88 A;  5D69 A;  2LMU A;  4YGA A;  4F0Z B;  4BY5 A;  1GGW A;  1SK6 D;  2H61 C;  3VRP A;  1A75 B;  4ETO A;  4A4B A;  1MWN A;  1KQM B;  2CXJ A;  1N65 A;  4DS7 A;  2LC5 A;  1KWO B;  4WQ3 A;  5JOL A;  1TTX A;  3ZNI A;  1DVI A;  5I2L A;  3DF0 B;  3SG7 A;  4GNK B;  1NWD A;  1TNW A;  1Y1A A;  1K9K A;  2KI6 C;  2K7C A;  1IH0 A;  2KBM A;  1NCZ A;  2CT9 A;  4M2O A;  1KFX S;  2LP2 A;  1F54 A;  3GK1 A;  1ZFS A;  2LVI A;  4ICB A;  2NXQ A;  1U5I A;  4MN0 A;  1A2X A;  1BJF A;  2BCB A;  1F55 A;  1OOI X;  4CID A;  2KDH A;  2FJU B;  4DUQ A;  3SJS A;  4PE0 A;  3ZWH A;  2WOS A;  3D73 A;  3EK4 A;  3E3R A;  1S3P A;  5AXI A;  4C0J A;  2LCP A;  1FI5 A;  3B87 A;  1CLM A;  1PSB A;  2GGM A;  1A75 A;  5FI6 A;  4GGF A;  2JTT A;  1Z2C B;  1AJ5 A;  5G08 A;  3HCM A;  3NSO A;  3CWG A;  3R1P A;  1UHN A;  4OVN F;  1CFP A;  3JVT B;  3EK7 A;  1LVC D;  4QJ3 B;  2BAP A;  3VB1 A;  1BF5 A;  2BE6 A;  3DVK A;  1DJZ A;  2CCM A;  1SSE B;  4DIR A;  1OZS A;  1AUI B;  2KAX A;  1IGV A;  1KK8 C;  1NP8 A;  2I18 A;  2JXL A;  1OOG A;  2KLE A;  2A4J A;  2WCH A;  1BR1 B;  3Q8I A;  4JQ0 D;  2JT8 A;  2OTG B;  5KU1 A;  2I7A A;  3DY9 A;  4MRX A;  2KQ6 A;  1LIN A;  2DOQ A;  3EVV A;  1XFZ O;  5AFP A;  5ER5 A;  1B8L A;  1XFY O;  1QAT A;  3MSE B;  4FQT A;  1UHH A;  3KO0 A;  1K9P A;  1QAS A;  1DGV A;  3LK1 A;  2PMY A;  1SL7 A;  3S0F A;  4MBE A;  2JRF A;  1S5G Y;  2KSP A;  4YGC B;  5HL1 A;  3GK2 A;  1PK0 D;  1R2U A;  2MA2 A;  3SIA A;  4YI9 A;  1AP4 A;  3B6X A;  4R1E A;  5F6T A;  5HKW A;  3NSI A;  3TDI A;  3L47 A;  4MRY A;  5CSF A;  3OHM B;  3EKH A;  1ORG A;  2Y1M A;  1SRA A;  4MZL A;  2HQ8 A;  2K60 A;  1SW8 A;  1RJV A;  3OP0 A;  3OX6 A;  1TNP A;  4GGF C;  4I5K A;  3CS1 A;  3N7H A;  1J1D A;  1TOP A;  4KYN A;  1J7Q A;  1XYD A;  1KQM C;  2BKH B;  2BE4 A;  2Y5I A;  3FE9 A;  3FS7 A;  3IQQ A;  1KWO C;  2M9G A;  1KSO A;  3QME A;  2H61 A;  2PVB A;  2JPT A;  4GAO A;  2H8V A;  1CFF A;  1OOJ A;  2JPO A;  2O60 A;  1CDN A;  1ZMZ A;  3I5G B;  5HYD A;  2BL0 B;  4PCW A;  1R6P A;  3BFA A;  1UHI A;  1S1E A;  1QVI Y;  1Y1X A;  3FE6 A;  1L2O B;  2M29 A;  4GBA A;  1KSM A;  1TNX A;  1S26 D;  2KHN A;  4YGB B;  3CGA A;  1J1E A;  3WXA A;  1W7I B;  1SYM A;  3CTN A;  2F33 A;  1B8C A;  2KAY A;  1DJI