4INXA

Structure of pheromone-binding protein 1 in complex with (z,z)-11,13- hexadecadienol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
SPEIMKDLSINFGKALDTCKKELDLPDSINEDFYKFWKEDYEITNRLTGCAIKCLSEKLEMVDADGKLHHGNAREFAMKHGADDAMAKQLVDLIHGCEKSIPPNDDRCMEVLSIAMCFKKEIHNLKWAPNMEVVVGEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone-binding protein
molecule keywords Pheromone-binding protein 1
publication title Crystallographic Observation of pH-Induced Conformational Changes in the Amyelois transitella Pheromone-Binding Protein AtraPBP1.
pubmed doi rcsb
source organism Amyelois transitella
total genus 50
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4inxA00
1ORGA 3R72A 3BFAA 1OOIX 5DICA 3B86A 3D77A 1LS8A 4JD9A 1P28A 1GM0A 4FQTA 3NHIA 2P70A 3BFBA 1OW4A 3DYEA 2WCKA 3OGNA 3CABA 1QWVA 2QDIA 3R1OA 3VB1A 2WCJA 3NHTA 3S0BA 2H8VA 2WCMA 2QEVA 4PT1A 1XFRA 3V2LA 1OOGA 3D73A 3L47A 3CZ1A 3D76A 4INWA 3B88A 2WCHA 3FE9A 3S0DA 3K1EA 3B7AA 3D75A 3R1VA 2WCLA 3BFHA 2WC5A 1TWOA 3B87A 2KPHA 3R1PA 3Q8IA 3DZTA 3RZSA 2ERBA 3DY9A 5EL2A 3FE6A 4INXA 2FJYA 1OOFA 4F7FA 2QEBA 4OZDA 3QMEA 3N7HA 1C3YA 2P71A 2WC6A 3S0EA 3NGVA 3CYZA 3L4AA 3CZ0A 3BJHA 3D78A 1TUJA 3CDNA 2JPOA 3CZ2A 3B6XA 1C3ZA 1DQEA 3L4LA 3D74A 2GTEA 3S0AA 3S0GA 2L2CA 2QEOA 3S0FA 3DXLA 2QEHA 3FE8A 1T14A 1OOHA 2PQLA 3PJIA
chains in the Genus database with same CATH superfamily
4YGEB 3R72A 4PHJA 1QASA 2GGMA 4I5KA 3I5GC 2BKHB 4PDZA 1E8AA 1IJ5A 3CLNA 1X02A 2NCOA 2KI4C 2PRUA 1K8UA 5AANA 1C7VA 2LAPA 1W7IB 3NSIA 1K9PA 3KF9A 3SS3A 3WNXB 1P28A 1LXFC 3O6BA 1RJVA 3NHIA 3DYEA 1RECA 1S3PA 2KAYA 1R2UA 1RK9A 1RWYA 2A4JA 3OB2B 3OGNA 5IBWA 3GOFA 1B7TZ 1AJ4A 1B47A 1MR8A 1IH0A 4CFRA 3SIAA 4NQGA 1NUBA 1XFZO 5CSIA 3IF7A 3EG5B 3R1OA 3CR2A 3S0BA 1KFXL 1SYMA 4KYNA 4GPLB 