3CTNA

Structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
KDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ctnA00
1NP8A 3LLEA 1N0YA 1XK4A 5I2OA 4GGFA 3ZNIA 1SW8A 3TZ1A 2JT3A 1K96A 4NQGA 1ZOTB 2JNXA 1SMGA 4WQ2A 3O78A 1UHJA 2I7AA 1EH2A 4MZJA 1DVIA 2GGMA 1K9PA 2JPTA 3JVTC 4I5LB 1J7RA 5I2QA 3TDUA 3O6BA 4NDBA 1B8CA 4DCKA 2WCBA 4MZLA 3CTNA 3DF0B 3LK0A 1UWOA 2MLEC 3ICBA 5ER4X 2KI6C 3D10A 1YRUB 2KAYA 1EL4A 1KQMB 1OE9B 3I5HC 2LUXA 1OMRA 4JQ0D 4ETOA 2KYCA 1DT7B 1AUIB 1CNPA 1G8IA 3CS1A 1SR6B 5DKRA 2L2EA 4M2PA 1EJ3A 2CBLA 3SG4A 2ZRSA 1SPYA 1K9KA 5I2LA 1CLBA 1QX5B 2ZN8A 3I5GC 4YBHB 2O60A 2Y1NA 4I5KA 1S3PA 5D7FA 3LL8B 1KQVA 3H4SE 3SIAA 5HKYA 3OB1B 4I5JA 1IH0A 1A29A 3DVKA 4FTGA 3SG3A 2GV5A 4QJ4B 4GUKA 1W7JB 1WY9A 1FI6A 2KDHA 3FWCA 1A2XA 2BBMA 1KFUS 1B47A 1AVSA 2KBIA 1NIWA 4A4CA 4HREE 5D69A 1PSBA 1WDCC 2BE6A 1QIWA 4MZKA 5CSNA 1JFJA 3EVVA 3C1VA 5DKNA 2JZIA 3CLNA 2BL0B 1QTXA 2LMUA 1J1EA 3SG6A 1BF5A 4QJ3B 1B4CA 1K9UA 2WC8A 3CWGA 4AQJA 3WHTB 2ZKMX 2HF5A 2OS8B 4PE7A 1IGVA 1TNXA 4C0KA 2L50A 3DVEA 4AOMA 1OZOA 1Y1XA 1VRKA 5FYXA 3IQOA 1KCYA 3OB2B 2V53A 2AUCA 3CGAA 1CLMA 1KFXS 1ZMZA 2MAZA 3BYAA 1N65A 1BMOA 2DOQA 5CSIA 5CSJA 3OX5A 5J3XA 5AANA 1QASA 1K94A 2MBXA 2KSPA 3I5IC 2LANA 3VROA 1NPQA 1PULA 1QX7A 2M29A 1B8RA 5G08A 3JVTB 1IKUA 1HQVA 2NXQA 2LHLA 4PHKA 2FOTA 2K7CA 1CKKA 3DVMA 2K2FA 1RFJA 1X02A 2L5XB 2G2BA 3CR2A 1ZACA 1M31A 5KSZA 1NYAA 2LVKA 3VGOA 1GGZA 2LC5A 3DVJA 2M3WA 2LP2A 1YVHA 5I8NA 5K89A 1M39A 2KI4C 1YVLA 3PATA 4HRHA 1J7QA 4OR9B 1C7VA 4NDCA 1OSAA 1V1FA 1JF0A 2KOTA 3EK8A 4CPVA 3F45A 1QV1A 3O4YA 4F0ZB 1MR8A 1WRLA 2HQ8A 4ZCVA 2JXLA 1NSHA 3DD4A 2MJWB 4DIRA 2KAXA 4PHNA 1XVJA 2JU0A 4ORBB 1BG1A 2JULA 1NWDA 1YTZC 1DJWA 2M8UA 1IJ6A 1YURA 3RM1A 1NCYA 3QRXA 2F8PA 1GQMA 4C0JA 4USLA 2EHBA 1XFUO 2ZRTA 4PE4A 1NX3A 2LUCA 1TCOB 3OHMB 1BOCA 2R2IA 1QS7A 2KI6D 4PHJA 3PM8A 1F71A 2JT8A 2RGIA 1CM1A 1BR1B 1DMOA 1IQ5A 1RWYA 1S6IA 3NSOA 1TCFA 3TS5C 2K0JA 2HPSA 2KFFA 1TTXA 1YX7A 4GGNA 3BOWB 1XFVO 1QXPA 5IBWA 1YX8A 1HT9A 4YGCB 2LAPA 3HX4A 2KBMA 4D1EA 1S26D 3A8RA 4P2YB 1Y6WA 2P6BB 1SL8A 2KFGA 1UHKA 1YRTB 1PALA 4MRYA 1CMFA 1CFPA 1H4BA 3BUWB 1F8HA 3AKBA 1B1GA 1CTRA 1TIZA 3KHEA 2ZNDA 5KTYA 3GK4X 1M63B 1C07A 1JWDA 1WRKA 2G9BA 2EC6C 2K7DA 3LK1A 1FF1A 4GPLB 1MWNA 5BPJA 1BODA 4BY4A 3BOWA 1Y0VH 1XFZO 2JQ6A 2BBNA 4P5OE 2WOSA 2F2OA 4TNCA 3DF0A 1DJIA 5HLVA 1XFXO 1AJ4A 2OTGB 2H61A 3EVRA 2HETA 1DTLA 1DJYA 1SCMB 2M97A 3BUXB 1TNWA 1Y1AA 4XJKB 3SG5A 1IQ3A 1U5IB 1XK4C 2AMIA 4GGFC 1CDNA 2WCFA 1QVIZ 1PRWA 1CM4A 2BCBA 2JT0A 1RJVA 2PALA 4OVNF 4PHMA 1MHOA 2WCEA 4YRUA 1LKJA 2M1UA 2L4HA 2K61A 1XFWO 1SRAA 4ORCB 1CMGA 1QVIY 4OCIA 2JXCA 2ZFDA 3EVUA 5CSFA 4MEWA 2LLUA 1L2OC 1C7WA 1J1DA 2ZN9A 2M1KB 1JF2A 5HKWA 4BY5A 4GFTA 1MXLC 2EGDA 1NX1A 1QATA 2B1UA 2Q4UA 4C0LA 5GQQC 1DF0B 1JUOA 2SASA 3NSLA 2MRDA 3FS7A 2K2AA 3BUMB 1L7ZA 4N1GA 4U8DA 1G33A 1LA0A 3VRPA 1JSAA 5HLOA 3SG2A 4A4BA 3PN7C 1A4PA 3VRNA 2LLTA 1F55A 3TUYC 1OQPA 1CFCA 4IL1A 1LXFC 1Y1UA 1PVAA 1S1EA 1TN4A 3LCPC 1FI5A 4PE1A 1KK7Y 1LVCD 1UHHA 1JC2A 5AERA 1FPWA 3FWBA 4M2OA 5JOLA 1SL9A 1DGUA 3A4UB 5JJGA 1KSOA 2M7LA 4PDZA 1N2DA 1XFYO 3NSKA 1SR6C 1OZSA 2COLB 4OKHA 1J55A 1DJXA 1S5GZ 3SJSA 1RK9A 1BU3A 1TNQA 2PMYA 3I5FC 4WQ3A 3PLFB 2F2PA 2LHIA 4ORAB 1K90D 2LV7A 3I5HB 4YGEB 1YR5A 1CFFA 2BKIB 1F4OA 1R6PA 3NSIA 1S5GY 4YI8A 4WRIA 2Y5IA 3RLZA 1UURA 3CR4X 5AEQA 2D8NA 1LA3A 2CNPA 2AAOA 2I94A 4HSZA 3I5GB 1DJZA 1IWQA 1J7OA 5F6TA 1WRZA 3SG7A 2K8MB 2QPTA 1J7PA 4AQIA 2L98A 1SKTA 3NXAA 1D1OA 1XA5A 3AAJA 4FQOA 2MA2A 1K2HA 1M45A 2PASA 2JOJA 1MF8B 1OMDA 3O2PA 2PRUA 1K93D 1NCZA 2OPOA 2LMVA 1EG4A 5B8IB 1SK6D 3IF7A 1MXEA 1NX0A 2LP3A 2WNDA 2SCPA 1SL7A 2BL0C 2NLNA 1RROA 3WNXB 1WDCB 2LVIA 2WORA 2M49B 1XYDA 2ZNEA 3PFVA 4R1EA 1SCVA 4MN0A 2PVBA 1L2OB 4OV2A 1A75B 1PK0D 2BE4A 4QJ5B 4DRWA 3GK2A 1F4QA 1PVBA 4N1FA 2Y4QA 1QV0A 4ICBA 3WXAA 1CB1A 2LNKA 2NCPA 3ZWHA 2GGZA 1F70A 1MQ1A 1FBVA 1KK8C 4DUQA 1ZFSA 1KFUL 3KPXA 2JTTA 4CIDA 2I2RE 1S6JA 2KQYA 2KGRA 2L4IA 5HYDA 1ALVA 4DS7A 3PN7B 1KWOC 2O5GA 2A4JA 3EKHA 3TUYB 4I5NB 2LVVA 2JC2A 2PSRA 1ZUZA 1A75A 3I5IB 4YGAA 3CZTX 1CDMA 2E6WA 1BJFA 1G4YR 1S36A 3IQQA 4GNKB 4MLWA 2TN4A 1M46A 3BQ3A 5AFPA 2LCPA 5AXIA 3FIAA 1IJ5A 4HRGA 1SY9A 3M0WA 2FJUB 1RECA 1NUBA 1KFXL 1DJGA 2F3ZA 3JTDC 4YI9A 4E68A 1OOJA 1BLQA 3I5FB 2H2KA 2LM5A 1QJTA 1CDLA 4YGDB 1NX2A 2KI4B 5HKZA 4GAOA 1YUSA 1DGVA 1MUXA 2KFHA 2JNFA 2LVJA 4L9MA 2K7BA 4JWQA 2BCAA 1PSRA 1R2UA 2KYFA 3EK4A 4XJKA 3VRQA 1AK8A 2F3YA 1U5IA 1RTP1 1W7IB 3D0YB 1LINA 1QX2A 1A03A 2E30A 1Q80A 2IS9A 2KAVA 4JPZB 4YGBB 5KU1A 1AJ5A 1TRFA 5CPVA 4ZCUA 2JWWA 1KK7Z 2KNEA 5PALA 1NCXA 4MBEA 2BCXA 1SNLA 3OX6A 3WHUB 1JBAA 2QACA 3PSRA 4CFQA 3EKJA 1DJHA 4PALA 3SIBA 3VRRA 1S6CA 2H61C 2M7NA 1FW4A 4UPGA 1CDPA 1KQMC 1DF0A 2L51A 1EXRA 4MSPA 1BR4B 3D0YA 3KF9A 3TS5B 1YUUA 4CLNA 3KO0A 1CLLA 2FCDA 2LLSA 1BT6A 4M2QA 1UHIA 1V1GA 1XO5A 1OMVA 1F54A 4Q04A 3GK1A 3EK7A 5DKQA 2JRFA 1KK8B 1SYMA 1QLSA 1K8UA 3BUOB 1KSMA 2CXJA 3HCMA 1YUTA 1CFDA 3K21A 1ALWA 1QIVA 1EG3A 2K7OA 1QLKA 2LE9B 2OTGC 3CR5X 3TDIA 1IG5A 1KWOB 3MSEB 2CTNA 2F33A 2KQ6A 2EC6B 2MHHA 2M9GA 1UHNA 1SCMC 2ISDA 2I18A 4MRXA 1TOPA 1B9AA 1ODBA 4PCWA 2CT9A 2Q91A 2VRGA 1AHRA 1B7TZ 2NCOA 4XYNA 1JFKA 2LMTA 2L0PA 3OP0A 4N5XA 4PE0A 1UUSA 2HQWA 2KHNA 1B7TY 4GBAA 1E8AA 4MVFA 5ER5A 2MLFC 1AP4A 1H8BA 1GJYA 3BUNB 3JTDB 1TNPA 2BKHB 1SBJA 1B8LA 1GGWA 3KEVA 2KGBC 1UP5A 2NZ0A 1WLMA 3BXKA 3PALA 4CFRA 2FCEA 2CCMA 3AKAA 4NDDA 2OS8C 5TNCA 3TDZA 1WLZA 3GOFA 3AAKA 2JTZA 1K95A 1IRJA 2BECA 2M0RA 3E3RA 2Y1MA