A;  1KQV A;  1JSA A;  2L2C A;  1QIV A;  2KFF A;  3A8R A;  3DXL A;  3CR4 X;  1NUB A;  4ORC B;  1GQM A;  2D8N A;  2ZN9 A;  2MHH A;  1EH2 A;  2EGD A;  2JNX A;  2WCM A;  2LE9 B;  1K8U A;  3F45 A;  3VRN A;  3B7A A;  1A4P A;  2JOJ A;  1WDC C;  3R1O A;  2HF5 A;  2RGI A;  2SAS A;  1Y6W A;  1QIW A;  2KOT A;  3JVT C;  2MJW B;  4ORA B;  2L5Y A;  3EG5 B;  1SPY A;  4YRU A;  2BBM A;  1IIO A;  1B9A A;  1XFU O;  1WRL A;  2F3Z A;  4GFT A;  2LAP A;  2LP3 A;  4FTG A;  2OPO A;  1SR6 B;  1IKU A;  4INX A;  1PVB A;  4PHJ A;  2M97 A;  2KYC A;  3TS5 B;  2K2A A;  2ERB A;  1A29 A;  3D76 A;  1REC A;  1OZO A;  5FYX A;  4AQJ A;  2EC6 B;  2OTG C;  2WC5 A;  4QJ4 B;  2JQ6 A;  1QX5 B;  3NGV A;  3DYE A;  3BYA A;  3L4A A;  2I94 A;  4PE7 A;  5I94 A;  1SNL A;  2L0P A;  4GUK A;  2LHI A;  3D75 A;  1WY9 A;  1YRU B;  2LHL A;  1J55 A;  2YGU A;  3DVJ A;  2BEC A;  1NCY A;  2PYQ A;  4HSZ A;  1JF2 A;  1E8A A;  3PFV A;  2CNP A;  2KQY A;  2KGR A;  4OKH A;  2WCK A;  2WCF A;  4TNC A;  3D74 A;  4JPZ B;  2G2B A;  3BFB A;  3DD4 A;  1XFV O;  3CZT X;  5K89 A;  3OB2 B;  1EG4 A;  1PVA A;  3EVR A;  1VRK A;  1CDL A;  3IQO A;  1YX8 A;  4USL A;  2KI4 B;  2MBX A;  1M63 B;  2I2R E;  1IWQ A;  1G4Y R;  1LS8 A;  2LM5 A;  2VRG A;  2Y4Q A;  3SG5 A;  1YVH A;  3L4L A;  2JT0 A;  2K7O A;  3H4S E;  2KI6 D;  1SBJ A;  3PAT A;  2MRD A;  1IRJ A;  1T14 A;  1TUZ A;  3I5G C;  1CNP A;  1Z4H A;  2BL0 C;  1CDM A;  1H4B A;  1K90 D;  1KK7 Y;  3BOW B;  2QPT A;  3OX5 A;  4YGD B;  5AEQ A;  1F8H A;  1L2O C;  2LUX A;  2LLU A;  1TNQ A;  1IG5 A;  3D0Y B;  3DF0 A;  3LCP C;  5I2Q A;  4PE1 A;  2ZN8 A;  1LA0 A;  2PSR A;  3UO9 A;  2L4H A;  2M0R A;  3CLN A;  4NDD A;  2LNK A;  1TUJ A;  2AAO A;  1IJ5 A;  1UWO A;  2AMI A;  1BR4 B;  3WNX B;  4F7F A;  1AK8 A;  2KYF A;  2F2O A;  3GK4 X;  3LLE A;  2BCA A;  1S5G Z;  4MSP A;  1SCV A;  1BT6 A;  1M39 A;  2WND A;  3DVE A;  1XO5 A;  3I5F B;  1CMG A;  4WRI A;  1K9U A;  2QEV A;  3RLZ A;  1SL8 A;  3BUX B;  4YGE B;  1AHR A;  1KFX L;  2EHB A;  4PDZ A;  1GGZ A;  2E30 A;  2HPS A;  3O6B A;  3PLF B;  4N1F A;  2P6B B;  2JU0 A;  1UHK A;  1IQ3 A;  1MXE A;  2QEB A;  5CSN A;  3CYZ A;  2COL B;  1SR6 C;  1B47 A;  1C7W A;  1NX3 A;  1TCO B;  1FBV A;  1XFX O;  3JTD C;  3KPX A;  3TS5 