2BCAA

High-resolution solution structure of calcium-loaded calbindin d9k
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title High-resolution structure of calcium-loaded calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 28
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1993-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bcaA00
1F4QA 1XFVO 1NSHA 2ZFDA 2L50A 5HKYA 1S6IA 3SIBA 1XFZO 2MJWB 3PSRA 3DVMA 5AXIA 1ALWA 1ZUZA 1S1EA 1OOJA 1RK9A 2JULA 4AQJA 2LLSA 2ZRSA 3I5FB 1DJZA 1L2OC 1CFPA 2BCAA 4PE0A 5D69A 4C0JA 1FPWA 3LCPC 4OCIA 2I7AA 4QJ5B 1DJGA 2PMYA 5CSJA 4P2YB 2MA2A 1IGVA 2L4IA 3FWBA 2I2RE 2M97A 2ISDA 1DGUA 1TNWA 2NLNA 3ZWHA 2JNXA 2JT3A 5I2OA 1K95A 2AUCA 2NCPA 3AAJA 1LINA 2LP3A 1GGZA 1QVIY 1BMOA 2KYCA 1IJ5A 1M39A 2JRFA 2LE9B 3RM1A 3CS1A 4ETOA 1BF5A 1SPYA 1XA5A 2JTZA 4GBAA 1DF0A 3SJSA 1DF0B 1KCYA 1MXEA 2QACA 5DKRA 1KFUL 2WNDA 2SCPA 3JVTB 4MN0A 5I2QA 1MR8A 3C1VA 1DJXA 4A4BA 1K93D 3D0YB 1WLMA 4OVNF 4WQ2A 5D7FA 4R1EA 1CLLA 1CDNA 4GGFC 3LL8B 3IQOA 4GPLB 3SG2A 3JVTC 3SG4A 1G8IA 1Y1XA 1K9KA 1CLMA 1S26D 4QJ3B 3CLNA 5AEQA 2Q91A 2KDHA 1C7WA 2H61A 1XFYO 4M2PA 4USLA 2LNKA 1NCZA 2Y1NA 4MVFA 5AANA 2I18A 2O60A 3I5GC 1DGVA 3BYAA 3O78A 2NXQA 2MHHA 3EVVA 4YI9A 1QX7A 2B1UA 2KGRA 4L9MA 3TS5C 2KGBC 1OZSA 5BPJA 2BBMA 1JBAA 1MWNA 5ER5A 2JWWA 1G33A 1QVIZ 2PASA 1QV1A 2K7OA 2PSRA 1SCVA 4P5OE 1KK7Z 1BU3A 2MLEC 1A2XA 4OV2A 4WRIA 5GQQC 1LA0A 1D1OA 5HKWA 3LLEA 4N5XA 3H4SE 1M46A 4ICBA 2JXCA 1UURA 1UHHA 2M0RA 1XFXO 1EH2A 1GGWA 1EJ3A 1QJTA 2CTNA 2CXJA 1Y1AA 3A4UB 3LK1A 2DOQA 3NSOA 1S6CA 1BR1B 1EL4A 4YGAA 5ER4X 2KHNA 2LMUA 2PRUA 5F6TA 4IL1A 3CTNA 2BE6A 2F3YA 4MLWA 4PCWA 3F45A 4E68A 1JSAA 1QX5B 3I5IB 1SNLA 2LC5A 3NSIA 3TDZA 1UHIA 1K8UA 4CFQA 1YURA 2ZKMX 4TNCA 3OX5A 2G2BA 1RTP1 2LP2A 5CSFA 1YX7A 2RGIA 4JQ0D 4PHJA 2EC6C 2L0PA 2BKIB 1QIWA 1KWOB 1CFDA 1TCFA 1H8BA 3BQ3A 3D10A 1OZOA 1BR4B 1TNPA 1WRZA 5DKQA 2M7NA 4MZJA 3DF0A 1CMGA 1CTRA 1SY9A 1WY9A 2LCPA 3DF0B 1FBVA 1DJWA 1XYDA 1KWOC 2MLFC 3DVKA 4YRUA 1L2OB 1YRTB 2HF5A 1B9AA 3I5HB 1A29A 1K94A 2K61A 3EK8A 2AAOA 2M1KB 4HRGA 4JPZB 1KK8C 1WDCB 3KEVA 2Y1MA 1RROA 2L51A 1AK8A 1GQMA 1UHJA 1KSOA 3TUYC 1FI5A 2FCEA 4ZCVA 3I5HC 2M3WA 1A03A 4D1EA 1A75A 1LKJA 1Q80A 4HRHA 3O2PA 1A75B 4Q04A 1K2HA 4CPVA 4MRYA 4ZCUA 1SW8A 1WDCC 1NX2A 3DD4A 2KNEA 4GNKB 5I8NA 1A4PA 1J7RA 1RWYA 1TNQA 1ZFSA 1QV0A 2LHIA 4YGEB 2GV5A 4YBHB 2F2PA 2GGMA 3QRXA 2WCBA 2JZIA 3DVEA 1F55A 3SG6A 1CLBA 2G9BA 4I5LB 2CBLA 3HCMA 2BCXA 2FJUB 1IH0A 1F4OA 1MQ1A 2D8NA 4FTGA 4GGFA 1J7PA 3K21A 3NSLA 1BG1A 3GK4X 1DVIA 1CMFA 3VRPA 1B47A 3PALA 3D0YA 1X02A 1YVLA 2ZNEA 1JWDA 3OHMB 2BCBA 1SYMA 5HKZA 1TTXA 3DVJA 1OE9B 2BKHB 1BODA 4C0KA 5IBWA 1UWOA 4CFRA 1NX0A 4GGNA 1ODBA 4A4CA 1MHOA 1OMDA 1V1FA 2LLUA 4N1GA 1SRAA 1XK4C 2OTGC 3BXKA 1LXFC 2ZRTA 3I5GB 3WHTB 2Y5IA 5KU1A 2JT8A 3OX6A 3RLZA 1B8LA 1QLKA 1K9UA 1SMGA 1JF2A 1SCMC 1TNXA 1W7JB 4DCKA 1PULA 2KAYA 3TS5B 4WQ3A 1BLQA 1AHRA 1YUTA 2LUCA 1OQPA 3SG3A 1LA3A 1SR6B 2KYFA 3GOFA 2VRGA 3GK2A 2L2EA 2KFHA 1YVHA 2BBNA 3KPXA 1M45A 4N1FA 2F8PA 3PN7C 1QIVA 2KQ6A 2R2IA 4ORAB 4F0ZB 2TN4A 1IRJA 1PSRA 1SR6C 2H2KA 2JNFA 4I5KA 3VROA 1N2DA 1S3PA 3JTDC 2KQYA 5HYDA 1K90D 5FYXA 1XO5A 2Y4QA 1ZACA 5PALA 2SASA 3ZNIA 3OB2B 3VRQA 1PALA 1OMVA 3CWGA 1OSAA 1NPQA 4UPGA 1KQMC 3SG7A 4MEWA 1F71A 3KF9A 2KSPA 1CDPA 1R2UA 3CR4X 4XJKB 1MUXA 2FCDA 5HLOA 4MZLA 2JC2A 4PALA 1B7TY 2KFFA 1E8AA 1XFWO 2L5XB 1S36A 2V53A 3NXAA 2EC6B 3CR2A 1NX1A 2K8MB 1HT9A 2KI6C 3EK4A 1B1GA 3CGAA 3EKJA 1C07A 3EVRA 4DRWA 1NX3A 4PHMA 1HQVA 1SBJA 1YX8A 3A8RA 1F54A 1N0YA 3M0WA 3BUMB 4YGDB 3VRRA 1YUSA 4CIDA 3BOWA 2O5GA 3BUOB 3BOWB 5CSNA 4NDCA 1YTZC 2LLTA 2LMTA 1J55A 1UHNA 2F3ZA 2LVJA 3OB1B 1PVAA 4PDZA 2JOJA 2HQ8A 4HREE 1XFUO 1QATA 2A4JA 2OPOA 1QXPA 2KFGA 1KK8B 3LK0A 2PVBA 3VGOA 2KBIA 4MSPA 3EVUA 3O4YA 3TUYB 5K89A 1JC2A 2ZN8A 1CKKA 1BT6A 4CLNA 3PLFB 1LVCD 3IF7A 2I94A 2COLB 4M2OA 2L4HA 1CM1A 5G08A 1ALVA 5KSZA 1BJFA 3HX4A 4BY5A 1NP8A 2K2FA 4XYNA 1CDMA 1IJ6A 1QTXA 1PK0D 4PE7A 1C7VA 1AVSA 3WNXB 1NYAA 4GUKA 1H4BA 4BY4A 1TCOB 2BECA 2Q4UA 4GFTA 2F33A 2MBXA 1CFFA 2K7DA 1PRWA 3BUNB 5HLVA 2F2OA 1Y1UA 4OR9B 2OS8C 1TRFA 2CT9A 1RFJA 1UHKA 5TNCA 1B7TZ 1FW4A 1R6PA 1WRLA 4PHKA 4DIRA 1M63B 1IQ5A 1AJ4A 2JU0A 2LV7A 2M1UA 1S5GY 2ZNDA 2LANA 1L7ZA 4I5JA 4MRXA 1CNPA 2EGDA 2M7LA 4PE1A 4YI8A 1ZOTB 1YUUA 1AJ5A 3BUWB 2K0JA 1S6JA 3KO0A 1AUIB 1WRKA 5I2LA 2JQ6A 1KFXS 4MBEA 1XK4A 3PATA 2OTGB 1K96A 3I5FC 4MZKA 2LVVA 2NZ0A 2K7CA 2KI4B 1DJYA 1IKUA 3EKHA 2M29A 1FI6A 1DJIA 5B8IB 2WORA 2M9GA 1WLZA 1KK7Y 1CDLA 1SCMB 2MAZA 4DS7A 1DT7B 1NCXA 2BL0B 2M8UA 2WC8A 2KAVA 1F70A 2KI4C 1EG4A 3TDIA 1KQVA 2E6WA 1QASA 2GGZA 2KOTA 2L98A 1SK6D 1SL8A 1BOCA 1OMRA 2BL0C 4JWQA 2AMIA 1SKTA 1Y6WA 3PN7B 4AOMA 1UUSA 3MSEB 1IG5A 1J1EA 3JTDB 1VRKA 1FF1A 1EXRA 2CCMA 4NQGA 2KI6D 4GAOA 1ZMZA 4NDBA 1QS7A 1RECA 3WXAA 2LAPA 5DKNA 1KFXL 1KQMB 2HPSA 3NSKA 2KAXA 2WCEA 1S5GZ 2K7BA 1MF8B 1IQ3A 1J7QA 1TOPA 1QLSA 3FIAA 1W7IB 2BE4A 1NCYA 4OKHA 2WOSA 2LVIA 3SG5A 4FQOA 1B8CA 3E3RA 4C0LA 1UP5A 2H61C 1PVBA 3GK1A 5KTYA 1CFCA 3ICBA 2K2AA 2M49B 3SIAA 3OP0A 3TDUA 1Y0VH 3PM8A 1J7OA 1IWQA 1EG3A 1SL7A 3FS7A 4XJKA 4NDDA 2LHLA 4QJ4B 3AKBA 1J1DA 1K9PA 3FWCA 3AKAA 1SL9A 1DTLA 3AAKA 1U5IA 2JTTA 5AERA 1CB1A 1B8RA 1U5IB 2LMVA 2PALA 4PHNA 1YR5A 1PSBA 4M2QA 2HETA 2IS9A 3CR5X 3TZ1A 5JJGA 2JPTA 4AQIA 1KSMA 3O6BA 2FOTA 1XVJA 2P6BB 3PFVA 5JOLA 2LM5A 5AFPA 1M31A 1GJYA 1DJHA 2CNPA 5CSIA 3EK7A 4I5NB 1CM4A 4U8DA 2JT0A 1MXLC 3WHUB 2HQWA 4HSZA 1NUBA 3CZTX 5J3XA 1TIZA 1JFJA 1JF0A 4YGBB 1TN4A 2LUXA 2MRDA 1NWDA 2WCFA 3KHEA 4YGCB 1DMOA 1AP4A 1N65A 1RJVA 1QX2A 4ORCB 1JFKA 3I5IC 4DUQA 1V1GA 1G4YR 1NIWA 1KFUS 2OS8B 3IQQA 1F8HA 2LVKA 4PE4A 3VRNA 2JXLA 1JUOA 3BUXB 4ORBB 2EHBA 2NCOA 2E30A 1YRUB 2KBMA 2ZN9A 1B4CA 2QPTA 5CPVA