chains in the Genus database with same CATH superfamily
1NP8A 3LLEA 1N0YA 1XK4A 5I2OA 4GGFA 2BAPA 3ZNIA 1SW8A 2KPHA 3TZ1A 2JT3A 1K96A 4NQGA 1ZOTB 2PYQA 2JNXA 1SMGA 4WQ2A 3FE6A 3O78A 1UHJA 2I7AA 1EH2A 4MZJA 1DVIA 2GGMA 1C3ZA 1K9PA 2JPTA 4IJ7A 3JVTC 4I5LB 1J7RA 5I2QA 3TDUA 1OW4A 3O6BA 4NDBA 1Z4HA 1B8CA 4DCKA 2WCBA 4MZLA 3CTNA 3DF0B 3LK0A 1UWOA 2MLEC 3ICBA 5ER4X 2KI6C 1DC1A 3D10A 1YRUB 2KAYA 3UO9A 2FJYA 1EL4A 1KQMB 1OE9B 3I5HC 2LUXA 1OMRA 4JQ0D 3FE8A 2KYCA 4ETOA 1AUIB 1DT7B 1CNPA 1G8IA 3CS1A 1SR6B 5DKRA 2L2EA 3S0BA 4M2PA 1EJ3A 2CBLA 3Q8IA 3SG4A 2ZRSA 1SPYA 1K9KA 5I2LA 1CLBA 1QX5B 2ZN8A 3I5GC 2L5YA 4YBHB 2O60A 2Y1NA 4I5KA 1S3PA 5D7FA 3LL8B 1KQVA 5I94A 3H4SE 3NHIA 3SIAA 5HKYA 3OB1B 4I5JA 1IH0A 1A29A 3DVKA 4FTGA 3B86A 3SG3A 2GV5A 4QJ4B 3NHTA 3S0AA 4GUKA 1W7JB 1WY9A 1FI6A 2KDHA 3FWCA 1A2XA 2BBMA 1KFUS 1B47A 1AVSA 2KBIA 1NIWA 4A4CA 5HL1A 4HREE 5D69A 1PSBA 1WDCC 2BE6A 1QIWA 4MZKA 5FI7A 5CSNA 3CZ2A 1JFJA 3EVVA 3C1VA 5DKNA 2JZIA 3CLNA 2BL0B 1QTXA 2LMUA 1J1EA 3SG6A 1BF5A 4QJ3B 3L4LA 1B4CA 1K9UA 2WC8A 3CWGA 4AQJA 3WHTB 2ZKMX 2HF5A 2OS8B 1T14A 1IGVA 3CZ1A 4PE7A 1TNXA 4C0KA 2L50A 3D75A 3DVEA 3PM2A 4AOMA 1OZOA 1Y1XA 1VRKA 5FYXA 3IQOA 1KCYA 3OB2B 3UNWA 2V53A 2AUCA 2H8VA 3CGAA 1CLMA 1KFXS 1ZMZA 2MAZA 3BYAA 1N65A 1BMOA 2DOQA 5CSIA 5CSJA 3OX5A 5J3XA 5AANA 1QASA 1K94A 3S0DA 2MBXA 2KSPA 3I5IC 2LANA 3VROA 1NPQA 1PULA 1QX7A 2M29A 1B8RA 5G08A 3JVTB 1IKUA 1HQVA 2NXQA 2LHLA 4PHKA 2FOTA 2K7CA 1CKKA 3DVMA 2K2FA 1RFJA 1GM0A 1X02A 2L5XB 2G2BA 3CR2A 1ZACA 1M31A 5KSZA 1NYAA 2LVKA 3VGOA 1GGZA 2WC6A 2LC5A 3DVJA 2M3WA 2LP2A 1YVHA 5I8NA 1DELA 4PHMA 5K89A 1M39A 2KI4C 1YVLA 3L4AA 3PATA 2JPOA 4HRHA 1J7QA 4OR9B 1C7VA 4NDCA 1OSAA 1V1FA 1JF0A 2KOTA 3EK8A 4CPVA 3F45A 1QV1A 3K1EA 3O4YA 4F0ZB 1MR8A 1WRLA 2HQ8A 4ZCVA 2JXLA 1NSHA 1Z2CB 3DD4A 2MJWB 4DIRA 2KAXA 4PHNA 1XVJA 2JU0A 4ORBB 1BG1A 2JULA 1NWDA 1YTZC 1DJWA 2M8UA 1IJ6A 1YURA 3RM1A 1NCYA 3QRXA 2F8PA 1GQMA 4C0JA 4USLA 2EHBA 1XFUO 3BJHA 2ZRTA 4PE4A 1NX3A 2LUCA 2PQLA 1TCOB 3OHMB 1BOCA 2R2IA 1QS7A 2KI6D 4PHJA 3PM8A 1TUJA 2JT8A 1F71A 2RGIA 1CM1A 3BFBA 2QEHA 1BR1B 1DMOA 1IQ5A 1RWYA 1S6IA 2GTEA 3NSOA 1TCFA 3TS5C 2K0JA 2HPSA 2KFFA 1TTXA 3S0FA 1YX7A 1OOFA 4GGNA 3BOWB 1XFVO 1QXPA 3OGNA 5IBWA 1YX8A 2QEBA 1HT9A 3EG5B 4YGCB 2LAPA 3HX4A 3S0EA 2KBMA 4D1EA 1S26D 3A8RA 3DXLA 1Y6WA 2P6BB 1SL8A 2KFGA 4P2YB 1UHKA 1YRTB 1PALA 4MRYA 3R72A 1CMFA 1CFPA 1H4BA 3BUWB 3S0GA 1F8HA 3AKBA 1B1GA 1CTRA 1TIZA 3KHEA 2ZNDA 5KTYA 3GK4X 1M63B 2P71A 1C07A 3N7HA 1JWDA 1WRKA 2G9BA 2EC6C 2K7DA 2QEOA 3LK1A 1FF1A 4GPLB 1MWNA 5BPJA 1BODA 4BY4A 3BOWA 1Y0VH 1XFZO 2JQ6A 2BBNA 4P5OE 2WOSA 2F2OA 3SS4A 4TNCA 3IVTA 3DF0A 3BFHA 1DJIA 5HLVA 1XFXO 1AJ4A 2OTGB 3DYEA 3D74A 2H61A 3EVRA 2HETA 1DTLA 1DJYA 1SCMB 2M97A 3BUXB 1TNWA 1Y1AA 4XJKB 3SG5A 1IQ3A 1U5IB 1XK4C 2AMIA 3D78A 4GGFC 1CDNA 2WCFA 1QVIZ 1PRWA 1CM4A 2BCBA 2JT0A 1RJVA 2PALA 3B7AA 3BFAA 1MHOA 4OVNF 2WCEA 4YRUA 1LKJA 1ORGA 2M1UA 3O4XA 2L4HA 2K61A 1XFWO 1SRAA 3D77A 4ORCB 1CMGA 1QVIY 4OCIA 3PJIA 2JXCA 2ZFDA 3EVUA 5CSFA 4MEWA 2LLUA 1L2OC 1C7WA 1J1DA 2ZN9A 2M1KB 1JF2A 3QMEA 5HKWA 4BY5A 4GFTA 1MXLC 2EGDA 1NX1A 1QATA 2B1UA 2Q4UA 4FQTA 4C0LA 3RZSA 4INXA 5GQQC 1DF0B 1JUOA 2SASA 3NSLA 2MRDA 3FS7A 2K2AA 3BUMB 1L7ZA 4N1GA 4U8DA 1G33A 1LA0A 3VRPA 1JSAA 5HLOA 3SG2A 4A4BA 3PN7C 1A4PA 4JKTA 3VRNA 2LLTA 1F55A 3TUYC 1OQPA 1CFCA 4IL1A 1LXFC 1Y1UA 1PVAA 1S1EA 1TN4A 3LCPC 1FI5A 4PE1A 5DICA 1KK7Y 1LVCD 1UHHA 3FE9A 1JC2A 5AERA 3B87A 1QWVA 4PT1A 1FPWA 3FWBA 4M2OA 3B6XA 5JOLA 1SL9A 1DGUA 3A4UB 5JJGA 1KSOA 2M7LA 4PDZA 1N2DA 3DY9A 1XFYO 3NSKA 1SR6C 1OZSA 2COLB 4OKHA 1J55A 1DJXA 1S5GZ 3SJSA 1RK9A 1BU3A 1TNQA 1OOIX 2PMYA 3I5FC 4WQ3A 2YGUA 2F2PA 2LHIA 3PLFB 4ORAB 5FI6A 1DQEA 1K90D 2LV7A 3I5HB 1YR5A 4YGEB 1CFFA 2BKIB 3SS5A 1F4OA 1R6PA 3NSIA 1S5GY 4YI8A 4WRIA 2Y5IA 3RLZA 1UURA 3CR4X 5AEQA 2D8NA 1LA3A 2CNPA 2WCJA 2AAOA 2I94A 4HSZA 3I5GB 1DJZA 1IWQA 1J7OA 5F6TA 1WRZA 1SSEB 3SG7A 2K8MB 2QPTA 3CABA 1J7PA 2WCKA 4AQIA 2L98A 1SKTA 3NXAA 1D1OA 1XA5A 2K60A 3AAJA 4FQOA 2MA2A 1K2HA 1M45A 2PASA 2JOJA 1MF8B 1OMDA 3O2PA 2PRUA 1K93D 1NCZA 2OPOA 2LMVA 1EG4A 5B8IB 1SK6D 3IF7A 1MXEA 1NX0A 2LP3A 2WNDA 2SCPA 1SL7A 2BL0C 2NLNA 1RROA 1W9ZA 5EL2A 3WNXB 1WDCB 2LVIA 2WORA 2M49B 1XYDA 2ZNEA 3PFVA 4R1EA 1SCVA 4MN0A 2PVBA 1L2OB 4OV2A 1A75B 1PK0D 2BE4A 4QJ5B 3D73A 4DRWA 3GK2A 1F4QA 1PVBA 4N1FA 2Y4QA 1QV0A 4ICBA 4JD9A 3WXAA 1CB1A 2LNKA 2NCPA 3ZWHA 2GGZA 1F70A 1MQ1A 1FBVA 1KK8C 1OOGA 4DUQA 1ZFSA 3R1PA 1KFUL 3CZ0A 3KPXA 2JTTA 2KLEA 4CIDA 2I2RE 1S6JA 2KQYA 2QEVA 2KGRA 2L4IA 5HYDA 1ALVA 4DS7A 3PN7B 1KWOC 2O5GA 2A4JA 3EKHA 3TUYB 4I5NB 2LVVA 2JC2A 2P70A 2PSRA 1ZUZA 1A75A 3I5IB 4YGAA 3CZTX 1CDMA 2E6WA 1BJFA 1G4YR 1S36A 3IQQA 4GNKB 4MLWA 1TWOA 2TN4A 1M46A 3BQ3A 5AFPA 2LCPA 5AXIA 3VB1A 3FIAA 1IJ5A 4HRGA 1SY9A 3M0WA 2FJUB 1RECA 1H8BA 4OZDA 1NUBA 1KFXL 1DJGA 2F3ZA 3JTDC 4YI9A 4E68A 1OOJA 1BLQA 1TUZA 3I5FB 2H2KA 2LM5A 1QJTA 1CDLA 4YGDB 1NX2A 2KI4B 5HKZA 4GAOA 4INWA 1YUSA 1DGVA 1MUXA 2KFHA 2JNFA 2LVJA 4L9MA 3CDNA 2K7BA 3CYZA 4JWQA 2BCAA 1PSRA 4KYNA 3SS3A 1R2UA 2KYFA 3EK4A 4XJKA 3VRQA 1AK8A 2F3YA 1U5IA 1RTP1 1W7IB 3D0YB 1LINA 1QX2A 1A03A 2WC5A 2E30A 1Q80A 2IS9A 2KAVA 4JPZB 2KLDA 4YGBB 2QDIA 5KU1A 1AJ5A 1TRFA 5CPVA 4ZCUA 2JWWA 