2F3YA 5BPJA 5HLOA 1LVCD 1XYDA 2CCMA 1UHNA 5AEQA 2LP2A 2QEVA 1LA3A 3SG2A 3KHEA 2LCPA 2LP3A 1CMFA 5G08A 2IS9A 1SL9A 4YGBB 2ZN9A 3L47A 1IG5A 5ER4X 1ODBA 1PVBA 4TNCA 5D69A 1IWQA 1MXLC 2P6BB 3B88A 2M0RA 2Y4QA 3I5HC 2L4IA 4GGFC 4NDBA 2FOTA 2LVVA 5AFPA 2MRDA 1J7RA 2KFGA 2NLNA 1CLBA 2Q91A 4GGFA 2BL0B 1ZFSA 3BOWB 1QX2A 1K9UA 3CZTX 3D75A 1NX0A 4JQ0D 1QV1A 3RLZA 2JULA 2M1UA 3I5GB 3BUNB 1SBJA 2MAZA 1CFPA 2KI4B 1JBAA 3B87A 2BBNA 2ZKMX 4OV2A 4MZKA 4PHMA 3R1PA 4WRIA 2PMYA 1CTRA 1D1OA 4GFTA 5HKWA 5FI2A 4YBHB 1XFVO 1FW4A 3IQOA 4WQ2A 1OMRA 2H61C 3PM8A 3DY9A 1QX7A 1M46A 2HF5A 3HCMA 5CPVA 4USLA 1L7ZA 4MVFA 1B8LA 3DVEA 3O4YA 1Z2CB 2BKIB 3PN7C 1PVAA 2L2EA 1CDLA 1WY9A 2BNXA 4INXA 1QXPA 4NDCA 4OKHA 3WXAA 1SW8A 2JTZA 1Y1XA 1YVHA 5FI6A 5D7FA 4ORAB 2LUXA 3N7HA 3VGOA 1OSAA 1TTXA 1AJ5A 3BUOB 3NSKA 1Y0VH 3S0EA 3O4XA 4N1FA 1CKKA 1BMOA 1DJZA 3LLEA 1WRZA 3I5HB 4M2PA 2BE4A 2DOQA 1SK6D 4JKTA 3BJHA 3D78A 4PE7A 2ZRTA 4QJ3B 2JPOA 3JVTC 1CM1A 2JXLA 3B6XA 4M2OA 5FI7A 1DELA 2KHNA 3FIAA 5GQQC 1DQEA 1HT9A 1EG3A 1RFJA 2G9BA 2AUCA 1YR5A 2ZNDA 1TNXA 2KQYA 2LMUA 2Q4UA 2KBMA 1XFXO 2QEOA 1N65A 3IVTA 2M7NA 2LLTA 2ZFDA 2EGDA 3M0WA 1DGUA 5DKRA 2I2RE 3NSLA 2HQWA 3TUYC 1TCOB 1AHRA 3VRRA 2V53A 3FE8A 1T14A 2LC5A 2WC8A 1FPWA 1XA5A 4OR9B 5K89A 3BFBA 1IRJA 2CTNA 1ZUZA 1ORGA 5D3OA 3DVMA 4BY5A 1F4OA 2NXQA 2K8MB 4MBEA 3BFAA 1OOIX 2YGUA 3PM2A 5DICA 1IIOA 1CLLA 1K90D 2R2IA 3ZWHA 3I5FC 4FQTA 1J7QA 2P70A 1OW4A 2F33A 2LLSA 2JQ6A 2KLEA 2K60A 4YGDB 1ZMZA 2E6WA 1QVIY 4DCKA 1NP8A 1YUSA 1J1EA 3WHUB 2JT0A 1A4PA 1XO5A 4HRHA 4PCWA 1MXEA 3EVUA 1F71A 3SG5A 2WCJA 3NHTA 1K95A 4HSZA 1KCYA 4GUKA 2H8VA 2KAXA 2PASA 1DJWA 1MUXA 1SR6B 3E3RA 4JWQA 1FI6A 2HETA 4GNKB 1CM4A 1UURA 2MLEC 5PALA 1A2XA 1KK7Y 2MJWB 3BOWA 4PT1A 1MHOA 2AAOA 1XFRA 1BODA 1SPYA 1J55A 1S6CA 2Y5IA 1V1FA 