chains in the Genus database with same CATH superfamily
1F4QA 1XFVO 3UNWA 1NSHA 2ZFDA 2L50A 5HKYA 1S6IA 3SIBA 1DQEA 1XFZO 2MJWB 3PSRA 3CZ2A 3DVMA 5AXIA 1ALWA 1ZUZA 1S1EA 1OOJA 1RK9A 2JULA 4AQJA 2LLSA 2ZRSA 3I5FB 3DYEA 1DJZA 1L2OC 1CFPA 2BCAA 4PE0A 5D69A 4C0JA 1FPWA 3LCPC 2WCJA 4OCIA 2I7AA 4QJ5B 1DJGA 2PMYA 5CSJA 4P2YB 2MA2A 1IGVA 2L4IA 3FWBA 2I2RE 2M97A 2ISDA 1DGUA 1TNWA 2NLNA 3ZWHA 2JNXA 3S0EA 2YGUA 2JT3A 5I2OA 1K95A 2AUCA 2NCPA 3AAJA 3DZTA 1LINA 2LP3A 1GGZA 1QVIY 1BMOA 2KYCA 1IJ5A 1M39A 2JRFA 2LE9B 3RM1A 3CS1A 4ETOA 1BF5A 1SPYA 1XA5A 2JTZA 4GBAA 1DF0A 3SJSA 1DF0B 1GM0A 1KCYA 1OOFA 1MXEA 2QACA 3CABA 1KFUL 5DKRA 2WNDA 2SCPA 3JVTB 4MN0A 3B86A 5I2QA 1MR8A 2P71A 1DJXA 3C1VA 4A4BA 1K93D 3D0YB 1WLMA 4OVNF 4WQ2A 5D7FA 3UO9A 4R1EA 1CLLA 1CDNA 4GGFC 3LL8B 3IQOA 4GPLB 3SG2A 3JVTC 3SG4A 1G8IA 3DY9A 1Y1XA 1K9KA 1CLMA 3CYZA 1S26D 4QJ3B 3BFAA 3CLNA 5AEQA 2Q91A 2KDHA 1C7WA 2H61A 3D75A 1XFYO 4M2PA 1Z2CB 3EG5B 4USLA 2P70A 2LNKA 1NCZA 2Y1NA 4MVFA 5AANA 2I18A 2O60A 3I5GC 1DGVA 3BYAA 3O78A 4FQTA 2NXQA 2MHHA 3EVVA 3PJIA 4YI9A 1QX7A 3FE9A 2B1UA 2KGRA 4L9MA 3TS5C 2KGBC 1OZSA 3CZ1A 5BPJA 3FE6A 2BBMA 1JBAA 1MWNA 5ER5A 2JWWA 1G33A 1QVIZ 2PASA 1QV1A 2K7OA 2PSRA 1SCVA 4P5OE 1KK7Z 1BU3A 2QEOA 2MLEC 1A2XA 4OV2A 4WRIA 5GQQC 1LA0A 1D1OA 5HKWA 3LLEA 3OBVA 3H4SE 4N5XA 1M46A 4ICBA 2JXCA 1UURA 1UHHA 2M0RA 1XFXO 1EH2A 1GGWA 1EJ3A 1QJTA 2CTNA 2CXJA 1Y1AA 3A4UB 3LK1A 2DOQA 3NSOA 1P28A 1S6CA 1BR1B 1EL4A 4YGAA 5ER4X 1TUZA 2KHNA 2LMUA 2PRUA 5F6TA 4IL1A 1C3ZA 3CTNA 2BE6A 2F3YA 4MLWA 3NHTA 3N7HA 1SSEB 2GTEA 4PCWA 3F45A 4E68A 1JSAA 1QX5B 3I5IB 4F7FA 1SNLA 2LC5A 2PYQA 3NSIA 3TDZA 1UHIA 1K8UA 4CFQA 1YURA 2ZKMX 4TNCA 3OX5A 2G2BA 1RTP1 2LP2A 5CSFA 1YX7A 2RGIA 4JQ0D 4PHJA 2EC6C 2L0PA 2WCMA 2BKIB 1QIWA 1KWOB 1CFDA 1TCFA 1H8BA 3BQ3A 1OOGA 3D10A 1OZOA 3BFHA 1BR4B 1TNPA 1WRZA 4INWA 2M7NA 5DKQA 4MZJA 3DF0A 1CMGA 1CTRA 1SY9A 1WY9A 2LCPA 3DF0B 3BFBA 1FBVA 5FI7A 1DJWA 1XYDA 1KWOC 2MLFC 3DVKA 4YRUA 1L2OB 1YRTB 2HF5A 1B9AA 3BJHA 3I5HB 1A29A 1K94A 2K61A 2QEHA 3B87A 3EK8A 2AAOA 2M1KB 4HRGA 4JPZB 5HL1A 1KK8C 1WDCB 3KEVA 2Y1MA 1RROA 2L51A 1AK8A 1GQMA 1UHJA 3B7AA 1KSOA 5FI2A 3TUYC 1FI5A 2FCEA 1QWVA 3D78A 5FI6A 3I5HC 4ZCVA 2M3WA 1A03A 4D1EA 1A75A 1LKJA 1Q80A 4HRHA 3O2PA 1A75B 4Q04A 1K2HA 4CPVA 4MRYA 4ZCUA 1SW8A 1WDCC 1NX2A 3DD4A 2KNEA 4GNKB 5I8NA 1A4PA 1J7RA 1RWYA 1TNQA 1ZFSA 1QV0A 2LHIA 4YGEB 2GV5A 4YBHB 2F2PA 2GGMA 1LS8A 3QRXA 2WCBA 2JZIA 3FE8A 3DVEA 1F55A 3SG6A 3OGNA 1CLBA 2G9BA 4I5LB 2CBLA 2WC6A 3HCMA 2BCXA 2FJUB 1IH0A 1F4OA 1MQ1A 2D8NA 4FTGA 4GGFA 3S0AA 1J7PA 3K21A 3NSLA 1BG1A 3GK4X 1DVIA 1DELA 3L4AA 3SS5A 1CMFA 2WCKA 3VRPA 1B47A 3PALA 3D0YA 1X02A 1YVLA 2ZNEA 1JWDA 3OHMB 2BCBA 1SYMA 5HKZA 1TTXA 3DVJA 1OE9B 2BKHB 1BODA 4C0KA 5IBWA 1UWOA 4CFRA 1NX0A 4GGNA 1ODBA 5EL2A 4A4CA 1MHOA 1OMDA 1V1FA 2LLUA 1DC1A 4N1GA 1C3YA 1SRAA 1XK4C 1IIOA 2OTGC 5I94A 2JPOA 3BXKA 1LXFC 2ZRTA 3I5GB 3WHTB 2Y5IA 5KU1A 3D76A 2JT8A 3OX6A 3RLZA 1B8LA 1QLKA 1K9UA 1SMGA 2WCHA 1JF2A 1SCMC 1TNXA 1W7JB 4DCKA 1PULA 2KAYA 3TS5B 4WQ3A 1BLQA 1AHRA 1YUTA 2LUCA 1OQPA 4KYNA 1ORGA 2L2CA 4INXA 3SG3A 1LA3A 1SR6B 2KYFA 3GOFA 2VRGA 3D77A 3GK2A 2L2EA 2KFHA 1YVHA 2BBNA 3KPXA 1M45A 4N1FA 2F8PA 1OOHA 3PN7C 1QIVA 2KQ6A 2R2IA 4ORAB 4F0ZB 2TN4A 1IRJA 1PSRA 1SR6C 2H2KA 2JNFA 2KLEA 4I5KA 3VROA 1N2DA 1S3PA 3JTDC 2KQYA 5HYDA 1K90D 5FYXA 2QDIA 1XO5A 2Y4QA 1ZACA 5PALA 2SASA 3ZNIA 2KPHA 3K1EA 3OB2B 3V2LA 3VRQA 1PALA 1OMVA 3CWGA 1Z4HA 1OSAA 1NPQA 4UPGA 1KQMC 3SG7A 4MEWA 1F71A 1TWOA 3B88A 3KF9A 2KSPA 1T14A 2QEBA 1CDPA 1R2UA 3PM2A 3CR4X 1XFRA 2PQLA 4XJKB 1MUXA 3NHIA 2FCDA 5HLOA 4MZLA 2JC2A 4PALA 1B7TY 2KFFA 1E8AA 1XFWO 2L5XB 1S36A 2V53A 3NXAA 2EC6B 3CR2A 1NX1A 2K8MB 1HT9A 2KI6C 3EK4A 1B1GA 3CGAA 3EKJA 1C07A 3EVRA 4DRWA 1NX3A 4PHMA 1HQVA 1SBJA 1YX8A 3A8RA 2FJYA 1F54A 1N0YA 3M0WA 3BUMB 4YGDB 3VRRA 1YUSA 4CIDA 3BOWA 2O5GA 3BUOB 3BOWB 5CSNA 4NDCA 1YTZC 2LLTA 2LMTA 1J55A 1UHNA 2F3ZA 2LVJA 3OB1B 3QMEA 1PVAA 4PDZA 2JOJA 2HQ8A 4HREE 1XFUO 1OOIX 1QATA 2A4JA 1QXPA 2KFGA 2OPOA 1KK8B 3LK0A 2PVBA 3VGOA 2KBIA 4MSPA 3EVUA 3O4YA 3TUYB 5K89A 1JC2A 2ZN8A 1CKKA 1BT6A 4CLNA 3PLFB 1LVCD 3IF7A 2I94A 3R1OA 2COLB 4M2OA 2L4HA 3DXLA 1CM1A 3B6XA 5G08A 1ALVA 5KSZA 1BJFA 3HX4A 4BY5A 3SS4A 1OW4A 1NP8A 2K2FA 4XYNA 1CDMA 3S0BA 1IJ6A 1QTXA 1PK0D 4PE7A 3RZSA 1AVSA 3WNXB 1NYAA 1C7VA 4GUKA 1H4BA 4BY4A 1TCOB 2BECA 2Q4UA 4GFTA 2F33A 3CDNA 1DEKA 2MBXA 1CFFA 2K7DA 1PRWA 3BUNB 3R1PA 5HLVA 2F2OA 1Y1UA 4OR9B 2OS8C 1TRFA 2CT9A 1RFJA 2H8VA 1UHKA 5TNCA 1B7TZ 1FW4A 1R6PA 1WRLA 4PHKA 4DIRA 1M63B 1IQ5A 1AJ4A 2JU0A 2LV7A 2M1UA 1S5GY 2ZNDA 2LANA 1L7ZA 4I5JA 4MRXA 3S0FA 1CNPA 2EGDA 2M7LA 4PE1A 4YI8A 3IVTA 1ZOTB 1YUUA 1AJ5A 3BUWB 2K0JA 1S6JA 3KO0A 1AUIB 1WRKA 5I2LA 2JQ6A 1KFXS 4MBEA 1XK4A 3PATA 2L5YA 2OTGB 1K96A 3I5FC 4MZKA 2LVVA 2NZ0A 2K7CA 2KI4B 1DJYA 1IKUA 3EKHA 2M29A 1FI6A 1DJIA 5B8IB 2WORA 2M9GA 1WLZA 1KK7Y 1CDLA 1SCMB 2MAZA 2QEVA 4DS7A 1DT7B 1NCXA 2BL0B 2M8UA 2WC8A 2KAVA 1F70A 2KI4C 1EG4A 3TDIA 2WC5A 3R1VA 2E6WA 3L47A 1KQVA 1QASA 2GGZA 2KOTA 2ERBA 2L98A 1SK6D 1SL8A 