2BCAA

High-resolution solution structure of calcium-loaded calbindin d9k
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
publication title High-resolution structure of calcium-loaded calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
total genus 28
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1993-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bcaA00
2K2AA 3EK8A 1KFUS 4CPVA 4MSPA 1KWOB 4GNKB 4PE1A 1CTRA 2FCDA 1QV1A 2M3WA 1NP8A 4USLA 2MBXA 4ETOA 4PCWA 1RROA 1UHJA 1Y1UA 5CSIA 2LM5A 4P5OE 2CNPA 3PFVA 4AQIA 2CBLA 1S3PA 2LMVA 3PALA 1WDCC 1SRAA 1YRTB 2HETA 1H4BA 1Y6WA 2LMTA 4FQOA 1PSBA 4ICBA 1A75A 2FJUB 2LLSA 2NXQA 3NSIA 3BUNB 1CNPA 2NCOA 1F4QA 1M45A 1SL7A 5I2OA 4GPLB 4P2YB 1KCYA 1R2UA 3DVEA 5J3XA 2M1KB 2Y1NA 4YRUA 1M63B 1G4YR 4CFRA 4WQ3A 1PALA 4XYNA 1KQVA 3DD4A 3EK7A 2L51A 2ZNDA 3OB1B 2NCPA 3HX4A 5D69A 3WHUB 5AERA 5G08A 3RM1A 1YVHA 2F3YA 2JNFA 1RTP1 3CR5X 1F8HA 1QX5B 1NCXA 3OHMB 3CWGA 2H2KA 4PHNA 5I8NA 3KEVA 3CR4X 1NCZA 2KFHA 1BLQA 1N0YA 1WRLA 1SCMC 1YURA 4XJKA 1PK0D 1JFJA 4Q04A 1NX0A 2LHLA 5KU1A 1W7JB 1C7WA 1KK8C 3GK2A 3JVTC 1IJ6A 1DJGA 1KSMA 5D7FA 3TDUA 3I5HB 1C7VA 3BUWB 4MBEA 3DVKA 4N1GA 1QJTA 2KFGA 2CCMA 2Y1MA 3PSRA 1TCOB 1ZOTB 2LVIA 2R2IA 1KK7Z 1KWOC 3VROA 4YI9A 5K89A 4TNCA 1IH0A 1K95A 2EGDA 2O60A 1YRUB 5AANA 1L7ZA 2JTTA 2JT3A 2COLB 1FW4A 2PRUA 3CS1A 1UHIA 1OSAA 5HKWA 4PHKA 4HRGA 1RJVA 1KK7Y 1SK6D 2AMIA 2KNEA 2ZNEA 1BT6A 2PVBA 1QS7A 2WC8A 1B47A 1NYAA 5F6TA 3LCPC 1BF5A 1X02A 5I2QA 2CT9A 4MLWA 2HQWA 2JULA 2BECA 4HRHA 1BU3A 2FOTA 3SIAA 1BG1A 4I5JA 1FI6A 4MN0A 2K61A 3GOFA 1B8LA 3RLZA 1TCFA 3BUMB 3OB2B 1M46A 1NX1A 1Y1AA 1K96A 1MHOA 3KO0A 3NSOA 2M0RA 1F4OA 2K7OA 2LE9B 2M7LA 1QV0A 1XA5A 4AOMA 4U8DA 1DGVA 1D1OA 4WQ2A 4C0JA 4ZCVA 1PVAA 3DVJA 4MZJA 3OP0A 1CDPA 3FWCA 1YR5A 2JOJA 2L4HA 1XVJA 3BOWA 1IRJA 1J7RA 1AJ4A 1SCMB 5FYXA 4PALA 4MRXA 1K9UA 2H61C 1S5GZ 2NZ0A 3I5HC 3TDZA 3JVTB 2CXJA 1PVBA 1K2HA 2GGMA 2KSPA 2KAVA 1WLZA 4OVNF 1TRFA 4DS7A 2F2OA 1J1DA 1QLKA 2G2BA 4ORCB 3H4SE 1S1EA 5IBWA 2HPSA 4DIRA 1AVSA 1DJWA 1XFYO 3DF0A 3PM8A 4YGDB 4OV2A 4L9MA 5HLVA 3GK4X 1S5GY 1RECA 1DF0A 1SNLA 1CFFA 1MWNA 2JXCA 4HREE 1SKTA 1DMOA 2JC2A 2MAZA 3AAJA 1CM1A 2F3ZA 1CLLA 1XO5A 2JZIA 3EK4A 3IQQA 1A03A 2Y5IA 3I5GB 2QACA 1E8AA 1CMGA 2VRGA 3BQ3A 2P6BB 1U5IB 1B7TZ 3CZTX 1UUSA 3SG6A 3VRNA 2ZRTA 2LVJA 1NWDA 1XK4C 1YUTA 2MHHA 1UHHA 3OX6A 2BE6A 2L5XB 3OX5A 1XFUO 2V53A 2LCPA 2PMYA 3O4YA 1JC2A 1Y1XA 5AFPA 1K93D 2F2PA 1B7TY 1DVIA 4GAOA 1K8UA 1R6PA 1SR6B 4DCKA 3ZNIA 1OMDA 2A4JA 4NDBA 2KYCA 5DKRA 3CLNA 1RFJA 3D10A 2KI4B 1HT9A 5KSZA 3PN7B 4PE4A 3WXAA 3GK1A 1XYDA 2K7DA 1ALWA 1IQ5A 1BJFA 2BKHB 2M29A 2RGIA 1CLMA 2AUCA 5HYDA 2TN4A 1QTXA 2K2FA 5DKNA 2M7NA 4AQJA 4NDDA 2KAYA 2BCAA 2AAOA 4GUKA 5BPJA 1LVCD 2E6WA 2JNXA 4OR9B 2HF5A 2JT0A 2ZFDA 5CPVA 3SG5A 1JUOA 3D0YA 2ZKMX 4A4BA 1PSRA 2EHBA 1H8BA 3KPXA 1J7OA 2I94A 1DJXA 4MZLA 2I7AA 4QJ4B 1L2OB 2F8PA 2K0JA 1A4PA 3EVVA 1NSHA 2KOTA 2JQ6A 1K9KA 2O5GA 1B1GA 3NSKA 1TNXA 1A2XA 1TNPA 1B4CA 1IG5A 1AUIB 3I5GC 1CM4A 3IQOA 4CFQA 1YUUA 1EG3A 1OMVA 4ORBB 4PHMA 1MXEA 2JWWA 1G33A 1ALVA 1YUSA 1B8CA 3IF7A 2LANA 1W7IB 1JBAA 1CFPA 1MXLC 3EVUA 1GGWA 1PULA 4CIDA 2L98A 2ISDA 2LHIA 1BMOA 3MSEB 3NXAA 2IS9A 1DJYA 4C0KA 1FF1A 1MQ1A 3AKAA 1JF0A 1SR6C 1OQPA 2I18A 5CSJA 1VRKA 1CKKA 2MLFC 4I5KA 2G9BA 1NX2A 4QJ3B 1TOPA 3TS5B 1KFXL 2LUCA 2KI4C 3PN7C 4GGFC 2Q4UA 4R1EA 5JJGA 1DTLA 1YX8A 3CR2A 2JXLA 1KFXS 3PLFB 3FIAA 1Y0VH 3I5IB 2F33A 1NCYA 4UPGA 2K7CA 5HKZA 1RWYA 1V1GA 1A75B 1YX7A 2DOQA 1JF2A 2LLUA 1DJIA 2WCEA 3CGAA 1QASA 2MLEC 2QPTA 1SW8A 2SASA 2EC6B 1JFKA 2JRFA 4YGCB 1CDNA 1J55A 2KGBC 1J7PA 1Q80A 2JT8A 2KBMA 3I5FB 2KGRA 5CSFA 2BCXA 2D8NA 1OE9B 2OTGB 3VRPA 2H61A 1EJ3A 1K94A 2BKIB 1PRWA 2BL0B 2OPOA 4MVFA 3HCMA 4WRIA 1IJ5A 1KQMB 1AJ5A 4IL1A 1CFDA 4DRWA 5TNCA 2KAXA 4NDCA 2M49B 5KTYA 3BYAA 2M8UA 4MRYA 2JPTA 1L2OC 1WRZA 1B8RA 5CSNA 5PALA 1SL8A 1CFCA 1FPWA 1ZUZA 2KQ6A 4XJKB 3KF9A 4NQGA 4PE0A 1WLMA 2LP3A 1CB1A 3TUYB 1S36A 1GGZA 1V1FA 3TDIA 1QIVA 2I2RE 2KQYA 3EKJA 4PE7A 1QATA 1UHNA 1DGUA 2MRDA 1M39A 5HLOA 1DT7B 2LC5A 2FCEA 1FBVA 4BY5A 2WOSA 3DVMA 2KI6C 3M0WA 4PHJA 1YVLA 2PASA 3WHTB 3A8RA 4N5XA 3ICBA 1N2DA 1XK4A 2BBMA 2LNKA 3SJSA 4PDZA 1IGVA 1MR8A 3VGOA 1QIWA 2PSRA 4GFTA 4YGEB 3LLEA 4JPZB 3TS5C 1AP4A 3CTNA 1IKUA 3O78A 3EKHA 1TIZA 4OKHA 4D1EA 3A4UB 4A4CA 1UHKA 1C07A 1QVIZ 4C0LA 3O2PA 1LINA 4N1FA 3I5IC 5AEQA 1JWDA 2WORA 4YI8A 2L0PA 3SIBA 4QJ5B 3BXKA 5ER5A 2K8MB 3F45A 1G8IA 2KBIA 2ZN9A 2GV5A 5GQQC 2EC6C 1QVIY 2LP2A 3PATA 2KHNA 2LVVA 4HSZA 4MEWA 1M31A 3AAKA 3I5FC 2PALA 1RK9A 3JTDC 2OTGC 1F71A 2CTNA 3SG4A 1XFZO 1EL4A 1F70A 2WCBA 2BL0C 1J1EA 2KYFA 5I2LA 2LAPA 1KQMC 1DJHA 1S26D 2L50A 2LLTA 3TZ1A 1TTXA 1WY9A 2OS8B 2KI6D 4F0ZB 1QX2A 1MF8B 1QXPA 1TNWA 2K7BA 2LUXA 2HQ8A 1NX3A 3BOWB 2M97A 1OMRA 3TUYC 1SL9A 2JU0A 3LK0A 1K9PA 4FTGA 2KFFA 2LVKA 1DJZA 1QX7A 4ZCUA 1LA0A 2LV7A 3BUXB 3VRQA 3BUOB 4MZKA 3ZWHA 1CLBA 3FS7A 1NUBA 1CDMA 1OZSA 1IWQA 3FWBA 2M9GA 4ORAB 1U5IA 1N65A 1ZMZA 3DF0B 2L4IA 1BOCA 3EVRA 1EG4A 4CLNA 4YGAA 1A29A 1B9AA 1DF0B 4M2QA 1NIWA 1UURA 1UWOA 1TNQA 2E30A 2JTZA 1S6CA 1SBJA 4JQ0D 3VRRA 4YBHB 1K90D 5DKQA 3K21A 1SY9A 2BCBA 1QLSA 4BY4A 2KDHA 5AXIA 4GGFA 1UP5A 1IQ3A 1S6IA 1S6JA 1EH2A 1GQMA 1WDCB 3E3RA 5B8IB 1SCVA 2MA2A 1LKJA 1CDLA 2NLNA 4E68A 4I5NB 2B1UA 5JOLA 1BR1B 1CMFA 2BBNA 1SYMA 2L2EA 4M2OA 4M2PA 5HKYA 3LK1A 1MUXA 2GGZA 2M1UA 3SG3A 1GJYA 2ZN8A 3WNXB 3JTDB 1EXRA 1J7QA 1NPQA 1OOJA 2BE4A 3KHEA 2WNDA 2OS8C 1JSAA 1SPYA 3SG7A 1AK8A 3SG2A 1LXFC 1LA3A 1YTZC 1AHRA 1HQVA 1XFXO 1BODA 2LMUA 3NSLA 2Q91A 4I5LB 4GGNA 1OZOA 2MJWB 1BR4B 2ZRSA 4DUQA 3LL8B 2Y4QA 1KSOA 3AKBA 1F54A 1ZFSA 1XFVO 1ZACA 3QRXA 1F55A 1KK8B 3O6BA 4GBAA 4JWQA 1SMGA 2WCFA 3D0YB 4YGBB 3C1VA 2SCPA 1KFUL 1FI5A 1TN4A 1ODBA 1XFWO 4OCIA 5ER4X 1WRKA