1KK7Z 2KNEA 3L47A 5PALA 1NCXA 1OOHA 4MBEA 2BCXA 2WCHA 1SNLA 1C3YA 1P28A 3OX6A 3WHUB 1JBAA 2QACA 3PSRA 4CFQA 3EKJA 1DJHA 4PALA 3SIBA 3R1OA 1S6CA 2H61C 2M7NA 1FW4A 3VRRA 4UPGA 1CDPA 1KQMC 1DF0A 2L51A 1EXRA 4MSPA 1BR4B 3D0YA 3KF9A 3TS5B 1YUUA 4CLNA 3KO0A 1CLLA 2FCDA 2LLSA 4F7FA 1BT6A 4M2QA 1UHIA 1V1GA 1XO5A 1OMVA 1F54A 4Q04A 3GK1A 3EK7A 5DKQA 2JRFA 1KK8B 1SYMA 1QLSA 1K8UA 3BUOB 1KSMA 2CXJA 3HCMA 1YUTA 1CFDA 3K21A 1ALWA 2WCMA 1QIVA 1EG3A 2K7OA 1QLKA 3V2LA 2LE9B 1IIOA 2OTGC 3CR5X 3TDIA 1IG5A 1KWOB 3MSEB 5FI2A 2CTNA 2F33A 2KQ6A 2EC6B 2MHHA 2M9GA 1UHNA 1SCMC 2ISDA 2I18A 4MRXA 1TOPA 1B9AA 1ODBA 3DZTA 4PCWA 2CT9A 2Q91A 3NGVA 2VRGA 2WCLA 1AHRA 1B7TZ 2NCOA 3R1VA 3D76A 4XYNA 1JFKA 2LMTA 2L0PA 5D3OA 3OP0A 4N5XA 4PE0A 1UUSA 2HQWA 2KHNA 1B7TY 4GBAA 1E8AA 1LS8A 4MVFA 2MLFC 5ER5A 1AP4A 1GJYA 3BUNB 3OBVA 3JTDB 1TNPA 2BKHB 1SBJA 1B8LA 2ERBA 2L2CA 1GGWA 3KEVA 2KGBC 1XFRA 1UP5A 2NZ0A 1WLMA 3BXKA 3PALA 4CFRA 2FCEA 2CCMA 3AKAA 2BNXA 4NDDA 2OS8C 5TNCA 3TDZA 1DEKA 1WLZA 3GOFA 3AAKA 2JTZA 1K95A 1IRJA 2BECA 2M0RA 3B88A 3E3RA 2Y1MA
chains in the Genus database with same CATH topology
1NP8A 3LLEA 1N0YA 1XK4A 5I2OA 4GGFA 3ZNIA 1SW8A 3TZ1A 2JT3A 1K96A 4NQGA 1ZOTB 2JNXA 1SMGA 4WQ2A 3O78A 1UHJA 2I7AA 1EH2A 4MZJA 1DVIA 2GGMA 1K9PA 2JPTA 3JVTC 4I5LB 1J7RA 5I2QA 3TDUA 3O6BA 4NDBA 1B8CA 4DCKA 2WCBA 4MZLA 3CTNA 3DF0B 3LK0A 1UWOA 2MLEC 3ICBA 5ER4X 2KI6C 3D10A 1YRUB 2KAYA 1EL4A 1KQMB 1OE9B 3I5HC 2LUXA 1OMRA 4JQ0D 4ETOA 2KYCA 1DT7B 1AUIB 1CNPA 1G8IA 3CS1A 1SR6B 5DKRA 2L2EA 4M2PA 1EJ3A 2CBLA 3SG4A 2ZRSA 1SPYA 1K9KA 5I2LA 1CLBA 1QX5B 2ZN8A 3I5GC 4YBHB 2O60A 2Y1NA 4I5KA 1S3PA 5D7FA 3LL8B 1KQVA 3H4SE 3SIAA 5HKYA 3OB1B 4I5JA 1IH0A 1A29A 3DVKA 4FTGA 3SG3A 2GV5A 4QJ4B 4GUKA 1W7JB 1WY9A 1FI6A 2KDHA 3FWCA 1A2XA 2BBMA 1KFUS 1B47A 1AVSA 2KBIA 1NIWA 4A4CA 4HREE 5D69A 1PSBA 1WDCC 2BE6A 1QIWA 4MZKA 5CSNA 1JFJA 3EVVA 3C1VA 5DKNA 2JZIA 3CLNA 2BL0B 1QTXA 2LMUA 1J1EA 3SG6A 1BF5A 4QJ3B 1B4CA 1K9UA 2WC8A 3CWGA 4AQJA 3WHTB 2ZKMX 2HF5A 2OS8B 4PE7A 1IGVA 1TNXA 4C0KA 2L50A 3DVEA 4AOMA 1OZOA 1Y1XA 1VRKA 5FYXA 3IQOA 1KCYA 3OB2B 2V53A 2AUCA 3CGAA 1CLMA 1KFXS 1ZMZA 2MAZA 3BYAA 1N65A 1BMOA 2DOQA 5CSIA 5CSJA 3OX5A 5J3XA 5AANA 1QASA 1K94A 2MBXA 2KSPA 3I5IC 2LANA 3VROA 1NPQA 1PULA 1QX7A 2M29A 1B8RA 5G08A 3JVTB 1IKUA 1HQVA 2NXQA 2LHLA 4PHKA 2FOTA 2K7CA 1CKKA 3DVMA 2K2FA 1RFJA 1X02A 2L5XB 2G2BA 3CR2A 1ZACA 1M31A 5KSZA 1NYAA 2LVKA 3VGOA 1GGZA 2LC5A 3DVJA 2M3WA 2LP2A 1YVHA 5I8NA 5K89A 1M39A 2KI4C 1YVLA 3PATA 4HRHA 1J7QA 4OR9B 1C7VA 4NDCA 1OSAA 1V1FA 1JF0A 2KOTA 3EK8A 4CPVA 3F45A 1QV1A 3O4YA 4F0ZB 1MR8A 1WRLA 2HQ8A 4ZCVA 2JXLA 1NSHA 3DD4A 2MJWB 4DIRA 2KAXA 4PHNA 1XVJA 2JU0A 4ORBB 1BG1A 2JULA 1NWDA 1YTZC 1DJWA 2M8UA 1IJ6A 1YURA 3RM1A 1NCYA 3QRXA 2F8PA 1GQMA 4C0JA 4USLA 2EHBA 1XFUO 2ZRTA 4PE4A 1NX3A 2LUCA 1TCOB 3OHMB 1BOCA 2R2IA 1QS7A 2KI6D 4PHJA 3PM8A 1F71A 2JT8A 2RGIA 1CM1A 1BR1B 1DMOA 1IQ5A 1RWYA 1S6IA 3NSOA 1TCFA 3TS5C 2K0JA 2HPSA 2KFFA 1TTXA 1YX7A 4GGNA 3BOWB 1XFVO 1QXPA 5IBWA 1YX8A 1HT9A 4YGCB 2LAPA 3HX4A 2KBMA 4D1EA 1S26D 3A8RA 4P2YB 1Y6WA 2P6BB 1SL8A 2KFGA 1UHKA 1YRTB 1PALA 4MRYA 1CMFA 1CFPA 1H4BA 3BUWB 1F8HA 3AKBA 1B1GA 1CTRA 1TIZA 3KHEA 2ZNDA 5KTYA 3GK4X 1M63B 1C07A 1JWDA 1WRKA 2G9BA 2EC6C 2K7DA 3LK1A 1FF1A 4GPLB 1MWNA 5BPJA 1BODA 4BY4A 3BOWA 1Y0VH 1XFZO 2JQ6A 2BBNA 4P5OE 2WOSA 2F2OA 4TNCA 3DF0A 1DJIA 5HLVA 1XFXO 1AJ4A 2OTGB 2H61A 3EVRA 2HETA 1DTLA 1DJYA 1SCMB 2M97A 3BUXB 1TNWA 1Y1AA 4XJKB 3SG5A 1IQ3A 1U5IB 1XK4C 2AMIA 4GGFC 1CDNA 2WCFA 1QVIZ 1PRWA 1CM4A 2BCBA 2JT0A 1RJVA 2PALA 4OVNF 4PHMA 1MHOA 2WCEA 4YRUA 1LKJA 2M1UA 2L4HA 2K61A 1XFWO 1SRAA 4ORCB 1CMGA 1QVIY 4OCIA 2JXCA 2ZFDA 3EVUA 5CSFA 4MEWA 2LLUA 1L2OC 1C7WA 1J1DA 2ZN9A 2M1KB 1JF2A 5HKWA 4BY5A 4GFTA 1MXLC 2EGDA 1NX1A 1QATA 2B1UA 2Q4UA 4C0LA 5GQQC 1DF0B 1JUOA 2SASA 3NSLA 2MRDA 3FS7A 2K2AA 3BUMB 1L7ZA 4N1GA 4U8DA 1G33A 1LA0A 3VRPA 1JSAA 5HLOA 3SG2A 4A4BA 3PN7C 1A4PA 3VRNA 2LLTA 1F55A 3TUYC 1OQPA 1CFCA 4IL1A 1LXFC 1Y1UA 1PVAA 1S1EA 1TN4A 3LCPC 1FI5A 4PE1A 1KK7Y 1LVCD 1UHHA 1JC2A 5AERA 1FPWA 3FWBA 4M2OA 5JOLA 1SL9A 1DGUA 3A4UB 5JJGA 1KSOA 2M7LA 4PDZA 1N2DA 1XFYO 3NSKA 1SR6C 1OZSA 2COLB 4OKHA 1J55A 1DJXA 1S5GZ 3SJSA 1RK9A 1BU3A 1TNQA 2PMYA 3I5FC 4WQ3A 3PLFB 2F2PA 2LHIA 4ORAB 1K90D 2LV7A 3I5HB 4YGEB 1YR5A 1CFFA 2BKIB 1F4OA 1R6PA 3NSIA 1S5GY 4YI8A 4WRIA 2Y5IA 3RLZA 1UURA 3CR4X 5AEQA 2D8NA 1LA3A 2CNPA 2AAOA 2I94A 4HSZA 3I5GB 1DJZA 1IWQA 1J7OA 5F6TA 1WRZA 3SG7A 2K8MB 2QPTA 1J7PA 4AQIA 2L98A 1SKTA 3NXAA 1D1OA 1XA5A 3AAJA 4FQOA 2MA2A 1K2HA 1M45A 2PASA 2JOJA 1MF8B 1OMDA 3O2PA 2PRUA 1K93D 1NCZA 2OPOA 2LMVA 1EG4A 5B8IB 1SK6D 3IF7A 1MXEA 1NX0A 2LP3A 2WNDA 2SCPA 1SL7A 2BL0C 2NLNA 1RROA 3WNXB 1WDCB 2LVIA 2WORA 2M49B 1XYDA 2ZNEA 3PFVA 4R1EA 1SCVA 4MN0A 2PVBA 1L2OB 4OV2A 1A75B 1PK0D 2BE4A 4QJ5B 4DRWA 3GK2A 1F4QA 1PVBA 4N1FA 2Y4QA 1QV0A 4ICBA 3WXAA 1CB1A 2LNKA 2NCPA 3ZWHA 2GGZA 1F70A 1MQ1A 1FBVA 1KK8C 4DUQA 1ZFSA 1KFUL 3KPXA 2JTTA 4CIDA 2I2RE 1S6JA 2KQYA 2KGRA 2L4IA 5HYDA 1ALVA 4DS7A 3PN7B 1KWOC 2O5GA 2A4JA 3EKHA 3TUYB 4I5NB 2LVVA 2JC2A 2PSRA 1ZUZA 1A75A 3I5IB 4YGAA 3CZTX 1CDMA 2E6WA 1BJFA 1G4YR 1S36A 3IQQA 4GNKB 4MLWA 2TN4A 1M46A 3BQ3A 5AFPA 2LCPA 5AXIA 3FIAA 1IJ5A 4HRGA 1SY9A 3M0WA 2FJUB 1RECA 1NUBA 1KFXL 1DJGA 2F3ZA 3JTDC 4YI9A 4E68A 1OOJA 1BLQA 3I5FB 2H2KA 2LM5A 1QJTA 1CDLA 4YGDB 1NX2A 2KI4B 5HKZA 4GAOA 1YUSA 1DGVA 1MUXA 