1BOCA 1OMRA 2BL0C 4JWQA 2AMIA 1SKTA 3L4LA 1Y6WA 3PN7B 3S0GA 4AOMA 1UUSA 3CZ0A 3MSEB 1IG5A 1J1EA 3JTDB 1VRKA 1FF1A 1EXRA 2CCMA 4NQGA 2KI6D 4GAOA 1ZMZA 4NDBA 1QS7A 1RECA 3O4XA 3WXAA 2LAPA 5DKNA 1KFXL 1KQMB 2HPSA 4PT1A 3NSKA 2K60A 2KAXA 2WCEA 1S5GZ 2K7BA 1MF8B 5D3OA 1IQ3A 1TOPA 1QLSA 1J7QA 3FIAA 1W7IB 2BE4A 1NCYA 4OKHA 2WOSA 2LVIA 3VB1A 3SG5A 4FQOA 1B8CA 3E3RA 2BAPA 1UP5A 2H61C 1PVBA 3GK1A 4C0LA 5KTYA 3ICBA 2K2AA 2M49B 3SIAA 3OP0A 3TDUA 1Y0VH 3PM8A 2KLDA 1J7OA 1IWQA 1EG3A 1SL7A 3FS7A 3Q8IA 4XJKA 2WCLA 2LHLA 4NDDA 4QJ4B 3AKBA 1J1DA 1K9PA 3FWCA 3AKAA 1SL9A 1DTLA 3AAKA 1U5IA 2JTTA 5AERA 1CB1A 1B8RA 1U5IB 2LMVA 2PALA 4PHNA 1YR5A 1PSBA 4M2QA 2HETA 2IS9A 3CR5X 3TZ1A 5JJGA 4JKTA 2JPTA 4AQIA 1KSMA 3O6BA 2FOTA 1XVJA 2BNXA 2P6BB 3PFVA 5JOLA 5DICA 3SS3A 2LM5A 5AFPA 1M31A 1DJHA 1GJYA 2CNPA 3NGVA 5CSIA 3EK7A 3D74A 4I5NB 1CM4A 3S0DA 4JD9A 2JT0A 4U8DA 1MXLC 3WHUB 2HQWA 4HSZA 1NUBA 3CZTX 5J3XA 1TIZA 1JFJA 1JF0A 4YGBB 1TUJA 1TN4A 2LUXA 2MRDA 1NWDA 2WCFA 3KHEA 4YGCB 1DMOA 1AP4A 1N65A 1RJVA 1QX2A 4ORCB 1CFCA 1JFKA 3I5IC 4DUQA 4IJ7A 1V1GA 1G4YR 1NIWA 1KFUS 2OS8B 3IQQA 1F8HA 2LVKA 4PE4A 3VRNA 2JXLA 1JUOA 3BUXB 4ORBB 2EHBA 2NCOA 2E30A 1YRUB 2KBMA 2ZN9A 1B4CA 1W9ZA 3R72A 2QPTA 4OZDA 5CPVA 3D73A
chains in the Genus database with same CATH topology
1F4QA 1XFVO 1NSHA 2ZFDA 2L50A 5HKYA 1S6IA 3SIBA 1XFZO 2MJWB 3PSRA 3DVMA 5AXIA 1ALWA 1ZUZA 1S1EA 1OOJA 1RK9A 2JULA 4AQJA 2LLSA 2ZRSA 3I5FB 1DJZA 1L2OC 1CFPA 2BCAA 4PE0A 5D69A 4C0JA 1FPWA 3LCPC 4OCIA 2I7AA 4QJ5B 1DJGA 2PMYA 5CSJA 4P2YB 2MA2A 1IGVA 2L4IA 3FWBA 2I2RE 2M97A 2ISDA 1DGUA 1TNWA 2NLNA 3ZWHA 2JNXA 2JT3A 5I2OA 1K95A 2AUCA 2NCPA 3AAJA 1LINA 2LP3A 1GGZA 1QVIY 1BMOA 2KYCA 1IJ5A 1M39A 2JRFA 2LE9B 3RM1A 3CS1A 4ETOA 1BF5A 1SPYA 1XA5A 2JTZA 4GBAA 1DF0A 3SJSA 1DF0B 1KCYA 1MXEA 2QACA 5DKRA 1KFUL 2WNDA 2SCPA 3JVTB 4MN0A 5I2QA 1MR8A 3C1VA 1DJXA 4A4BA 1K93D 3D0YB 1WLMA 4OVNF 4WQ2A 5D7FA 4R1EA 1CLLA 1CDNA 4GGFC 3LL8B 3IQOA 4GPLB 3SG2A 3JVTC 3SG4A 1G8IA 1Y1XA 1K9KA 1CLMA 1S26D 4QJ3B 3CLNA 5AEQA 2Q91A 2KDHA 1C7WA 2H61A 1XFYO 4M2PA 4USLA 2LNKA 1NCZA 2Y1NA 4MVFA 5AANA 2I18A 2O60A 3I5GC 1DGVA 3BYAA 3O78A 2NXQA 2MHHA 3EVVA 4YI9A 1QX7A 2B1UA 2KGRA 4L9MA 3TS5C 2KGBC 1OZSA 5BPJA 2BBMA 1JBAA 1MWNA 5ER5A 2JWWA 1G33A 1QVIZ 2PASA 1QV1A 2K7OA 2PSRA 1SCVA 4P5OE 1KK7Z 1BU3A 2MLEC 1A2XA 4OV2A 4WRIA 5GQQC 1LA0A 1D1OA 5HKWA 3LLEA 4N5XA 3H4SE 1M46A 4ICBA 2JXCA 1UURA 1UHHA 2M0RA 1XFXO 1EH2A 1GGWA 1EJ3A 1QJTA 2CTNA 2CXJA 1Y1AA 3A4UB 3LK1A 2DOQA 3NSOA 1S6CA 1BR1B 1EL4A 4YGAA 5ER4X 2KHNA 2LMUA 2PRUA 5F6TA 4IL1A 3CTNA 2BE6A 2F3YA 4MLWA 4PCWA 3F45A 4E68A 1JSAA 1QX5B 3I5IB 1SNLA 2LC5A 3NSIA 3TDZA 1UHIA 1K8UA 4CFQA 1YURA 2ZKMX 4TNCA 3OX5A 2G2BA 1RTP1 2LP2A 5CSFA 1YX7A 2RGIA 4JQ0D 4PHJA 2EC6C 2L0PA 2BKIB 1QIWA 1KWOB 1CFDA 1TCFA 1H8BA 3BQ3A 3D10A 1OZOA 1BR4B 1TNPA 1WRZA 5DKQA 2M7NA 4MZJA 3DF0A 1CMGA 1CTRA 1SY9A 1WY9A 2LCPA 3DF0B 1FBVA 1DJWA 1XYDA 1KWOC 2MLFC 3DVKA 4YRUA 1L2OB 1YRTB 2HF5A 1B9AA 3I5HB 1A29A 1K94A 2K61A 3EK8A 2AAOA 2M1KB 4HRGA 4JPZB 1KK8C 1WDCB 3KEVA 2Y1MA 1RROA 2L51A 1AK8A 1GQMA 1UHJA 1KSOA 3TUYC 1FI5A 2FCEA 4ZCVA 3I5HC 2M3WA 1A03A 4D1EA 1A75A 1LKJA 1Q80A 4HRHA 3O2PA 1A75B 4Q04A 1K2HA 4CPVA 4MRYA 4ZCUA 1SW8A 1WDCC 1NX2A 3DD4A 2KNEA 4GNKB 5I8NA 1A4PA 1J7RA 1RWYA 1TNQA 1ZFSA 1QV0A 2LHIA 4YGEB 2GV5A 4YBHB 2F2PA 2GGMA 3QRXA 2WCBA 2JZIA 3DVEA 1F55A 3SG6A 1CLBA 2G9BA 4I5LB 2CBLA 3HCMA 2BCXA 2FJUB 1IH0A 1F4OA 1MQ1A 2D8NA 4FTGA 4GGFA 1J7PA 3K21A 3NSLA 1BG1A 3GK4X 1DVIA 1CMFA 3VRPA 1B47A 3PALA 3D0YA 1X02A 1YVLA 2ZNEA 1JWDA 3OHMB 2BCBA 1SYMA 5HKZA 1TTXA 3DVJA 1OE9B 2BKHB 1BODA 4C0KA 5IBWA 1UWOA 4CFRA 1NX0A 4GGNA 1ODBA 4A4CA 1MHOA 1OMDA 1V1FA 2LLUA 4N1GA 1SRAA 1XK4C 2OTGC 3BXKA 1LXFC 2ZRTA 3I5GB 3WHTB 2Y5IA 5KU1A 2JT8A 3OX6A 3RLZA 1B8LA 1QLKA 1K9UA 1SMGA 1JF2A 1SCMC 1TNXA 1W7JB 4DCKA 1PULA 2KAYA 3TS5B 4WQ3A 1BLQA 1AHRA 1YUTA 2LUCA 1OQPA 3SG3A 1LA3A 1SR6B 2KYFA 3GOFA 2VRGA 3GK2A 2L2EA 2KFHA 1YVHA 2BBNA 3KPXA 1M45A 4N1FA 2F8PA 3PN7C 1QIVA 2KQ6A 2R2IA 4ORAB 4F0ZB 2TN4A 1IRJA 1PSRA 1SR6C 2H2KA 2JNFA 4I5KA 3VROA 1N2DA 1S3PA 3JTDC 2KQYA 5HYDA 1K90D 5FYXA 1XO5A 2Y4QA 1ZACA 5PALA 2SASA 3ZNIA 3OB2B 3VRQA 1PALA 1OMVA 3CWGA 1OSAA 1NPQA 4UPGA 1KQMC 3SG7A 4MEWA 1F71A 3KF9A 2KSPA 1CDPA 1R2UA 3CR4X 4XJKB 1MUXA 2FCDA 5HLOA 4MZLA 2JC2A 4PALA 1B7TY 2KFFA 1E8AA 1XFWO 2L5XB 1S36A 2V53A 3NXAA 2EC6B 3CR2A 1NX1A 2K8MB 1HT9A 2KI6C 3EK4A 1B1GA 3CGAA 3EKJA 1C07A 3EVRA 4DRWA 1NX3A 4PHMA 1HQVA 1SBJA 1YX8A 3A8RA 1F54A 1N0YA 3M0WA 3BUMB 4YGDB 3VRRA 1YUSA 4CIDA 3BOWA 2O5GA 3BUOB 3BOWB 5CSNA 4NDCA 1YTZC 2LLTA 2LMTA 1J55A 1UHNA 2F3ZA 2LVJA 3OB1B 1PVAA 4PDZA 2JOJA 2HQ8A 4HREE 1XFUO 1QATA 2A4JA 2OPOA 1QXPA 2KFGA 1KK8B 3LK0A 2PVBA 3VGOA 2KBIA 4MSPA 3EVUA 3O4YA 3TUYB 5K89A 1JC2A 2ZN8A 1CKKA 1BT6A 4CLNA 3PLFB 1LVCD 3IF7A 2I94A 2COLB 4M2OA 2L4HA 1CM1A 5G08A 1ALVA 5KSZA 1BJFA 3HX4A 4BY5A 1NP8A 2K2FA 4XYNA 1CDMA 1IJ6A 1QTXA 1PK0D 4PE7A 1C7VA 1AVSA 3WNXB 1NYAA 4GUKA 1H4BA 4BY4A 1TCOB 2BECA 2Q4UA 4GFTA 2F33A 2MBXA 1CFFA 2K7DA 1PRWA 3BUNB 5HLVA 2F2OA 1Y1UA 4OR9B 2OS8C 1TRFA 2CT9A 1RFJA 1UHKA 5TNCA 1B7TZ 1FW4A 1R6PA 1WRLA 4PHKA 4DIRA 1M63B 1IQ5A 1AJ4A 2JU0A 2LV7A 2M1UA 1S5GY 2ZNDA 2LANA 1L7ZA 4I5JA 4MRXA 1CNPA 2EGDA 2M7LA 4PE1A 4YI8A 1ZOTB 1YUUA 1AJ5A 3BUWB 2K0JA 1S6JA 3KO0A 1AUIB 1WRKA 5I2LA 2JQ6A 1KFXS 4MBEA 1XK4A 3PATA 2OTGB 1K96A 3I5FC 4MZKA 2LVVA 2NZ0A 2K7CA 2KI4B 1DJYA 1IKUA 