C;  2L51 A;  1C7V A;  4OCI A;  1XFR A;  1UP5 A;  2EC6 C;  3KEV A;  2BCX A;  4PE4 A;  1BMO A;  3CR5 X;  2JWW A;  2KLD A;  1YUT A;  2JC2 A;  4YI8 A;  2ZRT A;  1D1O A;  1JF0 A;  1QVI Z;  4I5J A;  2K61 A;  2QEO A;  1JC2 A;  4PHN A;  2ZND A;  3S0B A;  3CR2 A;  3CZ2 A;  3M0W A;  1CTR A;  2PRU A;  2G9B A;  3BUN B;  3EVU A;  3D77 A;  1JFJ A;  3D10 A;  2JTZ A;  1CFC A;  1B7T Y;  1N2D A;  1TWO A;  1YUU A;  2CBL A;  2HET A;  2ZRS A;  3AAK A;  1CMF A;  1ZUZ A;  1WLZ A;  3IF7 A;  1G8I A;  1DJG A;  1A03 A;  1KCY A;  1ALW A;  2KPH A;  4MVF A;  4PHK A;  4XJK B;  1JFK A;  5J3X A;  1BG1 A;  1FF1 A;  1YRT B;  1SMG A;  5CSJ A;  2QDI A;  1ALV A;  1TCF A;  2PAL A;  4M2P A;  3SIB A;  2KI4 C;  4A4C A;  2FCD A;  1Y0V H;  2PQL A;  3ICB A;  4BY4 A;  3NSK A;  4CFR A;  1NCX A;  1NX1 A;  2FCE A;  4AQI A;  2E6W A;  2WCL A;  2L5X B;  3TZ1 A; 
#chains in the Genus database with same CATH homology
 2LLS A;  1QV1 A;  3LL8 B;  1OMR A;  1EXR A;  5GQQ C;  2R2I A;  1NSH A;  5PAL A;  2LVK A;  3EK8 A;  2OS8 B;  4D1E A;  1SCM B;  2LAN A;  1LKJ A;  1QV0 A;  4DCK A;  1G33 A;  1DF0 B;  5HLO A;  2NLN A;  3C1V A;  3NSL A;  5JJG A;  1HQV A;  3VRO A;  4QJ5 B;  1J7P A;  1L7Z A;  3OB1 B;  2LMV A;  4C0K A;  2KAV A;  1X02 A;  2LUC A;  1V1F A;  1M31 A;  1QS7 A;  2KNE A;  1MHO A;  2F8P A;  2M8U A;  4OR9 B;  4XJK A;  1F70 A;  3WHU B;  1YVL A;  2H2K A;  1FI6 A;  2AUC A;  3FWC A;  3PSR A;  5TNC A;  1QX7 A;  3AKB A;  5DKQ A;  1S36 A;  2B1U A;  3I5F C;  1SL9 A;  4CPV A;  4NQG A;  3BUM B;  2WOR A;  2KBI A;  1AVS A;  2ISD A;  3VRR A;  1CKK A;  1JUO A;  1N0Y A;  1JWD A;  4JWQ A;  5DKN A;  1QLK A;  5HKY A;  2GGZ A;  1U5I B;  4MZJ A;  1CM1 A;  4P2Y B;  1XK4 A;  1DF0 A;  1K2H A;  1XVJ A;  2L2E A;  1UUS A;  2JXC A;  1YTZ C;  4I5N B;  4L9M A;  2FOT A;  1KFU L;  2V53 A;  4WQ2 A;  4YGB B;  3RM1 A;  1BLQ A;  3DVM A;  3FIA A;  1NYA A;  3AAJ A;  1NX0 A;  1QJT A;  2JUL A;  1FW4 A;  3AKA A;  1M46 A;  5CPV A;  1KK7 Z;  1OMD A;  4YBH B;  1WLM A;  2L4I A;  1YX7 A;  1DMO A;  1QLS A;  3I5H B;  1FPW A;  1MQ1 A;  4ZCV A;  1NIW A;  4I5L B;  2M3W A;  2WC8 A;  3LK0 A;  3BUO B;  4NDC A;  1EJ3 A;  4E68 A;  1NX2 A;  2LVJ A;  1CB1 A;  4IL1 A;  3O78 A;  2JT3 A;  1OMV A;  1XFW O;  5I2O A;  1CLB