chains in the Genus database with same CATH superfamily
2K2AA 3EK8A 1KFUS 4CPVA 4MSPA 1KWOB 4GNKB 4PE1A 1CTRA 2FCDA 1QV1A 1C3ZA 3S0GA 2M3WA 1NP8A 4USLA 2MBXA 4ETOA 4PCWA 1RROA 1UHJA 1Y1UA 5CSIA 2LM5A 3L4AA 4P5OE 2CNPA 3PFVA 4AQIA 2CBLA 1OOGA 1S3PA 5FI2A 2LMVA 3DYEA 3PALA 1WDCC 1SRAA 1YRTB 2HETA 1H4BA 1DEKA 3PJIA 1Y6WA 2LMTA 2GTEA 4FQOA 1PSBA 4ICBA 1A75A 2FJUB 1Z2CB 2LLSA 2NXQA 3NSIA 3BUNB 1CNPA 2NCOA 1F4QA 1M45A 1SL7A 5I2OA 4GPLB 4P2YB 1KCYA 1R2UA 3DVEA 3B7AA 5J3XA 3UNWA 3R1VA 2M1KB 2Y1NA 3NHIA 4YRUA 1M63B 1G4YR 4CFRA 2P71A 3R72A 1PALA 4WQ3A 4XYNA 1KQVA 3DD4A 3EK7A 2L51A 2ZNDA 3OB1B 2NCPA 3HX4A 5D69A 3WHUB 5AERA 3CDNA 4OZDA 5G08A 3BFHA 1YVHA 3RM1A 2F3YA 2JNFA 1RTP1 4PT1A 3CR5X 1F8HA 1QX5B 1NCXA 3OHMB 3CWGA 2H2KA 3D74A 4PHNA 3KEVA 3CR4X 1NCZA 2KFHA 5I8NA 1BLQA 1N0YA 1WRLA 1SCMC 1YURA 4XJKA 1PK0D 2BAPA 1JFJA 4Q04A 1NX0A 2LHLA 5KU1A 1W7JB 3V2LA 1C7WA 1KK8C 3GK2A 3JVTC 1ORGA 1IJ6A 1DJGA 1KSMA 5D7FA 3TDUA 5HL1A 3I5HB 1C7VA 3BUWB 4MBEA 3DVKA 4N1GA 1QJTA 2KFGA 2CCMA 2Y1MA 3PSRA 1TCOB 1ZOTB 2LVIA 2R2IA 1KK7Z 1KWOC 3VROA 4YI9A 5K89A 4TNCA 3RZSA 1IH0A 1K95A 2EGDA 2O60A 1YRUB 5AANA 1L7ZA 2JTTA 2JT3A 4KYNA 2COLB 1FW4A 2PRUA 3DXLA 3CYZA 3CS1A 1UHIA 1OSAA 5HKWA 3B88A 4PHKA 3O4XA 4HRGA 1RJVA 1KK7Y 1SK6D 2AMIA 2KNEA 2ZNEA 1BT6A 2PVBA 1QS7A 2WC8A 1B47A 4INWA 1NYAA 5F6TA 2WCMA 3LCPC 3D76A 1BF5A 1X02A 5I2QA 2CT9A 2WCKA 4MLWA 2L5YA 2HQWA 2JULA 2BECA 4HRHA 1BU3A 2ERBA 2FOTA 3SIAA 1BG1A 4I5JA 1FI6A 4MN0A 2BNXA 2K61A 3GOFA 1B8LA 3RLZA 1QWVA 1TCFA 3BUMB 3OB2B 1M46A 1NX1A 5FI6A 1Y1AA 1K96A 1MHOA 3KO0A 3NSOA 2H8VA 1F4OA 2K7OA 2LE9B 2M0RA 1QV0A 1XA5A 2M7LA 4U8DA 1DGVA 4AOMA 1D1OA 4WQ2A 4C0JA 4ZCVA 1PVAA 3DVJA 4MZJA 3OP0A 2WC6A 1CDPA 3FWCA 1YR5A 3K1EA 2JOJA 2L4HA 2PYQA 1XVJA 3BOWA 1IRJA 1J7RA 1AJ4A 1LS8A 1SCMB 5FYXA 4PALA 4MRXA 1K9UA 2H61C 1S5GZ 2NZ0A 3I5HC 3TDZA 3JVTB 2CXJA 1PVBA 1K2HA 2GGMA 2KSPA 1DC1A 2KAVA 1WLZA 4OVNF 1TRFA 4DS7A 2F2OA 1J1DA 1QLKA 2G2BA 2QEHA 4ORCB 3H4SE 1S1EA 5IBWA 3L4LA 1OOFA 2HPSA 4DIRA 1AVSA 1DJWA 1XFYO 3BFAA 3DF0A 3PM8A 4OV2A 4L9MA 4YGDB 3GK4X 5D3OA 5HLVA 1S5GY 1RECA 1DF0A 1SNLA 2QEBA 1MWNA 2JXCA 4HREE 4INXA 1CFFA 1SKTA 1DMOA 2JC2A 2MAZA 3AAJA 1CM1A 2F3ZA 1CLLA 1XO5A 2JZIA 2WCJA 3EK4A 3IQQA 3N7HA 1A03A 2Y5IA 3I5GB 2QACA 1E8AA 1CMGA 2VRGA 3BQ3A 2P6BB 1U5IB 1B7TZ 3CZTX 1UUSA 1OOIX 3SG6A 2ZRTA 2LVJA 3VRNA 1NWDA 1XK4C 1YUTA 2MHHA 3UO9A 1UHHA 2PQLA 3OX6A 2BE6A 2L5XB 3OX5A 1XFUO 2V53A 2LCPA 2PMYA 3FE9A 3O4YA 1JC2A 1Y1XA 5AFPA 1K93D 2F2PA 1B7TY 1DVIA 4GAOA 1K8UA 1R6PA 1SR6B 3Q8IA 4DCKA 3ZNIA 2FJYA 1OMDA 2A4JA 4NDBA 2KYCA 5DKRA 3CLNA 1RFJA 3CZ1A 3D10A 2KI4B 1HT9A 5KSZA 3PN7B 4PE4A 3WXAA 3GK1A 1XYDA 2K7DA 1ALWA 1IQ5A 1BJFA 2BKHB 2M29A 2RGIA 1CLMA 2AUCA 2JPOA 5HYDA 2TN4A 1QTXA 2K2FA 3VB1A 5DKNA 2M7NA 4AQJA 4NDDA 1W9ZA 2KAYA 3OBVA 2BCAA 1P28A 2AAOA 3B86A 4GUKA 5BPJA 1LVCD 2E6WA 2JNXA 4OR9B 3SS3A 2HF5A 2JT0A 2ZFDA 5CPVA 3SG5A 1JUOA 3D0YA 2ZKMX 4A4BA 1PSRA 2EHBA 1H8BA 3KPXA 1J7OA 2I94A 1DJXA 4MZLA 2I7AA 4QJ4B 1L2OB 2F8PA 2K0JA 1A4PA 3EVVA 1NSHA 2KOTA 2JQ6A 1K9KA 2O5GA 1B1GA 3NSKA 1TNXA 1A2XA 1TNPA 1B4CA 1IG5A 1AUIB 3I5GC 1CM4A 3CZ2A 3IQOA 4CFQA 1YUUA 1EG3A 1OMVA 4ORBB 4PHMA 1MXEA 2JWWA 1G33A 1ALVA 1YUSA 1B8CA 3D73A 3IF7A 2LANA 1W7IB 1JBAA 1CFPA 1MXLC 3PM2A 3EVUA 1GGWA 1PULA 4CIDA 2L98A 1T14A 2ISDA 2LHIA 1BMOA 3MSEB 3NXAA 2IS9A 1DJYA 4C0KA 1FF1A 3D78A 1MQ1A 3AKAA 1JF0A 3CABA 1SR6C 3B6XA 1OQPA 2I18A 5CSJA 1VRKA 1CKKA 2MLFC 4I5KA 2G9BA 1NX2A 4QJ3B 5I94A 1TOPA 3TS5B 1KFXL 2LUCA 2KI4C 3QMEA 3PN7C 4GGFC 2Q4UA 4R1EA 5JJGA 1DTLA 1YX8A 3CR2A 2JXLA 1SSEB 1KFXS 3PLFB 3FIAA 3S0EA 1Y0VH 3I5IB 2F33A 1NCYA 4UPGA 2K7CA 5HKZA 1RWYA 1V1GA 1A75B 1YX7A 2DOQA 1JF2A 2LLUA 1DJIA 2WCEA 3CGAA 1QASA 3FE8A 2MLEC 2QPTA 1SW8A 2SASA 2EC6B 1JFKA 2JRFA 4YGCB 1CDNA 1J55A 2KGBC 1J7PA 1Q80A 2JT8A 2KBMA 3I5FB 2KGRA 5CSFA 2BCXA 2D8NA 3D75A 1OE9B 2OTGB 3VRPA 2H61A 1EJ3A 1K94A 2BKIB 1PRWA 2BL0B 2OPOA 4MVFA 3CZ0A 3HCMA 1IJ5A 4WRIA 1KQMB 1AJ5A 4IL1A 1CFDA 4DRWA 5TNCA 1TUZA 2KAXA 4NDCA 2M49B 5KTYA 3BYAA 2M8UA 4MRYA 2JPTA 1L2OC 1WRZA 1B8RA 5CSNA 5PALA 1SL8A 1CFCA 1FPWA 1ZUZA 2KQ6A 3BJHA 4XJKB 2QEOA 3KF9A 4NQGA 4PE0A 1WLMA 2LP3A 1CB1A 3TUYB 1S36A 1GGZA 3B87A 1GM0A 1V1FA 3TDIA 1QIVA 2I2RE 2KQYA 3EKJA 4PE7A 1QATA 1UHNA 1DGUA 2MRDA 1M39A 5HLOA 1DT7B 2LC5A 5FI7A 2FCEA 1FBVA 4BY5A 2WOSA 3DVMA 2KI6C 3M0WA 3FE6A 4PHJA 1YVLA 2PASA 3WHTB 1TUJA 3A8RA 4N5XA 3ICBA 1N2DA 1XK4A 2BBMA 2LNKA 3SJSA 2QDIA 4PDZA 1IGVA 2WCLA 1MR8A 3VGOA 1QIWA 2PSRA 3L47A 4GFTA 4YGEB 3LLEA 4JPZB 3TS5C 1AP4A 3CTNA 1IKUA 3O78A 3EKHA 1TIZA 4OKHA 4D1EA 3A4UB 4A4CA 1UHKA 1C07A 1QVIZ 4C0LA 1DQEA 3O2PA 1LINA 4N1FA 3I5IC 5AEQA 1JWDA 2WORA 4YI8A 2L0PA 3SIBA 4QJ5B 3BFBA 3BXKA 3R1OA 5ER5A 2K8MB 3F45A 1G8IA 2KBIA 2ZN9A 2GV5A 3EG5B 2EC6C 5GQQC 1QVIY 2LP2A 3PATA 2KHNA 2LVVA 3NHTA 4HSZA 4MEWA 1M31A 3AAKA 3I5FC 2PALA 2L2CA 1RK9A 2WCHA 2OTGC 3JTDC 2CTNA 3SG4A 1XFZO 1F71A 1EL4A 1F70A 3D77A 2WCBA 3OGNA 2BL0C 1J1EA 2KYFA 5I2LA 2LAPA 1KQMC 1DJHA 1S26D 2L50A 2LLTA 1XFRA 3TZ1A 1TTXA 1WY9A 2OS8B 