2BCAA

High-resolution solution structure of calcium-loaded calbindin d9k
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title High-resolution structure of calcium-loaded calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 28
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1993-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bcaA00
2CXJA 2BKIB 2KI4C 3BUMB 4PHNA 3JTDB 4N1GA 1Y6WA 2JT3A 2H61C 3EKHA 1OMRA 3JVTC 1WLMA 2KQ6A 4I5KA 1NCXA 5DKNA 2LE9B 1ODBA 1H4BA 1K93D 3DF0B 2EHBA 2ZKMX 1SYMA 1KFXS 1DJGA 5B8IB 2LVIA 2M8UA 2KFFA 2L2EA 1BODA 1RECA 1MR8A 1F4QA 1XK4A 1YRTB 3SIBA 3I5IB 1BOCA 3PSRA 4ORAB 2M49B 3O2PA 2LM5A 1K9UA 2L51A 3CR2A 3LK1A 1VRKA 4PE4A 2ISDA 3GK2A 4XYNA 1K90D 2AAOA 3JTDC 5D7FA 2O60A 3KEVA 4AQJA 1NX3A 1IKUA 1M46A 5ER4X 4F0ZB 2NCPA 3DD4A 1XFVO 4ORBB 3GOFA 5GQQC 2LLUA 1FPWA 2PSRA 3D0YA 2K0JA 1GGZA 3VRQA 4A4BA 3KPXA 1DT7B 4N1FA 3CZTX 2LUXA 1NWDA 1XO5A 1TNQA 2F3ZA 1Q80A 2WNDA 3SG7A 1IJ5A 4PDZA 4TNCA 4NDDA 4CFRA 2LLTA 2ZNEA 1UHKA 2LP2A 1QX7A 1N2DA 1QASA 3I5IC 1WY9A 1MHOA 2I7AA 1PVBA 4A4CA 4YGBB 5BPJA 1TNPA 2E30A 2KYFA 1IQ3A 1AHRA 2LUCA 3IQQA 4PHJA 3D0YB 3I5GB 2F2PA 1DMOA 1PULA 2JU0A 3EK8A 1LINA 2MJWB 1L2OB 2D8NA 1CDPA 1NX1A 1WRKA 1AJ4A 2JC2A 4I5NB 1QVIZ 1S5GZ 1XA5A 2M9GA 1QVIY 1S5GY 1D1OA 3BYAA 2AMIA 3DVJA 1SBJA 2PASA 1XK4C 1MXEA 1YVLA 1TRFA 1YR5A 3BOWA 2Q91A 4FTGA 4NDBA 1JSAA 2KAYA 3IQOA 1QTXA 1Y1AA 5KSZA 1DJYA 1MXLC 2M7NA 2L0PA 3O6BA 2LVJA 4HSZA 2M1UA 2NZ0A 3CTNA 1NUBA 4GFTA 1YVHA 2M1KB 4BY4A 2PRUA 4OR9B 4MRYA 2K2FA 1W7JB 2KGBC 1UUSA 2I2RE 1KFXL 2LNKA 2JPTA 3NSIA 4N5XA 1AK8A 4YGAA 3I5GC 1SL7A 2VRGA 4OKHA 1CDLA 3CR4X 1L2OC 4OVNF 3BOWB 4NDCA 3TDZA 3K21A 1S6JA 1YUTA 1K94A 4MZJA 5FYXA 2CBLA 1E8AA 4M2QA 1J7RA 4WQ2A 5TNCA 2FJUB 4R1EA 2BE6A 1XFUO 1IG5A 4GNKB 1GJYA 5HKWA 1TNWA 2M29A 4YGDB 5HLOA 4ORCB 1CM4A 1CB1A 1KSMA 1OMVA 1QV0A 3ZNIA 3TS5B 4ZCVA 1KCYA 3OB2B 1UURA 2AUCA 2JTTA 1JUOA 2RGIA 4MRXA 1CFCA 1KFUS 1XFZO 2LMTA 1CLMA 1M45A 1SCVA 1MUXA 4GGFA 3SIAA 1KK8B 3SG2A 1N0YA 1QIWA 1EH2A 2PALA 1ZOTB 2B1UA 1IWQA 2WCFA 3DVEA 4NQGA 1DJWA 2Y1NA 4USLA 4AOMA 1XFXO 3VRRA 1MF8B 1TIZA 2V53A 2BCXA 4C0KA 2JNFA 2BCAA 2KFHA 2KFGA 1B1GA 1YRUB 4OCIA 3AKAA 3KF9A 1NIWA 3BUOB 3HCMA 4YI8A 3CWGA 1GQMA 4UPGA 5KU1A 4C0JA 1RJVA 2MRDA 1OSAA 1K8UA 3C1VA 3TDIA 1QLKA 1F54A 2M0RA 3NSKA 1B8CA 2F2OA 3DVMA 2KOTA 1PSBA 4MZKA 1CMFA 1IRJA 1KQVA 3KO0A 1DJXA 1BR4B 2EC6B 3EVUA 3TS5C 3MSEB 1KQMB 4MBEA 1QS7A 4MVFA 4CPVA 1JFJA 3D10A 2SCPA 3H4SE 1EXRA 2IS9A 1J7OA 5HYDA 1CLBA 1V1FA 1LA0A 2CNPA 1KK8C 2M97A 1B4CA 4P2YB 4DRWA 5I2OA 1K96A 2KAXA 5HKZA 1K2HA 1YX7A 1C07A 1FI5A 1AJ5A 1DJZA 1TCFA 3CS1A 1SL8A 2NXQA 3FS7A 4OV2A 1PVAA 1A03A 2KYCA 5CSJA 4PE7A 1J55A 2M7LA 1UP5A 2JZIA 2OTGB 3GK4X 3WHUB 2NCOA 1QX2A 2WCEA 2A4JA 2JWWA 4PHMA 2EC6C 3FIAA 1BR1B 1QIVA 3LLEA 1KQMC 3CGAA 3O4YA 4IL1A 3PLFB 1WLZA 2BKHB 1KK7Z 2G2BA 5AFPA 1A29A 4AQIA 1FI6A 1WDCB 1FBVA 3SG6A 1V1GA 3LL8B 2Y4QA 4P5OE 2JULA 1KSOA 4I5LB 1CLLA 2EGDA 1B47A 1K95A 2LC5A 1NP8A 1S3PA 1JF0A 1YUSA 1A75A 2LAPA 3VRPA 4L9MA 1DJHA 1NX2A 1TCOB 1JC2A 1EJ3A 3EVRA 4ETOA 1SW8A 3PN7B 5K89A 1KFUL 5I2QA 1PRWA 2ZRSA 1NX0A 1TN4A 1NSHA 2OTGC 1LVCD 2ZRTA 1G4YR 1OOJA 5CSFA 3AKBA 1A2XA 3TUYB 1QXPA 2ZN9A 5KTYA 1H8BA 3EK7A 2G9BA 4PCWA 2ZFDA 4XJKA 1AUIB 2HETA 4C0LA 1MQ1A 3EK4A 2BCBA 2BBNA 5JJGA 1WDCC 3E3RA 1A75B 2K8MB 2L4IA 5DKQA 3LK0A 5AEQA 4ICBA 2P6BB 5AERA 1S6CA 2L4HA 4JQ0D 1F4OA 4DS7A 2LANA 3TZ1A 1OE9B 1DGVA 4I5JA 1SCMB 1IH0A 1SK6D 2LVKA 1XYDA 1JBAA 1CFDA 3PN7C 2M3WA 1CNPA 2H2KA 1UHHA 1J7PA 2KNEA 1SR6B 4WRIA 4PE0A 4DIRA 4GBAA 2JNXA 3O78A 2HF5A 2SASA 4XJKB 3VRNA 1MWNA 4PALA 4YBHB 3WHTB 1KWOB 3TUYC 2KGRA 2GGZA 3WXAA 1OZSA 2ZNDA 5CPVA 1C7WA 2OS8B 1XVJA 4YI9A 1F71A 1SKTA 1XFYO 1HT9A 1ZMZA 1B9AA 1BU3A 1CMGA 2F33A 2JXCA 2LLSA 3RM1A 1BF5A 2LVVA 2LCPA 1EL4A 1EG4A 1QLSA 1SRAA 4E68A 2L5XB 1UHNA 5D69A 1F70A 5HKYA 4YGCB 2PMYA 5CSNA 1CTRA 1SCMC 5JOLA 5I8NA 1RWYA 2JOJA 2CCMA 4FQOA 3I5HB 1JF2A 3PALA 1SR6C 3DVKA 5F6TA 3TDUA 4PE1A 1M31A 4GAOA 1NYAA 1S1EA 4MSPA 4Q04A 1NCYA 4CLNA 2DOQA 1GGWA 4BY5A 1JWDA 1RFJA 2BBMA 3OX6A 1CDNA 2LMVA 2LHIA 3AAJA 4WQ3A 5AANA 1CFFA 2I18A 3WNXB 4QJ4B 1KWOC 2K2AA 2MLEC 1BT6A 2Q4UA 2OS8C 1CFPA 4M2PA 3ZWHA 1K9KA 2BE4A 3BXKA 3SG3A 2QACA 1RK9A 1NCZA 4JPZB 1AVSA 1XFWO 4DCKA 1J1EA 1PALA 1UWOA 1M39A 5IBWA 3VROA 3ICBA 4MLWA 1TTXA 3QRXA 1QATA 2JT8A 3NSLA 1TNXA 1NPQA 3NXAA 2KBIA 1B8LA 2JT0A 1R2UA 2WC8A 3LCPC 1Y1UA 1A4PA 4GPLB 4GGFC 2FOTA 3I5HC 1DGUA 3F45A 4D1EA 4YRUA 1IQ5A 5HLVA 1R6PA 3BQ3A 2WCBA 1SNLA 3NSOA 1G8IA 1S36A 1ZUZA 5AXIA 1KK7Y 1W7IB 4QJ5B 2HPSA 2KQYA 2Y5IA 1IJ6A 1OMDA 1DJIA 1FW4A 1DF0A 1BJFA 5CSIA 2F3YA 1DVIA 2GGMA 1PSRA 2HQWA 2KI6C 2LMUA 4ZCUA 2WOSA 5I2LA 1K9PA 1Y1XA 2K7OA 3OB1B 1X02A 4HRHA 3SJSA 4U8DA 1S6IA 1AP4A 3IF7A 1LA3A 2PVBA 2CT9A 3FWBA 1ZACA 1B8RA 2E6WA 2L50A 3M0WA 1Y0VH 2R2IA 2JRFA 3VGOA 2H61A 2LV7A 2LHLA 2WORA 1CKKA 1JFKA 1BLQA 1YX8A 1OQPA 1BG1A 5G08A 2KBMA 1BMOA 2FCEA 4GGNA 4JWQA 4MEWA 2KI6D 2BL0B 2LP3A 4MN0A 1C7VA 1J7QA 1G33A 1DF0B 2KHNA 2TN4A 2O5GA 4CIDA 2CTNA 1SL9A 1QX5B 2JQ6A 2OPOA 1SPYA 1YTZC 3AAKA 1FF1A 1U5IA 2GV5A 1CDMA 2BECA 1DTLA 3I5FB 2JXLA 3OX5A 2KSPA 1CM1A 1YUUA 1B7TZ 1UHIA 2KI4B 3EVVA 1B7TY 3A4UB 1RROA 2COLB 4MZLA 2MAZA 1J1DA 1N65A 3GK1A 1L7ZA 5PALA 1SMGA 3SG4A 4QJ3B 2KAVA 2HQ8A 4GUKA 1F55A 1LKJA 4CFQA 2L98A 2K7BA 3KHEA 2I94A 4HRGA 1PK0D 3JVTB 3PATA 1WRZA 2JTZA 1LXFC 2MHHA 2MLFC 5DKRA 1ZFSA 3A8RA 3CR5X 3BUNB 1OZOA 2K61A 3EKJA 3PFVA 4PHKA 2ZN8A 1IGVA 1S26D 3OHMB 2F8PA 1F8HA 1QJTA 1U5IB 2K7CA 3CLNA 2MBXA 1ALVA 2MA2A 3FWCA 5J3XA 3PM8A 3RLZA 4M2OA 1TOPA 1HQVA 2BL0C 2QPTA 3BUXB 2KDHA 2NLNA 4HREE 1ALWA 3DF0A 1YURA 3OP0A 4YGEB 2FCDA 3HX4A 1WRLA 1SY9A 1EG3A 2K7DA 1M63B 1UHJA 5ER5A 1QV1A 3SG5A 3BUWB 1RTP1 2Y1MA 3I5FC 4DUQA