2KFHA 2JNFA 2LVJA 4L9MA 2K7BA 4JWQA 2BCAA 1PSRA 1R2UA 2KYFA 3EK4A 4XJKA 3VRQA 1AK8A 2F3YA 1U5IA 1RTP1 1W7IB 3D0YB 1LINA 1QX2A 1A03A 2E30A 1Q80A 2IS9A 2KAVA 4JPZB 4YGBB 5KU1A 1AJ5A 1TRFA 5CPVA 4ZCUA 2JWWA 1KK7Z 2KNEA 5PALA 1NCXA 4MBEA 2BCXA 1SNLA 3OX6A 3WHUB 1JBAA 2QACA 3PSRA 4CFQA 3EKJA 1DJHA 4PALA 3SIBA 3VRRA 1S6CA 2H61C 2M7NA 1FW4A 4UPGA 1CDPA 1KQMC 1DF0A 2L51A 1EXRA 4MSPA 1BR4B 3D0YA 3KF9A 3TS5B 1YUUA 4CLNA 3KO0A 1CLLA 2FCDA 2LLSA 1BT6A 4M2QA 1UHIA 1V1GA 1XO5A 1OMVA 1F54A 4Q04A 3GK1A 3EK7A 5DKQA 2JRFA 1KK8B 1SYMA 1QLSA 1K8UA 3BUOB 1KSMA 2CXJA 3HCMA 1YUTA 1CFDA 3K21A 1ALWA 1QIVA 1EG3A 2K7OA 1QLKA 2LE9B 2OTGC 3CR5X 3TDIA 1IG5A 1KWOB 3MSEB 2CTNA 2F33A 2KQ6A 2EC6B 2MHHA 2M9GA 1UHNA 1SCMC 2ISDA 2I18A 4MRXA 1TOPA 1B9AA 1ODBA 4PCWA 2CT9A 2Q91A 2VRGA 1AHRA 1B7TZ 2NCOA 4XYNA 1JFKA 2LMTA 2L0PA 3OP0A 4N5XA 4PE0A 1UUSA 2HQWA 2KHNA 1B7TY 4GBAA 1E8AA 4MVFA 5ER5A 2MLFC 1AP4A 1H8BA 1GJYA 3BUNB 3JTDB 1TNPA 2BKHB 1SBJA 1B8LA 1GGWA 3KEVA 2KGBC 1UP5A 2NZ0A 1WLMA 3BXKA 3PALA 4CFRA 2FCEA 2CCMA 3AKAA 4NDDA 2OS8C 5TNCA 3TDZA 1WLZA 3GOFA 3AAKA 2JTZA 1K95A 1IRJA 2BECA 2M0RA 3E3RA 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NP8 A;  3LLE A;  1N0Y A;  1XK4 A;  5I2O A;  4GGF A;  3ZNI A;  1SW8 A;  3TZ1 A;  2JT3 A;  1K96 A;  4NQG A;  1ZOT B;  2JNX A;  1SMG A;  4WQ2 A;  3O78 A;  1UHJ A;  2I7A A;  1EH2 A;  4MZJ A;  1DVI A;  2GGM A;  1K9P A;  2JPT A;  3JVT C;  4I5L B;  1J7R A;  5I2Q A;  3TDU A;  3O6B A;  4NDB A;  1B8C A;  4DCK A;  2WCB A;  4MZL A;  3CTN A;  3DF0 B;  3LK0 A;  1UWO A;  2MLE C;  3ICB A;  5ER4 X;  2KI6 C;  3D10 A;  1YRU B;  2KAY A;  1EL4 A;  1KQM B;  1OE9 B;  3I5H C;  2LUX A;  1OMR A;  4JQ0 D;  4ETO A;  2KYC A;  1DT7 B;  1AUI B;  1CNP A;  1G8I A;  3CS1 A;  1SR6 B;  5DKR A;  2L2E A;  4M2P A;  1EJ3 A;  2CBL A;  3SG4 A;  2ZRS A;  1SPY A;  1K9K A;  5I2L A;  1CLB A;  1QX5 B;  2ZN8 A;  3I5G C;  4YBH B;  2O60 A;  2Y1N A;  4I5K A;  1S3P A;  5D7F A;  3LL8 B;  1KQV A;  3H4S E;  3SIA A;  5HKY A;  3OB1 B;  4I5J A;  1IH0 A;  1A29 A;  3DVK A;  4FTG A;  3SG3 A;  2GV5 A;  4QJ4 B;  4GUK A;  1W7J B;  1WY9 A;  1FI6 A;  2KDH A;  3FWC A;  1A2X A;  2BBM A;  1KFU S;  1B47 A;  1AVS A;  2KBI A;  1NIW A;  4A4C A;  4HRE E;  5D69 A;  1PSB A;  1WDC C;  2BE6 A;  1QIW A;  4MZK A;  5CSN A;  1JFJ A;  3EVV A;  3C1V A;  5DKN A;  2JZI A;  3CLN A;  2BL0 B;  1QTX A;  2LMU A;  1J1E A;  3SG6 A;  1BF5 A;  4QJ3 B;  1B4C A;  1K9U A;  2WC8 A;  3CWG A;  4AQJ A;  3WHT B;  2ZKM X;  2HF5 A;  2OS8 B;  4PE7 A;  1IGV A;  1TNX A;  4C0K A;  2L50 A;  3DVE A;  4AOM A;  1OZO A;  1Y1X A;  1VRK A;  5FYX A;  3IQO A;  1KCY A;  3OB2 B;  2V53 A;  2AUC A;  3CGA A;  1CLM A;  1KFX S;  1ZMZ A;  2MAZ A;  3BYA A;  1N65 A;  1BMO A;  2DOQ A;  5CSI A;  5CSJ A;  3OX5 A;  5J3X A;  5AAN A;  1QAS A;  1K94 A;  2MBX A;  2KSP A;  3I5I C;  2LAN A;  3VRO A;  1NPQ A;  1PUL A;  1QX7 A;  2M29 A;  1B8R A;  5G08 A;  3JVT B;  1IKU A;  1HQV A;  2NXQ A;  2LHL A;  4PHK A;  2FOT A;  2K7C A;  1CKK A;  3DVM A;  2K2F A;  1RFJ A;  1X02 A;  2L5X B;  2G2B A;  3CR2 A;  1ZAC A;  1M31 A;  5KSZ A;  1NYA A;  2LVK A;  3VGO A;  1GGZ A;  2LC5 A;  3DVJ A;  2M3W A;  2LP2 A;  1YVH A;  5I8N A;  5K89 A;  1M39 A;  2KI4 C;  1YVL A;  3PAT A;  4HRH A;  1J7Q A;  4OR9 B;  1C7V A;  4NDC A;  1OSA A;  1V1F A;  1JF0 A;  2KOT A;  3EK8 A;  4CPV A;  3F45 A;  1QV1 A;  3O4Y A;  4F0Z B;  1MR8 A;  1WRL A;  2HQ8 A;  4ZCV A;  2JXL A;  1NSH A;  3DD4 A;  2MJW B;  4DIR A;  2KAX A;  4PHN A;  1XVJ A;  2JU0 A;  4ORB B;  1BG1 A;  2JUL A;  1NWD A;  1YTZ C;  1DJW A;  2M8U A;  1IJ6 A;  1YUR A;  3RM1 A;  1NCY A;  3QRX A;  2F8P A;  1GQM A;  4C0J A;  4USL A;  2EHB A;  1XFU O;  2ZRT A;  4PE4 A;  1NX3 A;  2LUC A;  1TCO B;  3OHM B;  1BOC A;  2R2I A;  1QS7 A;  2KI6 D;  4PHJ A;  3PM8 A;  1F71 A;  2JT8 A;  2RGI A;  1CM1 A;  1BR1 B;  1DMO A;  1IQ5 A;  1RWY A;  1S6I A;  3NSO A;  1TCF A;  3TS5 C;  2K0J A;  2HPS A;  2KFF A;  1TTX A;  1YX7 A;  4GGN A;  3BOW B;  1XFV O;  1QXP A;  5IBW A;  1YX8 A;  1HT9 A;  4YGC B;  2LAP A;  3HX4 A;  2KBM A;  4D1E A;  1S26 D;  3A8R A;  4P2Y B;  1Y6W A;  2P6B B;  1SL8 A;  2KFG A;  1UHK A;  1YRT B;  1PAL A;  4MRY A;  1CMF A;  1CFP A;  1H4B A;  3BUW B;  1F8H A;  3AKB A;  1B1G A;  1CTR A;  1TIZ A;  3KHE A;  2ZND A;  5KTY A;  3GK4 X;  1M63 B;  1C07 A;  1JWD A;  1WRK A;  2G9B A;  2EC6 C;  2K7D A;  3LK1 A;  1FF1 A;  4GPL B;  1MWN A;  5BPJ A;  1BOD A;  4BY4 A;  3BOW A;  1Y0V H;  1XFZ O;  2JQ6 A;  2BBN A;  4P5O E;  2WOS A;  2F2O A;  4TNC A;  3DF0 A;  1DJI A;  5HLV A;  1XFX O;  1AJ4 A;  2OTG B;  2H61 A;  3EVR A;  2HET A;  1DTL A;  1DJY A;  1SCM B;  2M97 A;  3BUX B;  1TNW A;  1Y1A A;  4XJK B;  3SG5 A;  1IQ3 A;  1U5I B;  1XK4 C;  2AMI A;  4GGF C;  1CDN A;  2WCF A;  1QVI Z;  1PRW A;  1CM4 A;  2BCB A;  2JT0 A;  1RJV A;  2PAL A;  4OVN F;  4PHM A;  1MHO A;  2WCE A;  4YRU A;  1LKJ A;  2M1U A;  2L4H A;  2K61 A;  1XFW O;  1SRA A;  4ORC B;  1CMG A;  1QVI Y;  4OCI A;  2JXC A;  2ZFD A;  3EVU A;  5CSF A;  4MEW A;  2LLU A;  1L2O C;  1C7W A;  1J1D A;  2ZN9 A;  2M1K B;  1JF2 A;  5HKW A;  4BY5 A;  4GFT A;  1MXL C;  2EGD A;  1NX1 A;  1QAT A;  2B1U A;  2Q4U A;  4C0L A;  5GQQ C;  1DF0 B;  1JUO A;  2SAS A;  3NSL A;  2MRD A;  3FS7 A;  2K2A A;  3BUM B;  1L7Z A;  4N1G A;  4U8D A;  1G33 A;  1LA0 A;  3VRP A;  1JSA A;  5HLO A;  3SG2 A;  4A4B A;  3PN7 C;  