3EKHA 2M29A 1FI6A 1DJIA 5B8IB 2WORA 2M9GA 1WLZA 1KK7Y 1CDLA 1SCMB 2MAZA 4DS7A 1DT7B 1NCXA 2BL0B 2M8UA 2WC8A 2KAVA 1F70A 2KI4C 1EG4A 3TDIA 1KQVA 2E6WA 1QASA 2GGZA 2KOTA 2L98A 1SK6D 1SL8A 1BOCA 1OMRA 2BL0C 4JWQA 2AMIA 1SKTA 1Y6WA 3PN7B 4AOMA 1UUSA 3MSEB 1IG5A 1J1EA 3JTDB 1VRKA 1FF1A 1EXRA 2CCMA 4NQGA 2KI6D 4GAOA 1ZMZA 4NDBA 1QS7A 1RECA 3WXAA 2LAPA 5DKNA 1KFXL 1KQMB 2HPSA 3NSKA 2KAXA 2WCEA 1S5GZ 2K7BA 1MF8B 1IQ3A 1J7QA 1TOPA 1QLSA 3FIAA 1W7IB 2BE4A 1NCYA 4OKHA 2WOSA 2LVIA 3SG5A 4FQOA 1B8CA 3E3RA 4C0LA 1UP5A 2H61C 1PVBA 3GK1A 5KTYA 1CFCA 3ICBA 2K2AA 2M49B 3SIAA 3OP0A 3TDUA 1Y0VH 3PM8A 1J7OA 1IWQA 1EG3A 1SL7A 3FS7A 4XJKA 4NDDA 2LHLA 4QJ4B 3AKBA 1J1DA 1K9PA 3FWCA 3AKAA 1SL9A 1DTLA 3AAKA 1U5IA 2JTTA 5AERA 1CB1A 1B8RA 1U5IB 2LMVA 2PALA 4PHNA 1YR5A 1PSBA 4M2QA 2HETA 2IS9A 3CR5X 3TZ1A 5JJGA 2JPTA 4AQIA 1KSMA 3O6BA 2FOTA 1XVJA 2P6BB 3PFVA 5JOLA 2LM5A 5AFPA 1M31A 1GJYA 1DJHA 2CNPA 5CSIA 3EK7A 4I5NB 1CM4A 4U8DA 2JT0A 1MXLC 3WHUB 2HQWA 4HSZA 1NUBA 3CZTX 5J3XA 1TIZA 1JFJA 1JF0A 4YGBB 1TN4A 2LUXA 2MRDA 1NWDA 2WCFA 3KHEA 4YGCB 1DMOA 1AP4A 1N65A 1RJVA 1QX2A 4ORCB 1JFKA 3I5IC 4DUQA 1V1GA 1G4YR 1NIWA 1KFUS 2OS8B 3IQQA 1F8HA 2LVKA 4PE4A 3VRNA 2JXLA 1JUOA 3BUXB 4ORBB 2EHBA 2NCOA 2E30A 1YRUB 2KBMA 2ZN9A 1B4CA 2QPTA 5CPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4Q A;  1XFV O;  1NSH A;  2ZFD A;  2L50 A;  5HKY A;  1S6I A;  3SIB A;  1XFZ O;  2MJW B;  3PSR A;  3DVM A;  5AXI A;  1ALW A;  1ZUZ A;  1S1E A;  1OOJ A;  1RK9 A;  2JUL A;  4AQJ A;  2LLS A;  2ZRS A;  3I5F B;  1DJZ A;  1L2O C;  1CFP A;  2BCA A;  4PE0 A;  5D69 A;  4C0J A;  1FPW A;  3LCP C;  4OCI A;  2I7A A;  4QJ5 B;  1DJG A;  2PMY A;  5CSJ A;  4P2Y B;  2MA2 A;  1IGV A;  2L4I A;  3FWB A;  2I2R E;  2M97 A;  2ISD A;  1DGU A;  1TNW A;  2NLN A;  3ZWH A;  2JNX A;  2JT3 A;  5I2O A;  1K95 A;  2AUC A;  2NCP A;  3AAJ A;  1LIN A;  2LP3 A;  1GGZ A;  1QVI Y;  1BMO A;  2KYC A;  1IJ5 A;  1M39 A;  2JRF A;  2LE9 B;  3RM1 A;  3CS1 A;  4ETO A;  1BF5 A;  1SPY A;  1XA5 A;  2JTZ A;  4GBA A;  1DF0 A;  3SJS A;  1DF0 B;  1KCY A;  1MXE A;  2QAC A;  5DKR A;  1KFU L;  2WND A;  2SCP A;  3JVT B;  4MN0 A;  5I2Q A;  1MR8 A;  3C1V A;  1DJX A;  4A4B A;  1K93 D;  3D0Y B;  1WLM A;  4OVN F;  4WQ2 A;  5D7F A;  4R1E A;  1CLL A;  1CDN A;  4GGF C;  3LL8 B;  3IQO A;  4GPL B;  3SG2 A;  3JVT C;  3SG4 A;  1G8I A;  1Y1X A;  1K9K A;  1CLM A;  1S26 D;  4QJ3 B;  3CLN A;  5AEQ A;  2Q91 A;  2KDH A;  1C7W A;  2H61 A;  1XFY O;  4M2P A;  4USL A;  2LNK A;  1NCZ A;  2Y1N A;  4MVF A;  5AAN A;  2I18 A;  2O60 A;  3I5G C;  1DGV A;  3BYA A;  3O78 A;  2NXQ A;  2MHH A;  3EVV A;  4YI9 A;  1QX7 A;  2B1U A;  2KGR A;  4L9M A;  3TS5 C;  2KGB C;  1OZS A;  5BPJ A;  2BBM A;  1JBA A;  1MWN A;  5ER5 A;  2JWW A;  1G33 A;  1QVI Z;  2PAS A;  1QV1 A;  2K7O A;  2PSR A;  1SCV A;  4P5O E;  1KK7 Z;  1BU3 A;  2MLE C;  1A2X A;  4OV2 A;  4WRI A;  5GQQ C;  1LA0 A;  1D1O A;  5HKW A;  3LLE A;  4N5X A;  3H4S E;  1M46 A;  4ICB A;  2JXC A;  1UUR A;  1UHH A;  2M0R A;  1XFX O;  1EH2 A;  1GGW A;  1EJ3 A;  1QJT A;  2CTN A;  2CXJ A;  1Y1A A;  3A4U B;  3LK1 A;  2DOQ A;  3NSO A;  1S6C A;  1BR1 B;  1EL4 A;  4YGA A;  5ER4 X;  2KHN A;  2LMU A;  2PRU A;  5F6T A;  4IL1 A;  3CTN A;  2BE6 A;  2F3Y A;  4MLW A;  4PCW A;  3F45 A;  4E68 A;  1JSA A;  1QX5 B;  3I5I B;  1SNL A;  2LC5 A;  3NSI A;  3TDZ A;  1UHI A;  1K8U A;  4CFQ A;  1YUR A;  2ZKM X;  4TNC A;  3OX5 A;  2G2B A;  1RTP 1;  2LP2 A;  5CSF A;  1YX7 A;  2RGI A;  4JQ0 D;  4PHJ A;  2EC6 C;  2L0P A;  2BKI B;  1QIW A;  1KWO B;  1CFD A;  1TCF A;  1H8B A;  3BQ3 A;  3D10 A;  1OZO A;  1BR4 B;  1TNP A;  1WRZ A;  5DKQ A;  2M7N A;  4MZJ A;  3DF0 A;  1CMG A;  1CTR A;  1SY9 A;  1WY9 A;  2LCP A;  3DF0 B;  1FBV A;  1DJW A;  1XYD A;  1KWO C;  2MLF C;  3DVK A;  4YRU A;  1L2O B;  1YRT B;  2HF5 A;  1B9A A;  3I5H B;  1A29 A;  1K94 A;  2K61 A;  3EK8 A;  2AAO A;  2M1K B;  4HRG A;  4JPZ B;  1KK8 C;  1WDC B;  3KEV A;  2Y1M A;  1RRO A;  2L51 A;  1AK8 A;  1GQM A;  1UHJ A;  1KSO A;  3TUY C;  1FI5 A;  2FCE A;  4ZCV A;  3I5H C;  2M3W A;  1A03 A;  4D1E A;  1A75 A;  1LKJ A;  1Q80 A;  4HRH A;  3O2P A;  1A75 B;  4Q04 A;  1K2H A;  4CPV A;  4MRY A;  4ZCU A;  1SW8 A;  1WDC C;  1NX2 A;  3DD4 A;  2KNE A;  4GNK B;  5I8N A;  1A4P A;  1J7R A;  1RWY A;  1TNQ A;  1ZFS A;  1QV0 A;  2LHI A;  4YGE B;  2GV5 A;  4YBH B;  2F2P A;  2GGM A;  3QRX A;  2WCB A;  2JZI A;  3DVE A;  1F55 A;  3SG6 A;  1CLB A;  2G9B A;  4I5L B;  2CBL A;  3HCM A;  2BCX A;  2FJU B;  1IH0 A;  1F4O A;  1MQ1 A;  2D8N A;  4FTG A;  4GGF A;  1J7P A;  3K21 A;  3NSL A;  1BG1 A;  3GK4 X;  1DVI A;  1CMF A;  3VRP A;  1B47 A;  3PAL A;  3D0Y A;  1X02 A;  1YVL A;  2ZNE A;  1JWD A;  3OHM B;  2BCB A;  1SYM A;  5HKZ A;  1TTX A;  3DVJ A;  1OE9 B;  2BKH B;  1BOD A;  4C0K A;  5IBW A;  1UWO A;  4CFR A;  1NX0 A;  4GGN A;  1ODB A;  4A4C A;  1MHO A;  1OMD A;  1V1F A;  2LLU A;  4N1G A;  1SRA A;  1XK4 C;  2OTG C;  3BXK A;  1LXF C;  2ZRT A;  3I5G B;  3WHT B;  2Y5I A;  5KU1 A;  2JT8 A;  3OX6 A;  3RLZ A;  1B8L A;  1QLK A;  1K9U A;  1SMG A;  1JF2 A;  1SCM C;  1TNX A;  1W7J B;  4DCK A;  1PUL A;  2KAY A;  3TS5 B;  4WQ3 A;  1BLQ A;  1AHR A;  1YUT A;  2LUC A;  1OQP A;  3SG3 A;  1LA3 A;  1SR6 B;  2KYF A;  3GOF A;  2VRG A;  3GK2 A;  2L2E A;  2KFH A;  1YVH A;  2BBN A;  3KPX A;  1M45 A;  4N1F A;  2F8P A;  3PN7 C;  1QIV A;  2KQ6 A;  2R2I A;  4ORA