chains in the Genus database with same CATH superfamily
2CXJA 2BKIB 2KI4C 3BUMB 1OOGA 1TWOA 4PHNA 3JTDB 4N1GA 1Y6WA 2JT3A 3NHIA 2H61C 3EKHA 5FI6A 1LS8A 2KLEA 1OMRA 3JVTC 1WLMA 2KQ6A 4I5KA 1NCXA 5DKNA 5HL1A 2LE9B 1ODBA 1H4BA 1K93D 3DF0B 2K60A 2EHBA 2ZKMX 1SYMA 1KFXS 1DJGA 5B8IB 2LVIA 1DEKA 2M8UA 2KFFA 2L2EA 1BODA 1RECA 1MR8A 3S0BA 1F4QA 1XK4A 1YRTB 3SIBA 3CABA 3I5IB 3PJIA 1BOCA 3PSRA 4ORAB 2M49B 2PYQA 3O2PA 2LM5A 1K9UA 2L51A 1OW4A 3CR2A 3LK1A 1VRKA 4PE4A 2ISDA 3GK2A 4XYNA 1K90D 2AAOA 3JTDC 5D7FA 2O60A 3KEVA 4AQJA 1NX3A 1IKUA 1M46A 5ER4X 3R72A 4KYNA 4F0ZB 2NCPA 3DD4A 1XFVO 3CZ1A 4ORBB 3GOFA 5GQQC 2LLUA 1FPWA 2PSRA 3D0YA 2K0JA 1GGZA 3VRQA 2P70A 4A4BA 3KPXA 3SS4A 1DT7B 4N1FA 3CZTX 2LUXA 1NWDA 1XO5A 1TNQA 2F3ZA 1Q80A 2WNDA 3SG7A 1IJ5A 4PDZA 4TNCA 4NDDA 4CFRA 2LLTA 2ZNEA 1UHKA 2LP2A 1DQEA 1QX7A 1N2DA 1QASA 3I5IC 3RZSA 1WY9A 1MHOA 2I7AA 1PVBA 4A4CA 4YGBB 3BFAA 5BPJA 1TNPA 2E30A 2KYFA 4F7FA 1IQ3A 1AHRA 2LUCA 3IQQA 4PHJA 3D0YB 3I5GB 2F2PA 1DMOA 1PULA 2JU0A 2WCKA 3EK8A 1LINA 2MJWB 3S0EA 1L2OB 2D8NA 1C3YA 1CDPA 1NX1A 1WRKA 1AJ4A 2JC2A 4I5NB 1QVIZ 1S5GZ 1XA5A 2M9GA 1QVIY 1S5GY 1D1OA 3BYAA 3EG5B 1C3ZA 2AMIA 3DVJA 1SBJA 2PASA 1XK4C 1MXEA 1YVLA 3BFHA 1TRFA 1YR5A 3BOWA 2Q91A 4FTGA 3Q8IA 4NDBA 1JSAA 2KAYA 3IQOA 1QTXA 1Y1AA 5KSZA 1DJYA 3BJHA 1MXLC 2M7NA 1Z2CB 2L0PA 3O6BA 2LVJA 2QEBA 4HSZA 1OOIX 2M1UA 3D78A 2NZ0A 3CTNA 1NUBA 4GFTA 3V2LA 1YVHA 2M1KB 1P28A 2PRUA 4OR9B 4BY4A 3B6XA 4MRYA 2K2FA 4IJ7A 1W7JB 2KGBC 1UUSA 2I2RE 1KFXL 2LNKA 2JPTA 3NSIA 4N5XA 1AK8A 4YGAA 3I5GC 1SL7A 2VRGA 1SSEB 4OKHA 1CDLA 3CR4X 3OBVA 1L2OC 4OVNF 3K1EA 3BOWB 4NDCA 3TDZA 3K21A 1S6JA 1YUTA 1K94A 4MZJA 5FYXA 2CBLA 1E8AA 4M2QA 1J7RA 4WQ2A 5TNCA 2FJUB 4R1EA 2BE6A 1XFUO 1IG5A 4GNKB 5DICA 1GJYA 5HKWA 1TNWA 2M29A 4YGDB 5HLOA 4ORCB 1CM4A 1CB1A 1KSMA 1OMVA 1QV0A 3ZNIA 3NHTA 4ZCVA 3TS5B 1KCYA 3OB2B 1UURA 2AUCA 2JTTA 1JUOA 2RGIA 4MRXA 1CFCA 1KFUS 1XFZO 1XFRA 3O4XA 2LMTA 1CLMA 1M45A 1SCVA 1MUXA 4GGFA 3SIAA 1KK8B 5I94A 3SG2A 1N0YA 1QIWA 1EH2A 2PALA 1ZOTB 2B1UA 1IWQA 2WCFA 3DVEA 3NGVA 1DJWA 4NQGA 2Y1NA 4USLA 4AOMA 1XFXO 3VRRA 1MF8B 1TIZA 1Z4HA 2V53A 3VB1A 2BCXA 4C0KA 2JNFA 2BCAA 2KFHA 2L2CA 3OGNA 2KLDA 2KFGA 1B1GA 1YRUB 4OCIA 3AKAA 3KF9A 1NIWA 3BUOB 3HCMA 4YI8A 3CWGA 1GQMA 4UPGA 5KU1A 4C0JA 1RJVA 2MRDA 1OSAA 1K8UA 1TUZA 3C1VA 1QLKA 3TDIA 1F54A 2M0RA 3NSKA 1B8CA 2F2OA 3DVMA 2KOTA 1PSBA 4MZKA 1CMFA 1IIOA 1IRJA 1KQVA 4FQTA 3KO0A 1DJXA 1BR4B 2EC6B 3EVUA 3TS5C 3MSEB 1KQMB 4MBEA 1QS7A 4INWA 4MVFA 4CPVA 1JFJA 3D10A 2SCPA 3H4SE 1EXRA 2IS9A 3SS3A 1J7OA 5HYDA 1CLBA 1DELA 3D76A 1V1FA 3S0AA 1LA0A 2KPHA 2CNPA 1KK8C 2M97A 1B4CA 4P2YB 4DRWA 5I2OA 1K96A 2KAXA 4JKTA 5HKZA 1K2HA 1YX7A 1C07A 3DY9A 1FI5A 1AJ5A 1DJZA 1TCFA 3CS1A 1SL8A 2NXQA 2JPOA 3FS7A 4OV2A 1PVAA 1A03A 2KYCA 5CSJA 4PE7A 1J55A 2ERBA 2M7LA 1UP5A 2JZIA 2OTGB 3GK4X 3WHUB 2NCOA 1QX2A 2WCEA 2A4JA 2JWWA 5EL2A 4PHMA 2EC6C 3DXLA 3FIAA 1BR1B 1QIVA 3LLEA 1KQMC 3CGAA 3O4YA 4IL1A 3PLFB 1WLZA 2BKHB 1KK7Z 2G2BA 5AFPA 1A29A 4AQIA 4OZDA 1FI6A 2QDIA 1WDCB 1FBVA 3SG6A 1V1GA 3LL8B 2Y4QA 4P5OE 2JULA 1KSOA 3SS5A 3CZ2A 4I5LB 1CLLA 2EGDA 1B47A 5FI2A 1K95A 2LC5A 1NP8A 1S3PA 1JF0A 1YUSA 1A75A 2LAPA 3VRPA 4L9MA 1DJHA 1NX2A 1TCOB 1JC2A 1EJ3A 3EVRA 4ETOA 1SW8A 3PN7B 3R1PA 1KFUL 5I2QA 5K89A 1PRWA 2ZRSA 1NX0A 1TN4A 1OOHA 1ORGA 1QWVA 4INXA 4DUQA 1NSHA 2OTGC 3CZ0A 1LVCD 1GM0A 2ZRTA 1G4YR 1OOJA 5CSFA 3AKBA 1A2XA 3TUYB 1QXPA 2ZN9A 5KTYA 1H8BA 3EK7A 2G9BA 4PCWA 2ZFDA 4XJKA 1AUIB 2HETA 2WCJA 4C0LA 1MQ1A 3PM2A 3EK4A 2BCBA 2BBNA 5JJGA 1WDCC 3E3RA 1A75B 2K8MB 2L4IA 5DKQA 3LK0A 5AEQA 3R1VA 2P6BB 4ICBA 2QEVA 1S6CA 5AERA 2L4HA 3FE8A 4JQ0D 1F4OA 4DS7A 2LANA 3L47A 1OE9B 3B87A 1DGVA 3TZ1A 4I5JA 3N7HA 2PQLA 1SCMB 1IH0A 1SK6D 2LVKA 1XYDA 3R1OA 1CFDA 3PN7C 2M3WA 1CNPA 1JBAA 2H2KA 1UHHA 3D77A 1J7PA 2KNEA 1SR6B 4WRIA 4PE0A 4DIRA 4GBAA 3B86A 2JNXA 3O78A 2HF5A 2SASA 4XJKB 3VRNA 1MWNA 4PALA 3S0FA 4YBHB 3WHTB 1KWOB 3TUYC 2KGRA 2GGZA 3WXAA 1OZSA 2ZNDA 5CPVA 1C7WA 2GTEA 1XVJA 2BNXA 2OS8B 1SKTA 4YI9A 1F71A 1XFYO 1HT9A 1ZMZA 1B9AA 1BU3A 1CMGA 2F33A 2JXCA 2LLSA 3RM1A 1BF5A 2LVVA 2LCPA 1DC1A 1EL4A 1EG4A 1QLSA 1SRAA 4E68A 2L5XB 1UHNA 5D69A 1F70A 5HKYA 4YGCB 2WCMA 2PMYA 5CSNA 1CTRA 1W9ZA 3QMEA 1SCMC 5JOLA 5I8NA 1RWYA 2JOJA 2CCMA 4FQOA 3I5HB 1JF2A 3PALA 1SR6C 3DVKA 5F6TA 3TDUA 3CYZA 3CDNA 4PE1A 1M31A 4GAOA 1NYAA 1S1EA 4MSPA 5D3OA 4Q04A 1NCYA 4CLNA 2DOQA 1GGWA 4BY5A 2WCHA 1JWDA 1RFJA 2BBMA 3OX6A 1CDNA 2LMVA 2LHIA 3AAJA 4WQ3A 2YGUA 5AANA 1CFFA 2I18A 3WNXB 4QJ4B 1KWOC 2K2AA 2FJYA 3FE6A 2MLEC 1BT6A 2Q4UA 2OS8C 1CFPA 3L4AA 4M2PA 3ZWHA 1K9KA 2BE4A 3BXKA 3SG3A 2QACA 1RK9A 1NCZA 2QEHA 1AVSA 1XFWO 2WC6A 4JPZB 1J1EA 1PALA 1UWOA 2BAPA 4DCKA 1M39A 5IBWA 2P71A 3VROA 3ICBA 4MLWA 1TTXA 3QRXA 4JD9A 1QATA 2JT8A 3NSLA 1TNXA 1NPQA 3NXAA 2KBIA 3B7AA 1B8LA 2JT0A 1R2UA 2WC8A 3LCPC 3UNWA 1Y1UA 1A4PA 4GPLB 4GGFC 2FOTA 3I5HC 1DGUA 3BFBA 3F45A 4D1EA 4YRUA 1IQ5A 5HLVA 1R6PA 3BQ3A 2WCBA 1SNLA 3NSOA 1G8IA 1S36A 1ZUZA 5AXIA 1KK7Y 1W7IB 4QJ5B 2HPSA 2KQYA 2Y5IA 2WC5A 1IJ6A 1OMDA 1DJIA 1FW4A 1DF0A 1BJFA 