3SG7A 1OOGA 2F3ZA 4GGNA 4IJ7A 2CXJA 2JTTA 3D73A 2D8NA 3AAJA 2LUCA 2QACA 1DT7B 1UHIA 2WCEA 3PSRA 1CFCA 1UUSA 2M29A 3SS5A 3TUYB 1CNPA 3FE9A 3F45A 2OS8C 1S5GY 1EH2A 2L51A 3K1EA 1UHJA 3B7AA 2M7LA 2CBLA 1CLMA 4YI8A 2KBIA 1ZACA 4FTGA 1Q80A 4QJ4B 1AK8A 3TS5C 2L5XB 3BYAA 1EG4A 2KPHA 1OZSA 4MZJA 3I5FB 1SCVA 3Q8IA 1OMVA 1PRWA 4MRYA 3RM1A 2KSPA 3DZTA 2KYFA 1EXRA 2OPOA 2MBXA 1JUOA 1FF1A 2K7CA 1LA0A 1J7OA 3CWGA 2L4HA 1V1GA 1UWOA 4CFQA 1SY9A 2LNKA 1RROA 1QJTA 4I5JA 2FCDA 4C0KA 4CIDA 2GV5A 2K2AA 1JFJA 5HYDA 4D1EA 1OOFA 4F7FA 4OZDA 3OX6A 2P71A 1WDCC 4QJ5B 3CR4X 1GJYA 3SJSA 2BE6A 2WC6A 3OBVA 4AOMA 2JOJA 1BR1B 3GK4X 1NYAA 1S6IA 4WQ3A 1IKUA 1CMGA 1JF2A 2QPTA 2I94A 1JC2A 1NSHA 2M49B 3CZ0A 1TUJA 2OS8B 2M8UA 2O5GA 4M2QA 2L5YA 3PATA 3OHMB 2H61A 5ER5A 1XVJA 5CSFA 2O60A 5CSJA 1A75A 4AQIA 4C0JA 2KDHA 1WLMA 2CNPA 1IQ5A 3TS5B 2MA2A 5HKYA 1F54A 2WNDA 1JSAA 2LMVA 2PVBA 2JNXA 3AKBA 4MSPA 2PALA 1C07A 1NCYA 1NX2A 2FJUB 3NXAA 1DJGA 1TIZA 2K61A 3PJIA 1QS7A 4PALA 2RGIA 2PSRA 4C0LA 1F4QA 1N2DA 2JU0A 1PULA 3B86A 1DVIA 3D77A 3O78A 1CDPA 1DGVA 1LS8A 4I5LB 2F8PA 1N0YA 1YX7A 3BXKA 1GM0A 2LHLA 1GGZA 5HKZA 3BQ3A 2VRGA 1ALWA 2LVJA 5KSZA 1TUZA 3DVKA 1BT6A 4YRUA 2JT8A 1B8RA 1QWVA 2QDIA 1QIWA 3EKJA 2B1UA 2SCPA 3VROA 1IQ3A 1YUUA 2WCMA 4F0ZB 1IJ6A 2GGZA 5FYXA 1AP4A 4DRWA 2Y1MA 3DD4A 1A75B 1M39A 1K9KA 2KOTA 3PN7B 2BECA 3TZ1A 3V2LA 3FS7A 1H8BA 1PK0D 1SKTA 5AERA 2JZIA 1KFUS 1RTP1 1YURA 1YX8A 3CZ1A 2MLFC 4GAOA 4A4CA 2EHBA 3AKAA 3NSOA 4ORCB 1AUIB 4P2YB 1W9ZA 1PSRA 2KI6C 1CB1A 4U8DA 2LLUA 2WCFA 4PE0A 1R6PA 1OMDA 1PSBA 3KEVA 3A4UB 3O2PA 2KYCA 1XFWO 3R1VA 2WCLA 3VRNA 5I2OA 3KO0A 2HQ8A 3BFHA 4GBAA 1UP5A 1W7JB 2OTGC 5TNCA 1PALA 2LV7A 1QLKA 1YUTA 3JVTB 1TRFA 2E30A 1G33A 3VRQA 1QIVA 3CR5X 1BR4B 1K93D 2KGBC 2ZNEA 1Y1AA 5I94A 1GGWA 1KK8C 1LKJA 4CPVA 