B;  4F0Z B;  2TN4 A;  1IRJ A;  1PSR A;  1SR6 C;  2H2K A;  2JNF A;  4I5K A;  3VRO A;  1N2D A;  1S3P A;  3JTD C;  2KQY A;  5HYD A;  1K90 D;  5FYX A;  1XO5 A;  2Y4Q A;  1ZAC A;  5PAL A;  2SAS A;  3ZNI A;  3OB2 B;  3VRQ A;  1PAL A;  1OMV A;  3CWG A;  1OSA A;  1NPQ A;  4UPG A;  1KQM C;  3SG7 A;  4MEW A;  1F71 A;  3KF9 A;  2KSP A;  1CDP A;  1R2U A;  3CR4 X;  4XJK B;  1MUX A;  2FCD A;  5HLO A;  4MZL A;  2JC2 A;  4PAL A;  1B7T Y;  2KFF A;  1E8A A;  1XFW O;  2L5X B;  1S36 A;  2V53 A;  3NXA A;  2EC6 B;  3CR2 A;  1NX1 A;  2K8M B;  1HT9 A;  2KI6 C;  3EK4 A;  1B1G A;  3CGA A;  3EKJ A;  1C07 A;  3EVR A;  4DRW A;  1NX3 A;  4PHM A;  1HQV A;  1SBJ A;  1YX8 A;  3A8R A;  1F54 A;  1N0Y A;  3M0W A;  3BUM B;  4YGD B;  3VRR A;  1YUS A;  4CID A;  3BOW A;  2O5G A;  3BUO B;  3BOW B;  5CSN A;  4NDC A;  1YTZ C;  2LLT A;  2LMT A;  1J55 A;  1UHN A;  2F3Z A;  2LVJ A;  3OB1 B;  1PVA A;  4PDZ A;  2JOJ A;  2HQ8 A;  4HRE E;  1XFU O;  1QAT A;  2A4J A;  2OPO A;  1QXP A;  2KFG A;  1KK8 B;  3LK0 A;  2PVB A;  3VGO A;  2KBI A;  4MSP A;  3EVU A;  3O4Y A;  3TUY B;  5K89 A;  1JC2 A;  2ZN8 A;  1CKK A;  1BT6 A;  4CLN A;  3PLF B;  1LVC D;  3IF7 A;  2I94 A;  2COL B;  4M2O A;  2L4H A;  1CM1 A;  5G08 A;  1ALV A;  5KSZ A;  1BJF A;  3HX4 A;  4BY5 A;  1NP8 A;  2K2F A;  4XYN A;  1CDM A;  1IJ6 A;  1QTX A;  1PK0 D;  4PE7 A;  1C7V A;  1AVS A;  3WNX B;  1NYA A;  4GUK A;  1H4B A;  4BY4 A;  1TCO B;  2BEC A;  2Q4U A;  4GFT A;  2F33 A;  2MBX A;  1CFF A;  2K7D A;  1PRW A;  3BUN B;  5HLV A;  2F2O A;  1Y1U A;  4OR9 B;  2OS8 C;  1TRF A;  2CT9 A;  1RFJ A;  1UHK A;  5TNC A;  1B7T Z;  1FW4 A;  1R6P A;  1WRL A;  4PHK A;  4DIR A;  1M63 B;  1IQ5 A;  1AJ4 A;  2JU0 A;  2LV7 A;  2M1U A;  1S5G Y;  2ZND A;  2LAN A;  1L7Z A;  4I5J A;  4MRX A;  1CNP A;  2EGD A;  2M7L A;  4PE1 A;  4YI8 A;  1ZOT B;  1YUU A;  1AJ5 A;  3BUW B;  2K0J A;  1S6J A;  3KO0 A;  1AUI B;  1WRK A;  5I2L A;  2JQ6 A;  1KFX S;  4MBE A;  1XK4 A;  3PAT A;  2OTG B;  1K96 A;  3I5F C;  4MZK A;  2LVV A;  2NZ0 A;  2K7C A;  2KI4 B;  1DJY A;  1IKU A;  3EKH A;  2M29 A;  1FI6 A;  1DJI A;  5B8I B;  2WOR A;  2M9G A;  1WLZ A;  1KK7 Y;  1CDL A;  1SCM B;  2MAZ A;  4DS7 A;  1DT7 B;  1NCX A;  2BL0 B;  2M8U A;  2WC8 A;  2KAV A;  1F70 A;  2KI4 C;  1EG4 A;  3TDI A;  1KQV A;  2E6W A;  1QAS A;  2GGZ A;  2KOT A;  2L98 A;  1SK6 D;  1SL8 A;  1BOC A;  1OMR A;  2BL0 C;  4JWQ A;  2AMI A;  1SKT A;  1Y6W A;  3PN7 B;  4AOM A;  1UUS A;  3MSE B;  1IG5 A;  1J1E A;  3JTD B;  1VRK A;  1FF1 A;  1EXR A;  2CCM A;  4NQG A;  2KI6 D;  4GAO A;  1ZMZ A;  4NDB A;  1QS7 A;  1REC A;  3WXA A;  2LAP A;  5DKN A;  1KFX L;  1KQM B;  2HPS A;  3NSK A;  2KAX A;  2WCE A;  1S5G Z;  2K7B A;  1MF8 B;  1IQ3 A;  1J7Q A;  1TOP A;  1QLS A;  3FIA A;  1W7I B;  2BE4 A;  1NCY A;  4OKH A;  2WOS A;  2LVI A;  3SG5 A;  4FQO A;  1B8C A;  3E3R A;  4C0L A;  1UP5 A;  2H61 C;  1PVB A;  3GK1 A;  5KTY A;  1CFC A;  3ICB A;  2K2A A;  2M49 B;  3SIA A;  3OP0 A;  3TDU A;  1Y0V H;  3PM8 A;  1J7O A;  1IWQ A;  1EG3 A;  1SL7 A;  3FS7 A;  4XJK A;  4NDD A;  2LHL A;  4QJ4 B;  3AKB A;  1J1D A;  1K9P A;  3FWC A;  3AKA A;  1SL9 A;  1DTL A;  3AAK A;  1U5I A;  2JTT A;  5AER A;  1CB1 A;  1B8R A;  1U5I B;  2LMV A;  2PAL A;  4PHN A;  1YR5 A;  1PSB A;  4M2Q A;  2HET A;  2IS9 A;  3CR5 X;  3TZ1 A;  5JJG A;  2JPT A;  4AQI A;  1KSM A;  3O6B A;  2FOT A;  1XVJ A;  2P6B B;  3PFV A;  5JOL A;  2LM5 A;  5AFP A;  1M31 A;  1GJY A;  1DJH A;  2CNP A;  5CSI A;  3EK7 A;  4I5N B;  1CM4 A;  4U8D A;  2JT0 A;  1MXL C;  3WHU B;  2HQW A;  4HSZ A;  1NUB A;  3CZT X;  5J3X A;  1TIZ A;  1JFJ A;  1JF0 A;  4YGB B;  1TN4 A;  2LUX A;  2MRD A;  1NWD A;  2WCF A;  3KHE A;  4YGC B;  1DMO A;  1AP4 A;  1N65 A;  1RJV A;  1QX2 A;  4ORC B;  1JFK A;  3I5I C;  4DUQ A;  1V1G A;  1G4Y R;  1NIW A;  1KFU S;  2OS8 B;  3IQQ A;  1F8H A;  2LVK A;  4PE4 A;  3VRN A;  2JXL A;  1JUO A;  3BUX B;  4ORB B;  2EHB A;  2NCO A;  2E30 A;  1YRU B;  2KBM A;  2ZN9 A;  1B4C A;  2QPT A;  5CPV A; 
#chains in the Genus database with same CATH topology
 1F4Q A;  1XFV O;  3UNW A;  1NSH A;  2ZFD A;  2L50 A;  5HKY A;  1S6I A;  3SIB A;  1DQE A;  1XFZ O;  2MJW B;  3PSR A;  3CZ2 A;  3DVM A;  5AXI A;  1ALW A;  1ZUZ A;  1S1E A;  1OOJ A;  1RK9 A;  2JUL A;  4AQJ A;  2LLS A;  2ZRS A;  3I5F B;  3DYE A;  1DJZ A;  1L2O C;  1CFP A;  2BCA A;  4PE0 A;  5D69 A;  4C0J A;  1FPW A;  3LCP C;  2WCJ A;  4OCI A;  2I7A A;  4QJ5 B;  1DJG A;  2PMY A;  5CSJ A;  4P2Y B;  2MA2 A;  1IGV A;  2L4I A;  3FWB A;  2I2R E;  2M97 A;  2ISD A;  1DGU A;  1TNW A;  2NLN A;  3ZWH A;  2JNX A;  3S0E A;  2YGU A;  2JT3 A;  5I2O A;  1K95 A;  2AUC A;  2NCP A;  3AAJ A;  3DZT A;  1LIN A;  2LP3 A;  1GGZ A;  1QVI Y;  1BMO A;  2KYC A;  1IJ5 A;  1M39 A;  2JRF A;  2LE9 B;  3RM1 A;  3CS1 A;  4ETO A;  1BF5 A;  1SPY A;  1XA5 A;  2JTZ A;  4GBA A;  1DF0 A;  3SJS A;  1DF0 B;  1GM0 A;  1KCY A;  1OOF A;  1MXE A;  2QAC A;  3CAB A;  1KFU L;  5DKR A;  2WND A;  2SCP A;  3JVT B;  4MN0 A;  3B86 A;  5I2Q A;  1MR8 A;  2P71 A;  1DJX A;  3C1V A;  4A4B A;  1K93 D;  3D0Y B;  1WLM A;  4OVN F;  4WQ2 A;  5D7F A;  3UO9 A;  4R1E A;  1CLL A;  1CDN A;  4GGF C;  3LL8 B;  3IQO A;  4GPL B;  3SG2 A;  3JVT C;  3SG4 A;  1G8I A;  3DY9 A;  1Y1X A;  1K9K A;  1CLM A;  3CYZ A;  1S26 D;  4QJ3 B;  3BFA A;  3CLN A;  5AEQ A;  2Q91 A;  2KDH A;  1C7W A;  2H61 A;  3D75 A;  1XFY O;  4M2P A;  1Z2C B;  