1A4P A;  3VRN A;  2LLT A;  1F55 A;  3TUY C;  1OQP A;  1CFC A;  4IL1 A;  1LXF C;  1Y1U A;  1PVA A;  1S1E A;  1TN4 A;  3LCP C;  1FI5 A;  4PE1 A;  1KK7 Y;  1LVC D;  1UHH A;  1JC2 A;  5AER A;  1FPW A;  3FWB A;  4M2O A;  5JOL A;  1SL9 A;  1DGU A;  3A4U B;  5JJG A;  1KSO A;  2M7L A;  4PDZ A;  1N2D A;  1XFY O;  3NSK A;  1SR6 C;  1OZS A;  2COL B;  4OKH A;  1J55 A;  1DJX A;  1S5G Z;  3SJS A;  1RK9 A;  1BU3 A;  1TNQ A;  2PMY A;  3I5F C;  4WQ3 A;  3PLF B;  2F2P A;  2LHI A;  4ORA B;  1K90 D;  2LV7 A;  3I5H B;  4YGE B;  1YR5 A;  1CFF A;  2BKI B;  1F4O A;  1R6P A;  3NSI A;  1S5G Y;  4YI8 A;  4WRI A;  2Y5I A;  3RLZ A;  1UUR A;  3CR4 X;  5AEQ A;  2D8N A;  1LA3 A;  2CNP A;  2AAO A;  2I94 A;  4HSZ A;  3I5G B;  1DJZ A;  1IWQ A;  1J7O A;  5F6T A;  1WRZ A;  3SG7 A;  2K8M B;  2QPT A;  1J7P A;  4AQI A;  2L98 A;  1SKT A;  3NXA A;  1D1O A;  1XA5 A;  3AAJ A;  4FQO A;  2MA2 A;  1K2H A;  1M45 A;  2PAS A;  2JOJ A;  1MF8 B;  1OMD A;  3O2P A;  2PRU A;  1K93 D;  1NCZ A;  2OPO A;  2LMV A;  1EG4 A;  5B8I B;  1SK6 D;  3IF7 A;  1MXE A;  1NX0 A;  2LP3 A;  2WND A;  2SCP A;  1SL7 A;  2BL0 C;  2NLN A;  1RRO A;  3WNX B;  1WDC B;  2LVI A;  2WOR A;  2M49 B;  1XYD A;  2ZNE A;  3PFV A;  4R1E A;  1SCV A;  4MN0 A;  2PVB A;  1L2O B;  4OV2 A;  1A75 B;  1PK0 D;  2BE4 A;  4QJ5 B;  4DRW A;  3GK2 A;  1F4Q A;  1PVB A;  4N1F A;  2Y4Q A;  1QV0 A;  4ICB A;  3WXA A;  1CB1 A;  2LNK A;  2NCP A;  3ZWH A;  2GGZ A;  1F70 A;  1MQ1 A;  1FBV A;  1KK8 C;  4DUQ A;  1ZFS A;  1KFU L;  3KPX A;  2JTT A;  4CID A;  2I2R E;  1S6J A;  2KQY A;  2KGR A;  2L4I A;  5HYD A;  1ALV A;  4DS7 A;  3PN7 B;  1KWO C;  2O5G A;  2A4J A;  3EKH A;  3TUY B;  4I5N B;  2LVV A;  2JC2 A;  2PSR A;  1ZUZ A;  1A75 A;  3I5I B;  4YGA A;  3CZT X;  1CDM A;  2E6W A;  1BJF A;  1G4Y R;  1S36 A;  3IQQ A;  4GNK B;  4MLW A;  2TN4 A;  1M46 A;  3BQ3 A;  5AFP A;  2LCP A;  5AXI A;  3FIA A;  1IJ5 A;  4HRG A;  1SY9 A;  3M0W A;  2FJU B;  1REC A;  1NUB A;  1KFX L;  1DJG A;  2F3Z A;  3JTD C;  4YI9 A;  4E68 A;  1OOJ A;  1BLQ A;  3I5F B;  2H2K A;  2LM5 A;  1QJT A;  1CDL A;  4YGD B;  1NX2 A;  2KI4 B;  5HKZ A;  4GAO A;  1YUS A;  1DGV A;  1MUX A;  2KFH A;  2JNF A;  2LVJ A;  4L9M A;  2K7B A;  4JWQ A;  2BCA A;  1PSR A;  1R2U A;  2KYF A;  3EK4 A;  4XJK A;  3VRQ A;  1AK8 A;  2F3Y A;  1U5I A;  1RTP 1;  1W7I B;  3D0Y B;  1LIN A;  1QX2 A;  1A03 A;  2E30 A;  1Q80 A;  2IS9 A;  2KAV A;  4JPZ B;  4YGB B;  5KU1 A;  1AJ5 A;  1TRF A;  5CPV A;  4ZCU A;  2JWW A;  1KK7 Z;  2KNE A;  5PAL A;  1NCX A;  4MBE A;  2BCX A;  1SNL A;  3OX6 A;  3WHU B;  1JBA A;  2QAC A;  3PSR A;  4CFQ A;  3EKJ A;  1DJH A;  4PAL A;  3SIB A;  3VRR A;  1S6C A;  2H61 C;  2M7N A;  1FW4 A;  4UPG A;  1CDP A;  1KQM C;  1DF0 A;  2L51 A;  1EXR A;  4MSP A;  1BR4 B;  3D0Y A;  3KF9 A;  3TS5 B;  1YUU A;  4CLN A;  3KO0 A;  1CLL A;  2FCD A;  2LLS A;  1BT6 A;  4M2Q A;  1UHI A;  1V1G A;  1XO5 A;  1OMV A;  1F54 A;  4Q04 A;  3GK1 A;  3EK7 A;  5DKQ A;  2JRF A;  1KK8 B;  1SYM A;  1QLS A;  1K8U A;  3BUO B;  1KSM A;  2CXJ A;  3HCM A;  1YUT A;  1CFD A;  3K21 A;  1ALW A;  1QIV A;  1EG3 A;  2K7O A;  1QLK A;  2LE9 B;  2OTG C;  3CR5 X;  3TDI A;  1IG5 A;  1KWO B;  3MSE B;  2CTN A;  2F33 A;  2KQ6 A;  2EC6 B;  2MHH A;  2M9G A;  1UHN A;  1SCM C;  2ISD A;  2I18 A;  4MRX A;  1TOP A;  1B9A A;  1ODB A;  4PCW A;  2CT9 A;  2Q91 A;  2VRG A;  1AHR A;  1B7T Z;  2NCO A;  4XYN A;  1JFK A;  2LMT A;  2L0P A;  3OP0 A;  4N5X A;  4PE0 A;  1UUS A;  2HQW A;  2KHN A;  1B7T Y;  4GBA A;  1E8A A;  4MVF A;  5ER5 A;  2MLF C;  1AP4 A;  1H8B A;  1GJY A;  3BUN B;  3JTD B;  1TNP A;  2BKH B;  1SBJ A;  1B8L A;  1GGW A;  3KEV A;  2KGB C;  1UP5 A;  2NZ0 A;  1WLM A;  3BXK A;  3PAL A;  4CFR A;  2FCE A;  2CCM A;  3AKA A;  4NDD A;  2OS8 C;  5TNC A;  3TDZ A;  1WLZ A;  3GOF A;  3AAK A;  2JTZ A;  1K95 A;  1IRJ A;  2BEC A;  2M0R A;  3E3R A;  2Y1M A; 
#chains in the Genus database with same CATH topology
 1NP8 A;  3LLE A;  1N0Y A;  1XK4 A;  5I2O A;  4GGF A;  2BAP A;  3ZNI A;  1SW8 A;  2KPH A;  3TZ1 A;  2JT3 A;  1K96 A;  4NQG A;  1ZOT B;  2PYQ A;  2JNX A;  1SMG A;  4WQ2 A;  3FE6 A;  3O78 A;  1UHJ A;  2I7A A;  1EH2 A;  4MZJ A;  1DVI A;  2GGM A;  1C3Z A;  1K9P A;  2JPT A;  4IJ7 A;  3JVT C;  4I5L B;  1J7R A;  5I2Q A;  3TDU A;  1OW4 A;  3O6B A;  4NDB A;  1Z4H A;  1B8C A;  4DCK A;  2WCB A;  4MZL A;  3CTN A;  3DF0 B;  3LK0 A;  1UWO A;  2MLE C;  3ICB A;  5ER4 X;  2KI6 C;  1DC1 A;  3D10 A;  1YRU B;  2KAY A;  3UO9 A;  2FJY A;  1EL4 A;  1KQM B;  1OE9 B;  3I5H C;  2LUX A;  1OMR A;  4JQ0 D;  3FE8 A;  2KYC A;  4ETO A;  1AUI B;  1DT7 B;  1CNP A;  1G8I A;  3CS1 A;  1SR6 B;  5DKR A;  2L2E A;  3S0B A;  4M2P A;  1EJ3 A;  2CBL A;  3Q8I A;  3SG4 A;  2ZRS A;  1SPY A;  1K9K A;  5I2L A;  1CLB A;  1QX5 B;  2ZN8 A;  3I5G C;  2L5Y A;  4YBH B;  2O60 A;  2Y1N A;  4I5K A;  1S3P A;  5D7F A;  3LL8 B;  1KQV A;  5I94 A;  3H4S E;  3NHI A;  3SIA A;  5HKY A;  3OB1 B;  4I5J A;  1IH0 A;  1A29 A;  3DVK A;  4FTG A;  3B86 A;  3SG3 A;  2GV5 A;  4QJ4 B;  3NHT A;  3S0A A;  4GUK A;  1W7J B;  1WY9 A;  1FI6 A;  2KDH A;  3FWC A;  1A2X A;  2BBM A;  1KFU S;  1B47 A;  1AVS A;  2KBI A;  1NIW A;  4A4C A;  5HL1 A;  4HRE E;  5D69 A;  1PSB A;  1WDC C;  2BE6 A;  1QIW A;  4MZK A;  5FI7 A;  5CSN A;  3CZ2 A;  1JFJ A;  3EVV A;  3C1V A;  5DKN A;  2JZI A;  3CLN A;  2BL0 B;  1QTX A;  2LMU A;  1J1E