5CSIA 2F3YA 1DVIA 2GGMA 1PSRA 2HQWA 2KI6C 2LMUA 3DYEA 4PT1A 4ZCUA 2WOSA 5I2LA 1K9PA 1Y1XA 2K7OA 3OB1B 1X02A 4HRHA 3SJSA 4U8DA 1S6IA 3D75A 1AP4A 3S0DA 3IF7A 1T14A 1LA3A 2PVBA 2CT9A 3L4LA 3FWBA 1ZACA 3FE9A 1B8RA 2E6WA 2L50A 3M0WA 1Y0VH 2R2IA 2JRFA 3VGOA 2H61A 2LV7A 2LHLA 2WORA 1CKKA 1JFKA 1BLQA 1YX8A 1OOFA 1OQPA 3S0GA 1BG1A 5G08A 2KBMA 1BMOA 2FCEA 4GGNA 4JWQA 4MEWA 2KI6D 3UO9A 2BL0B 2LP3A 4MN0A 1C7VA 1J7QA 1G33A 1DF0B 2KHNA 2TN4A 2O5GA 4CIDA 2CTNA 1SL9A 1QX5B 2JQ6A 2OPOA 1SPYA 1YTZC 3AAKA 1FF1A 1U5IA 2GV5A 2H8VA 1CDMA 2BECA 1DTLA 3I5FB 2JXLA 3OX5A 2KSPA 1CM1A 1YUUA 1B7TZ 1UHIA 2KI4B 3EVVA 1B7TY 3A4UB 1RROA 2COLB 4MZLA 2MAZA 1J1DA 1N65A 3GK1A 1L7ZA 5FI7A 1SMGA 5PALA 3SG4A 4QJ3B 2KAVA 2HQ8A 4GUKA 1F55A 1LKJA 4CFQA 2L98A 2K7BA 3KHEA 2I94A 4HRGA 1PK0D 3JVTB 3PATA 1WRZA 2JTZA 1LXFC 2MHHA 2MLFC 5DKRA 1ZFSA 3A8RA 3CR5X 3BUNB 1OZOA 2QEOA 2K61A 3EKJA 3PFVA 4PHKA 2ZN8A 1IGVA 1S26D 3OHMB 2F8PA 1F8HA 1QJTA 1U5IB 2K7CA 3CLNA 3D73A 1ALVA 2MBXA 2MA2A 3FWCA 5J3XA 3B88A 3PM8A 4M2OA 3RLZA 1TOPA 1HQVA 2BL0C 2L5YA 2QPTA 2WCLA 3BUXB 2KDHA 2NLNA 3D74A 1ALWA 3DZTA 4HREE 3DF0A 1YURA 3OP0A 4YGEB 2FCDA 3HX4A 1WRLA 1TUJA 1SY9A 1EG3A 2K7DA 1M63B 1UHJA 5ER5A 1QV1A 3SG5A 3BUWB 1RTP1 2Y1MA 3I5FC 3IVTA
chains in the Genus database with same CATH topology
2CXJA 2BKIB 2KI4C 3BUMB 4PHNA 3JTDB 4N1GA 1Y6WA 2JT3A 2H61C 3EKHA 1OMRA 3JVTC 1WLMA 2KQ6A 4I5KA 1NCXA 5DKNA 2LE9B 1ODBA 1H4BA 1K93D 3DF0B 2EHBA 2ZKMX 1SYMA 1KFXS 1DJGA 5B8IB 2LVIA 2M8UA 2KFFA 2L2EA 1BODA 1RECA 1MR8A 1F4QA 1XK4A 1YRTB 3SIBA 3I5IB 1BOCA 3PSRA 4ORAB 2M49B 3O2PA 2LM5A 1K9UA 2L51A 3CR2A 3LK1A 1VRKA 4PE4A 2ISDA 3GK2A 4XYNA 1K90D 2AAOA 3JTDC 5D7FA 2O60A 3KEVA 4AQJA 1NX3A 1IKUA 1M46A 5ER4X 4F0ZB 2NCPA 3DD4A 1XFVO 4ORBB 3GOFA 5GQQC 2LLUA 1FPWA 2PSRA 3D0YA 2K0JA 1GGZA 3VRQA 4A4BA 3KPXA 1DT7B 4N1FA 3CZTX 2LUXA 1NWDA 1XO5A 1TNQA 2F3ZA 1Q80A 2WNDA 3SG7A 1IJ5A 4PDZA 4TNCA 4NDDA 4CFRA 2LLTA 2ZNEA 1UHKA 2LP2A 1QX7A 1N2DA 1QASA 3I5IC 1WY9A 1MHOA 2I7AA 1PVBA 4A4CA 4YGBB 5BPJA 1TNPA 2E30A 2KYFA 1IQ3A 1AHRA 2LUCA 3IQQA 4PHJA 3D0YB 3I5GB 2F2PA 1DMOA 1PULA 2JU0A 3EK8A 1LINA 2MJWB 1L2OB 2D8NA 1CDPA 1NX1A 1WRKA 1AJ4A 2JC2A 4I5NB 1QVIZ 1S5GZ 1XA5A 2M9GA 1QVIY 1S5GY 1D1OA 3BYAA 2AMIA 3DVJA 1SBJA 2PASA 1XK4C 1MXEA 1YVLA 1TRFA 1YR5A 3BOWA 2Q91A 4FTGA 4NDBA 1JSAA 2KAYA 3IQOA 1QTXA 1Y1AA 5KSZA 1DJYA 1MXLC 2M7NA 2L0PA 3O6BA 2LVJA 4HSZA 2M1UA 2NZ0A 3CTNA 1NUBA 4GFTA 1YVHA 2M1KB 4BY4A 2PRUA 4OR9B 4MRYA 2K2FA 1W7JB 2KGBC 1UUSA 2I2RE 1KFXL 2LNKA 2JPTA 3NSIA 4N5XA 1AK8A 4YGAA 3I5GC 1SL7A 2VRGA 4OKHA 1CDLA 3CR4X 1L2OC 4OVNF 3BOWB 4NDCA 3TDZA 3K21A 1S6JA 1YUTA 1K94A 4MZJA 5FYXA 2CBLA 1E8AA 4M2QA 1J7RA 4WQ2A 5TNCA 2FJUB 4R1EA 2BE6A 1XFUO 1IG5A 4GNKB 1GJYA 5HKWA 1TNWA 2M29A 4YGDB 5HLOA 4ORCB 1CM4A 1CB1A 1KSMA 1OMVA 1QV0A 3ZNIA 3TS5B 4ZCVA 1KCYA 3OB2B 1UURA 2AUCA 2JTTA 1JUOA 2RGIA 4MRXA 1CFCA 1KFUS 1XFZO 2LMTA 1CLMA 1M45A 1SCVA 1MUXA 4GGFA 3SIAA 1KK8B 3SG2A 1N0YA 1QIWA 1EH2A 2PALA 1ZOTB 2B1UA 1IWQA 2WCFA 3DVEA 4NQGA 1DJWA 2Y1NA 4USLA 4AOMA 1XFXO 3VRRA 1MF8B 1TIZA 2V53A 2BCXA 4C0KA 2JNFA 2BCAA 2KFHA 2KFGA 1B1GA 1YRUB 4OCIA 3AKAA 3KF9A 1NIWA 3BUOB 3HCMA 4YI8A 3CWGA 1GQMA 4UPGA 5KU1A 4C0JA 1RJVA 2MRDA 1OSAA 1K8UA 3C1VA 3TDIA 1QLKA 1F54A 2M0RA 3NSKA 1B8CA 2F2OA 3DVMA 2KOTA 1PSBA 4MZKA 1CMFA 1IRJA 1KQVA 3KO0A 1DJXA 1BR4B 2EC6B 3EVUA 3TS5C 3MSEB 1KQMB 4MBEA 1QS7A 4MVFA 4CPVA 1JFJA 3D10A 2SCPA 3H4SE 1EXRA 2IS9A 1J7OA 5HYDA 1CLBA 1V1FA 1LA0A 2CNPA 1KK8C 2M97A 1B4CA 4P2YB 4DRWA 5I2OA 1K96A 2KAXA 5HKZA 1K2HA 1YX7A 1C07A 1FI5A 1AJ5A 1DJZA 1TCFA 3CS1A 1SL8A 2NXQA 3FS7A 4OV2A 1PVAA 1A03A 2KYCA 5CSJA 4PE7A 1J55A 2M7LA 1UP5A 2JZIA 2OTGB 3GK4X 3WHUB 2NCOA 1QX2A 2WCEA 2A4JA 2JWWA 4PHMA 2EC6C 3FIAA 1BR1B 1QIVA 3LLEA 1KQMC 3CGAA 3O4YA 4IL1A 3PLFB 1WLZA 2BKHB 1KK7Z 2G2BA 5AFPA 1A29A 4AQIA 1FI6A 1WDCB 1FBVA 3SG6A 1V1GA 3LL8B 2Y4QA 4P5OE 2JULA 1KSOA 4I5LB 1CLLA 2EGDA 1B47A 1K95A 2LC5A 1NP8A 1S3PA 1JF0A 1YUSA 1A75A 2LAPA 3VRPA 4L9MA 1DJHA 1NX2A 1TCOB 1JC2A 1EJ3A 3EVRA 4ETOA 1SW8A 3PN7B 5K89A 1KFUL 5I2QA 1PRWA 2ZRSA 1NX0A 1TN4A 1NSHA 2OTGC 1LVCD 2ZRTA 1G4YR 1OOJA 5CSFA 3AKBA 1A2XA 3TUYB 1QXPA 2ZN9A 5KTYA 1H8BA 3EK7A 2G9BA 4PCWA 2ZFDA 4XJKA 1AUIB 2HETA 4C0LA 1MQ1A 3EK4A 2BCBA 2BBNA 5JJGA 1WDCC 3E3RA 1A75B 2K8MB 2L4IA 5DKQA 3LK0A 5AEQA 4ICBA 2P6BB 5AERA 1S6CA 2L4HA 4JQ0D 1F4OA 4DS7A 2LANA 3TZ1A 1OE9B 1DGVA 4I5JA 1SCMB 1IH0A 1SK6D 2LVKA 1XYDA 1JBAA 1CFDA 3PN7C 2M3WA 1CNPA 2H2KA 1UHHA 1J7PA 2KNEA 1SR6B 4WRIA 4PE0A 4DIRA 4GBAA 2JNXA 3O78A 2HF5A 2SASA 4XJKB 3VRNA 1MWNA 4PALA 4YBHB 3WHTB 1KWOB 3TUYC 2KGRA 2GGZA 3WXAA 1OZSA 2ZNDA 5CPVA 1C7WA 2OS8B 1XVJA 4YI9A 1F71A 1SKTA 1XFYO 1HT9A 1ZMZA 1B9AA 1BU3A 1CMGA 2F33A 2JXCA 2LLSA 3RM1A 1BF5A 2LVVA 2LCPA 1EL4A 1EG4A 1QLSA 1SRAA 4E68A 2L5XB 1UHNA 5D69A 1F70A 5HKYA 4YGCB 2PMYA 5CSNA 1CTRA 1SCMC 5JOLA 5I8NA 1RWYA 2JOJA 2CCMA 4FQOA 3I5HB 1JF2A 3PALA 1SR6C 3DVKA 5F6TA 3TDUA 4PE1A 1M31A 4GAOA 1NYAA 1S1EA 4MSPA 4Q04A 1NCYA 4CLNA 2DOQA 1GGWA 4BY5A 1JWDA 1RFJA 2BBMA 3OX6A 1CDNA 2LMVA 2LHIA 3AAJA 4WQ3A 5AANA 1CFFA 2I18A 3WNXB 4QJ4B 1KWOC 2K2AA 2MLEC 1BT6A 2Q4UA 2OS8C 1CFPA 4M2PA 3ZWHA 1K9KA 2BE4A 3BXKA 3SG3A 2QACA 1RK9A 1NCZA 4JPZB 1AVSA 1XFWO 4DCKA 1J1EA 1PALA 1UWOA 1M39A 5IBWA 3VROA 3ICBA 4MLWA 1TTXA 3QRXA 1QATA 2JT8A 3NSLA 1TNXA 1NPQA 3NXAA 2KBIA 1B8LA 2JT0A 1R2UA 2WC8A 3LCPC 1Y1UA 1A4PA 4GPLB 4GGFC 2FOTA 3I5HC 1DGUA 3F45A 