3EG5 B;  4USL A;  2P70 A;  2LNK A;  1NCZ A;  2Y1N A;  4MVF A;  5AAN A;  2I18 A;  2O60 A;  3I5G C;  1DGV A;  3BYA A;  3O78 A;  4FQT A;  2NXQ A;  2MHH A;  3EVV A;  3PJI A;  4YI9 A;  1QX7 A;  3FE9 A;  2B1U A;  2KGR A;  4L9M A;  3TS5 C;  2KGB C;  1OZS A;  3CZ1 A;  5BPJ A;  3FE6 A;  2BBM A;  1JBA A;  1MWN A;  5ER5 A;  2JWW A;  1G33 A;  1QVI Z;  2PAS A;  1QV1 A;  2K7O A;  2PSR A;  1SCV A;  4P5O E;  1KK7 Z;  1BU3 A;  2QEO A;  2MLE C;  1A2X A;  4OV2 A;  4WRI A;  5GQQ C;  1LA0 A;  1D1O A;  5HKW A;  3LLE A;  3OBV A;  3H4S E;  4N5X A;  1M46 A;  4ICB A;  2JXC A;  1UUR A;  1UHH A;  2M0R A;  1XFX O;  1EH2 A;  1GGW A;  1EJ3 A;  1QJT A;  2CTN A;  2CXJ A;  1Y1A A;  3A4U B;  3LK1 A;  2DOQ A;  3NSO A;  1P28 A;  1S6C A;  1BR1 B;  1EL4 A;  4YGA A;  5ER4 X;  1TUZ A;  2KHN A;  2LMU A;  2PRU A;  5F6T A;  4IL1 A;  1C3Z A;  3CTN A;  2BE6 A;  2F3Y A;  4MLW A;  3NHT A;  3N7H A;  1SSE B;  2GTE A;  4PCW A;  3F45 A;  4E68 A;  1JSA A;  1QX5 B;  3I5I B;  4F7F A;  1SNL A;  2LC5 A;  2PYQ A;  3NSI A;  3TDZ A;  1UHI A;  1K8U A;  4CFQ A;  1YUR A;  2ZKM X;  4TNC A;  3OX5 A;  2G2B A;  1RTP 1;  2LP2 A;  5CSF A;  1YX7 A;  2RGI A;  4JQ0 D;  4PHJ A;  2EC6 C;  2L0P A;  2WCM A;  2BKI B;  1QIW A;  1KWO B;  1CFD A;  1TCF A;  1H8B A;  3BQ3 A;  1OOG A;  3D10 A;  1OZO A;  3BFH A;  1BR4 B;  1TNP A;  1WRZ A;  4INW A;  2M7N A;  5DKQ A;  4MZJ A;  3DF0 A;  1CMG A;  1CTR A;  1SY9 A;  1WY9 A;  2LCP A;  3DF0 B;  3BFB A;  1FBV A;  5FI7 A;  1DJW A;  1XYD A;  1KWO C;  2MLF C;  3DVK A;  4YRU A;  1L2O B;  1YRT B;  2HF5 A;  1B9A A;  3BJH A;  3I5H B;  1A29 A;  1K94 A;  2K61 A;  2QEH A;  3B87 A;  3EK8 A;  2AAO A;  2M1K B;  4HRG A;  4JPZ B;  5HL1 A;  1KK8 C;  1WDC B;  3KEV A;  2Y1M A;  1RRO A;  2L51 A;  1AK8 A;  1GQM A;  1UHJ A;  3B7A A;  1KSO A;  5FI2 A;  3TUY C;  1FI5 A;  2FCE A;  1QWV A;  3D78 A;  5FI6 A;  3I5H C;  4ZCV A;  2M3W A;  1A03 A;  4D1E A;  1A75 A;  1LKJ A;  1Q80 A;  4HRH A;  3O2P A;  1A75 B;  4Q04 A;  1K2H A;  4CPV A;  4MRY A;  4ZCU A;  1SW8 A;  1WDC C;  1NX2 A;  3DD4 A;  2KNE A;  4GNK B;  5I8N A;  1A4P A;  1J7R A;  1RWY A;  1TNQ A;  1ZFS A;  1QV0 A;  2LHI A;  4YGE B;  2GV5 A;  4YBH B;  2F2P A;  2GGM A;  1LS8 A;  3QRX A;  2WCB A;  2JZI A;  3FE8 A;  3DVE A;  1F55 A;  3SG6 A;  3OGN A;  1CLB A;  2G9B A;  4I5L B;  2CBL A;  2WC6 A;  3HCM A;  2BCX A;  2FJU B;  1IH0 A;  1F4O A;  1MQ1 A;  2D8N A;  4FTG A;  4GGF A;  3S0A A;  1J7P A;  3K21 A;  3NSL A;  1BG1 A;  3GK4 X;  1DVI A;  1DEL A;  3L4A A;  3SS5 A;  1CMF A;  2WCK A;  3VRP A;  1B47 A;  3PAL A;  3D0Y A;  1X02 A;  1YVL A;  2ZNE A;  1JWD A;  3OHM B;  2BCB A;  1SYM A;  5HKZ A;  1TTX A;  3DVJ A;  1OE9 B;  2BKH B;  1BOD A;  4C0K A;  5IBW A;  1UWO A;  4CFR A;  1NX0 A;  4GGN A;  1ODB A;  5EL2 A;  4A4C A;  1MHO A;  1OMD A;  1V1F A;  2LLU A;  1DC1 A;  4N1G A;  1C3Y A;  1SRA A;  1XK4 C;  1IIO A;  2OTG C;  5I94 A;  2JPO A;  3BXK A;  1LXF C;  2ZRT A;  3I5G B;  3WHT B;  2Y5I A;  5KU1 A;  3D76 A;  2JT8 A;  3OX6 A;  3RLZ A;  1B8L A;  1QLK A;  1K9U A;  1SMG A;  2WCH A;  1JF2 A;  1SCM C;  1TNX A;  1W7J B;  4DCK A;  1PUL A;  2KAY A;  3TS5 B;  4WQ3 A;  1BLQ A;  1AHR A;  1YUT A;  2LUC A;  1OQP A;  4KYN A;  1ORG A;  2L2C A;  4INX A;  3SG3 A;  1LA3 A;  1SR6 B;  2KYF A;  3GOF A;  2VRG A;  3D77 A;  3GK2 A;  2L2E A;  2KFH A;  1YVH A;  2BBN A;  3KPX A;  1M45 A;  4N1F A;  2F8P A;  1OOH A;  3PN7 C;  1QIV A;  2KQ6 A;  2R2I A;  4ORA B;  4F0Z B;  2TN4 A;  1IRJ A;  1PSR A;  1SR6 C;  2H2K A;  2JNF A;  2KLE A;  4I5K A;  3VRO A;  1N2D A;  1S3P A;  3JTD C;  2KQY A;  5HYD A;  1K90 D;  5FYX A;  2QDI A;  1XO5 A;  2Y4Q A;  1ZAC A;  5PAL A;  2SAS A;  3ZNI A;  2KPH A;  3K1E A;  3OB2 B;  3V2L A;  3VRQ A;  1PAL A;  1OMV A;  3CWG A;  1Z4H A;  1OSA A;  1NPQ A;  4UPG A;  1KQM C;  3SG7 A;  4MEW A;  1F71 A;  1TWO A;  3B88 A;  3KF9 A;  2KSP A;  1T14 A;  2QEB A;  1CDP A;  1R2U A;  3PM2 A;  3CR4 X;  1XFR A;  2PQL A;  4XJK B;  1MUX A;  3NHI A;  2FCD A;  5HLO A;  4MZL A;  2JC2 A;  4PAL A;  1B7T Y;  2KFF A;  1E8A A;  1XFW O;  2L5X B;  1S36 A;  2V53 A;  3NXA A;  2EC6 B;  3CR2 A;  1NX1 A;  2K8M B;  1HT9 A;  2KI6 C;  3EK4 A;  1B1G A;  3CGA A;  3EKJ A;  1C07 A;  3EVR A;  4DRW A;  1NX3 A;  4PHM A;  1HQV A;  1SBJ A;  1YX8 A;  3A8R A;  2FJY A;  1F54 A;  1N0Y A;  3M0W A;  3BUM B;  4YGD B;  3VRR A;  1YUS A;  4CID A;  3BOW A;  2O5G A;  3BUO B;  3BOW B;  5CSN A;  4NDC A;  1YTZ C;  2LLT A;  2LMT A;  1J55 A;  1UHN A;  2F3Z A;  2LVJ A;  3OB1 B;  3QME A;  1PVA A;  4PDZ A;  2JOJ A;  2HQ8 A;  4HRE E;  1XFU O;  1OOI X;  1QAT A;  2A4J A;  1QXP A;  2KFG A;  2OPO A;  1KK8 B;  3LK0 A;  2PVB A;  3VGO A;  2KBI A;  4MSP A;  3EVU A;  3O4Y A;  3TUY B;  5K89 A;  1JC2 A;  2ZN8 A;  1CKK A;  1BT6 A;  4CLN A;  3PLF B;  1LVC D;  3IF7 A;  2I94 A;  3R1O A;  2COL B;  4M2O A;  2L4H A;  3DXL A;  1CM1 A;  3B6X A;  5G08 A;  1ALV A;  5KSZ A;  1BJF A;  3HX4 A;  4BY5 A;  3SS4 A;  1OW4 A;  1NP8 A;  2K2F A;  4XYN A;  1CDM A;  3S0B A;  1IJ6 A;  1QTX A;  1PK0 D;  4PE7 A;  3RZS A;  1AVS A;  3WNX B;  1NYA A;  1C7V A;  4GUK A;  1H4B A;  4BY4 A;  1TCO B;  2BEC A;  2Q4U A;  4GFT A;  2F33 A;  3CDN A;  1DEK A;  2MBX A;  1CFF A;  2K7D A;  1PRW A;  3BUN B;  3R1P A;  5HLV A;  2F2O A;  1Y1U A;  4OR9 B;  2OS8 C;  1TRF A;  2CT9 A;  1RFJ A;  2H8V A;  1UHK A;  5TNC A;  1B7T Z;  1FW4 A;  1R6P A;  1WRL A;  4PHK A;  4DIR A;  1M63 B;  1IQ5 A;  1AJ4 