A;  1DTL A;  2ZNE A;  1MR8 A;  1TIZ A;  2L98 A;  4GPL B;  1XA5 A;  3BUW B;  1J7R A;  5KTY A;  2LMT A;  4HRH A;  3SG3 A;  4MZK A;  1QX2 A;  3BQ3 A;  3VRQ A;  1CFD A;  1LA3 A;  3EKJ A;  3TUY B;  3TDU A;  1LXF C;  1C07 A;  1BU3 A;  1IQ5 A;  2Q4U A;  1SY9 A;  3KF9 A;  1RFJ A;  1MUX A;  1NPQ A;  1WRZ A;  2WCB A;  1YUR A;  2NZ0 A;  1WDC B;  1K93 D;  2OS8 C;  1MXL C;  1MF8 B;  1SCM C;  2KFH A;  2NCO A;  1YR5 A;  1OSA A;  1S6C A;  3I5I B;  1F71 A;  1XK4 C;  3PN7 B;  5HKZ A;  5D7F A;  1PRW A;  1DT7 B;  2M1U A;  3QRX A;  1RRO A;  3KHE A;  3A4U B;  3BOW A;  1RK9 A;  2M1K B;  1K96 A;  4NDB A;  4OV2 A;  1CLL A;  2JNF A;  3D0Y A;  2MLE C;  2ZKM X;  5I8N A;  1UHJ A;  5B8I B;  2LV7 A;  1Q80 A;  2ZFD A;  4N5X A;  1RWY A;  2PAS A;  5DKR A;  1QTX A;  4M2Q A;  3TDZ A;  2Q91 A;  1B7T Z;  3SG6 A;  2O5G A;  4DRW A;  1BOC A;  3HX4 A;  1DGU A;  1K94 A;  1K95 A;  2K8M B;  4Q04 A;  1UUR A;  2BBN A;  4UPG A;  5CSI A;  5ER4 X;  2JZI A;  2BKI B;  2Y1N A;  1S6I A;  2K7D A;  1H8B A;  1QXP A;  2IS9 A;  1TN4 A;  2TN4 A;  4ZCU A;  3SG4 A;  1AJ4 A;  1S6J A;  4MEW A;  4U8D A;  4CFQ A;  1Y1U A;  1V1G A;  2L50 A;  4HRG A;  2F2P A;  4MLW A;  3WHT B;  4CLN A;  1PUL A;  3BXK A;  1J7O A;  2K2F A;  2LVV A;  1ODB A;  3VGO A;  1M45 A;  1SKT A;  5AAN A;  2NCP A;  1F4Q A;  3NXA A;  1CM4 A;  1ZAC A;  3I5H C;  1PAL A;  1W7J B;  1GJY A;  1WRK A;  2LLT A;  1B4C A;  1OE9 B;  2GV5 A;  2MLF C;  1B8R A;  3FWB A;  2F3Y A;  4AOM A;  1EL4 A;  1DJH A;  1OQP A;  4FQO A;  1KK8 B;  2M49 B;  2MAZ A;  1DJY A;  2QAC A;  1CDP A;  1YUS A;  4HRE E;  4N1G A;  1JBA A;  2HQW A;  1DJX A;  1F4O A;  2WCE A;  1RTP 1;  3O2P A;  3SG2 A;  5HLV A;  3TUY C;  5IBW A;  2K7B A;  3GOF A;  1KFU S;  3K21 A;  4ORB B;  1BOD A;  2K0J A;  1ZOT B;  1IJ6 A;  3PAL A;  1EG3 A;  2M7N A;  1B1G A;  4C0L A;  3I5I C;  2SCP A;  3O4Y A;  2M7L A;  2CTN A;  5KSZ A;  1DJW A;  3PN7 C;  4P5O E;  2KGB C;  4GGN A;  4PHM A;  1TRF A;  3PM8 A;  1PSR A;  1HT9 A;  4XYN A;  3JTD B;  2KFG A;  5AER A;  5BPJ A;  4PAL A;  5D69 A;  2LMU A;  4YGA A;  4F0Z B;  4BY5 A;  1GGW A;  1SK6 D;  2H61 C;  3VRP A;  1A75 B;  4ETO A;  4A4B A;  1MWN A;  1KQM B;  2CXJ A;  1N65 A;  4DS7 A;  2LC5 A;  1KWO B;  4WQ3 A;  5JOL A;  1TTX A;  3ZNI