2KI6D 4F0ZB 1QX2A 1MF8B 1QXPA 1TNWA 2K7BA 2LUXA 2HQ8A 1NX3A 3BOWB 3IVTA 2M97A 4IJ7A 1OMRA 2QEVA 3TUYC 1SL9A 2K60A 2JU0A 3LK0A 1K9PA 4FTGA 3S0AA 3NGVA 2KFFA 2LVKA 1DJZA 1QX7A 4ZCUA 1LA0A 2LV7A 3BUXB 3VRQA 3BUOB 4MZKA 3ZWHA 1Z4HA 1CLBA 3FS7A 1NUBA 1CDMA 1OZSA 1IWQA 3FWBA 2M9GA 4ORAB 1U5IA 1N65A 1ZMZA 4JD9A 3DF0B 2L4IA 1BOCA 3EVRA 1EG4A 4CLNA 4YGAA 1A29A 1B9AA 1DF0B 4M2QA 1NIWA 1UURA 2KLDA 1UWOA 1TNQA 1C3YA 2E30A 2JTZA 1OW4A 1S6CA 1SBJA 4JQ0D 3VRRA 4F7FA 4YBHB 1K90D 5DKQA 2YGUA 1DELA 3K21A 1SY9A 2BCBA 1QLSA 2KLEA 3S0FA 4BY4A 2KDHA 5AXIA 4GGFA 1UP5A 1IQ3A 3SS4A 1S6IA 1S6JA 1EH2A 1GQMA 1WDCB 3E3RA 2KPHA 5B8IB 1SCVA 2MA2A 1LKJA 1CDLA 1IIOA 2NLNA 4E68A 4I5NB 2B1UA 5JOLA 1BR1B 1CMFA 2BBNA 1SYMA 2L2EA 4M2OA 4M2PA 5HKYA 3LK1A 1MUXA 2GGZA 2M1UA 3SG3A 1GJYA 5DICA 4FQTA 2ZN8A 3WNXB 3JTDB 1EXRA 1J7QA 1NPQA 1OOJA 2BE4A 3KHEA 2WNDA 1OOHA 2OS8C 1JSAA 1SPYA 3SG7A 1AK8A 3SG2A 1LXFC 1LA3A 3S0BA 1YTZC 1AHRA 1HQVA 1XFXO 2P70A 1BODA 2LMUA 3NSLA 2WC5A 2Q91A 4I5LB 4GGNA 1OZOA 2MJWB 3S0DA 1BR4B 2ZRSA 4DUQA 3LL8B 2Y4QA 5EL2A 1KSOA 3AKBA 1F54A 1ZFSA 1XFVO 1ZACA 3QRXA 1F55A 1KK8B 3O6BA 3R1PA 4GBAA 4JWQA 1SMGA 2WCFA 3D0YB 3DY9A 4YGBB 1TWOA 3SS5A 3C1VA 2SCPA 1KFUL 3DZTA 1FI5A 1TN4A 1ODBA 1XFWO 4OCIA 5ER4X 4JKTA 1WRKA
chains in the Genus database with same CATH topology
2K2AA 3EK8A 1KFUS 4CPVA 4MSPA 1KWOB 4GNKB 4PE1A 1CTRA 2FCDA 1QV1A 2M3WA 1NP8A 4USLA 2MBXA 4ETOA 4PCWA 1RROA 1UHJA 1Y1UA 5CSIA 2LM5A 4P5OE 2CNPA 3PFVA 4AQIA 2CBLA 1S3PA 2LMVA 3PALA 1WDCC 1SRAA 1YRTB 2HETA 1H4BA 1Y6WA 2LMTA 4FQOA 1PSBA 4ICBA 1A75A 2FJUB 2LLSA 2NXQA 3NSIA 3BUNB 1CNPA 2NCOA 1F4QA 1M45A 1SL7A 5I2OA 4GPLB 4P2YB 1KCYA 1R2UA 3DVEA 5J3XA 2M1KB 2Y1NA 4YRUA 1M63B 1G4YR 4CFRA 4WQ3A 1PALA 4XYNA 1KQVA 3DD4A 3EK7A 2L51A 2ZNDA 3OB1B 2NCPA 3HX4A 5D69A 3WHUB 5AERA 5G08A 3RM1A 1YVHA 2F3YA 2JNFA 1RTP1 3CR5X 1F8HA 1QX5B 1NCXA 3OHMB 3CWGA 2H2KA 4PHNA 5I8NA 3KEVA 3CR4X 1NCZA 2KFHA 1BLQA 1N0YA 1WRLA 1SCMC 1YURA 4XJKA 1PK0D 1JFJA 4Q04A 1NX0A 2LHLA 5KU1A 1W7JB 1C7WA 1KK8C 3GK2A 3JVTC 1IJ6A 1DJGA 1KSMA 5D7FA 3TDUA 3I5HB 1C7VA 3BUWB 4MBEA 3DVKA 4N1GA 1QJTA 2KFGA 2CCMA 2Y1MA 3PSRA 1TCOB 1ZOTB 2LVIA 2R2IA 1KK7Z 1KWOC 3VROA 4YI9A 5K89A 4TNCA 1IH0A 1K95A 2EGDA 2O60A 1YRUB 5AANA 1L7ZA 2JTTA 2JT3A 2COLB 1FW4A 2PRUA 3CS1A 1UHIA 1OSAA 5HKWA 4PHKA 4HRGA 1RJVA 1KK7Y 1SK6D 2AMIA 2KNEA 2ZNEA 1BT6A 2PVBA 1QS7A 2WC8A 1B47A 1NYAA 5F6TA 3LCPC 1BF5A 1X02A 5I2QA 2CT9A 4MLWA 2HQWA 2JULA 2BECA 4HRHA 1BU3A 2FOTA 3SIAA 1BG1A 4I5JA 1FI6A 4MN0A 2K61A 3GOFA 1B8LA 3RLZA 1TCFA 3BUMB 3OB2B 1M46A 1NX1A 1Y1AA 1K96A 1MHOA 3KO0A 3NSOA 2M0RA 1F4OA 2K7OA 2LE9B 2M7LA 1QV0A 1XA5A 4AOMA 4U8DA 1DGVA 1D1OA 4WQ2A 4C0JA 4ZCVA 1PVAA 3DVJA 4MZJA 3OP0A 1CDPA 3FWCA 1YR5A 2JOJA 2L4HA 1XVJA 3BOWA 1IRJA 1J7RA 1AJ4A 1SCMB 5FYXA 4PALA 4MRXA 1K9UA 2H61C 1S5GZ 2NZ0A 3I5HC 3TDZA 3JVTB 2CXJA 1PVBA 1K2HA 2GGMA 2KSPA 2KAVA 1WLZA 4OVNF 1TRFA 4DS7A 2F2OA 1J1DA 1QLKA 2G2BA 4ORCB 3H4SE 1S1EA 5IBWA 2HPSA 4DIRA 1AVSA 1DJWA 1XFYO 3DF0A 3PM8A 4YGDB 4OV2A 4L9MA 5HLVA 3GK4X 1S5GY 1RECA 1DF0A 1SNLA 1CFFA 1MWNA 2JXCA 4HREE 1SKTA 1DMOA 2JC2A 2MAZA 3AAJA 1CM1A 2F3ZA 1CLLA 1XO5A 2JZIA 3EK4A 3IQQA 1A03A 2Y5IA 3I5GB 2QACA 1E8AA 1CMGA 2VRGA 3BQ3A 2P6BB 1U5IB 1B7TZ 3CZTX 1UUSA 3SG6A 3VRNA 2ZRTA 2LVJA 1NWDA 1XK4C 1YUTA 2MHHA 1UHHA 3OX6A 2BE6A 2L5XB 3OX5A 1XFUO 2V53A 2LCPA 2PMYA 3O4YA 1JC2A 1Y1XA 5AFPA 1K93D 2F2PA 1B7TY 1DVIA 4GAOA 1K8UA 1R6PA 1SR6B 4DCKA 3ZNIA 1OMDA 2A4JA 4NDBA 2KYCA 5DKRA 3CLNA 1RFJA 3D10A 2KI4B 1HT9A 5KSZA 3PN7B 4PE4A 3WXAA 3GK1A 1XYDA 2K7DA 1ALWA 1IQ5A 1BJFA 2BKHB 2M29A 2RGIA 1CLMA 2AUCA 5HYDA 2TN4A 1QTXA 2K2FA 5DKNA 2M7NA 4AQJA 4NDDA 2KAYA 2BCAA 2AAOA 4GUKA 5BPJA 1LVCD 2E6WA 2JNXA 4OR9B 2HF5A 2JT0A 2ZFDA 5CPVA 3SG5A 1JUOA 3D0YA 2ZKMX 4A4BA 1PSRA 2EHBA 1H8BA 3KPXA 1J7OA 2I94A 1DJXA 4MZLA 2I7AA 4QJ4B 1L2OB 2F8PA 2K0JA 1A4PA 3EVVA 1NSHA 2KOTA 2JQ6A 1K9KA 2O5GA 1B1GA 3NSKA 1TNXA 1A2XA 1TNPA 1B4CA 1IG5A 1AUIB 3I5GC 1CM4A 3IQOA 4CFQA 1YUUA 1EG3A 1OMVA 4ORBB 4PHMA 1MXEA 2JWWA 1G33A 1ALVA 1YUSA 1B8CA 3IF7A 2LANA 1W7IB 1JBAA 1CFPA 1MXLC 3EVUA 1GGWA 1PULA 4CIDA 2L98A 2ISDA 2LHIA 1BMOA 3MSEB 3NXAA 2IS9A 1DJYA 4C0KA 1FF1A 1MQ1A 3AKAA 1JF0A 1SR6C 1OQPA 2I18A 5CSJA 1VRKA 1CKKA 2MLFC 4I5KA 2G9BA 1NX2A 4QJ3B 1TOPA 3TS5B 1KFXL 2LUCA 2KI4C 3PN7C 4GGFC 2Q4UA 4R1EA 5JJGA 1DTLA 1YX8A 3CR2A 2JXLA 1KFXS 3PLFB 3FIAA 1Y0VH 3I5IB 2F33A 1NCYA 4UPGA 2K7CA 5HKZA 1RWYA 1V1GA 1A75B 1YX7A 2DOQA 1JF2A 2LLUA 1DJIA 2WCEA 3CGAA 1QASA 2MLEC 2QPTA 1SW8A 2SASA 2EC6B 1JFKA 2JRFA 4YGCB 1CDNA 1J55A 2KGBC 1J7PA 1Q80A 2JT8A 2KBMA 3I5FB 2KGRA 5CSFA 2BCXA 2D8NA 1OE9B 2OTGB 3VRPA 2H61A 1EJ3A 1K94A 2BKIB 1PRWA 2BL0B 2OPOA 4MVFA 3HCMA 4WRIA 1IJ5A 1KQMB 1AJ5A 4IL1A 1CFDA 4DRWA 5TNCA 2KAXA 4NDCA 2M49B 5KTYA 3BYAA 2M8UA 4MRYA 2JPTA 1L2OC 1WRZA 1B8RA 5CSNA 5PALA 1SL8A 1CFCA 1FPWA 1ZUZA 2KQ6A 4XJKB 3KF9A 4NQGA 4PE0A 1WLMA 2LP3A 1CB1A 3TUYB 1S36A 1GGZA 1V1FA 3TDIA 1QIVA 2I2RE 2KQYA 3EKJA 4PE7A 1QATA 1UHNA 1DGUA 2MRDA 1M39A 5HLOA 1DT7B 2LC5A 2FCEA 1FBVA 4BY5A 2WOSA 3DVMA 2KI6C 3M0WA 4PHJA 1YVLA 2PASA 3WHTB 3A8RA 4N5XA 3ICBA 1N2DA 1XK4A 2BBMA 2LNKA 3SJSA 4PDZA 1IGVA 1MR8A 3VGOA 1QIWA 2PSRA 4GFTA 4YGEB 3LLEA 4JPZB 3TS5C 1AP4A 3CTNA 1IKUA 3O78A 3EKHA 1TIZA 4OKHA 4D1EA 3A4UB 4A4CA 1UHKA 1C07A 1QVIZ 4C0LA 3O2PA 1LINA 4N1FA 3I5IC 5AEQA 1JWDA 2WORA 4YI8A 2L0PA 3SIBA 4QJ5B 3BXKA 5ER5A 2K8MB 3F45A 1G8IA 2KBIA 2ZN9A 