A;  3SG6 A;  1BF5 A;  4QJ3 B;  3L4L A;  1B4C A;  1K9U A;  2WC8 A;  3CWG A;  4AQJ A;  3WHT B;  2ZKM X;  2HF5 A;  2OS8 B;  1T14 A;  1IGV A;  3CZ1 A;  4PE7 A;  1TNX A;  4C0K A;  2L50 A;  3D75 A;  3DVE A;  3PM2 A;  4AOM A;  1OZO A;  1Y1X A;  1VRK A;  5FYX A;  3IQO A;  1KCY A;  3OB2 B;  3UNW A;  2V53 A;  2AUC A;  2H8V A;  3CGA A;  1CLM A;  1KFX S;  1ZMZ A;  2MAZ A;  3BYA A;  1N65 A;  1BMO A;  2DOQ A;  5CSI A;  5CSJ A;  3OX5 A;  5J3X A;  5AAN A;  1QAS A;  1K94 A;  3S0D A;  2MBX A;  2KSP A;  3I5I C;  2LAN A;  3VRO A;  1NPQ A;  1PUL A;  1QX7 A;  2M29 A;  1B8R A;  5G08 A;  3JVT B;  1IKU A;  1HQV A;  2NXQ A;  2LHL A;  4PHK A;  2FOT A;  2K7C A;  1CKK A;  3DVM A;  2K2F A;  1RFJ A;  1GM0 A;  1X02 A;  2L5X B;  2G2B A;  3CR2 A;  1ZAC A;  1M31 A;  5KSZ A;  1NYA A;  2LVK A;  3VGO A;  1GGZ A;  2WC6 A;  2LC5 A;  3DVJ A;  2M3W A;  2LP2 A;  1YVH A;  5I8N A;  1DEL A;  4PHM A;  5K89 A;  1M39 A;  2KI4 C;  1YVL A;  3L4A A;  3PAT A;  2JPO A;  4HRH A;  1J7Q A;  4OR9 B;  1C7V A;  4NDC A;  1OSA A;  1V1F A;  1JF0 A;  2KOT A;  3EK8 A;  4CPV A;  3F45 A;  1QV1 A;  3K1E A;  3O4Y A;  4F0Z B;  1MR8 A;  1WRL A;  2HQ8 A;  4ZCV A;  2JXL A;  1NSH A;  1Z2C B;  3DD4 A;  2MJW B;  4DIR A;  2KAX A;  4PHN A;  1XVJ A;  2JU0 A;  4ORB B;  1BG1 A;  2JUL A;  1NWD A;  1YTZ C;  1DJW A;  2M8U A;  1IJ6 A;  1YUR A;  3RM1 A;  1NCY A;  3QRX A;  2F8P A;  1GQM A;  4C0J A;  4USL A;  2EHB A;  1XFU O;  3BJH A;  2ZRT A;  4PE4 A;  1NX3 A;  2LUC A;  2PQL A;  1TCO B;  3OHM B;  1BOC A;  2R2I A;  1QS7 A;  2KI6 D;  4PHJ A;  3PM8 A;  1TUJ A;  2JT8 A;  1F71 A;  2RGI A;  1CM1 A;  3BFB A;  2QEH A;  1BR1 B;  1DMO A;  1IQ5 A;  1RWY A;  1S6I A;  2GTE A;  3NSO A;  1TCF A;  3TS5 C;  2K0J A;  2HPS A;  2KFF A;  1TTX A;  3S0F A;  1YX7 A;  1OOF A;  4GGN A;  3BOW B;  1XFV O;  1QXP A;  3OGN A;  5IBW A;  1YX8 A;  2QEB A;  1HT9 A;  3EG5 B;  4YGC B;  2LAP A;  3HX4 A;  3S0E A;  2KBM A;  4D1E A;  1S26 D;  3A8R A;  3DXL A;  1Y6W A;  2P6B B;  1SL8 A;  2KFG A;  4P2Y B;  1UHK A;  1YRT B;  1PAL A;  4MRY A;  3R72 A;  1CMF A;  1CFP A;  1H4B A;  3BUW B;  3S0G A;  1F8H A;  3AKB A;  1B1G A;  1CTR A;  1TIZ A;  3KHE A;  2ZND A;  5KTY A;  3GK4 X;  1M63 B;  2P71 A;  1C07 A;  3N7H A;  1JWD A;  1WRK A;  2G9B A;  2EC6 C;  2K7D A;  2QEO A;  3LK1 A;  1FF1 A;  4GPL B;  1MWN A;  5BPJ A;  1BOD A;  4BY4 A;  3BOW A;  1Y0V H;  1XFZ O;  2JQ6 A;  2BBN A;  4P5O E;  2WOS A;  2F2O A;  3SS4 A;  4TNC A;  3IVT A;  3DF0 A;  3BFH A;  1DJI A;  5HLV A;  1XFX O;  1AJ4 A;  2OTG B;  3DYE A;  3D74 A;  2H61 A;  3EVR A;  2HET A;  1DTL A;  1DJY A;  1SCM B;  2M97 A;  3BUX B;  1TNW A;  1Y1A A;  4XJK B;  3SG5 A;  1IQ3 A;  1U5I B;  1XK4 C;  2AMI A;  3D78 A;  4GGF C;  1CDN A;  2WCF A;  1QVI Z;  1PRW A;  1CM4 A;  2BCB A;  2JT0 A;  1RJV A;  2PAL A;  3B7A A;  3BFA A;  1MHO A;  4OVN F;  2WCE A;  4YRU A;  1LKJ A;  1ORG A;  2M1U A;  3O4X A;  2L4H A;  2K61 A;  1XFW O;  1SRA A;  3D77 A;  4ORC B;  1CMG A;  1QVI Y;  4OCI A;  3PJI A;  2JXC A;  2ZFD A;  3EVU A;  5CSF A;  4MEW A;  2LLU A;  1L2O C;  1C7W A;  1J1D A;  2ZN9 A;  2M1K B;  1JF2 A;  3QME A;  5HKW A;  4BY5 A;  4GFT A;  1MXL C;  2EGD A;  1NX1 A;  1QAT A;  2B1U A;  2Q4U A;  4FQT A;  4C0L A;  3RZS A;  4INX A;  5GQQ C;  1DF0 B;  1JUO A;  2SAS A;  3NSL A;  2MRD A;  3FS7 A;  2K2A A;  3BUM B;  1L7Z A;  4N1G A;  4U8D A;  1G33 A;  1LA0 A;  3VRP A;  1JSA A;  5HLO A;  3SG2 A;  4A4B A;  3PN7 C;  1A4P A;  4JKT A;  3VRN A;  2LLT A;  1F55 A;  3TUY C;  1OQP A;  1CFC A;  4IL1 A;  1LXF C;  1Y1U A;  1PVA A;  1S1E A;  1TN4 A;  3LCP C;  1FI5 A;  4PE1 A;  5DIC A;  1KK7 Y;  1LVC D;  1UHH A;  3FE9 A;  1JC2 A;  5AER A;  3B87 A;  1QWV A;  4PT1 A;  1FPW A;  3FWB A;  4M2O A;  3B6X A;  5JOL A;  1SL9 A;  1DGU A;  3A4U B;  5JJG A;  1KSO A;  2M7L A;  4PDZ A;  1N2D A;  3DY9 A;  1XFY O;  3NSK A;  1SR6 C;  1OZS A;  2COL B;  4OKH A;  1J55 A;  1DJX A;  1S5G Z;  3SJS A;  1RK9 A;  1BU3 A;  1TNQ A;  1OOI X;  2PMY A;  3I5F C;  4WQ3 A;  2YGU A;  2F2P A;  2LHI A;  3PLF B;  4ORA B;  5FI6 A;  1DQE A;  1K90 D;  2LV7 A;  3I5H B;  1YR5 A;  4YGE B;  1CFF A;  2BKI B;  3SS5 A;  1F4O A;  1R6P A;  3NSI A;  1S5G Y;  4YI8 A;  4WRI A;  2Y5I A;  3RLZ A;  1UUR A;  3CR4 X;  5AEQ A;  2D8N A;  1LA3 A;  2CNP A;  2WCJ A;  2AAO A;  2I94 A;  4HSZ A;  3I5G B;  1DJZ A;  1IWQ A;  1J7O A;  5F6T A;  1WRZ A;  1SSE B;  3SG7 A;  2K8M B;  2QPT A;  3CAB A;  1J7P A;  2WCK A;  4AQI A;  2L98 A;  1SKT A;  3NXA A;  1D1O A;  1XA5 A;  2K60 A;  3AAJ A;  4FQO A;  2MA2 A;  1K2H A;  1M45 A;  2PAS A;  2JOJ A;  1MF8 B;  1OMD A;  3O2P A;  2PRU A;  1K93 D;  1NCZ A;  2OPO A;  2LMV A;  1EG4 A;  5B8I B;  1SK6 D;  3IF7 A;  1MXE A;  1NX0 A;  2LP3 A;  2WND A;  2SCP A;  1SL7 A;  2BL0 C;  2NLN A;  1RRO A;  1W9Z A;  5EL2 A;  3WNX B;  1WDC B;  2LVI A;  2WOR A;  2M49 B;  1XYD A;  2ZNE A;  3PFV A;  4R1E A;  1SCV A;  4MN0 A;  2PVB A;  1L2O B;  4OV2 A;  1A75 B;  1PK0 D;  2BE4 A;  4QJ5 B;  3D73 A;  4DRW A;  3GK2 A;  1F4Q A;  1PVB A;  4N1F A;  2Y4Q A;  1QV0 A;  4ICB A;  4JD9 A;  3WXA A;  1CB1 A;  2LNK A;  2NCP A;  3ZWH A;  2GGZ A;  1F70 A;  1MQ1 A;  1FBV A;  1KK8 C;  1OOG A;  4DUQ A;  1ZFS A;  3R1P A;  1KFU L;  3CZ0 A;  3KPX A;  2JTT A;  2KLE A;  4CID A;  2I2R E;  1S6J A;  2KQY A;  2QEV A;  2KGR A;  2L4I A;  5HYD A;  1ALV A;  4DS7 A;  3PN7 B;  1KWO C;  2O5G A;  2A4J A;  3EKH A;  3TUY