A;  1DVI A;  5I2L A;  3DF0 B;  3SG7 A;  4GNK B;  1NWD A;  1TNW A;  1Y1A A;  1K9K A;  2KI6 C;  2K7C A;  1IH0 A;  2KBM A;  1NCZ A;  2CT9 A;  4M2O A;  1KFX S;  2LP2 A;  1F54 A;  3GK1 A;  1ZFS A;  2LVI A;  4ICB A;  2NXQ A;  1U5I A;  4MN0 A;  1A2X A;  1BJF A;  2BCB A;  1F55 A;  4CID A;  4DUQ A;  2KDH A;  2FJU B;  3SJS A;  4PE0 A;  3ZWH A;  2WOS A;  3EK4 A;  5AXI A;  3E3R A;  1S3P A;  4C0J A;  1FI5 A;  2LCP A;  1CLM A;  1PSB A;  2GGM A;  1A75 A;  4GGF A;  2JTT A;  1AJ5 A;  5G08 A;  3HCM A;  3NSO A;  3CWG A;  1UHN A;  4OVN F;  1CFP A;  3JVT B;  3EK7 A;  1LVC D;  4QJ3 B;  1BF5 A;  2BE6 A;  3DVK A;  1DJZ A;  2CCM A;  4DIR A;  1OZS A;  1AUI B;  2KAX A;  1IGV A;  1KK8 C;  1NP8 A;  2I18 A;  2JXL A;  2A4J A;  1BR1 B;  4JQ0 D;  2JT8 A;  2OTG B;  5KU1 A;  2I7A A;  4MRX A;  2KQ6 A;  1LIN A;  2DOQ A;  3EVV A;  1XFZ O;  5AFP A;  5ER5 A;  1B8L A;  1XFY O;  1QAT A;  3MSE B;  1UHH A;  3KO0 A;  1K9P A;  1QAS A;  1DGV A;  3LK1 A;  2PMY A;  1SL7 A;  4MBE A;  2JRF A;  1S5G Y;  2KSP A;  4YGC B;  3GK2 A;  1PK0 D;  1R2U A;  2MA2 A;  3SIA A;  4YI9 A;  1AP4 A;  4R1E A;  5F6T A;  5HKW A;  3NSI A;  3TDI A;  4MRY A;  5CSF A;  3OHM B;  3EKH A;  2Y1M A;  1SRA A;  4MZL A;  2HQ8 A;  1SW8 A;  1RJV A;  3OP0 A;  3OX6 A;  1TNP A;  4GGF C;  4I5K A;  3CS1 A;  1J1D A;  1TOP A;  1J7Q A;  1XYD A;  1KQM C;  2BKH B;  2BE4 A;  2Y5I A;  3FS7 A;  3IQQ A;  1KWO C;  2M9G A;  1KSO A;  2H61 A;  2PVB A;  2JPT A;  4GAO A;  1CFF A;  1OOJ A;  2O60 A;  1CDN A;  1ZMZ A;  3I5G B;  5HYD A;  2BL0 B;  4PCW A;  1R6P A;  1UHI A;  1S1E A;  1QVI Y;  1Y1X A;  1L2O B;  2M29 A;  4GBA A;  1KSM A;  1TNX A;  1S26 D;  2KHN A;  3CGA A;  1J1E A;  3WXA A;  1W7I B;  1SYM A;  3CTN A;  2F33 A;  1B8C A;  2KAY A;  1DJI A;  1KQV A;  1JSA A;  1QIV A;  2KFF A;  3A8R A;  3CR4 X;  1NUB A;  4ORC B;  1GQM A;  2D8N A;  2ZN9 A;  2MHH A;  1EH2 A;  2EGD A;  2JNX A;  2LE9 B;  1K8U A;  3F45 A;  3VRN A;  1A4P A;  2JOJ A;  1WDC C;  2HF5 A;  2RGI A;  2SAS A;  1Y6W A;  1QIW A;  2KOT A;  3JVT C;  2MJW B;  4ORA B;  1SPY A;  4YRU A;  2BBM A;  1B9A A;  1XFU O;  1WRL A;  2F3Z A;  4GFT A;  2LAP A;  2LP3 A;  4FTG A;  2OPO A;  1SR6 B;  1IKU A;  4PHJ A;  1PVB A;  3TS5 B;  2M97 A;  2KYC A;  2K2A A;  5FYX A;  1A29 