2GV5A 5GQQC 2EC6C 1QVIY 2LP2A 3PATA 2KHNA 2LVVA 4HSZA 4MEWA 1M31A 3AAKA 3I5FC 2PALA 1RK9A 3JTDC 2OTGC 1F71A 2CTNA 3SG4A 1XFZO 1EL4A 1F70A 2WCBA 2BL0C 1J1EA 2KYFA 5I2LA 2LAPA 1KQMC 1DJHA 1S26D 2L50A 2LLTA 3TZ1A 1TTXA 1WY9A 2OS8B 2KI6D 4F0ZB 1QX2A 1MF8B 1QXPA 1TNWA 2K7BA 2LUXA 2HQ8A 1NX3A 3BOWB 2M97A 1OMRA 3TUYC 1SL9A 2JU0A 3LK0A 1K9PA 4FTGA 2KFFA 2LVKA 1DJZA 1QX7A 4ZCUA 1LA0A 2LV7A 3BUXB 3VRQA 3BUOB 4MZKA 3ZWHA 1CLBA 3FS7A 1NUBA 1CDMA 1OZSA 1IWQA 3FWBA 2M9GA 4ORAB 1U5IA 1N65A 1ZMZA 3DF0B 2L4IA 1BOCA 3EVRA 1EG4A 4CLNA 4YGAA 1A29A 1B9AA 1DF0B 4M2QA 1NIWA 1UURA 1UWOA 1TNQA 2E30A 2JTZA 1S6CA 1SBJA 4JQ0D 3VRRA 4YBHB 1K90D 5DKQA 3K21A 1SY9A 2BCBA 1QLSA 4BY4A 2KDHA 5AXIA 4GGFA 1UP5A 1IQ3A 1S6IA 1S6JA 1EH2A 1GQMA 1WDCB 3E3RA 5B8IB 1SCVA 2MA2A 1LKJA 1CDLA 2NLNA 4E68A 4I5NB 2B1UA 5JOLA 1BR1B 1CMFA 2BBNA 1SYMA 2L2EA 4M2OA 4M2PA 5HKYA 3LK1A 1MUXA 2GGZA 2M1UA 3SG3A 1GJYA 2ZN8A 3WNXB 3JTDB 1EXRA 1J7QA 1NPQA 1OOJA 2BE4A 3KHEA 2WNDA 2OS8C 1JSAA 1SPYA 3SG7A 1AK8A 3SG2A 1LXFC 1LA3A 1YTZC 1AHRA 1HQVA 1XFXO 1BODA 2LMUA 3NSLA 2Q91A 4I5LB 4GGNA 1OZOA 2MJWB 1BR4B 2ZRSA 4DUQA 3LL8B 2Y4QA 1KSOA 3AKBA 1F54A 1ZFSA 1XFVO 1ZACA 3QRXA 1F55A 1KK8B 3O6BA 4GBAA 4JWQA 1SMGA 2WCFA 3D0YB 4YGBB 3C1VA 2SCPA 1KFUL 1FI5A 1TN4A 1ODBA 1XFWO 4OCIA 5ER4X 1WRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2A A;  3EK8 A;  1KFU S;  4CPV A;  4MSP A;  1KWO B;  4GNK B;  4PE1 A;  1CTR A;  2FCD A;  1QV1 A;  2M3W A;  1NP8 A;  4USL A;  2MBX A;  4ETO A;  4PCW A;  1RRO A;  1UHJ A;  1Y1U A;  5CSI A;  2LM5 A;  4P5O E;  2CNP A;  3PFV A;  4AQI A;  2CBL A;  1S3P A;  2LMV A;  3PAL A;  1WDC C;  1SRA A;  1YRT B;  2HET A;  1H4B A;  1Y6W A;  2LMT A;  4FQO A;  1PSB A;  4ICB A;  1A75 A;  2FJU B;  2LLS A;  2NXQ A;  3NSI A;  3BUN B;  1CNP A;  2NCO A;  1F4Q A;  1M45 A;  1SL7 A;  5I2O A;  4GPL B;  4P2Y B;  1KCY A;  1R2U A;  3DVE A;  5J3X A;  2M1K B;  2Y1N A;  4YRU A;  1M63 B;  1G4Y R;  4CFR A;  4WQ3 A;  1PAL A;  4XYN A;  1KQV A;  3DD4 A;  3EK7 A;  2L51 A;  2ZND A;  3OB1 B;  2NCP A;  3HX4 A;  5D69 A;  3WHU B;  5AER A;  5G08 A;  3RM1 A;  1YVH A;  2F3Y A;  2JNF A;  1RTP 1;  3CR5 X;  1F8H A;  1QX5 B;  1NCX A;  3OHM B;  3CWG A;  2H2K A;  4PHN A;  5I8N A;  3KEV A;  3CR4 X;  1NCZ A;  2KFH A;  1BLQ A;  1N0Y A;  1WRL A;  1SCM C;  1YUR A;  4XJK A;  1PK0 D;  1JFJ A;  4Q04 A;  1NX0 A;  2LHL A;  5KU1 A;  1W7J B;  1C7W A;  1KK8 C;  3GK2 A;  3JVT C;  1IJ6 A;  1DJG A;  1KSM A;  5D7F A;  3TDU A;  3I5H B;  1C7V A;  3BUW B;  4MBE A;  3DVK A;  4N1G A;  1QJT A;  2KFG A;  2CCM A;  2Y1M A;  3PSR A;  1TCO B;  1ZOT B;  2LVI A;  2R2I A;  1KK7 Z;  1KWO C;  3VRO A;  4YI9 A;  5K89 A;  4TNC A;  1IH0 A;  1K95 A;  2EGD A;  2O60 A;  1YRU B;  5AAN A;  1L7Z A;  2JTT A;  2JT3 A;  2COL B;  1FW4 A;  2PRU A;  3CS1 A;  1UHI A;  1OSA A;  5HKW A;  4PHK A;  4HRG A;  1RJV A;  1KK7 Y;  1SK6 D;  2AMI A;  2KNE A;  2ZNE A;  1BT6 A;  2PVB A;  1QS7 A;  2WC8 A;  1B47 A;  1NYA A;  5F6T A;  3LCP C;  1BF5 A;  1X02 A;  5I2Q A;  2CT9 A;  4MLW A;  2HQW A;  2JUL A;  2BEC A;  4HRH A;  1BU3 A;  2FOT A;  3SIA A;  1BG1 A;  4I5J A;  1FI6 A;  4MN0 A;  2K61 A;  3GOF A;  1B8L A;  3RLZ A;  1TCF A;  3BUM B;  3OB2 B;  1M46 A;  1NX1 A;  1Y1A A;  1K96 A;  1MHO A;  3KO0 A;  3NSO A;  2M0R A;  1F4O A;  2K7O A;  2LE9 B;  2M7L A;  1QV0 A;  1XA5 A;  4AOM A;  4U8D A;  1DGV A;  1D1O A;  4WQ2 A;  4C0J A;  4ZCV A;  1PVA A;  3DVJ A;  4MZJ A;  3OP0 A;  1CDP A;  3FWC A;  1YR5 A;  2JOJ A;  2L4H A;  1XVJ A;  3BOW A;  1IRJ A;  1J7R A;  1AJ4 A;  1SCM B;  5FYX A;  4PAL A;  4MRX A;  1K9U A;  2H61 C;  1S5G Z;  2NZ0 A;  3I5H C;  3TDZ A;  3JVT B;  2CXJ A;  1PVB A;  1K2H A;  2GGM A;  2KSP A;  2KAV A;  1WLZ A;  4OVN F;  1TRF A;  4DS7 A;  2F2O A;  1J1D A;  1QLK A;  2G2B A;  4ORC B;  3H4S E;  1S1E A;  5IBW A;  2HPS A;  4DIR A;  1AVS A;  1DJW A;  1XFY O;  3DF0 A;  3PM8 A;  4YGD B;  4OV2 A;  4L9M A;  5HLV A;  3GK4 X;  1S5G Y;  1REC A;  1DF0 A;  1SNL A;  1CFF A;  1MWN A;  2JXC A;  4HRE E;  1SKT A;  1DMO A;  2JC2 A;  2MAZ A;  3AAJ A;  1CM1 A;  2F3Z A;  1CLL A;  1XO5 A;  2JZI A;  3EK4 A;  3IQQ A;  1A03 A;  2Y5I A;  3I5G B;  2QAC A;  1E8A A;  1CMG A;  2VRG A;  3BQ3 A;  2P6B B;  1U5I B;  1B7T Z;  3CZT X;  1UUS A;  3SG6 A;  3VRN A;  2ZRT A;  2LVJ A;  1NWD A;  1XK4 C;  1YUT A;  2MHH A;  1UHH A;  3OX6 A;  2BE6 A;  2L5X B;  3OX5 A;  1XFU O;  2V53 A;  2LCP A;  2PMY A;  3O4Y A;  1JC2 A;  1Y1X A;  5AFP A;  1K93 D;  2F2P A;  1B7T Y;  1DVI A;  4GAO A;  1K8U A;  1R6P A;  1SR6 B;  4DCK A;  3ZNI A;  1OMD A;  2A4J A;  4NDB A;  2KYC A;  5DKR A;  3CLN A;  1RFJ A;  3D10 A;  2KI4 B;  1HT9 A;  5KSZ A;  3PN7 B;  4PE4 A;  3WXA A;  3GK1 A;  1XYD A;  2K7D A;  1ALW A;  1IQ5 A;  1BJF A;  2BKH B;  2M29 A;  2RGI A;  1CLM A;  2AUC A;  5HYD A;  2TN4 A;  1QTX A;  2K2F A;  5DKN A;  2M7N A;  4AQJ A;  4NDD A;  2KAY A;  2BCA A;  2AAO A;  4GUK A;  5BPJ A;  1LVC D;  2E6W A;  2JNX A;  4OR9 B;  2HF5 A;  2JT0 A;  2ZFD A;  5CPV A;  3SG5 A;  1JUO A;  3D0Y A;  2ZKM X;  4A4B A;  1PSR A;  2EHB A;  1H8B A;  3KPX A;  1J7O A;  2I94 A;  1DJX A;  4MZL A;  2I7A A;  4QJ4 B;  1L2O B;  2F8P A;  2K0J A;  1A4P A;  3EVV A;  1NSH A;  2KOT A;  2JQ6 A;  1K9K A;  2O5G A;  1B1G A;  3NSK A;  1TNX A;  1A2X A;  1TNP A;  1B4C A;  1IG5 A;  1AUI B;  3I5G C;  1CM4 A;  3IQO A;  4CFQ A;  1YUU A;  1EG3 A;  1OMV A;  4ORB B;  4PHM A;  1MXE A;  2JWW A;  1G33 A;  1ALV