4D1EA 4YRUA 1IQ5A 5HLVA 1R6PA 3BQ3A 2WCBA 1SNLA 3NSOA 1G8IA 1S36A 1ZUZA 5AXIA 1KK7Y 1W7IB 4QJ5B 2HPSA 2KQYA 2Y5IA 1IJ6A 1OMDA 1DJIA 1FW4A 1DF0A 1BJFA 5CSIA 2F3YA 1DVIA 2GGMA 1PSRA 2HQWA 2KI6C 2LMUA 4ZCUA 2WOSA 5I2LA 1K9PA 1Y1XA 2K7OA 3OB1B 1X02A 4HRHA 3SJSA 4U8DA 1S6IA 1AP4A 3IF7A 1LA3A 2PVBA 2CT9A 3FWBA 1ZACA 1B8RA 2E6WA 2L50A 3M0WA 1Y0VH 2R2IA 2JRFA 3VGOA 2H61A 2LV7A 2LHLA 2WORA 1CKKA 1JFKA 1BLQA 1YX8A 1OQPA 1BG1A 5G08A 2KBMA 1BMOA 2FCEA 4GGNA 4JWQA 4MEWA 2KI6D 2BL0B 2LP3A 4MN0A 1C7VA 1J7QA 1G33A 1DF0B 2KHNA 2TN4A 2O5GA 4CIDA 2CTNA 1SL9A 1QX5B 2JQ6A 2OPOA 1SPYA 1YTZC 3AAKA 1FF1A 1U5IA 2GV5A 1CDMA 2BECA 1DTLA 3I5FB 2JXLA 3OX5A 2KSPA 1CM1A 1YUUA 1B7TZ 1UHIA 2KI4B 3EVVA 1B7TY 3A4UB 1RROA 2COLB 4MZLA 2MAZA 1J1DA 1N65A 3GK1A 1L7ZA 5PALA 1SMGA 3SG4A 4QJ3B 2KAVA 2HQ8A 4GUKA 1F55A 1LKJA 4CFQA 2L98A 2K7BA 3KHEA 2I94A 4HRGA 1PK0D 3JVTB 3PATA 1WRZA 2JTZA 1LXFC 2MHHA 2MLFC 5DKRA 1ZFSA 3A8RA 3CR5X 3BUNB 1OZOA 2K61A 3EKJA 3PFVA 4PHKA 2ZN8A 1IGVA 1S26D 3OHMB 2F8PA 1F8HA 1QJTA 1U5IB 2K7CA 3CLNA 2MBXA 1ALVA 2MA2A 3FWCA 5J3XA 3PM8A 3RLZA 4M2OA 1TOPA 1HQVA 2BL0C 2QPTA 3BUXB 2KDHA 2NLNA 4HREE 1ALWA 3DF0A 1YURA 3OP0A 4YGEB 2FCDA 3HX4A 1WRLA 1SY9A 1EG3A 2K7DA 1M63B 1UHJA 5ER5A 1QV1A 3SG5A 3BUWB 1RTP1 2Y1MA 3I5FC 4DUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXJ A;  2BKI B;  2KI4 C;  3BUM B;  4PHN A;  3JTD B;  4N1G A;  1Y6W A;  2JT3 A;  2H61 C;  3EKH A;  1OMR A;  3JVT C;  1WLM A;  2KQ6 A;  4I5K A;  1NCX A;  5DKN A;  2LE9 B;  1ODB A;  1H4B A;  1K93 D;  3DF0 B;  2EHB A;  2ZKM X;  1SYM A;  1KFX S;  1DJG A;  5B8I B;  2LVI A;  2M8U A;  2KFF A;  2L2E A;  1BOD A;  1REC A;  1MR8 A;  1F4Q A;  1XK4 A;  1YRT B;  3SIB A;  3I5I B;  1BOC A;  3PSR A;  4ORA B;  2M49 B;  3O2P A;  2LM5 A;  1K9U A;  2L51 A;  3CR2 A;  3LK1 A;  1VRK A;  4PE4 A;  2ISD A;  3GK2 A;  4XYN A;  1K90 D;  2AAO A;  3JTD C;  5D7F A;  2O60 A;  3KEV A;  4AQJ A;  1NX3 A;  1IKU A;  1M46 A;  5ER4 X;  4F0Z B;  2NCP A;  3DD4 A;  1XFV O;  4ORB B;  3GOF A;  5GQQ C;  2LLU A;  1FPW A;  2PSR A;  3D0Y A;  2K0J A;  1GGZ A;  3VRQ A;  4A4B A;  3KPX A;  1DT7 B;  4N1F A;  3CZT X;  2LUX A;  1NWD A;  1XO5 A;  1TNQ A;  2F3Z A;  1Q80 A;  2WND A;  3SG7 A;  1IJ5 A;  4PDZ A;  4TNC A;  4NDD A;  4CFR A;  2LLT A;  2ZNE A;  1UHK A;  2LP2 A;  1QX7 A;  1N2D A;  1QAS A;  3I5I C;  1WY9 A;  1MHO A;  2I7A A;  1PVB A;  4A4C A;  4YGB B;  5BPJ A;  1TNP A;  2E30 A;  2KYF A;  1IQ3 A;  1AHR A;  2LUC A;  3IQQ A;  4PHJ A;  3D0Y B;  3I5G B;  2F2P A;  1DMO A;  1PUL A;  2JU0 A;  3EK8 A;  1LIN A;  2MJW B;  1L2O B;  2D8N A;  1CDP A;  1NX1 A;  1WRK A;  1AJ4 A;  2JC2 A;  4I5N B;  1QVI Z;  1S5G Z;  1XA5 A;  2M9G A;  1QVI Y;  1S5G Y;  1D1O A;  3BYA A;  2AMI A;  3DVJ A;  1SBJ A;  2PAS A;  1XK4 C;  1MXE A;  1YVL A;  1TRF A;  1YR5 A;  3BOW A;  2Q91 A;  4FTG A;  4NDB A;  1JSA A;  2KAY A;  3IQO A;  1QTX A;  1Y1A A;  5KSZ A;  1DJY A;  1MXL C;  2M7N A;  2L0P A;  3O6B A;  2LVJ A;  4HSZ A;  2M1U A;  2NZ0 A;  3CTN A;  1NUB A;  4GFT A;  1YVH A;  2M1K B;  4BY4 A;  2PRU A;  4OR9 B;  4MRY A;  2K2F A;  1W7J B;  2KGB C;  1UUS A;  2I2R E;  1KFX L;  2LNK A;  2JPT A;  3NSI A;  4N5X A;  1AK8 A;  4YGA A;  3I5G C;  1SL7 A;  2VRG A;  4OKH A;  1CDL A;  3CR4 X;  1L2O C;  4OVN F;  3BOW B;  4NDC A;  3TDZ A;  3K21 A;  1S6J A;  1YUT A;  1K94 A;  4MZJ A;  5FYX A;  2CBL A;  1E8A A;  4M2Q A;  1J7R A;  4WQ2 A;  5TNC A;  2FJU B;  4R1E A;  2BE6 A;  1XFU O;  1IG5 A;  4GNK B;  1GJY A;  5HKW A;  1TNW A;  2M29 A;  4YGD B;  5HLO A;  4ORC B;  1CM4 A;  1CB1 A;  1KSM A;  1OMV A;  1QV0 A;  3ZNI A;  3TS5 B;  4ZCV A;  1KCY A;  3OB2 B;  1UUR A;  2AUC A;  2JTT A;  1JUO A;  2RGI A;  4MRX A;  1CFC A;  1KFU S;  1XFZ O;  2LMT A;  1CLM A;  1M45 A;  1SCV A;  1MUX A;  4GGF A;  3SIA A;  1KK8 B;  3SG2 A;  1N0Y A;  1QIW A;  1EH2 A;  2PAL A;  1ZOT B;  2B1U A;  1IWQ A;  2WCF A;  3DVE A;  4NQG A;  1DJW A;  2Y1N A;  4USL A;  4AOM A;  1XFX O;  3VRR A;  1MF8 B;  1TIZ A;  2V53 A;  2BCX A;  4C0K A;  2JNF A;  2BCA A;  2KFH A;  2KFG A;  1B1G A;  1YRU B;  4OCI A;  3AKA A;  3KF9 A;  1NIW A;  3BUO B;  3HCM A;  4YI8 A;  3CWG A;  1GQM A;  4UPG A;  5KU1 A;  4C0J A;  1RJV A;  2MRD A;  1OSA A;  1K8U A;  3C1V A;  3TDI A;  1QLK A;  1F54 A;  2M0R A;  3NSK A;  1B8C A;  2F2O A;  3DVM A;  2KOT A;  1PSB A;  4MZK A;  1CMF A;  1IRJ A;  1KQV A;  3KO0 A;  1DJX A;  1BR4 B;  2EC6 B;  3EVU A;  3TS5 C;  3MSE B;  1KQM B;  4MBE A;  1QS7 A;  4MVF A;  4CPV A;  1JFJ A;  3D10 A;  2SCP A;  3H4S E;  1EXR A;  2IS9 A;  1J7O A;  5HYD A;  1CLB A;  1V1F A;  1LA0 A;  2CNP A;  1KK8 C;  2M97 A;  1B4C A;  4P2Y B;  4DRW A;  5I2O A;  1K96 A;  2KAX A;  5HKZ A;  1K2H A;  1YX7 A;  1C07 A;  1FI5 A;  1AJ5 A;  1DJZ A;  1TCF A;  3CS1 A;  1SL8 A;  2NXQ A;  3FS7 A;  4OV2 A;  1PVA A;  1A03 A;  2KYC A;  5CSJ A;  4PE7 A;  1J55 A;  2M7L A;  1UP5 A;  2JZI A;  2OTG B;  3GK4 X;  3WHU B;  2NCO A;  1QX2 A;  2WCE A;  2A4J A;  2JWW A;  4PHM A;  2EC6 C;  3FIA A;  1BR1 B;  1QIV A;  3LLE A;  1KQM C;  3CGA A;  3O4Y A;  4IL1 A;  3PLF B;  1WLZ A;  2BKH B;  1KK7 Z;  2G2B A;  5AFP A;  1A29 A;  4AQI A;  1FI6 A;  1WDC B;  1FBV A;  3SG6 A;  1V1G A;  3LL8 B;  2Y4Q A;  4P5O E;  2JUL A;  1KSO A;  4I5L B;  1CLL A;  2EGD A;  1B47 A;  1K95 A;  2LC5 A;  1NP8 A;  1S3P A;  1JF0 A;  1YUS A;  1A75 A;  2LAP A;  3VRP A;  4L9M A;  1DJH A;  1NX2 A;  1TCO B;  1JC2 A;  1EJ3 A;  3EVR