A;  2JU0 A;  2LV7 A;  2M1U A;  1S5G Y;  2ZND A;  2LAN A;  1L7Z A;  4I5J A;  4MRX A;  3S0F A;  1CNP A;  2EGD A;  2M7L A;  4PE1 A;  4YI8 A;  3IVT A;  1ZOT B;  1YUU A;  1AJ5 A;  3BUW B;  2K0J A;  1S6J A;  3KO0 A;  1AUI B;  1WRK A;  5I2L A;  2JQ6 A;  1KFX S;  4MBE A;  1XK4 A;  3PAT A;  2L5Y A;  2OTG B;  1K96 A;  3I5F C;  4MZK A;  2LVV A;  2NZ0 A;  2K7C A;  2KI4 B;  1DJY A;  1IKU A;  3EKH A;  2M29 A;  1FI6 A;  1DJI A;  5B8I B;  2WOR A;  2M9G A;  1WLZ A;  1KK7 Y;  1CDL A;  1SCM B;  2MAZ A;  2QEV A;  4DS7 A;  1DT7 B;  1NCX A;  2BL0 B;  2M8U A;  2WC8 A;  2KAV A;  1F70 A;  2KI4 C;  1EG4 A;  3TDI A;  2WC5 A;  3R1V A;  2E6W A;  3L47 A;  1KQV A;  1QAS A;  2GGZ A;  2KOT A;  2ERB A;  2L98 A;  1SK6 D;  1SL8 A;  1BOC A;  1OMR A;  2BL0 C;  4JWQ A;  2AMI A;  1SKT A;  3L4L A;  1Y6W A;  3PN7 B;  3S0G A;  4AOM A;  1UUS A;  3CZ0 A;  3MSE B;  1IG5 A;  1J1E A;  3JTD B;  1VRK A;  1FF1 A;  1EXR A;  2CCM A;  4NQG A;  2KI6 D;  4GAO A;  1ZMZ A;  4NDB A;  1QS7 A;  1REC A;  3O4X A;  3WXA A;  2LAP A;  5DKN A;  1KFX L;  1KQM B;  2HPS A;  4PT1 A;  3NSK A;  2K60 A;  2KAX A;  2WCE A;  1S5G Z;  2K7B A;  1MF8 B;  5D3O A;  1IQ3 A;  1TOP A;  1QLS A;  1J7Q A;  3FIA A;  1W7I B;  2BE4 A;  1NCY A;  4OKH A;  2WOS A;  2LVI A;  3VB1 A;  3SG5 A;  4FQO A;  1B8C A;  3E3R A;  2BAP A;  1UP5 A;  2H61 C;  1PVB A;  3GK1 A;  4C0L A;  5KTY A;  3ICB A;  2K2A A;  2M49 B;  3SIA A;  3OP0 A;  3TDU A;  1Y0V H;  3PM8 A;  2KLD A;  1J7O A;  1IWQ A;  1EG3 A;  1SL7 A;  3FS7 A;  3Q8I A;  4XJK A;  2WCL A;  2LHL A;  4NDD A;  4QJ4 B;  3AKB A;  1J1D A;  1K9P A;  3FWC A;  3AKA A;  1SL9 A;  1DTL A;  3AAK A;  1U5I A;  2JTT A;  5AER A;  1CB1 A;  1B8R A;  1U5I B;  2LMV A;  2PAL A;  4PHN A;  1YR5 A;  1PSB A;  4M2Q A;  2HET A;  2IS9 A;  3CR5 X;  3TZ1 A;  5JJG A;  4JKT A;  2JPT A;  4AQI A;  1KSM A;  3O6B A;  2FOT A;  1XVJ A;  2BNX A;  2P6B B;  3PFV A;  5JOL A;  5DIC A;  3SS3 A;  2LM5 A;  5AFP A;  1M31 A;  1DJH A;  1GJY A;  2CNP A;  3NGV A;  5CSI A;  3EK7 A;  3D74 A;  4I5N B;  1CM4 A;  3S0D A;  4JD9 A;  2JT0 A;  4U8D A;  1MXL C;  3WHU B;  2HQW A;  4HSZ A;  1NUB A;  3CZT X;  5J3X A;  1TIZ A;  1JFJ A;  1JF0 A;  4YGB B;  1TUJ A;  1TN4 A;  2LUX A;  2MRD A;  1NWD A;  2WCF A;  3KHE A;  4YGC B;  1DMO A;  1AP4 A;  1N65 A;  1RJV A;  1QX2 A;  4ORC B;  1CFC A;  1JFK A;  3I5I C;  4DUQ A;  4IJ7 A;  1V1G A;  1G4Y R;  1NIW A;  1KFU S;  2OS8 B;  3IQQ A;  1F8H A;  2LVK A;  4PE4 A;  3VRN A;  2JXL A;  1JUO A;  3BUX B;  4ORB B;  2EHB A;  2NCO A;  2E30 A;  1YRU B;  2KBM A;  2ZN9 A;  1B4C A;  1W9Z A;  3R72 A;  2QPT A;  4OZD A;  5CPV A;  3D73 A; 
#chains in the Genus database with same CATH homology
 1F4Q A;  1XFV O;  1NSH A;  2ZFD A;  2L50 A;  5HKY A;  1S6I A;  3SIB A;  1XFZ O;  2MJW B;  3PSR A;  3DVM A;  5AXI A;  1ALW A;  1ZUZ A;  1S1E A;  1OOJ A;  1RK9 A;  2JUL A;  4AQJ A;  2LLS A;  2ZRS A;  3I5F B;  1DJZ A;  1L2O C;  1CFP A;  2BCA A;  4PE0 A;  5D69 A;  4C0J A;  1FPW A;  3LCP C;  4OCI A;  2I7A A;  4QJ5 B;  1DJG A;  2PMY A;  5CSJ A;  4P2Y B;  2MA2 A;  1IGV A;  2L4I A;  3FWB A;  2I2R E;  2M97 A;  2ISD A;  1DGU A;  1TNW A;  2NLN A;  3ZWH A;  2JNX A;  2JT3 A;  5I2O A;  1K95 A;  2AUC A;  2NCP A;  3AAJ A;  1LIN A;  2LP3 A;  1GGZ A;  1QVI Y;  1BMO A;  2KYC A;  1IJ5 A;  1M39 A;  2JRF A;  2LE9 B;  3RM1 A;  3CS1 A;  4ETO A;  1BF5 A;  1SPY A;  1XA5 A;  2JTZ A;  4GBA A;  1DF0 A;  3SJS A;  1DF0 B;  1KCY A;  1MXE A;  2QAC A;  5DKR A;  1KFU L;  2WND A;  2SCP A;  3JVT B;  4MN0 A;  5I2Q A;  1MR8 A;  3C1V A;  1DJX A;  4A4B A;  1K93 D;  3D0Y B;  1WLM A;  4OVN F;  4WQ2 A;  5D7F A;  4R1E A;  1CLL A;  1CDN A;  4GGF C;  3LL8 B;  3IQO A;  4GPL B;  3SG2 A;  3JVT C;  3SG4 A;  1G8I A;  1Y1X A;  1K9K A;  1CLM A;  1S26 D;  4QJ3 B;  3CLN A;  5AEQ A;  2Q91 A;  2KDH A;  1C7W A;  2H61 A;  1XFY O;  4M2P A;  4USL A;  2LNK A;  1NCZ A;  2Y1N A;  4MVF A;  5AAN A;  2I18 A;  2O60 A;  3I5G C;  1DGV A;  3BYA A;  3O78 A;  2NXQ A;  2MHH A;  3EVV A;  4YI9 A;  1QX7 A;  2B1U A;  2KGR A;  4L9M A;  3TS5 C;  2KGB C;  1OZS A;  5BPJ A;  2BBM A;  1JBA A;  1MWN A;  5ER5 A;  2JWW A;  1G33 A;  1QVI Z;  2PAS A;  1QV1 A;  2K7O A;  2PSR A;  1SCV A;  4P5O E;  1KK7 Z;  1BU3 A;  2MLE C;  1A2X A;  4OV2 A;  4WRI A;  5GQQ C;  1LA0 A;  1D1O A;  5HKW A;  3LLE A;  4N5X A;  3H4S E;  1M46 A;  4ICB A;  2JXC A;  1UUR A;  1UHH A;  2M0R A;  1XFX O;  1EH2 A;  1GGW A;  1EJ3 A;  1QJT A;  2CTN A;  2CXJ A;  1Y1A A;  3A4U B;  3LK1 A;  2DOQ A;  3NSO A;  1S6C A;  1BR1 B;  1EL4 A;  4YGA A;  5ER4 X;  2KHN A;  2LMU A;  2PRU A;  5F6T A;  4IL1 A;  3CTN A;  2BE6 A;  2F3Y A;  4MLW A;  4PCW A;  3F45 A;  4E68 A;  1JSA A;  1QX5 B;  3I5I B;  1SNL A;  2LC5 A;  3NSI A;  3TDZ A;  1UHI A;  1K8U A;  4CFQ A;  1YUR A;  2ZKM X;  4TNC A;  3OX5 A;  2G2B A;  1RTP 1;  2LP2 A;  5CSF A;  1YX7 A;  2RGI A;  4JQ0 D;  4PHJ A;  2EC6 C;  2L0P A;  2BKI B;  1QIW A;  1KWO B;  1CFD A;  1TCF A;  1H8B A;  3BQ3 A;  3D10 A;  1OZO A;  1BR4 B;  1TNP A;  1WRZ A;  5DKQ A;  2M7N A;  4MZJ A;  3DF0 A;  1CMG A;  1CTR A;  1SY9 A;  1WY9 A;  2LCP A;  3DF0 B;  1FBV A;  1DJW A;  1XYD A;  1KWO C;  2MLF C;  3DVK A;  4YRU A;  1L2O B;  1YRT B;  2HF5 A;  1B9A A;  3I5H B;  1A29 A;  1K94 A;  2K61 A;  3EK8 A;  2AAO A;  2M1K B;  4HRG A;  4JPZ B;  1KK8 C;  1WDC B;  3KEV A;  2Y1M A;  1RRO A;  2L51 A;  1AK8 A;  1GQM A;  1UHJ A;  1KSO A;  3TUY C;  1FI5 A;  2FCE A;  