A;  1YUS A;  1B8C A;  3IF7 A;  2LAN A;  1W7I B;  1JBA A;  1CFP A;  1MXL C;  3EVU A;  1GGW A;  1PUL A;  4CID A;  2L98 A;  2ISD A;  2LHI A;  1BMO A;  3MSE B;  3NXA A;  2IS9 A;  1DJY A;  4C0K A;  1FF1 A;  1MQ1 A;  3AKA A;  1JF0 A;  1SR6 C;  1OQP A;  2I18 A;  5CSJ A;  1VRK A;  1CKK A;  2MLF C;  4I5K A;  2G9B A;  1NX2 A;  4QJ3 B;  1TOP A;  3TS5 B;  1KFX L;  2LUC A;  2KI4 C;  3PN7 C;  4GGF C;  2Q4U A;  4R1E A;  5JJG A;  1DTL A;  1YX8 A;  3CR2 A;  2JXL A;  1KFX S;  3PLF B;  3FIA A;  1Y0V H;  3I5I B;  2F33 A;  1NCY A;  4UPG A;  2K7C A;  5HKZ A;  1RWY A;  1V1G A;  1A75 B;  1YX7 A;  2DOQ A;  1JF2 A;  2LLU A;  1DJI A;  2WCE A;  3CGA A;  1QAS A;  2MLE C;  2QPT A;  1SW8 A;  2SAS A;  2EC6 B;  1JFK A;  2JRF A;  4YGC B;  1CDN A;  1J55 A;  2KGB C;  1J7P A;  1Q80 A;  2JT8 A;  2KBM A;  3I5F B;  2KGR A;  5CSF A;  2BCX A;  2D8N A;  1OE9 B;  2OTG B;  3VRP A;  2H61 A;  1EJ3 A;  1K94 A;  2BKI B;  1PRW A;  2BL0 B;  2OPO A;  4MVF A;  3HCM A;  4WRI A;  1IJ5 A;  1KQM B;  1AJ5 A;  4IL1 A;  1CFD A;  4DRW A;  5TNC A;  2KAX A;  4NDC A;  2M49 B;  5KTY A;  3BYA A;  2M8U A;  4MRY A;  2JPT A;  1L2O C;  1WRZ A;  1B8R A;  5CSN A;  5PAL A;  1SL8 A;  1CFC A;  1FPW A;  1ZUZ A;  2KQ6 A;  4XJK B;  3KF9 A;  4NQG A;  4PE0 A;  1WLM A;  2LP3 A;  1CB1 A;  3TUY B;  1S36 A;  1GGZ A;  1V1F A;  3TDI A;  1QIV A;  2I2R E;  2KQY A;  3EKJ A;  4PE7 A;  1QAT A;  1UHN A;  1DGU A;  2MRD A;  1M39 A;  5HLO A;  1DT7 B;  2LC5 A;  2FCE A;  1FBV A;  4BY5 A;  2WOS A;  3DVM A;  2KI6 C;  3M0W A;  4PHJ A;  1YVL A;  2PAS A;  3WHT B;  3A8R A;  4N5X A;  3ICB A;  1N2D A;  1XK4 A;  2BBM A;  2LNK A;  3SJS A;  4PDZ A;  1IGV A;  1MR8 A;  3VGO A;  1QIW A;  2PSR A;  4GFT A;  4YGE B;  3LLE A;  4JPZ B;  3TS5 C;  1AP4 A;  3CTN A;  1IKU A;  3O78 A;  3EKH A;  1TIZ A;  4OKH A;  4D1E A;  3A4U B;  4A4C A;  1UHK A;  1C07 A;  1QVI Z;  4C0L A;  3O2P A;  1LIN A;  4N1F A;  3I5I C;  5AEQ A;  1JWD A;  2WOR A;  4YI8 A;  2L0P A;  3SIB A;  4QJ5 B;  3BXK A;  5ER5 A;  2K8M B;  3F45 A;  1G8I A;  2KBI A;  2ZN9 A;  2GV5 A;  5GQQ C;  2EC6 C;  1QVI Y;  2LP2 A;  3PAT A;  2KHN A;  2LVV A;  4HSZ A;  4MEW A;  1M31 A;  3AAK A;  3I5F C;  2PAL A;  1RK9 A;  3JTD C;  2OTG C;  1F71 A;  2CTN A;  3SG4 A;  1XFZ O;  1EL4 A;  1F70 A;  2WCB A;  2BL0 C;  1J1E A;  2KYF A;  5I2L A;  2LAP A;  1KQM C;  1DJH A;  1S26 D;  2L50 A;  2LLT A;  3TZ1 A;  1TTX A;  1WY9 A;  2OS8 B;  2KI6 D;  4F0Z B;  1QX2 A;  1MF8 B;  1QXP A;  1TNW A;  2K7B A;  2LUX A;  2HQ8 A;  1NX3 A;  3BOW B;  2M97 A;  1OMR A;  3TUY C;  1SL9 A;  2JU0 A;  3LK0 A;  1K9P A;  4FTG A;  2KFF A;  2LVK A;  1DJZ A;  1QX7 A;  4ZCU A;  1LA0 A;  2LV7 A;  3BUX B;  3VRQ A;  3BUO B;  4MZK A;  3ZWH A;  1CLB A;  3FS7 A;  1NUB A;  1CDM A;  1OZS A;  1IWQ A;  3FWB A;  2M9G A;  4ORA B;  1U5I A;  1N65 A;  1ZMZ A;  3DF0 B;  2L4I A;  1BOC A;  3EVR A;  1EG4 A;  4CLN A;  4YGA A;  1A29 A;  1B9A A;  1DF0 B;  4M2Q A;  1NIW A;  1UUR A;  1UWO A;  1TNQ A;  2E30 A;  2JTZ A;  1S6C A;  1SBJ A;  4JQ0 D;  3VRR A;  4YBH B;  1K90 D;  5DKQ A;  3K21 A;  1SY9 A;  2BCB A;  1QLS A;  4BY4 A;  2KDH A;  5AXI A;  4GGF A;  1UP5 A;  1IQ3 A;  1S6I A;  1S6J A;  1EH2 A;  1GQM A;  1WDC B;  3E3R A;  5B8I B;  1SCV A;  2MA2 A;  1LKJ A;  1CDL A;  2NLN A;  4E68 A;  4I5N B;  2B1U A;  5JOL A;  1BR1 B;  1CMF A;  2BBN A;  1SYM A;  2L2E A;  4M2O A;  4M2P A;  5HKY A;  3LK1 A;  1MUX A;  2GGZ A;  2M1U A;  3SG3 A;  1GJY A;  2ZN8 A;  3WNX B;  3JTD B;  1EXR A;  1J7Q A;  1NPQ A;  1OOJ A;  2BE4 A;  3KHE A;  2WND A;  2OS8 C;  1JSA A;  1SPY A;  3SG7 A;  1AK8 A;  3SG2 A;  1LXF C;  1LA3 A;  1YTZ C;  1AHR A;  1HQV A;  1XFX O;  1BOD A;  2LMU A;  3NSL A;  2Q91 A;  4I5L B;  4GGN A;  1OZO A;  2MJW B;  1BR4 B;  2ZRS A;  4DUQ A;  3LL8 B;  2Y4Q A;  1KSO A;  3AKB A;  1F54 A;  1ZFS A;  1XFV O;  1ZAC A;  3QRX A;  1F55 A;  1KK8 B;  3O6B A;  4GBA A;  4JWQ A;  1SMG A;  2WCF A;  3D0Y B;  4YGB B;  3C1V A;  2SCP A;  1KFU L;  1FI5 A;  1TN4 A;  1ODB A;  1XFW O;  4OCI A;  5ER4 X;  1WRK A; 
#chains in the Genus database with same CATH topology
 2K2A A;  3EK8 A;  1KFU S;  4CPV A;  4MSP A;  1KWO B;  4GNK B;  4PE1 A;  1CTR A;  2FCD A;  1QV1 A;  1C3Z A;  3S0G A;  2M3W A;  1NP8 A;  4USL A;  2MBX A;  4ETO A;  4PCW A;  1RRO A;  1UHJ A;  1Y1U A;  5CSI A;  2LM5 A;  3L4A A;  4P5O E;  2CNP A;  3PFV A;  4AQI A;  2CBL A;  1OOG A;  1S3P A;  5FI2 A;  2LMV A;  3DYE A;  3PAL A;  1WDC C;  1SRA A;  1YRT B;  2HET A;  1H4B A;  1DEK A;  3PJI A;  1Y6W A;  2LMT A;  2GTE A;  4FQO A;  1PSB A;  4ICB A;  1A75 A;  2FJU B;  1Z2C B;  2LLS A;  2NXQ A;  3NSI A;  3BUN B;  1CNP A;  2NCO A;  1F4Q A;  1M45 A;  1SL7 A;  5I2O A;  4GPL B;  4P2Y B;  1KCY A;  1R2U A;  3DVE A;  3B7A A;  5J3X A;  3UNW A;  3R1V A;  2M1K B;  2Y1N A;  3NHI A;  4YRU A;  1M63 B;  1G4Y R;  4CFR A;  2P71 A;  3R72 A;  1PAL A;  4WQ3 A;  4XYN A;  1KQV A;  3DD4 A;  3EK7 A;  2L51 A;  2ZND A;  3OB1 B;  2NCP A;  3HX4 A;  5D69 A;  3WHU B;  5AER A;  3CDN A;  4OZD A;  5G08 A;  3BFH A;  1YVH A;  3RM1 A;  2F3Y A;  2JNF A;  1RTP 1;  4PT1 A;  3CR5 X;  1F8H A;  1QX5 B;  1NCX A;  3OHM B;  3CWG A;  2H2K A;  3D74 A;  4PHN A;  3KEV A;  3CR4 X;  1NCZ A;  2KFH A;  5I8N A;  1BLQ A;  1N0Y A;  1WRL A;  1SCM C;  1YUR A;  4XJK A;  1PK0 D;  2BAP A;  1JFJ A;  4Q04 A;  1NX0 A;  2LHL A;  5KU1 A;  1W7J B;  3V2L A;  1C7W A;  1KK8 C;  3GK2 A;  3JVT C;  1ORG A;  1IJ6 A;  1DJG A;  