A;  4ETO A;  1SW8 A;  3PN7 B;  5K89 A;  1KFU L;  5I2Q A;  1PRW A;  2ZRS A;  1NX0 A;  1TN4 A;  1NSH A;  2OTG C;  1LVC D;  2ZRT A;  1G4Y R;  1OOJ A;  5CSF A;  3AKB A;  1A2X A;  3TUY B;  1QXP A;  2ZN9 A;  5KTY A;  1H8B A;  3EK7 A;  2G9B A;  4PCW A;  2ZFD A;  4XJK A;  1AUI B;  2HET A;  4C0L A;  1MQ1 A;  3EK4 A;  2BCB A;  2BBN A;  5JJG A;  1WDC C;  3E3R A;  1A75 B;  2K8M B;  2L4I A;  5DKQ A;  3LK0 A;  5AEQ A;  4ICB A;  2P6B B;  5AER A;  1S6C A;  2L4H A;  4JQ0 D;  1F4O A;  4DS7 A;  2LAN A;  3TZ1 A;  1OE9 B;  1DGV A;  4I5J A;  1SCM B;  1IH0 A;  1SK6 D;  2LVK A;  1XYD A;  1JBA A;  1CFD A;  3PN7 C;  2M3W A;  1CNP A;  2H2K A;  1UHH A;  1J7P A;  2KNE A;  1SR6 B;  4WRI A;  4PE0 A;  4DIR A;  4GBA A;  2JNX A;  3O78 A;  2HF5 A;  2SAS A;  4XJK B;  3VRN A;  1MWN A;  4PAL A;  4YBH B;  3WHT B;  1KWO B;  3TUY C;  2KGR A;  2GGZ A;  3WXA A;  1OZS A;  2ZND A;  5CPV A;  1C7W A;  2OS8 B;  1XVJ A;  4YI9 A;  1F71 A;  1SKT A;  1XFY O;  1HT9 A;  1ZMZ A;  1B9A A;  1BU3 A;  1CMG A;  2F33 A;  2JXC A;  2LLS A;  3RM1 A;  1BF5 A;  2LVV A;  2LCP A;  1EL4 A;  1EG4 A;  1QLS A;  1SRA A;  4E68 A;  2L5X B;  1UHN A;  5D69 A;  1F70 A;  5HKY A;  4YGC B;  2PMY A;  5CSN A;  1CTR A;  1SCM C;  5JOL A;  5I8N A;  1RWY A;  2JOJ A;  2CCM A;  4FQO A;  3I5H B;  1JF2 A;  3PAL A;  1SR6 C;  3DVK A;  5F6T A;  3TDU A;  4PE1 A;  1M31 A;  4GAO A;  1NYA A;  1S1E A;  4MSP A;  4Q04 A;  1NCY A;  4CLN A;  2DOQ A;  1GGW A;  4BY5 A;  1JWD A;  1RFJ A;  2BBM A;  3OX6 A;  1CDN A;  2LMV A;  2LHI A;  3AAJ A;  4WQ3 A;  5AAN A;  1CFF A;  2I18 A;  3WNX B;  4QJ4 B;  1KWO C;  2K2A A;  2MLE C;  1BT6 A;  2Q4U A;  2OS8 C;  1CFP A;  4M2P A;  3ZWH A;  1K9K A;  2BE4 A;  3BXK A;  3SG3 A;  2QAC A;  1RK9 A;  1NCZ A;  4JPZ B;  1AVS A;  1XFW O;  4DCK A;  1J1E A;  1PAL A;  1UWO A;  1M39 A;  5IBW A;  3VRO A;  3ICB A;  4MLW A;  1TTX A;  3QRX A;  1QAT A;  2JT8 A;  3NSL A;  1TNX A;  1NPQ A;  3NXA A;  2KBI A;  1B8L A;  2JT0 A;  1R2U A;  2WC8 A;  3LCP C;  1Y1U A;  1A4P A;  4GPL B;  4GGF C;  2FOT A;  3I5H C;  1DGU A;  3F45 A;  4D1E A;  4YRU A;  1IQ5 A;  5HLV A;  1R6P A;  3BQ3 A;  2WCB A;  1SNL A;  3NSO A;  1G8I A;  1S36 A;  1ZUZ A;  5AXI A;  1KK7 Y;  1W7I B;  4QJ5 B;  2HPS A;  2KQY A;  2Y5I A;  1IJ6 A;  1OMD A;  1DJI A;  1FW4 A;  1DF0 A;  1BJF A;  5CSI A;  2F3Y A;  1DVI A;  2GGM A;  1PSR A;  2HQW A;  2KI6 C;  2LMU A;  4ZCU A;  2WOS A;  5I2L A;  1K9P A;  1Y1X A;  2K7O A;  3OB1 B;  1X02 A;  4HRH A;  3SJS A;  4U8D A;  1S6I A;  1AP4 A;  3IF7 A;  1LA3 A;  2PVB A;  2CT9 A;  3FWB A;  1ZAC A;  1B8R A;  2E6W A;  2L50 A;  3M0W A;  1Y0V H;  2R2I A;  2JRF A;  3VGO A;  2H61 A;  2LV7 A;  2LHL A;  2WOR A;  1CKK A;  1JFK A;  1BLQ A;  1YX8 A;  1OQP A;  1BG1 A;  5G08 A;  2KBM A;  1BMO A;  2FCE A;  4GGN A;  4JWQ A;  4MEW A;  2KI6 D;  2BL0 B;  2LP3 A;  4MN0 A;  1C7V A;  1J7Q A;  1G33 A;  1DF0 B;  2KHN A;  2TN4 A;  2O5G A;  4CID A;  2CTN A;  1SL9 A;  1QX5 B;  2JQ6 A;  2OPO A;  1SPY A;  1YTZ C;  3AAK A;  1FF1 A;  1U5I A;  2GV5 A;  1CDM A;  2BEC A;  1DTL A;  3I5F B;  2JXL A;  3OX5 A;  2KSP A;  1CM1 A;  1YUU A;  1B7T Z;  1UHI A;  2KI4 B;  3EVV A;  1B7T Y;  3A4U B;  1RRO A;  2COL B;  4MZL A;  2MAZ A;  1J1D A;  1N65 A;  3GK1 A;  1L7Z A;  5PAL A;  1SMG A;  3SG4 A;  4QJ3 B;  2KAV A;  2HQ8 A;  4GUK A;  1F55 A;  1LKJ A;  4CFQ A;  2L98 A;  2K7B A;  3KHE A;  2I94 A;  4HRG A;  1PK0 D;  3JVT B;  3PAT A;  1WRZ A;  2JTZ A;  1LXF C;  2MHH A;  2MLF C;  5DKR A;  1ZFS A;  3A8R A;  3CR5 X;  3BUN B;  1OZO A;  2K61 A;  3EKJ A;  3PFV A;  4PHK A;  2ZN8 A;  1IGV A;  1S26 D;  3OHM B;  2F8P A;  1F8H A;  1QJT A;  1U5I B;  2K7C A;  3CLN A;  2MBX A;  1ALV A;  2MA2 A;  3FWC A;  5J3X A;  3PM8 A;  3RLZ A;  4M2O A;  1TOP A;  1HQV A;  2BL0 C;  2QPT A;  3BUX B;  2KDH A;  2NLN A;  4HRE E;  1ALW A;  3DF0 A;  1YUR A;  3OP0 A;  4YGE B;  2FCD A;  3HX4 A;  1WRL A;  1SY9 A;  1EG3 A;  2K7D A;  1M63 B;  1UHJ A;  5ER5 A;  1QV1 A;  3SG5 A;  3BUW B;  1RTP 1;  2Y1M A;  3I5F C;  4DUQ A; 
#chains in the Genus database with same CATH topology
 2CXJ A;  2BKI B;  2KI4 C;  3BUM B;  1OOG A;  1TWO A;  4PHN A;  3JTD B;  4N1G A;  1Y6W A;  2JT3 A;  3NHI A;  2H61 C;  3EKH A;  5FI6 A;  1LS8 A;  2KLE A;  1OMR A;  3JVT C;  1WLM A;  2KQ6 A;  4I5K A;  1NCX A;  5DKN A;  5HL1 A;  2LE9 B;  1ODB A;  1H4B A;  1K93 D;  3DF0 B;  2K60 A;  2EHB A;  2ZKM X;  1SYM A;  1KFX S;  1DJG A;  5B8I B;  2LVI A;  1DEK A;  2M8U A;  2KFF A;  2L2E A;  1BOD A;  1REC A;  1MR8 A;  3S0B A;  1F4Q A;  1XK4 A;  1YRT B;  3SIB A;  3CAB A;  3I5I B;  3PJI A;  1BOC A;  3PSR A;  4ORA B;  2M49 B;  2PYQ A;  3O2P A;  2LM5 A;  1K9U A;  2L51 A;  1OW4 A;  3CR2 A;  3LK1 A;  1VRK A;  4PE4 A;  2ISD A;  3GK2 A;  4XYN A;  1K90 D;  2AAO A;  3JTD C;  5D7F A;  2O60 A;  3KEV A;  4AQJ A;  1NX3 A;  1IKU A;  1M46 A;  5ER4 X;  3R72 A;  4KYN A;  4F0Z B;  2NCP A;  3DD4 A;  1XFV O;  3CZ1 A;  4ORB B;  3GOF A;  5GQQ C;  2LLU A;  1FPW A;  2PSR A;  3D0Y A;  2K0J A;  1GGZ A;  3VRQ A;  2P70 A;  4A4B A;  3KPX A;  3SS4 A;  1DT7 B;  4N1F A;  3CZT X;  2LUX A;  1NWD A;  1XO5 A;  1TNQ A;  2F3Z A;  1Q80 A;  2WND A;  3SG7 A;  1IJ5 A;  4PDZ A;  4TNC A;  4NDD A;  4CFR A;  2LLT A;  2ZNE A;  1UHK A;  2LP2 A;  1DQE A;  1QX7 A;  1N2D A;  1QAS A;  3I5I C;  3RZS A;  1WY9 A;  1MHO A;  2I7A A;  1PVB A;  4A4C A;  4YGB B;  3BFA A;  5BPJ A;  1TNP A;  2E30 A;  2KYF A;  4F7F A;  1IQ3 A;  