B;  4I5N B;  2LVV A;  2JC2 A;  2P70 A;  2PSR A;  1ZUZ A;  1A75 A;  3I5I B;  4YGA A;  3CZT X;  1CDM A;  2E6W A;  1BJF A;  1G4Y R;  1S36 A;  3IQQ A;  4GNK B;  4MLW A;  1TWO A;  2TN4 A;  1M46 A;  3BQ3 A;  5AFP A;  2LCP A;  5AXI A;  3VB1 A;  3FIA A;  1IJ5 A;  4HRG A;  1SY9 A;  3M0W A;  2FJU B;  1REC A;  1H8B A;  4OZD A;  1NUB A;  1KFX L;  1DJG A;  2F3Z A;  3JTD C;  4YI9 A;  4E68 A;  1OOJ A;  1BLQ A;  1TUZ A;  3I5F B;  2H2K A;  2LM5 A;  1QJT A;  1CDL A;  4YGD B;  1NX2 A;  2KI4 B;  5HKZ A;  4GAO A;  4INW A;  1YUS A;  1DGV A;  1MUX A;  2KFH A;  2JNF A;  2LVJ A;  4L9M A;  3CDN A;  2K7B A;  3CYZ A;  4JWQ A;  2BCA A;  1PSR A;  4KYN A;  3SS3 A;  1R2U A;  2KYF A;  3EK4 A;  4XJK A;  3VRQ A;  1AK8 A;  2F3Y A;  1U5I A;  1RTP 1;  1W7I B;  3D0Y B;  1LIN A;  1QX2 A;  1A03 A;  2WC5 A;  2E30 A;  1Q80 A;  2IS9 A;  2KAV A;  4JPZ B;  2KLD A;  4YGB B;  2QDI A;  5KU1 A;  1AJ5 A;  1TRF A;  5CPV A;  4ZCU A;  2JWW A;  1KK7 Z;  2KNE A;  3L47 A;  5PAL A;  1NCX A;  1OOH A;  4MBE A;  2BCX A;  2WCH A;  1SNL A;  1C3Y A;  1P28 A;  3OX6 A;  3WHU B;  1JBA A;  2QAC A;  3PSR A;  4CFQ A;  3EKJ A;  1DJH A;  4PAL A;  3SIB A;  3R1O A;  1S6C A;  2H61 C;  2M7N A;  1FW4 A;  3VRR A;  4UPG A;  1CDP A;  1KQM C;  1DF0 A;  2L51 A;  1EXR A;  4MSP A;  1BR4 B;  3D0Y A;  3KF9 A;  3TS5 B;  1YUU A;  4CLN A;  3KO0 A;  1CLL A;  2FCD A;  2LLS A;  4F7F A;  1BT6 A;  4M2Q A;  1UHI A;  1V1G A;  1XO5 A;  1OMV A;  1F54 A;  4Q04 A;  3GK1 A;  3EK7 A;  5DKQ A;  2JRF A;  1KK8 B;  1SYM A;  1QLS A;  1K8U A;  3BUO B;  1KSM A;  2CXJ A;  3HCM A;  1YUT A;  1CFD A;  3K21 A;  1ALW A;  2WCM A;  1QIV A;  1EG3 A;  2K7O A;  1QLK A;  3V2L A;  2LE9 B;  1IIO A;  2OTG C;  3CR5 X;  3TDI A;  1IG5 A;  1KWO B;  3MSE B;  5FI2 A;  2CTN A;  2F33 A;  2KQ6 A;  2EC6 B;  2MHH A;  2M9G A;  1UHN A;  1SCM C;  2ISD A;  2I18 A;  4MRX A;  1TOP A;  1B9A A;  1ODB A;  3DZT A;  4PCW A;  2CT9 A;  2Q91 A;  3NGV A;  2VRG A;  2WCL A;  1AHR A;  1B7T Z;  2NCO A;  3R1V A;  3D76 A;  4XYN A;  1JFK A;  2LMT A;  2L0P A;  5D3O A;  3OP0 A;  4N5X A;  4PE0 A;  1UUS A;  2HQW A;  2KHN A;  1B7T Y;  4GBA A;  1E8A A;  1LS8 A;  4MVF A;  2MLF C;  5ER5 A;  1AP4 A;  1GJY A;  3BUN B;  3OBV A;  3JTD B;  1TNP A;  2BKH B;  1SBJ A;  1B8L A;  2ERB A;  2L2C A;  1GGW A;  3KEV A;  2KGB C;  1XFR A;  1UP5 A;  2NZ0 A;  1WLM A;  3BXK A;  3PAL A;  4CFR A;  2FCE A;  2CCM A;  3AKA A;  2BNX A;  4NDD A;  2OS8 C;  5TNC A;  3TDZ A;  1DEK A;  1WLZ A;  3GOF A;  3AAK A;  2JTZ A;  1K95 A;  1IRJ A;  2BEC A;  2M0R A;  3B88 A;  3E3R A;  2Y1M A; 
#chains in the Genus database with same CATH homology
 1NP8 A;  3LLE A;  1N0Y A;  1XK4 A;  5I2O A;  4GGF A;  3ZNI A;  1SW8 A;  3TZ1 A;  2JT3 A;  1K96 A;  4NQG A;  1ZOT B;  2JNX A;  1SMG A;  4WQ2 A;  3O78 A;  1UHJ A;  2I7A A;  1EH2 A;  4MZJ A;  1DVI A;  2GGM A;  1K9P A;  2JPT A;  3JVT C;  4I5L B;  1J7R A;  5I2Q A;  3TDU A;  3O6B A;  4NDB A;  1B8C A;  4DCK A;  2WCB A;  4MZL A;  3CTN A;  3DF0 B;  3LK0 A;  1UWO A;  2MLE C;  3ICB A;  5ER4 X;  2KI6 C;  3D10 A;  1YRU B;  2KAY A;  1EL4 A;  1KQM B;  1OE9 B;  3I5H C;  2LUX A;  1OMR A;  4JQ0 D;  4ETO A;  2KYC A;  1DT7 B;  1AUI B;  1CNP A;  1G8I A;  3CS1 A;  1SR6 B;  5DKR A;  2L2E A;  4M2P A;  1EJ3 A;  2CBL A;  3SG4 A;  2ZRS A;  1SPY A;  1K9K A;  5I2L A;  1CLB A;  1QX5 B;  2ZN8 A;  3I5G C;  4YBH B;  2O60 A;  2Y1N A;  4I5K A;  1S3P A;  5D7F A;  3LL8 B;  1KQV A;  3H4S E;  3SIA A;  5HKY A;  3OB1 B;  4I5J A;  1IH0 A;  1A29 A;  3DVK A;  4FTG A;  3SG3 A;  2GV5 A;  4QJ4 B;  4GUK A;  1W7J B;  1WY9 A;  1FI6 A;  2KDH A;  3FWC A;  1A2X A;  2BBM A;  1KFU S;  1B47 A;  1AVS A;  2KBI A;  1NIW A;  4A4C A;  4HRE E;  5D69 A;  1PSB A;  1WDC C;  2BE6 A;  1QIW A;  4MZK A;  5CSN A;  1JFJ A;  3EVV A;  3C1V A;  5DKN A;  2JZI A;  3CLN A;  2BL0 B;  1QTX A;  2LMU A;  1J1E A;  3SG6 A;  1BF5 A;  4QJ3 B;  1B4C A;  1K9U A;  2WC8 A;  3CWG A;  4AQJ A;  3WHT B;  2ZKM X;  2HF5 A;  2OS8 B;  4PE7 A;  1IGV A;  1TNX A;  4C0K A;  2L50 A;  3DVE A;  4AOM A;  1OZO A;  1Y1X A;  1VRK A;  5FYX A;  3IQO A;  1KCY A;  3OB2 B;  2V53 A;  2AUC A;  3CGA A;  1CLM A;  1KFX S;  1ZMZ A;  2MAZ A;  3BYA A;  1N65 A;  1BMO A;  2DOQ A;  5CSI A;  5CSJ A;  3OX5 A;  5J3X A;  5AAN A;  1QAS A;  1K94 A;  2MBX A;  2KSP A;  3I5I C;  2LAN A;  3VRO A;  1NPQ A;  1PUL A;  1QX7 A;  2M29 A;  1B8R A;  5G08 A;  3JVT B;  1IKU A;  1HQV A;  2NXQ A;  2LHL A;  4PHK A;  2FOT A;  2K7C A;  1CKK A;  3DVM A;  2K2F A;  1RFJ A;  1X02 A;  2L5X B;  2G2B A;  3CR2 A;  1ZAC A;  1M31 A;  5KSZ A;  1NYA A;  2LVK A;  3VGO A;  1GGZ A;  2LC5 A;  3DVJ A;  2M3W A;  2LP2 A;  1YVH A;  5I8N A;  5K89 A;  1M39 A;  2KI4 C;  1YVL A;  3PAT A;  4HRH A;  1J7Q A;  4OR9 B;  1C7V A;  4NDC A;  1OSA A;  1V1F A;  1JF0 A;  2KOT A;  3EK8 A;  4CPV A;  3F45 A;  1QV1 A;  3O4Y A;  4F0Z B;  1MR8 A;  1WRL A;  2HQ8 A;  4ZCV A;  2JXL A;  1NSH A;  3DD4 A;  2MJW B;  4DIR A;  2KAX A;  4PHN A;  1XVJ A;  2JU0 A;  4ORB B;  1BG1 A;  2JUL A;  1NWD A;  1YTZ C;  1DJW A;  2M8U A;  1IJ6 A;  1YUR A;  3RM1 A;  1NCY A;  3QRX A;  2F8P A;  1GQM A;  4C0J A;  4USL A;  2EHB A;  1XFU O;  2ZRT A;  4PE4 A;  1NX3 A;  2LUC A;  1TCO B;  3OHM B;  1BOC A;  2R2I A;  1QS7 A;  2KI6 D;  4PHJ A;  3PM8 A;  1F71 A;  2JT8 A;  2RGI A;  1CM1 A;  1BR1 B;  1DMO A;  1IQ5 A;  1RWY A;  1S6I A;  3NSO A;  1TCF A;  3TS5 C;  2K0J A;  2HPS