1KSM A;  5D7F A;  3TDU A;  5HL1 A;  3I5H B;  1C7V A;  3BUW B;  4MBE A;  3DVK A;  4N1G A;  1QJT A;  2KFG A;  2CCM A;  2Y1M A;  3PSR A;  1TCO B;  1ZOT B;  2LVI A;  2R2I A;  1KK7 Z;  1KWO C;  3VRO A;  4YI9 A;  5K89 A;  4TNC A;  3RZS A;  1IH0 A;  1K95 A;  2EGD A;  2O60 A;  1YRU B;  5AAN A;  1L7Z A;  2JTT A;  2JT3 A;  4KYN A;  2COL B;  1FW4 A;  2PRU A;  3DXL A;  3CYZ A;  3CS1 A;  1UHI A;  1OSA A;  5HKW A;  3B88 A;  4PHK A;  3O4X A;  4HRG A;  1RJV A;  1KK7 Y;  1SK6 D;  2AMI A;  2KNE A;  2ZNE A;  1BT6 A;  2PVB A;  1QS7 A;  2WC8 A;  1B47 A;  4INW A;  1NYA A;  5F6T A;  2WCM A;  3LCP C;  3D76 A;  1BF5 A;  1X02 A;  5I2Q A;  2CT9 A;  2WCK A;  4MLW A;  2L5Y A;  2HQW A;  2JUL A;  2BEC A;  4HRH A;  1BU3 A;  2ERB A;  2FOT A;  3SIA A;  1BG1 A;  4I5J A;  1FI6 A;  4MN0 A;  2BNX A;  2K61 A;  3GOF A;  1B8L A;  3RLZ A;  1QWV A;  1TCF A;  3BUM B;  3OB2 B;  1M46 A;  1NX1 A;  5FI6 A;  1Y1A A;  1K96 A;  1MHO A;  3KO0 A;  3NSO A;  2H8V A;  1F4O A;  2K7O A;  2LE9 B;  2M0R A;  1QV0 A;  1XA5 A;  2M7L A;  4U8D A;  1DGV A;  4AOM A;  1D1O A;  4WQ2 A;  4C0J A;  4ZCV A;  1PVA A;  3DVJ A;  4MZJ A;  3OP0 A;  2WC6 A;  1CDP A;  3FWC A;  1YR5 A;  3K1E A;  2JOJ A;  2L4H A;  2PYQ A;  1XVJ A;  3BOW A;  1IRJ A;  1J7R A;  1AJ4 A;  1LS8 A;  1SCM B;  5FYX A;  4PAL A;  4MRX A;  1K9U A;  2H61 C;  1S5G Z;  2NZ0 A;  3I5H C;  3TDZ A;  3JVT B;  2CXJ A;  1PVB A;  1K2H A;  2GGM A;  2KSP A;  1DC1 A;  2KAV A;  1WLZ A;  4OVN F;  1TRF A;  4DS7 A;  2F2O A;  1J1D A;  1QLK A;  2G2B A;  2QEH A;  4ORC B;  3H4S E;  1S1E A;  5IBW A;  3L4L A;  1OOF A;  2HPS A;  4DIR A;  1AVS A;  1DJW A;  1XFY O;  3BFA A;  3DF0 A;  3PM8 A;  4OV2 A;  4L9M A;  4YGD B;  3GK4 X;  5D3O A;  5HLV A;  1S5G Y;  1REC A;  1DF0 A;  1SNL A;  2QEB A;  1MWN A;  2JXC A;  4HRE E;  4INX A;  1CFF A;  1SKT A;  1DMO A;  2JC2 A;  2MAZ A;  3AAJ A;  1CM1 A;  2F3Z A;  1CLL A;  1XO5 A;  2JZI A;  2WCJ A;  3EK4 A;  3IQQ A;  3N7H A;  1A03 A;  2Y5I A;  3I5G B;  2QAC A;  1E8A A;  1CMG A;  2VRG A;  3BQ3 A;  2P6B B;  1U5I B;  1B7T Z;  3CZT X;  1UUS A;  1OOI X;  3SG6 A;  2ZRT A;  2LVJ A;  3VRN A;  1NWD A;  1XK4 C;  1YUT A;  2MHH A;  3UO9 A;  1UHH A;  2PQL A;  3OX6 A;  2BE6 A;  2L5X B;  3OX5 A;  1XFU O;  2V53 A;  2LCP A;  2PMY A;  3FE9 A;  3O4Y A;  1JC2 A;  1Y1X A;  5AFP A;  1K93 D;  2F2P A;  1B7T Y;  1DVI A;  4GAO A;  1K8U A;  1R6P A;  1SR6 B;  3Q8I A;  4DCK A;  3ZNI A;  2FJY A;  1OMD A;  2A4J A;  4NDB A;  2KYC A;  5DKR A;  3CLN A;  1RFJ A;  3CZ1 A;  3D10 A;  2KI4 B;  1HT9 A;  5KSZ A;  3PN7 B;  4PE4 A;  3WXA A;  3GK1 A;  1XYD A;  2K7D A;  1ALW A;  1IQ5 A;  1BJF A;  2BKH B;  2M29 A;  2RGI A;  1CLM A;  2AUC A;  2JPO A;  5HYD A;  2TN4 A;  1QTX A;  2K2F A;  3VB1 A;  5DKN A;  2M7N A;  4AQJ A;  4NDD A;  1W9Z A;  2KAY A;  3OBV A;  2BCA A;  1P28 A;  2AAO A;  3B86 A;  4GUK A;  5BPJ A;  1LVC D;  2E6W A;  2JNX A;  4OR9 B;  3SS3 A;  2HF5 A;  2JT0 A;  2ZFD A;  5CPV A;  3SG5 A;  1JUO A;  3D0Y A;  2ZKM X;  4A4B A;  1PSR A;  2EHB A;  1H8B A;  3KPX A;  1J7O A;  2I94 A;  1DJX A;  4MZL A;  2I7A A;  4QJ4 B;  1L2O B;  2F8P A;  2K0J A;  1A4P A;  3EVV A;  1NSH A;  2KOT A;  2JQ6 A;  1K9K A;  2O5G A;  1B1G A;  3NSK A;  1TNX A;  1A2X A;  1TNP A;  1B4C A;  1IG5 A;  1AUI B;  3I5G C;  1CM4 A;  3CZ2 A;  3IQO A;  4CFQ A;  1YUU A;  1EG3 A;  1OMV A;  4ORB B;  4PHM A;  1MXE A;  2JWW A;  1G33 A;  1ALV A;  1YUS A;  1B8C A;  3D73 A;  3IF7 A;  2LAN A;  1W7I B;  1JBA A;  1CFP A;  1MXL C;  3PM2 A;  3EVU A;  1GGW A;  1PUL A;  4CID A;  2L98 A;  1T14 A;  2ISD A;  2LHI A;  1BMO A;  3MSE B;  3NXA A;  2IS9 A;  1DJY A;  4C0K A;  1FF1 A;  3D78 A;  1MQ1 A;  3AKA A;  1JF0 A;  3CAB A;  1SR6 C;  3B6X A;  1OQP A;  2I18 A;  5CSJ A;  1VRK A;  1CKK A;  2MLF C;  4I5K A;  2G9B A;  1NX2 A;  4QJ3 B;  5I94 A;  1TOP A;  3TS5 B;  1KFX L;  2LUC A;  2KI4 C;  3QME A;  3PN7 C;  4GGF C;  2Q4U A;  4R1E A;  5JJG A;  1DTL A;  1YX8 A;  3CR2 A;  2JXL A;  1SSE B;  1KFX S;  3PLF B;  3FIA A;  3S0E A;  1Y0V H;  3I5I B;  2F33 A;  1NCY A;  4UPG A;  2K7C A;  5HKZ A;  1RWY A;  1V1G A;  1A75 B;  1YX7 A;  2DOQ A;  1JF2 A;  2LLU A;  1DJI A;  2WCE A;  3CGA A;  1QAS A;  3FE8 A;  2MLE C;  2QPT A;  1SW8 A;  2SAS A;  2EC6 B;  1JFK A;  2JRF A;  4YGC B;  1CDN A;  1J55 A;  2KGB C;  1J7P A;  1Q80 A;  2JT8 A;  2KBM A;  3I5F B;  2KGR A;  5CSF A;  2BCX A;  2D8N A;  3D75 A;  1OE9 B;  2OTG B;  3VRP A;  2H61 A;  1EJ3 A;  1K94 A;  2BKI B;  1PRW A;  2BL0 B;  2OPO A;  4MVF A;  3CZ0 A;  3HCM A;  1IJ5 A;  4WRI A;  1KQM B;  1AJ5 A;  4IL1 A;  1CFD A;  4DRW A;  5TNC A;  1TUZ A;  2KAX A;  4NDC A;  2M49 B;  5KTY A;  3BYA A;  2M8U A;  4MRY A;  2JPT A;  1L2O C;  1WRZ A;  1B8R A;  5CSN A;  5PAL A;  1SL8 A;  1CFC A;  1FPW A;  1ZUZ A;  2KQ6 A;  3BJH A;  4XJK B;  2QEO A;  3KF9 A;  4NQG A;  4PE0 A;  1WLM A;  2LP3 A;  1CB1 A;  3TUY B;  1S36 A;  1GGZ A;  3B87 A;  1GM0 A;  1V1F A;  3TDI A;  1QIV A;  2I2R E;  2KQY A;  3EKJ A;  4PE7 A;  1QAT A;  1UHN A;  1DGU A;  2MRD A;  1M39 A;  5HLO A;  1DT7 B;  2LC5 A;  5FI7 A;  2FCE A;  1FBV A;  4BY5 A;  2WOS A;  3DVM A;  2KI6 C;  3M0W A;  3FE6 A;  4PHJ A;  1YVL A;  2PAS A;  3WHT B;  1TUJ A;  3A8R A;  4N5X A;  3ICB A;  1N2D A;  1XK4 A;  2BBM A;  2LNK A;  3SJS A;  2QDI A;  4PDZ A;  1IGV A;  2WCL A;  1MR8 A;  3VGO A;  1QIW A;  2PSR A;  3L47 A;  4GFT A;  4YGE B;  3LLE A;  4JPZ B;  3TS5 C;  1AP4 A;  3CTN A;  1IKU A;  3O78 A;  