A;  4AQJ A;  1REC A;  1OZO A;  2EC6 B;  2OTG C;  4QJ4 B;  2JQ6 A;  1QX5 B;  3BYA A;  2I94 A;  4PE7 A;  1SNL A;  2L0P A;  4GUK A;  2LHI A;  1WY9 A;  1YRU B;  2LHL A;  1J55 A;  3DVJ A;  2BEC A;  1NCY A;  4HSZ A;  1JF2 A;  1E8A A;  3PFV A;  2CNP A;  2KQY A;  2KGR A;  4OKH A;  2WCF A;  4TNC A;  4JPZ B;  2G2B A;  3DD4 A;  1XFV O;  3CZT X;  5K89 A;  3OB2 B;  1EG4 A;  1PVA A;  3EVR A;  1VRK A;  1CDL A;  3IQO A;  1YX8 A;  4USL A;  2KI4 B;  2MBX A;  1M63 B;  2I2R E;  1IWQ A;  1G4Y R;  2LM5 A;  2VRG A;  2Y4Q A;  3SG5 A;  1YVH A;  2JT0 A;  2K7O A;  3H4S E;  2KI6 D;  1SBJ A;  3PAT A;  2MRD A;  1IRJ A;  3I5G C;  1CNP A;  2BL0 C;  1H4B A;  1CDM A;  1K90 D;  1KK7 Y;  3BOW B;  2QPT A;  3OX5 A;  4YGD B;  5AEQ A;  1F8H A;  1L2O C;  2LUX A;  2LLU A;  1TNQ A;  1IG5 A;  3D0Y B;  3DF0 A;  3LCP C;  5I2Q A;  4PE1 A;  2ZN8 A;  1LA0 A;  2PSR A;  2L4H A;  2M0R A;  3CLN A;  4NDD A;  2LNK A;  2AAO A;  1IJ5 A;  1UWO A;  2AMI A;  1BR4 B;  3WNX B;  1AK8 A;  2KYF A;  2F2O A;  3GK4 X;  3LLE A;  2BCA A;  1S5G Z;  4MSP A;  1SCV A;  1BT6 A;  1M39 A;  2WND A;  3DVE A;  1XO5 A;  3I5F B;  1CMG A;  4WRI A;  1K9U A;  3RLZ A;  1SL8 A;  3BUX B;  4YGE B;  1AHR A;  1KFX L;  2EHB A;  4PDZ A;  1GGZ A;  2E30 A;  2HPS A;  3O6B A;  3PLF B;  4N1F A;  2P6B B;  2JU0 A;  1UHK A;  1IQ3 A;  1MXE A;  5CSN A;  2COL B;  1SR6 C;  1B47 A;  1C7W A;  1NX3 A;  1TCO B;  1FBV A;  1XFX O;  3JTD C;  3KPX A;  3TS5 C;  2L51 A;  1C7V A;  4OCI A;  3KEV A;  1UP5 A;  2EC6 C;  2BCX A;  4PE4 A;  1BMO A;  3CR5 X;  2JWW A;  1YUT A;  2JC2 A;  4YI8 A;  2ZRT A;  1D1O A;  1JF0 A;  1QVI Z;  4I5J A;  2K61 A;  1JC2 A;  4PHN A;  2ZND A;  3CR2 A;  3M0W A;  1CTR A;  2PRU A;  2G9B A;  3BUN B;  3EVU A;  1JFJ A;  3D10 A;  2JTZ A;  1CFC A;  2CBL A;  1B7T Y;  1N2D A;  1YUU A;  2HET A;  2ZRS A;  3AAK A;  1CMF A;  1ZUZ A;  1WLZ A;  3IF7 A;  1G8I A;  1DJG A;  1A03 A;  1KCY A;  1ALW A;  4MVF A;  4PHK A;  4XJK B;  5J3X A;  1JFK A;  1BG1 A;  1FF1 A;  1YRT B;  1SMG A;  5CSJ A;  3SIB A;  1ALV A;  1TCF A;  2PAL A;  4M2P A;  4A4C A;  2KI4 C;  4BY4 A;  2FCD A;  1Y0V H;  3ICB A;  3NSK A;  4CFR A;  1NCX A;  1NX1 A;  2FCE A;  4AQI A;  2E6W A;  2L5X B;  3TZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...