A;  2KFF A;  1TTX A;  1YX7 A;  4GGN A;  3BOW B;  1XFV O;  1QXP A;  5IBW A;  1YX8 A;  1HT9 A;  4YGC B;  2LAP A;  3HX4 A;  2KBM A;  4D1E A;  1S26 D;  3A8R A;  4P2Y B;  1Y6W A;  2P6B B;  1SL8 A;  2KFG A;  1UHK A;  1YRT B;  1PAL A;  4MRY A;  1CMF A;  1CFP A;  1H4B A;  3BUW B;  1F8H A;  3AKB A;  1B1G A;  1CTR A;  1TIZ A;  3KHE A;  2ZND A;  5KTY A;  3GK4 X;  1M63 B;  1C07 A;  1JWD A;  1WRK A;  2G9B A;  2EC6 C;  2K7D A;  3LK1 A;  1FF1 A;  4GPL B;  1MWN A;  5BPJ A;  1BOD A;  4BY4 A;  3BOW A;  1Y0V H;  1XFZ O;  2JQ6 A;  2BBN A;  4P5O E;  2WOS A;  2F2O A;  4TNC A;  3DF0 A;  1DJI A;  5HLV A;  1XFX O;  1AJ4 A;  2OTG B;  2H61 A;  3EVR A;  2HET A;  1DTL A;  1DJY A;  1SCM B;  2M97 A;  3BUX B;  1TNW A;  1Y1A A;  4XJK B;  3SG5 A;  1IQ3 A;  1U5I B;  1XK4 C;  2AMI A;  4GGF C;  1CDN A;  2WCF A;  1QVI Z;  1PRW A;  1CM4 A;  2BCB A;  2JT0 A;  1RJV A;  2PAL A;  4OVN F;  4PHM A;  1MHO A;  2WCE A;  4YRU A;  1LKJ A;  2M1U A;  2L4H A;  2K61 A;  1XFW O;  1SRA A;  4ORC B;  1CMG A;  1QVI Y;  4OCI A;  2JXC A;  2ZFD A;  3EVU A;  5CSF A;  4MEW A;  2LLU A;  1L2O C;  1C7W A;  1J1D A;  2ZN9 A;  2M1K B;  1JF2 A;  5HKW A;  4BY5 A;  4GFT A;  1MXL C;  2EGD A;  1NX1 A;  1QAT A;  2B1U A;  2Q4U A;  4C0L A;  5GQQ C;  1DF0 B;  1JUO A;  2SAS A;  3NSL A;  2MRD A;  3FS7 A;  2K2A A;  3BUM B;  1L7Z A;  4N1G A;  4U8D A;  1G33 A;  1LA0 A;  3VRP A;  1JSA A;  5HLO A;  3SG2 A;  4A4B A;  3PN7 C;  1A4P A;  3VRN A;  2LLT A;  1F55 A;  3TUY C;  1OQP A;  1CFC A;  4IL1 A;  1LXF C;  1Y1U A;  1PVA A;  1S1E A;  1TN4 A;  3LCP C;  1FI5 A;  4PE1 A;  1KK7 Y;  1LVC D;  1UHH A;  1JC2 A;  5AER A;  1FPW A;  3FWB A;  4M2O A;  5JOL A;  1SL9 A;  1DGU A;  3A4U B;  5JJG A;  1KSO A;  2M7L A;  4PDZ A;  1N2D A;  1XFY O;  3NSK A;  1SR6 C;  1OZS A;  2COL B;  4OKH A;  1J55 A;  1DJX A;  1S5G Z;  3SJS A;  1RK9 A;  1BU3 A;  1TNQ A;  2PMY A;  3I5F C;  4WQ3 A;  3PLF B;  2F2P A;  2LHI A;  4ORA B;  1K90 D;  2LV7 A;  3I5H B;  4YGE B;  1YR5 A;  1CFF A;  2BKI B;  1F4O A;  1R6P A;  3NSI A;  1S5G Y;  4YI8 A;  4WRI A;  2Y5I A;  3RLZ A;  1UUR A;  3CR4 X;  5AEQ A;  2D8N A;  1LA3 A;  2CNP A;  2AAO A;  2I94 A;  4HSZ A;  3I5G B;  1DJZ A;  1IWQ A;  1J7O A;  5F6T A;  1WRZ A;  3SG7 A;  2K8M B;  2QPT A;  1J7P A;  4AQI A;  2L98 A;  1SKT A;  3NXA A;  1D1O A;  1XA5 A;  3AAJ A;  4FQO A;  2MA2 A;  1K2H A;  1M45 A;  2PAS A;  2JOJ A;  1MF8 B;  1OMD A;  3O2P A;  2PRU A;  1K93 D;  1NCZ A;  2OPO A;  2LMV A;  1EG4 A;  5B8I B;  1SK6 D;  3IF7 A;  1MXE A;  1NX0 A;  2LP3 A;  2WND A;  2SCP A;  1SL7 A;  2BL0 C;  2NLN A;  1RRO A;  3WNX B;  1WDC B;  2LVI A;  2WOR A;  2M49 B;  1XYD A;  2ZNE A;  3PFV A;  4R1E A;  1SCV A;  4MN0 A;  2PVB A;  1L2O B;  4OV2 A;  1A75 B;  1PK0 D;  2BE4 A;  4QJ5 B;  4DRW A;  3GK2 A;  1F4Q A;  1PVB A;  4N1F A;  2Y4Q A;  1QV0 A;  4ICB A;  3WXA A;  1CB1 A;  2LNK A;  2NCP A;  3ZWH A;  2GGZ A;  1F70 A;  1MQ1 A;  1FBV A;  1KK8 C;  4DUQ A;  1ZFS A;  1KFU L;  3KPX A;  2JTT A;  4CID A;  2I2R E;  1S6J A;  2KQY A;  2KGR A;  2L4I A;  5HYD A;  1ALV A;  4DS7 A;  3PN7 B;  1KWO C;  2O5G A;  2A4J A;  3EKH A;  3TUY B;  4I5N B;  2LVV A;  2JC2 A;  2PSR A;  1ZUZ A;  1A75 A;  3I5I B;  4YGA A;  3CZT X;  1CDM A;  2E6W A;  1BJF A;  1G4Y R;  1S36 A;  3IQQ A;  4GNK B;  4MLW A;  2TN4 A;  1M46 A;  3BQ3 A;  5AFP A;  2LCP A;  5AXI A;  3FIA A;  1IJ5 A;  4HRG A;  1SY9 A;  3M0W A;  2FJU B;  1REC A;  1NUB A;  1KFX L;  1DJG A;  2F3Z A;  3JTD C;  4YI9 A;  4E68 A;  1OOJ A;  1BLQ A;  3I5F B;  2H2K A;  2LM5 A;  1QJT A;  1CDL A;  4YGD B;  1NX2 A;  2KI4 B;  5HKZ A;  4GAO A;  1YUS A;  1DGV A;  1MUX A;  2KFH A;  2JNF A;  2LVJ A;  4L9M A;  2K7B A;  4JWQ A;  2BCA A;  1PSR A;  1R2U A;  2KYF A;  3EK4 A;  4XJK A;  3VRQ A;  1AK8 A;  2F3Y A;  1U5I A;  1RTP 1;  1W7I B;  3D0Y B;  1LIN A;  1QX2 A;  1A03 A;  2E30 A;  1Q80 A;  2IS9 A;  2KAV A;  4JPZ B;  4YGB B;  5KU1 A;  1AJ5 A;  1TRF A;  5CPV A;  4ZCU A;  2JWW A;  1KK7 Z;  2KNE A;  5PAL A;  1NCX A;  4MBE A;  2BCX A;  1SNL A;  3OX6 A;  3WHU B;  1JBA A;  2QAC A;  3PSR A;  4CFQ A;  3EKJ A;  1DJH A;  4PAL A;  3SIB A;  3VRR A;  1S6C A;  2H61 C;  2M7N A;  1FW4 A;  4UPG A;  1CDP A;  1KQM C;  1DF0 A;  2L51 A;  1EXR A;  4MSP A;  1BR4 B;  3D0Y A;  3KF9 A;  3TS5 B;  1YUU A;  4CLN A;  3KO0 A;  1CLL A;  2FCD A;  2LLS A;  1BT6 A;  4M2Q A;  1UHI A;  1V1G A;  1XO5 A;  1OMV A;  1F54 A;  4Q04 A;  3GK1 A;  3EK7 A;  5DKQ A;  2JRF A;  1KK8 B;  1SYM A;  1QLS A;  1K8U A;  3BUO B;  1KSM A;  2CXJ A;  3HCM A;  1YUT A;  1CFD A;  3K21 A;  1ALW A;  1QIV A;  1EG3 A;  2K7O A;  1QLK A;  2LE9 B;  2OTG C;  3CR5 X;  3TDI A;  1IG5 A;  1KWO B;  3MSE B;  2CTN A;  2F33 A;  2KQ6 A;  2EC6 B;  2MHH A;  2M9G A;  1UHN A;  1SCM C;  2ISD A;  2I18 A;  4MRX A;  1TOP A;  1B9A A;  1ODB A;  4PCW A;  2CT9 A;  2Q91 A;  2VRG A;  1AHR A;  1B7T Z;  2NCO A;  4XYN A;  1JFK A;  2LMT A;  2L0P A;  3OP0 A;  4N5X A;  4PE0 A;  1UUS A;  2HQW A;  2KHN A;  1B7T Y;  4GBA A;  1E8A A;  4MVF A;  5ER5 A;  2MLF C;  1AP4 A;  1H8B A;  1GJY A;  3BUN B;  3JTD B;  1TNP A;  2BKH B;  1SBJ A;  1B8L A;  1GGW A;  3KEV A;  2KGB C;  1UP5 A;  2NZ0 A;  1WLM A;  3BXK A;  3PAL A;  4CFR A;  2FCE A;  2CCM A;  3AKA A;  4NDD A;  2OS8 C;  5TNC A;  3TDZ A;  1WLZ A;  3GOF A;  3AAK A;  2JTZ A;  1K95 A;  1IRJ A;  2BEC A;  2M0R A;  3E3R A;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...