3EKH A;  1TIZ A;  4OKH A;  4D1E A;  3A4U B;  4A4C A;  1UHK A;  1C07 A;  1QVI Z;  4C0L A;  1DQE A;  3O2P A;  1LIN A;  4N1F A;  3I5I C;  5AEQ A;  1JWD A;  2WOR A;  4YI8 A;  2L0P A;  3SIB A;  4QJ5 B;  3BFB A;  3BXK A;  3R1O A;  5ER5 A;  2K8M B;  3F45 A;  1G8I A;  2KBI A;  2ZN9 A;  2GV5 A;  3EG5 B;  2EC6 C;  5GQQ C;  1QVI Y;  2LP2 A;  3PAT A;  2KHN A;  2LVV A;  3NHT A;  4HSZ A;  4MEW A;  1M31 A;  3AAK A;  3I5F C;  2PAL A;  2L2C A;  1RK9 A;  2WCH A;  2OTG C;  3JTD C;  2CTN A;  3SG4 A;  1XFZ O;  1F71 A;  1EL4 A;  1F70 A;  3D77 A;  2WCB A;  3OGN A;  2BL0 C;  1J1E A;  2KYF A;  5I2L A;  2LAP A;  1KQM C;  1DJH A;  1S26 D;  2L50 A;  2LLT A;  1XFR A;  3TZ1 A;  1TTX A;  1WY9 A;  2OS8 B;  2KI6 D;  4F0Z B;  1QX2 A;  1MF8 B;  1QXP A;  1TNW A;  2K7B A;  2LUX A;  2HQ8 A;  1NX3 A;  3BOW B;  3IVT A;  2M97 A;  4IJ7 A;  1OMR A;  2QEV A;  3TUY C;  1SL9 A;  2K60 A;  2JU0 A;  3LK0 A;  1K9P A;  4FTG A;  3S0A A;  3NGV A;  2KFF A;  2LVK A;  1DJZ A;  1QX7 A;  4ZCU A;  1LA0 A;  2LV7 A;  3BUX B;  3VRQ A;  3BUO B;  4MZK A;  3ZWH A;  1Z4H A;  1CLB A;  3FS7 A;  1NUB A;  1CDM A;  1OZS A;  1IWQ A;  3FWB A;  2M9G A;  4ORA B;  1U5I A;  1N65 A;  1ZMZ A;  4JD9 A;  3DF0 B;  2L4I A;  1BOC A;  3EVR A;  1EG4 A;  4CLN A;  4YGA A;  1A29 A;  1B9A A;  1DF0 B;  4M2Q A;  1NIW A;  1UUR A;  2KLD A;  1UWO A;  1TNQ A;  1C3Y A;  2E30 A;  2JTZ A;  1OW4 A;  1S6C A;  1SBJ A;  4JQ0 D;  3VRR A;  4F7F A;  4YBH B;  1K90 D;  5DKQ A;  2YGU A;  1DEL A;  3K21 A;  1SY9 A;  2BCB A;  1QLS A;  2KLE A;  3S0F A;  4BY4 A;  2KDH A;  5AXI A;  4GGF A;  1UP5 A;  1IQ3 A;  3SS4 A;  1S6I A;  1S6J A;  1EH2 A;  1GQM A;  1WDC B;  3E3R A;  2KPH A;  5B8I B;  1SCV A;  2MA2 A;  1LKJ A;  1CDL A;  1IIO A;  2NLN A;  4E68 A;  4I5N B;  2B1U A;  5JOL A;  1BR1 B;  1CMF A;  2BBN A;  1SYM A;  2L2E A;  4M2O A;  4M2P A;  5HKY A;  3LK1 A;  1MUX A;  2GGZ A;  2M1U A;  3SG3 A;  1GJY A;  5DIC A;  4FQT A;  2ZN8 A;  3WNX B;  3JTD B;  1EXR A;  1J7Q A;  1NPQ A;  1OOJ A;  2BE4 A;  3KHE A;  2WND A;  1OOH A;  2OS8 C;  1JSA A;  1SPY A;  3SG7 A;  1AK8 A;  3SG2 A;  1LXF C;  1LA3 A;  3S0B A;  1YTZ C;  1AHR A;  1HQV A;  1XFX O;  2P70 A;  1BOD A;  2LMU A;  3NSL A;  2WC5 A;  2Q91 A;  4I5L B;  4GGN A;  1OZO A;  2MJW B;  3S0D A;  1BR4 B;  2ZRS A;  4DUQ A;  3LL8 B;  2Y4Q A;  5EL2 A;  1KSO A;  3AKB A;  1F54 A;  1ZFS A;  1XFV O;  1ZAC A;  3QRX A;  1F55 A;  1KK8 B;  3O6B A;  3R1P A;  4GBA A;  4JWQ A;  1SMG A;  2WCF A;  3D0Y B;  3DY9 A;  4YGB B;  1TWO A;  3SS5 A;  3C1V A;  2SCP A;  1KFU L;  3DZT A;  1FI5 A;  1TN4 A;  1ODB A;  1XFW O;  4OCI A;  5ER4 X;  4JKT A;  1WRK A; 
#chains in the Genus database with same CATH homology
 2K2A A;  3EK8 A;  1KFU S;  4CPV A;  4MSP A;  1KWO B;  4GNK B;  4PE1 A;  1CTR A;  2FCD A;  1QV1 A;  2M3W A;  1NP8 A;  4USL A;  2MBX A;  4ETO A;  4PCW A;  1RRO A;  1UHJ A;  1Y1U A;  5CSI A;  2LM5 A;  4P5O E;  2CNP A;  3PFV A;  4AQI A;  2CBL A;  1S3P A;  2LMV A;  3PAL A;  1WDC C;  1SRA A;  1YRT B;  2HET A;  1H4B A;  1Y6W A;  2LMT A;  4FQO A;  1PSB A;  4ICB A;  1A75 A;  2FJU B;  2LLS A;  2NXQ A;  3NSI A;  3BUN B;  1CNP A;  2NCO A;  1F4Q A;  1M45 A;  1SL7 A;  5I2O A;  4GPL B;  4P2Y B;  1KCY A;  1R2U A;  3DVE A;  5J3X A;  2M1K B;  2Y1N A;  4YRU A;  1M63 B;  1G4Y R;  4CFR A;  4WQ3 A;  1PAL A;  4XYN A;  1KQV A;  3DD4 A;  3EK7 A;  2L51 A;  2ZND A;  3OB1 B;  2NCP A;  3HX4 A;  5D69 A;  3WHU B;  5AER A;  5G08 A;  3RM1 A;  1YVH A;  2F3Y A;  2JNF A;  1RTP 1;  3CR5 X;  1F8H A;  1QX5 B;  1NCX A;  3OHM B;  3CWG A;  2H2K A;  4PHN A;  5I8N A;  3KEV A;  3CR4 X;  1NCZ A;  2KFH A;  1BLQ A;  1N0Y A;  1WRL A;  1SCM C;  1YUR A;  4XJK A;  1PK0 D;  1JFJ A;  4Q04 A;  1NX0 A;  2LHL A;  5KU1 A;  1W7J B;  1C7W A;  1KK8 C;  3GK2 A;  3JVT C;  1IJ6 A;  1DJG A;  1KSM A;  5D7F A;  3TDU A;  3I5H B;  1C7V A;  3BUW B;  4MBE A;  3DVK A;  4N1G A;  1QJT A;  2KFG A;  2CCM A;  2Y1M A;  3PSR A;  1TCO B;  1ZOT B;  2LVI A;  2R2I A;  1KK7 Z;  1KWO C;  3VRO A;  4YI9 A;  5K89 A;  4TNC A;  1IH0 A;  1K95 A;  2EGD A;  2O60 A;  1YRU B;  5AAN A;  1L7Z A;  2JTT A;  2JT3 A;  2COL B;  1FW4 A;  2PRU A;  3CS1 A;  1UHI A;  1OSA A;  5HKW A;  4PHK A;  4HRG A;  1RJV A;  1KK7 Y;  1SK6 D;  2AMI A;  2KNE A;  2ZNE A;  1BT6 A;  2PVB A;  1QS7 A;  2WC8 A;  1B47 A;  1NYA A;  5F6T A;  3LCP C;  1BF5 A;  1X02 A;  5I2Q A;  2CT9 A;  4MLW A;  2HQW A;  2JUL A;  2BEC A;  4HRH A;  1BU3 A;  2FOT A;  3SIA A;  1BG1 A;  4I5J A;  1FI6 A;  4MN0 A;  2K61 A;  3GOF A;  1B8L A;  3RLZ A;  1TCF A;  3BUM B;  3OB2 B;  1M46 A;  1NX1 A;  1Y1A A;  1K96 A;  1MHO A;  3KO0 A;  3NSO A;  2M0R A;  1F4O A;  2K7O A;  2LE9 B;  2M7L A;  1QV0 A;  1XA5 A;  4AOM A;  4U8D A;  1DGV A;  1D1O A;  4WQ2 A;  4C0J A;  4ZCV A;  1PVA A;  3DVJ A;  4MZJ A;  3OP0 A;  1CDP A;  3FWC A;  1YR5 A;  2JOJ A;  2L4H A;  1XVJ A;  3BOW A;  1IRJ A;  1J7R A;  1AJ4 A;  1SCM B;  5FYX A;  4PAL A;  4MRX A;  1K9U A;  2H61 C;  1S5G Z;  2NZ0 A;  3I5H C;  3TDZ A;  3JVT B;  2CXJ A;  1PVB A;  1K2H A;  2GGM A;  2KSP A;  2KAV A;  1WLZ A;  4OVN F;  1TRF A;  4DS7 A;  2F2O A;  1J1D A;  1QLK A;  2G2B A;  4ORC B;  3H4S E;  1S1E A;  5IBW A;  2HPS A;  4DIR A;  1AVS A;  1DJW A;  1XFY O;  3DF0 A;  3PM8 A;  4YGD B;  4OV2 A;  4L9M A;  5HLV A;  3GK4 X;  1S5G Y;  1REC A;  1DF0 A;  1SNL A;  1CFF A;  1MWN A;  2JXC A;  4HRE E;  1SKT A;  1DMO A;  2JC2 A;  2MAZ A;  3AAJ A;  1CM1 A;  2F3Z