1AHR A;  2LUC A;  3IQQ A;  4PHJ A;  3D0Y B;  3I5G B;  2F2P A;  1DMO A;  1PUL A;  2JU0 A;  2WCK A;  3EK8 A;  1LIN A;  2MJW B;  3S0E A;  1L2O B;  2D8N A;  1C3Y A;  1CDP A;  1NX1 A;  1WRK A;  1AJ4 A;  2JC2 A;  4I5N B;  1QVI Z;  1S5G Z;  1XA5 A;  2M9G A;  1QVI Y;  1S5G Y;  1D1O A;  3BYA A;  3EG5 B;  1C3Z A;  2AMI A;  3DVJ A;  1SBJ A;  2PAS A;  1XK4 C;  1MXE A;  1YVL A;  3BFH A;  1TRF A;  1YR5 A;  3BOW A;  2Q91 A;  4FTG A;  3Q8I A;  4NDB A;  1JSA A;  2KAY A;  3IQO A;  1QTX A;  1Y1A A;  5KSZ A;  1DJY A;  3BJH A;  1MXL C;  2M7N A;  1Z2C B;  2L0P A;  3O6B A;  2LVJ A;  2QEB A;  4HSZ A;  1OOI X;  2M1U A;  3D78 A;  2NZ0 A;  3CTN A;  1NUB A;  4GFT A;  3V2L A;  1YVH A;  2M1K B;  1P28 A;  2PRU A;  4OR9 B;  4BY4 A;  3B6X A;  4MRY A;  2K2F A;  4IJ7 A;  1W7J B;  2KGB C;  1UUS A;  2I2R E;  1KFX L;  2LNK A;  2JPT A;  3NSI A;  4N5X A;  1AK8 A;  4YGA A;  3I5G C;  1SL7 A;  2VRG A;  1SSE B;  4OKH A;  1CDL A;  3CR4 X;  3OBV A;  1L2O C;  4OVN F;  3K1E A;  3BOW B;  4NDC A;  3TDZ A;  3K21 A;  1S6J A;  1YUT A;  1K94 A;  4MZJ A;  5FYX A;  2CBL A;  1E8A A;  4M2Q A;  1J7R A;  4WQ2 A;  5TNC A;  2FJU B;  4R1E A;  2BE6 A;  1XFU O;  1IG5 A;  4GNK B;  5DIC A;  1GJY A;  5HKW A;  1TNW A;  2M29 A;  4YGD B;  5HLO A;  4ORC B;  1CM4 A;  1CB1 A;  1KSM A;  1OMV A;  1QV0 A;  3ZNI A;  3NHT A;  4ZCV A;  3TS5 B;  1KCY A;  3OB2 B;  1UUR A;  2AUC A;  2JTT A;  1JUO A;  2RGI A;  4MRX A;  1CFC A;  1KFU S;  1XFZ O;  1XFR A;  3O4X A;  2LMT A;  1CLM A;  1M45 A;  1SCV A;  1MUX A;  4GGF A;  3SIA A;  1KK8 B;  5I94 A;  3SG2 A;  1N0Y A;  1QIW A;  1EH2 A;  2PAL A;  1ZOT B;  2B1U A;  1IWQ A;  2WCF A;  3DVE A;  3NGV A;  1DJW A;  4NQG A;  2Y1N A;  4USL A;  4AOM A;  1XFX O;  3VRR A;  1MF8 B;  1TIZ A;  1Z4H A;  2V53 A;  3VB1 A;  2BCX A;  4C0K A;  2JNF A;  2BCA A;  2KFH A;  2L2C A;  3OGN A;  2KLD A;  2KFG A;  1B1G A;  1YRU B;  4OCI A;  3AKA A;  3KF9 A;  1NIW A;  3BUO B;  3HCM A;  4YI8 A;  3CWG A;  1GQM A;  4UPG A;  5KU1 A;  4C0J A;  1RJV A;  2MRD A;  1OSA A;  1K8U A;  1TUZ A;  3C1V A;  1QLK A;  3TDI A;  1F54 A;  2M0R A;  3NSK A;  1B8C A;  2F2O A;  3DVM A;  2KOT A;  1PSB A;  4MZK A;  1CMF A;  1IIO A;  1IRJ A;  1KQV A;  4FQT A;  3KO0 A;  1DJX A;  1BR4 B;  2EC6 B;  3EVU A;  3TS5 C;  3MSE B;  1KQM B;  4MBE A;  1QS7 A;  4INW A;  4MVF A;  4CPV A;  1JFJ A;  3D10 A;  2SCP A;  3H4S E;  1EXR A;  2IS9 A;  3SS3 A;  1J7O A;  5HYD A;  1CLB A;  1DEL A;  3D76 A;  1V1F A;  3S0A A;  1LA0 A;  2KPH A;  2CNP A;  1KK8 C;  2M97 A;  1B4C A;  4P2Y B;  4DRW A;  5I2O A;  1K96 A;  2KAX A;  4JKT A;  5HKZ A;  1K2H A;  1YX7 A;  1C07 A;  3DY9 A;  1FI5 A;  1AJ5 A;  1DJZ A;  1TCF A;  3CS1 A;  1SL8 A;  2NXQ A;  2JPO A;  3FS7 A;  4OV2 A;  1PVA A;  1A03 A;  2KYC A;  5CSJ A;  4PE7 A;  1J55 A;  2ERB A;  2M7L A;  1UP5 A;  2JZI A;  2OTG B;  3GK4 X;  3WHU B;  2NCO A;  1QX2 A;  2WCE A;  2A4J A;  2JWW A;  5EL2 A;  4PHM A;  2EC6 C;  3DXL A;  3FIA A;  1BR1 B;  1QIV A;  3LLE A;  1KQM C;  3CGA A;  3O4Y A;  4IL1 A;  3PLF B;  1WLZ A;  2BKH B;  1KK7 Z;  2G2B A;  5AFP A;  1A29 A;  4AQI A;  4OZD A;  1FI6 A;  2QDI A;  1WDC B;  1FBV A;  3SG6 A;  1V1G A;  3LL8 B;  2Y4Q A;  4P5O E;  2JUL A;  1KSO A;  3SS5 A;  3CZ2 A;  4I5L B;  1CLL A;  2EGD A;  1B47 A;  5FI2 A;  1K95 A;  2LC5 A;  1NP8 A;  1S3P A;  1JF0 A;  1YUS A;  1A75 A;  2LAP A;  3VRP A;  4L9M A;  1DJH A;  1NX2 A;  1TCO B;  1JC2 A;  1EJ3 A;  3EVR A;  4ETO A;  1SW8 A;  3PN7 B;  3R1P A;  1KFU L;  5I2Q A;  5K89 A;  1PRW A;  2ZRS A;  1NX0 A;  1TN4 A;  1OOH A;  1ORG A;  1QWV A;  4INX A;  4DUQ A;  1NSH A;  2OTG C;  3CZ0 A;  1LVC D;  1GM0 A;  2ZRT A;  1G4Y R;  1OOJ A;  5CSF A;  3AKB A;  1A2X A;  3TUY B;  1QXP A;  2ZN9 A;  5KTY A;  1H8B A;  3EK7 A;  2G9B A;  4PCW A;  2ZFD A;  4XJK A;  1AUI B;  2HET A;  2WCJ A;  4C0L A;  1MQ1 A;  3PM2 A;  3EK4 A;  2BCB A;  2BBN A;  5JJG A;  1WDC C;  3E3R A;  1A75 B;  2K8M B;  2L4I A;  5DKQ A;  3LK0 A;  5AEQ A;  3R1V A;  2P6B B;  4ICB A;  2QEV A;  1S6C A;  5AER A;  2L4H A;  3FE8 A;  4JQ0 D;  1F4O A;  4DS7 A;  2LAN A;  3L47 A;  1OE9 B;  3B87 A;  1DGV A;  3TZ1 A;  4I5J A;  3N7H A;  2PQL A;  1SCM B;  1IH0 A;  1SK6 D;  2LVK A;  1XYD A;  3R1O A;  1CFD A;  3PN7 C;  2M3W A;  1CNP A;  1JBA A;  2H2K A;  1UHH A;  3D77 A;  1J7P A;  2KNE A;  1SR6 B;  4WRI A;  4PE0 A;  4DIR A;  4GBA A;  3B86 A;  2JNX A;  3O78 A;  2HF5 A;  2SAS A;  4XJK B;  3VRN A;  1MWN A;  4PAL A;  3S0F A;  4YBH B;  3WHT B;  1KWO B;  3TUY C;  2KGR A;  2GGZ A;  3WXA A;  1OZS A;  2ZND A;  5CPV A;  1C7W A;  2GTE A;  1XVJ A;  2BNX A;  2OS8 B;  1SKT A;  4YI9 A;  1F71 A;  1XFY O;  1HT9 A;  1ZMZ A;  1B9A A;  1BU3 A;  1CMG A;  2F33 A;  2JXC A;  2LLS A;  3RM1 A;  1BF5 A;  2LVV A;  2LCP A;  1DC1 A;  1EL4 A;  1EG4 A;  1QLS A;  1SRA A;  4E68 A;  2L5X B;  1UHN A;  5D69 A;  1F70 A;  5HKY A;  4YGC B;  2WCM A;  2PMY A;  5CSN A;  1CTR A;  1W9Z A;  3QME A;  1SCM C;  5JOL A;  5I8N A;  1RWY A;  2JOJ A;  2CCM A;  4FQO A;  3I5H B;  1JF2 A;  3PAL A;  1SR6 C;  3DVK A;  5F6T A;  3TDU A;  3CYZ A;  3CDN A;  4PE1 A;  1M31 A;  4GAO A;  1NYA A;  1S1E A;  4MSP A;  5D3O A;  4Q04 A;  1NCY A;  4CLN A;  2DOQ A;  1GGW A;  4BY5 A;  2WCH A;  1JWD A;  1RFJ A;  2BBM A;  3OX6 A;  1CDN A;  2LMV A;  2LHI A;  3AAJ A;  4WQ3 A;  2YGU A;  5AAN A;  1CFF A;  2I18 A;  3WNX B;  4QJ4 B;  1KWO C;  2K2A A;  2FJY A;  3FE6 A;  2MLE C;  1BT6 A;  2Q4U A;  2OS8 C;  1CFP