4ZCV A;  3I5H C;  2M3W A;  1A03 A;  4D1E A;  1A75 A;  1LKJ A;  1Q80 A;  4HRH A;  3O2P A;  1A75 B;  4Q04 A;  1K2H A;  4CPV A;  4MRY A;  4ZCU A;  1SW8 A;  1WDC C;  1NX2 A;  3DD4 A;  2KNE A;  4GNK B;  5I8N A;  1A4P A;  1J7R A;  1RWY A;  1TNQ A;  1ZFS A;  1QV0 A;  2LHI A;  4YGE B;  2GV5 A;  4YBH B;  2F2P A;  2GGM A;  3QRX A;  2WCB A;  2JZI A;  3DVE A;  1F55 A;  3SG6 A;  1CLB A;  2G9B A;  4I5L B;  2CBL A;  3HCM A;  2BCX A;  2FJU B;  1IH0 A;  1F4O A;  1MQ1 A;  2D8N A;  4FTG A;  4GGF A;  1J7P A;  3K21 A;  3NSL A;  1BG1 A;  3GK4 X;  1DVI A;  1CMF A;  3VRP A;  1B47 A;  3PAL A;  3D0Y A;  1X02 A;  1YVL A;  2ZNE A;  1JWD A;  3OHM B;  2BCB A;  1SYM A;  5HKZ A;  1TTX A;  3DVJ A;  1OE9 B;  2BKH B;  1BOD A;  4C0K A;  5IBW A;  1UWO A;  4CFR A;  1NX0 A;  4GGN A;  1ODB A;  4A4C A;  1MHO A;  1OMD A;  1V1F A;  2LLU A;  4N1G A;  1SRA A;  1XK4 C;  2OTG C;  3BXK A;  1LXF C;  2ZRT A;  3I5G B;  3WHT B;  2Y5I A;  5KU1 A;  2JT8 A;  3OX6 A;  3RLZ A;  1B8L A;  1QLK A;  1K9U A;  1SMG A;  1JF2 A;  1SCM C;  1TNX A;  1W7J B;  4DCK A;  1PUL A;  2KAY A;  3TS5 B;  4WQ3 A;  1BLQ A;  1AHR A;  1YUT A;  2LUC A;  1OQP A;  3SG3 A;  1LA3 A;  1SR6 B;  2KYF A;  3GOF A;  2VRG A;  3GK2 A;  2L2E A;  2KFH A;  1YVH A;  2BBN A;  3KPX A;  1M45 A;  4N1F A;  2F8P A;  3PN7 C;  1QIV A;  2KQ6 A;  2R2I A;  4ORA B;  4F0Z B;  2TN4 A;  1IRJ A;  1PSR A;  1SR6 C;  2H2K A;  2JNF A;  4I5K A;  3VRO A;  1N2D A;  1S3P A;  3JTD C;  2KQY A;  5HYD A;  1K90 D;  5FYX A;  1XO5 A;  2Y4Q A;  1ZAC A;  5PAL A;  2SAS A;  3ZNI A;  3OB2 B;  3VRQ A;  1PAL A;  1OMV A;  3CWG A;  1OSA A;  1NPQ A;  4UPG A;  1KQM C;  3SG7 A;  4MEW A;  1F71 A;  3KF9 A;  2KSP A;  1CDP A;  1R2U A;  3CR4 X;  4XJK B;  1MUX A;  2FCD A;  5HLO A;  4MZL A;  2JC2 A;  4PAL A;  1B7T Y;  2KFF A;  1E8A A;  1XFW O;  2L5X B;  1S36 A;  2V53 A;  3NXA A;  2EC6 B;  3CR2 A;  1NX1 A;  2K8M B;  1HT9 A;  2KI6 C;  3EK4 A;  1B1G A;  3CGA A;  3EKJ A;  1C07 A;  3EVR A;  4DRW A;  1NX3 A;  4PHM A;  1HQV A;  1SBJ A;  1YX8 A;  3A8R A;  1F54 A;  1N0Y A;  3M0W A;  3BUM B;  4YGD B;  3VRR A;  1YUS A;  4CID A;  3BOW A;  2O5G A;  3BUO B;  3BOW B;  5CSN A;  4NDC A;  1YTZ C;  2LLT A;  2LMT A;  1J55 A;  1UHN A;  2F3Z A;  2LVJ A;  3OB1 B;  1PVA A;  4PDZ A;  2JOJ A;  2HQ8 A;  4HRE E;  1XFU O;  1QAT A;  2A4J A;  2OPO A;  1QXP A;  2KFG A;  1KK8 B;  3LK0 A;  2PVB A;  3VGO A;  2KBI A;  4MSP A;  3EVU A;  3O4Y A;  3TUY B;  5K89 A;  1JC2 A;  2ZN8 A;  1CKK A;  1BT6 A;  4CLN A;  3PLF B;  1LVC D;  3IF7 A;  2I94 A;  2COL B;  4M2O A;  2L4H A;  1CM1 A;  5G08 A;  1ALV A;  5KSZ A;  1BJF A;  3HX4 A;  4BY5 A;  1NP8 A;  2K2F A;  4XYN A;  1CDM A;  1IJ6 A;  1QTX A;  1PK0 D;  4PE7 A;  1C7V A;  1AVS A;  3WNX B;  1NYA A;  4GUK A;  1H4B A;  4BY4 A;  1TCO B;  2BEC A;  2Q4U A;  4GFT A;  2F33 A;  2MBX A;  1CFF A;  2K7D A;  1PRW A;  3BUN B;  5HLV A;  2F2O A;  1Y1U A;  4OR9 B;  2OS8 C;  1TRF A;  2CT9 A;  1RFJ A;  1UHK A;  5TNC A;  1B7T Z;  1FW4 A;  1R6P A;  1WRL A;  4PHK A;  4DIR A;  1M63 B;  1IQ5 A;  1AJ4 A;  2JU0 A;  2LV7 A;  2M1U A;  1S5G Y;  2ZND A;  2LAN A;  1L7Z A;  4I5J A;  4MRX A;  1CNP A;  2EGD A;  2M7L A;  4PE1 A;  4YI8 A;  1ZOT B;  1YUU A;  1AJ5 A;  3BUW B;  2K0J A;  1S6J A;  3KO0 A;  1AUI B;  1WRK A;  5I2L A;  2JQ6 A;  1KFX S;  4MBE A;  1XK4 A;  3PAT A;  2OTG B;  1K96 A;  3I5F C;  4MZK A;  2LVV A;  2NZ0 A;  2K7C A;  2KI4 B;  1DJY A;  1IKU A;  3EKH A;  2M29 A;  1FI6 A;  1DJI A;  5B8I B;  2WOR A;  2M9G A;  1WLZ A;  1KK7 Y;  1CDL A;  1SCM B;  2MAZ A;  4DS7 A;  1DT7 B;  1NCX A;  2BL0 B;  2M8U A;  2WC8 A;  2KAV A;  1F70 A;  2KI4 C;  1EG4 A;  3TDI A;  1KQV A;  2E6W A;  1QAS A;  2GGZ A;  2KOT A;  2L98 A;  1SK6 D;  1SL8 A;  1BOC A;  1OMR A;  2BL0 C;  4JWQ A;  2AMI A;  1SKT A;  1Y6W A;  3PN7 B;  4AOM A;  1UUS A;  3MSE B;  1IG5 A;  1J1E A;  3JTD B;  1VRK A;  1FF1 A;  1EXR A;  2CCM A;  4NQG A;  2KI6 D;  4GAO A;  1ZMZ A;  4NDB A;  1QS7 A;  1REC A;  3WXA A;  2LAP A;  5DKN A;  1KFX L;  1KQM B;  2HPS A;  3NSK A;  2KAX A;  2WCE A;  1S5G Z;  2K7B A;  1MF8 B;  1IQ3 A;  1J7Q A;  1TOP A;  1QLS A;  3FIA A;  1W7I B;  2BE4 A;  1NCY A;  4OKH A;  2WOS A;  2LVI A;  3SG5 A;  4FQO A;  1B8C A;  3E3R A;  4C0L A;  1UP5 A;  2H61 C;  1PVB A;  3GK1 A;  5KTY A;  1CFC A;  3ICB A;  2K2A A;  2M49 B;  3SIA A;  3OP0 A;  3TDU A;  1Y0V H;  3PM8 A;  1J7O A;  1IWQ A;  1EG3 A;  1SL7 A;  3FS7 A;  4XJK A;  4NDD A;  2LHL A;  4QJ4 B;  3AKB A;  1J1D A;  1K9P A;  3FWC A;  3AKA A;  1SL9 A;  1DTL A;  3AAK A;  1U5I A;  2JTT A;  5AER A;  1CB1 A;  1B8R A;  1U5I B;  2LMV A;  2PAL A;  4PHN A;  1YR5 A;  1PSB A;  4M2Q A;  2HET A;  2IS9 A;  3CR5 X;  3TZ1 A;  5JJG A;  2JPT A;  4AQI A;  1KSM A;  3O6B A;  2FOT A;  1XVJ A;  2P6B B;  3PFV A;  5JOL A;  2LM5 A;  5AFP A;  1M31 A;  1GJY A;  1DJH A;  2CNP A;  5CSI A;  3EK7 A;  4I5N B;  1CM4 A;  4U8D A;  2JT0 A;  1MXL C;  3WHU B;  2HQW A;  4HSZ A;  1NUB A;  3CZT X;  5J3X A;  1TIZ A;  1JFJ A;  1JF0 A;  4YGB B;  1TN4 A;  2LUX A;  2MRD A;  1NWD A;  2WCF A;  3KHE A;  4YGC B;  1DMO A;  1AP4 A;  1N65 A;  1RJV A;  1QX2 A;  4ORC B;  1JFK A;  3I5I C;  4DUQ A;  1V1G A;  1G4Y R;  1NIW A;  1KFU S;  2OS8 B;  3IQQ A;  1F8H A;  2LVK A;  4PE4 A;  3VRN A;  2JXL A;  1JUO A;  3BUX B;  4ORB B;  2EHB A;  2NCO A;  2E30 A;  1YRU B;  2KBM A;  2ZN9 A;  1B4C A;  2QPT A;  5CPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...