A;  1CLL A;  1XO5 A;  2JZI A;  3EK4 A;  3IQQ A;  1A03 A;  2Y5I A;  3I5G B;  2QAC A;  1E8A A;  1CMG A;  2VRG A;  3BQ3 A;  2P6B B;  1U5I B;  1B7T Z;  3CZT X;  1UUS A;  3SG6 A;  3VRN A;  2ZRT A;  2LVJ A;  1NWD A;  1XK4 C;  1YUT A;  2MHH A;  1UHH A;  3OX6 A;  2BE6 A;  2L5X B;  3OX5 A;  1XFU O;  2V53 A;  2LCP A;  2PMY A;  3O4Y A;  1JC2 A;  1Y1X A;  5AFP A;  1K93 D;  2F2P A;  1B7T Y;  1DVI A;  4GAO A;  1K8U A;  1R6P A;  1SR6 B;  4DCK A;  3ZNI A;  1OMD A;  2A4J A;  4NDB A;  2KYC A;  5DKR A;  3CLN A;  1RFJ A;  3D10 A;  2KI4 B;  1HT9 A;  5KSZ A;  3PN7 B;  4PE4 A;  3WXA A;  3GK1 A;  1XYD A;  2K7D A;  1ALW A;  1IQ5 A;  1BJF A;  2BKH B;  2M29 A;  2RGI A;  1CLM A;  2AUC A;  5HYD A;  2TN4 A;  1QTX A;  2K2F A;  5DKN A;  2M7N A;  4AQJ A;  4NDD A;  2KAY A;  2BCA A;  2AAO A;  4GUK A;  5BPJ A;  1LVC D;  2E6W A;  2JNX A;  4OR9 B;  2HF5 A;  2JT0 A;  2ZFD A;  5CPV A;  3SG5 A;  1JUO A;  3D0Y A;  2ZKM X;  4A4B A;  1PSR A;  2EHB A;  1H8B A;  3KPX A;  1J7O A;  2I94 A;  1DJX A;  4MZL A;  2I7A A;  4QJ4 B;  1L2O B;  2F8P A;  2K0J A;  1A4P A;  3EVV A;  1NSH A;  2KOT A;  2JQ6 A;  1K9K A;  2O5G A;  1B1G A;  3NSK A;  1TNX A;  1A2X A;  1TNP A;  1B4C A;  1IG5 A;  1AUI B;  3I5G C;  1CM4 A;  3IQO A;  4CFQ A;  1YUU A;  1EG3 A;  1OMV A;  4ORB B;  4PHM A;  1MXE A;  2JWW A;  1G33 A;  1ALV A;  1YUS A;  1B8C A;  3IF7 A;  2LAN A;  1W7I B;  1JBA A;  1CFP A;  1MXL C;  3EVU A;  1GGW A;  1PUL A;  4CID A;  2L98 A;  2ISD A;  2LHI A;  1BMO A;  3MSE B;  3NXA A;  2IS9 A;  1DJY A;  4C0K A;  1FF1 A;  1MQ1 A;  3AKA A;  1JF0 A;  1SR6 C;  1OQP A;  2I18 A;  5CSJ A;  1VRK A;  1CKK A;  2MLF C;  4I5K A;  2G9B A;  1NX2 A;  4QJ3 B;  1TOP A;  3TS5 B;  1KFX L;  2LUC A;  2KI4 C;  3PN7 C;  4GGF C;  2Q4U A;  4R1E A;  5JJG A;  1DTL A;  1YX8 A;  3CR2 A;  2JXL A;  1KFX S;  3PLF B;  3FIA A;  1Y0V H;  3I5I B;  2F33 A;  1NCY A;  4UPG A;  2K7C A;  5HKZ A;  1RWY A;  1V1G A;  1A75 B;  1YX7 A;  2DOQ A;  1JF2 A;  2LLU A;  1DJI A;  2WCE A;  3CGA A;  1QAS A;  2MLE C;  2QPT A;  1SW8 A;  2SAS A;  2EC6 B;  1JFK A;  2JRF A;  4YGC B;  1CDN A;  1J55 A;  2KGB C;  1J7P A;  1Q80 A;  2JT8 A;  2KBM A;  3I5F B;  2KGR A;  5CSF A;  2BCX A;  2D8N A;  1OE9 B;  2OTG B;  3VRP A;  2H61 A;  1EJ3 A;  1K94 A;  2BKI B;  1PRW A;  2BL0 B;  2OPO A;  4MVF A;  3HCM A;  4WRI A;  1IJ5 A;  1KQM B;  1AJ5 A;  4IL1 A;  1CFD A;  4DRW A;  5TNC A;  2KAX A;  4NDC A;  2M49 B;  5KTY A;  3BYA A;  2M8U A;  4MRY A;  2JPT A;  1L2O C;  1WRZ A;  1B8R A;  5CSN A;  5PAL A;  1SL8 A;  1CFC A;  1FPW A;  1ZUZ A;  2KQ6 A;  4XJK B;  3KF9 A;  4NQG A;  4PE0 A;  1WLM A;  2LP3 A;  1CB1 A;  3TUY B;  1S36 A;  1GGZ A;  1V1F A;  3TDI A;  1QIV A;  2I2R E;  2KQY A;  3EKJ A;  4PE7 A;  1QAT A;  1UHN A;  1DGU A;  2MRD A;  1M39 A;  5HLO A;  1DT7 B;  2LC5 A;  2FCE A;  1FBV A;  4BY5 A;  2WOS A;  3DVM A;  2KI6 C;  3M0W A;  4PHJ A;  1YVL A;  2PAS A;  3WHT B;  3A8R A;  4N5X A;  3ICB A;  1N2D A;  1XK4 A;  2BBM A;  2LNK A;  3SJS A;  4PDZ A;  1IGV A;  1MR8 A;  3VGO A;  1QIW A;  2PSR A;  4GFT A;  4YGE B;  3LLE A;  4JPZ B;  3TS5 C;  1AP4 A;  3CTN A;  1IKU A;  3O78 A;  3EKH A;  1TIZ A;  4OKH A;  4D1E A;  3A4U B;  4A4C A;  1UHK A;  1C07 A;  1QVI Z;  4C0L A;  3O2P A;  1LIN A;  4N1F A;  3I5I C;  5AEQ A;  1JWD A;  2WOR A;  4YI8 A;  2L0P A;  3SIB A;  4QJ5 B;  3BXK A;  5ER5 A;  2K8M B;  3F45 A;  1G8I A;  2KBI A;  2ZN9 A;  2GV5 A;  5GQQ C;  2EC6 C;  1QVI Y;  2LP2 A;  3PAT A;  2KHN A;  2LVV A;  4HSZ A;  4MEW A;  1M31 A;  3AAK A;  3I5F C;  2PAL A;  1RK9 A;  3JTD C;  2OTG C;  1F71 A;  2CTN A;  3SG4 A;  1XFZ O;  1EL4 A;  1F70 A;  2WCB A;  2BL0 C;  1J1E A;  2KYF A;  5I2L A;  2LAP A;  1KQM C;  1DJH A;  1S26 D;  2L50 A;  2LLT A;  3TZ1 A;  1TTX A;  1WY9 A;  2OS8 B;  2KI6 D;  4F0Z B;  1QX2 A;  1MF8 B;  1QXP A;  1TNW A;  2K7B A;  2LUX A;  2HQ8 A;  1NX3 A;  3BOW B;  2M97 A;  1OMR A;  3TUY C;  1SL9 A;  2JU0 A;  3LK0 A;  1K9P A;  4FTG A;  2KFF A;  2LVK A;  1DJZ A;  1QX7 A;  4ZCU A;  1LA0 A;  2LV7 A;  3BUX B;  3VRQ A;  3BUO B;  4MZK A;  3ZWH A;  1CLB A;  3FS7 A;  1NUB A;  1CDM A;  1OZS A;  1IWQ A;  3FWB A;  2M9G A;  4ORA B;  1U5I A;  1N65 A;  1ZMZ A;  3DF0 B;  2L4I A;  1BOC A;  3EVR A;  1EG4 A;  4CLN A;  4YGA A;  1A29 A;  1B9A A;  1DF0 B;  4M2Q A;  1NIW A;  1UUR A;  1UWO A;  1TNQ A;  2E30 A;  2JTZ A;  1S6C A;  1SBJ A;  4JQ0 D;  3VRR A;  4YBH B;  1K90 D;  5DKQ A;  3K21 A;  1SY9 A;  2BCB A;  1QLS A;  4BY4 A;  2KDH A;  5AXI A;  4GGF A;  1UP5 A;  1IQ3 A;  1S6I A;  1S6J A;  1EH2 A;  1GQM A;  1WDC B;  3E3R A;  5B8I B;  1SCV A;  2MA2 A;  1LKJ A;  1CDL A;  2NLN A;  4E68 A;  4I5N B;  2B1U A;  5JOL A;  1BR1 B;  1CMF A;  2BBN A;  1SYM A;  2L2E A;  4M2O A;  4M2P A;  5HKY A;  3LK1 A;  1MUX A;  2GGZ A;  2M1U A;  3SG3 A;  1GJY A;  2ZN8 A;  3WNX B;  3JTD B;  1EXR A;  1J7Q A;  1NPQ A;  1OOJ A;  2BE4 A;  3KHE A;  2WND A;  2OS8 C;  1JSA A;  1SPY A;  3SG7 A;  1AK8 A;  3SG2 A;  1LXF C;  1LA3 A;  1YTZ C;  1AHR A;  1HQV A;  1XFX O;  1BOD A;  2LMU A;  3NSL A;  2Q91 A;  4I5L B;  4GGN A;  1OZO A;  2MJW B;  1BR4 B;  2ZRS A;  4DUQ A;  3LL8 B;  2Y4Q A;  1KSO A;  3AKB A;  1F54 A;  1ZFS A;  1XFV O;  1ZAC A;  3QRX A;  1F55 A;  1KK8 B;  3O6B A;  4GBA A;  4JWQ A;  1SMG A;  2WCF A;  3D0Y B;  4YGB B;  3C1V A;  2SCP A;  1KFU L;  1FI5 A;  1TN4 A;  1ODB A;  1XFW O;  4OCI A;  5ER4 X;  1WRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...