A;  3L4A A;  4M2P A;  3ZWH A;  1K9K A;  2BE4 A;  3BXK A;  3SG3 A;  2QAC A;  1RK9 A;  1NCZ A;  2QEH A;  1AVS A;  1XFW O;  2WC6 A;  4JPZ B;  1J1E A;  1PAL A;  1UWO A;  2BAP A;  4DCK A;  1M39 A;  5IBW A;  2P71 A;  3VRO A;  3ICB A;  4MLW A;  1TTX A;  3QRX A;  4JD9 A;  1QAT A;  2JT8 A;  3NSL A;  1TNX A;  1NPQ A;  3NXA A;  2KBI A;  3B7A A;  1B8L A;  2JT0 A;  1R2U A;  2WC8 A;  3LCP C;  3UNW A;  1Y1U A;  1A4P A;  4GPL B;  4GGF C;  2FOT A;  3I5H C;  1DGU A;  3BFB A;  3F45 A;  4D1E A;  4YRU A;  1IQ5 A;  5HLV A;  1R6P A;  3BQ3 A;  2WCB A;  1SNL A;  3NSO A;  1G8I A;  1S36 A;  1ZUZ A;  5AXI A;  1KK7 Y;  1W7I B;  4QJ5 B;  2HPS A;  2KQY A;  2Y5I A;  2WC5 A;  1IJ6 A;  1OMD A;  1DJI A;  1FW4 A;  1DF0 A;  1BJF A;  5CSI A;  2F3Y A;  1DVI A;  2GGM A;  1PSR A;  2HQW A;  2KI6 C;  2LMU A;  3DYE A;  4PT1 A;  4ZCU A;  2WOS A;  5I2L A;  1K9P A;  1Y1X A;  2K7O A;  3OB1 B;  1X02 A;  4HRH A;  3SJS A;  4U8D A;  1S6I A;  3D75 A;  1AP4 A;  3S0D A;  3IF7 A;  1T14 A;  1LA3 A;  2PVB A;  2CT9 A;  3L4L A;  3FWB A;  1ZAC A;  3FE9 A;  1B8R A;  2E6W A;  2L50 A;  3M0W A;  1Y0V H;  2R2I A;  2JRF A;  3VGO A;  2H61 A;  2LV7 A;  2LHL A;  2WOR A;  1CKK A;  1JFK A;  1BLQ A;  1YX8 A;  1OOF A;  1OQP A;  3S0G A;  1BG1 A;  5G08 A;  2KBM A;  1BMO A;  2FCE A;  4GGN A;  4JWQ A;  4MEW A;  2KI6 D;  3UO9 A;  2BL0 B;  2LP3 A;  4MN0 A;  1C7V A;  1J7Q A;  1G33 A;  1DF0 B;  2KHN A;  2TN4 A;  2O5G A;  4CID A;  2CTN A;  1SL9 A;  1QX5 B;  2JQ6 A;  2OPO A;  1SPY A;  1YTZ C;  3AAK A;  1FF1 A;  1U5I A;  2GV5 A;  2H8V A;  1CDM A;  2BEC A;  1DTL A;  3I5F B;  2JXL A;  3OX5 A;  2KSP A;  1CM1 A;  1YUU A;  1B7T Z;  1UHI A;  2KI4 B;  3EVV A;  1B7T Y;  3A4U B;  1RRO A;  2COL B;  4MZL A;  2MAZ A;  1J1D A;  1N65 A;  3GK1 A;  1L7Z A;  5FI7 A;  1SMG A;  5PAL A;  3SG4 A;  4QJ3 B;  2KAV A;  2HQ8 A;  4GUK A;  1F55 A;  1LKJ A;  4CFQ A;  2L98 A;  2K7B A;  3KHE A;  2I94 A;  4HRG A;  1PK0 D;  3JVT B;  3PAT A;  1WRZ A;  2JTZ A;  1LXF C;  2MHH A;  2MLF C;  5DKR A;  1ZFS A;  3A8R A;  3CR5 X;  3BUN B;  1OZO A;  2QEO A;  2K61 A;  3EKJ A;  3PFV A;  4PHK A;  2ZN8 A;  1IGV A;  1S26 D;  3OHM B;  2F8P A;  1F8H A;  1QJT A;  1U5I B;  2K7C A;  3CLN A;  3D73 A;  1ALV A;  2MBX A;  2MA2 A;  3FWC A;  5J3X A;  3B88 A;  3PM8 A;  4M2O A;  3RLZ A;  1TOP A;  1HQV A;  2BL0 C;  2L5Y A;  2QPT A;  2WCL A;  3BUX B;  2KDH A;  2NLN A;  3D74 A;  1ALW A;  3DZT A;  4HRE E;  3DF0 A;  1YUR A;  3OP0 A;  4YGE B;  2FCD A;  3HX4 A;  1WRL A;  1TUJ A;  1SY9 A;  1EG3 A;  2K7D A;  1M63 B;  1UHJ A;  5ER5 A;  1QV1 A;  3SG5 A;  3BUW B;  1RTP 1;  2Y1M A;  3I5F C;  3IVT A; 
#chains in the Genus database with same CATH homology
 2CXJ A;  2BKI B;  2KI4 C;  3BUM B;  4PHN A;  3JTD B;  4N1G A;  1Y6W A;  2JT3 A;  2H61 C;  3EKH A;  1OMR A;  3JVT C;  1WLM A;  2KQ6 A;  4I5K A;  1NCX A;  5DKN A;  2LE9 B;  1ODB A;  1H4B A;  1K93 D;  3DF0 B;  2EHB A;  2ZKM X;  1SYM A;  1KFX S;  1DJG A;  5B8I B;  2LVI A;  2M8U A;  2KFF A;  2L2E A;  1BOD A;  1REC A;  1MR8 A;  1F4Q A;  1XK4 A;  1YRT B;  3SIB A;  3I5I B;  1BOC A;  3PSR A;  4ORA B;  2M49 B;  3O2P A;  2LM5 A;  1K9U A;  2L51 A;  3CR2 A;  3LK1 A;  1VRK A;  4PE4 A;  2ISD A;  3GK2 A;  4XYN A;  1K90 D;  2AAO A;  3JTD C;  5D7F A;  2O60 A;  3KEV A;  4AQJ A;  1NX3 A;  1IKU A;  1M46 A;  5ER4 X;  4F0Z B;  2NCP A;  3DD4 A;  1XFV O;  4ORB B;  3GOF A;  5GQQ C;  2LLU A;  1FPW A;  2PSR A;  3D0Y A;  2K0J A;  1GGZ A;  3VRQ A;  4A4B A;  3KPX A;  1DT7 B;  4N1F A;  3CZT X;  2LUX A;  1NWD A;  1XO5 A;  1TNQ A;  2F3Z A;  1Q80 A;  2WND A;  3SG7 A;  1IJ5 A;  4PDZ A;  4TNC A;  4NDD A;  4CFR A;  2LLT A;  2ZNE A;  1UHK A;  2LP2 A;  1QX7 A;  1N2D A;  1QAS A;  3I5I C;  1WY9 A;  1MHO A;  2I7A A;  1PVB A;  4A4C A;  4YGB B;  5BPJ A;  1TNP A;  2E30 A;  2KYF A;  1IQ3 A;  1AHR A;  2LUC A;  3IQQ A;  4PHJ A;  3D0Y B;  3I5G B;  2F2P A;  1DMO A;  1PUL A;  2JU0 A;  3EK8 A;  1LIN A;  2MJW B;  1L2O B;  2D8N A;  1CDP A;  1NX1 A;  1WRK A;  1AJ4 A;  2JC2 A;  4I5N B;  1QVI Z;  1S5G Z;  1XA5 A;  2M9G A;  1QVI Y;  1S5G Y;  1D1O A;  3BYA A;  2AMI A;  3DVJ A;  1SBJ A;  2PAS A;  1XK4 C;  1MXE A;  1YVL A;  1TRF A;  1YR5 A;  3BOW A;  2Q91 A;  4FTG A;  4NDB A;  1JSA A;  2KAY A;  3IQO A;  1QTX A;  1Y1A A;  5KSZ A;  1DJY A;  1MXL C;  2M7N A;  2L0P A;  3O6B A;  2LVJ A;  4HSZ A;  2M1U A;  2NZ0 A;  3CTN A;  1NUB A;  4GFT A;  1YVH A;  2M1K B;  4BY4 A;  2PRU A;  4OR9 B;  4MRY A;  2K2F A;  1W7J B;  2KGB C;  1UUS A;  2I2R E;  1KFX L;  2LNK A;  2JPT A;  3NSI A;  4N5X A;  1AK8 A;  4YGA A;  3I5G C;  1SL7 A;  2VRG A;  4OKH A;  1CDL A;  3CR4 X;  1L2O C;  4OVN F;  3BOW B;  4NDC A;  3TDZ A;  3K21 A;  1S6J A;  1YUT A;  1K94 A;  4MZJ A;  5FYX A;  2CBL A;  1E8A A;  4M2Q A;  1J7R A;  4WQ2 A;  5TNC A;  2FJU B;  4R1E A;  2BE6 A;  1XFU O;  1IG5 A;  4GNK B;  1GJY A;  5HKW A;  1TNW A;  2M29 A;  4YGD B;  5HLO A;  4ORC B;  1CM4 A;  1CB1 A;  1KSM A;  1OMV A;  1QV0 A;  3ZNI A;  3TS5 B;  4ZCV A;  1KCY A;  3OB2 B;  1UUR A;  2AUC A;  2JTT A;  1JUO A;  2RGI A;  4MRX A;  1CFC A;  1KFU S;  1XFZ O;  2LMT A;  1CLM A;  1M45 A;  1SCV A;  1MUX A;  4GGF A;  3SIA A;  1KK8 B;  3SG2 A;  1N0Y A;  1QIW A;  1EH2 A;  2PAL A;  1ZOT B;  2B1U A;  1IWQ A;  2WCF A;  3DVE A;  4NQG A;  1DJW A;  2Y1N A;  4USL A;  4AOM A;  1XFX O;  3VRR A;  1MF8 B;  1TIZ A;  2V53 A;  2BCX A;  4C0K A;  2JNF A;  2BCA A;  2KFH A;  2KFG A;  1B1G A;  1YRU B;  4OCI A;  3AKA A;  3KF9 A;  1NIW A;  3BUO B;  3HCM A;  4YI8 A;  3CWG A;  1GQM A;  4UPG A;  5KU1 A;  4C0J A;  1RJV A;  2MRD A;  1OSA A;  1K8U A;  3C1V A;  3TDI A;  1QLK A;  1F54 A;  2M0R A;  3NSK A;  1B8C A;  2F2O A;  3DVM A;  2KOT A;  1PSB A;  4MZK A;  1CMF A;  1IRJ A;  1KQV A;  3KO0 A;  1DJX A;  1BR4 B;  2EC6 B;  3EVU A;  3TS5 C;  3MSE B;  1KQM B;  4MBE A;  1QS7 A;  4MVF A;  4CPV A;  1JFJ A;  3D10 A;  2SCP A;  3H4S E;  1EXR A;  2IS9 A;  1J7O A;  5HYD A;  1CLB A;  1V1F A;  1LA0 A;  2CNP A;  1KK8 C;  2M97 A;  1B4C A;  4P2Y B;  4DRW A;  5I2O A;  1K96 A;  2KAX A;  5HKZ A;  1K2H A;  1YX7 A;  1C07 A;  1FI5 A;  1AJ5 A;  1DJZ A;  1TCF A;  3CS1 A;  1SL8 A;  2NXQ A;  3FS7 A;  4OV2 A;  1PVA A;  1A03 A;  2KYC A;  5CSJ A;  4PE7 A;  1J55 A;  2M7L A;  1UP5 A;  2JZI A;  2OTG B;  3GK4 X;  3WHU B;  2NCO A;  1QX2 A;  2WCE A;  2A4J A;  2JWW A;  4PHM A;  2EC6 C;  3FIA A;  1BR1 B;  1QIV A;  3LLE A;  1KQM C;  3CGA A;  3O4Y A;  4IL1 A;  3PLF B;  1WLZ A;  2BKH B;  1KK7 Z;  2G2B A;  5AFP A;  1A29 A;  4AQI A;  1FI6 A;  1WDC B;  1FBV A;  3SG6 A;  1V1G A;  3LL8 B;  2Y4Q A;  4P5O E;  2JUL A;  1KSO A;  4I5L B;  1CLL A;  2EGD A;  1B47 A;  1K95 A;  2LC5 A;  1NP8 A;  1S3P A;  1JF0 A;  1YUS A;  1A75 A;  2LAP A;  3VRP A;  4L9M A;  1DJH A;  1NX2 A;  1TCO B;  1JC2 A;  1EJ3 A;  3EVR A;  4ETO A;  1SW8 A;  3PN7 B;  5K89 A;  1KFU L;  5I2Q A;  1PRW A;  2ZRS A;  1NX0 A;  1TN4 A;  1NSH A;  2OTG C;  1LVC D;  2ZRT A;  1G4Y R;  1OOJ A;  5CSF A;  3AKB A;  1A2X A;  3TUY B;  1QXP A;  2ZN9 A;  5KTY A;  1H8B A;  3EK7 A;  2G9B A;  4PCW A;  2ZFD A;  4XJK A;  1AUI B;  2HET A;  4C0L A;  1MQ1 A;  3EK4 A;  2BCB A;  2BBN A;  5JJG A;  1WDC C;  3E3R A;  1A75 B;  2K8M B;  2L4I A;  5DKQ A;  3LK0 A;  5AEQ A;  4ICB A;  2P6B B;  5AER A;  1S6C A;  2L4H A;  4JQ0 D;  1F4O A;  4DS7 A;  2LAN A;  3TZ1 A;  1OE9 B;  1DGV A;  4I5J A;  1SCM B;  1IH0 A;  1SK6 D;  2LVK A;  1XYD A;  1JBA A;  1CFD A;  3PN7 C;  2M3W A;  1CNP A;  2H2K A;  1UHH A;  1J7P A;  2KNE A;  1SR6 B;  4WRI A;  4PE0 A;  4DIR A;  4GBA A;  2JNX A;  3O78 A;  2HF5 A;  2SAS A;  4XJK B;  3VRN A;  1MWN A;  4PAL A;  4YBH B;  3WHT B;  1KWO B;  3TUY C;  2KGR A;  2GGZ A;  3WXA A;  1OZS A;  2ZND A;  5CPV A;  1C7W A;  2OS8 B;  1XVJ A;  4YI9 A;  1F71 A;  1SKT A;  1XFY O;  1HT9 A;  1ZMZ A;  1B9A A;  1BU3 A;  1CMG A;  2F33 A;  2JXC A;  2LLS A;  3RM1 A;  1BF5 A;  2LVV A;  2LCP A;  1EL4 A;  1EG4 A;  1QLS A;  1SRA A;  4E68 A;  2L5X B;  1UHN A;  5D69 A;  1F70 A;  5HKY A;  4YGC B;  2PMY A;  5CSN A;  1CTR A;  1SCM C;  5JOL A;  5I8N A;  1RWY A;  2JOJ A;  2CCM A;  4FQO A;  3I5H B;  1JF2 A;  3PAL A;  1SR6 C;  3DVK A;  5F6T A;  3TDU A;  4PE1 A;  1M31 A;  4GAO A;  1NYA A;  1S1E A;  4MSP A;  4Q04 A;  1NCY A;  4CLN A;  2DOQ A;  1GGW A;  4BY5 A;  1JWD A;  1RFJ A;  2BBM A;  3OX6 A;  1CDN A;  2LMV A;  2LHI A;  3AAJ A;  4WQ3 A;  5AAN A;  1CFF A;  2I18 A;  3WNX B;  4QJ4 B;  1KWO C;  2K2A A;  2MLE C;  1BT6 A;  2Q4U A;  2OS8 C;  1CFP A;  4M2P A;  3ZWH A;  1K9K A;  2BE4 A;  3BXK A;  3SG3 A;  2QAC A;  1RK9 A;  1NCZ A;  4JPZ B;  1AVS A;  1XFW O;  4DCK A;  1J1E A;  1PAL A;  1UWO A;  1M39 A;  5IBW A;  3VRO A;  3ICB A;  4MLW A;  1TTX A;  3QRX A;  1QAT A;  2JT8 A;  3NSL A;  1TNX A;  1NPQ A;  3NXA A;  2KBI A;  1B8L A;  2JT0 A;  1R2U A;  2WC8 A;  3LCP C;  1Y1U A;  1A4P A;  4GPL B;  4GGF C;  2FOT A;  3I5H C;  1DGU A;  3F45 A;  4D1E A;  4YRU A;  1IQ5 A;  5HLV A;  1R6P A;  3BQ3 A;  2WCB A;  1SNL A;  3NSO A;  1G8I A;  1S36 A;  1ZUZ A;  5AXI A;  1KK7 Y;  1W7I B;  4QJ5 B;  2HPS A;  2KQY A;  2Y5I A;  1IJ6 A;  1OMD A;  1DJI A;  1FW4 A;  1DF0 A;  1BJF A;  5CSI A;  2F3Y A;  1DVI A;  2GGM A;  1PSR A;  2HQW A;  2KI6 C;  2LMU A;  4ZCU A;  2WOS A;  5I2L A;  1K9P A;  1Y1X A;  2K7O A;  3OB1 B;  1X02 A;  4HRH A;  3SJS A;  4U8D A;  1S6I A;  1AP4 A;  3IF7 A;  1LA3 A;  2PVB A;  2CT9 A;  3FWB A;  1ZAC A;  1B8R A;  2E6W A;  2L50 A;  3M0W A;  1Y0V H;  2R2I A;  2JRF A;  3VGO A;  2H61 A;  2LV7 A;  2LHL A;  2WOR A;  1CKK A;  1JFK A;  1BLQ A;  1YX8 A;  1OQP A;  1BG1 A;  5G08 A;  2KBM A;  1BMO A;  2FCE A;  4GGN A;  4JWQ A;  4MEW A;  2KI6 D;  2BL0 B;  2LP3 A;  4MN0 A;  1C7V A;  1J7Q A;  1G33 A;  1DF0 B;  2KHN A;  2TN4 A;  2O5G A;  4CID A;  2CTN A;  1SL9 A;  1QX5 B;  2JQ6 A;  2OPO A;  1SPY A;  1YTZ C;  3AAK A;  1FF1 A;  1U5I A;  2GV5 A;  1CDM A;  2BEC A;  1DTL A;  3I5F B;  2JXL A;  3OX5 A;  2KSP A;  1CM1 A;  1YUU A;  1B7T Z;  1UHI A;  2KI4 B;  3EVV A;  1B7T Y;  3A4U B;  1RRO A;  2COL B;  4MZL A;  2MAZ A;  1J1D A;  1N65 A;  3GK1 A;  1L7Z A;  5PAL A;  1SMG A;  3SG4 A;  4QJ3 B;  2KAV A;  2HQ8 A;  4GUK A;  1F55 A;  1LKJ A;  4CFQ A;  2L98 A;  2K7B A;  3KHE A;  2I94 A;  4HRG A;  1PK0 D;  3JVT B;  3PAT A;  1WRZ A;  2JTZ A;  1LXF C;  2MHH A;  2MLF C;  5DKR A;  1ZFS A;  3A8R A;  3CR5 X;  3BUN B;  1OZO A;  2K61 A;  3EKJ A;  3PFV A;  4PHK A;  2ZN8 A;  1IGV A;  1S26 D;  3OHM B;  2F8P A;  1F8H A;  1QJT A;  1U5I B;  2K7C A;  3CLN A;  2MBX A;  1ALV A;  2MA2 A;  3FWC A;  5J3X A;  3PM8 A;  3RLZ A;  4M2O A;  1TOP A;  1HQV A;  2BL0 C;  2QPT A;  3BUX B;  2KDH A;  2NLN A;  4HRE E;  1ALW A;  3DF0 A;  1YUR A;  3OP0 A;  4YGE B;  2FCD A;  3HX4 A;  1WRL A;  1SY9 A;  1EG3 A;  2K7D A;  1M63 B;  1UHJ A;  5ER5 A;  1QV1 A;  3SG5 A;  3BUW B;  1RTP 1;  2Y1M A;  3I5F C;  4DUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...