3UNWA 2KGRA 4HREE 1K2HA 2JWWA 2NZ0A 5HL1A 4MEWA 3FWBA 4YI9A 2BCAA 3EK8A 1TOPA 1XK4C 1DJHA 5JJGA 1KSMA 1HQVA 1Z4HA 3QMEA 3D0YA 1TN4A 3D10A 4IL1A 3ZNIA 5KTYA 3SS4A 1XK4A 4N5XA 2LM5A 1KWOC 1M31A 4PHKA 1C3YA 2JRFA 2LVIA 3HX4A 2I18A 2LE9B 1DEKA 1JF0A 3GK1A 3NGVA 3EVRA 2CT9A 3JTDC 3OB1B 3CYZA 2HPSA 3BUXB 4MZLA 4MN0A 1DJIA 5B8IB 3FWCA 2BCXA 2I7AA 2KFHA 1DJXA 4A4BA 2TN4A 3A8RA 3KPXA 1C3ZA 3ICBA 4DS7A 2ZN8A 3D74A 2H2KA 1KFUL 3LK1A 2L2CA 3TDUA 1OQPA 2OTGB 1NCXA 1TNPA 1S6JA 3CGAA 2AMIA 4ICBA 4NDDA 3DXLA 5I2QA 2WOSA 2QEHA 5I2LA 1KSOA 1SNLA 5I8NA 2JXCA 1TCFA 2JNFA 1BOCA 1SSEB 4N1GA 1KK8B 2F2PA 2M1KB 1G4YR 2L0PA 2KFFA 1NX3A 1TNQA 3UO9A 1UHKA 3AAKA 1ZOTB 3QRXA 3TDIA 1YTZC 3D0YB 4JD9A 1NX1A 2JC2A 3OP0A 1A03A 2F2OA 1MF8B 1S36A 4JPZB 1FBVA 2WCKA 2G2BA 1KWOB 4YGCB 1AVSA 1B8CA 1CFDA 3CABA 1QLSA 1MWNA 3MSEB 4E68A 1MQ1A 2KLDA 1B7TY 3C1VA 1VRKA 3JTDB 2KNEA 5DKQA 3VB1A 1QATA 1FI5A 5HLVA 2WCBA 1SL8A 4Q04A 1Y6WA 1YVLA 4ZCUA 4ZCVA 1EJ3A 1CDNA 3BUWB 2NCPA 2ZRSA 4PHNA 3DF0A 1DMOA 4MRXA 2K7BA 1F55A 1OOJA 3I5IC 1K96A 4XJKA 2M97A 1BLQA 1U5IA 1SMGA 2EC6C 3D76A 4BY4A 3LL8B 3WHTB 2K2FA 2PYQA 1NIWA 2K0JA 2M3WA 3CTNA 1QVIZ 2M9GA 1LINA 4INWA 1KQMC 2BCBA 5KU1A 2WCHA 4OCIA 4R1EA 3SG3A 4OVNF 4PE4A 2FCEA 1WDCB 3S0DA 1QX5B 1J1DA 2ISDA 1H4BA 1L2OC 1WLZA 1NWDA 2LANA 4YGAA 1SCMC 4ETOA 2WC5A 4DIRA 3GK2A 4FQOA 5DKNA 3LCPC 1TWOA 3LK0A 1KK7Z 4DUQA 1K94A 5JOLA 4HRGA 5CSNA 1BJFA 3PALA 3TDZA 2SASA 1WRKA 3RZSA 3IQQA 1QTXA 2L50A 1SR6C 2ERBA 1OE9B 1SL7A 2LHIA 5J3XA 5EL2A 1DF0A 1UHHA 4AQJA 1JFKA 1ALVA 1CDMA 1S26D 3FE6A 1S5GZ 4MLWA 1B9AA 3PLFB 2KI6D 1XFUO 4ORBB 2FJYA 1KFXS 3DF0B 3SIBA 1M63B 1DC1A 5F6TA 1OZOA 3EK4A 2BAPA 1NPQA 2QEBA 1EL4A 4XJKB 3VRPA 4CLNA 1JWDA 2K7DA 1GQMA 1YRTB 2K7OA 3EVVA 1U5IB 3BUMB 2LMTA 1B1GA 1NCZA 3I5IB 1B4CA 3H4SE 1YRUB 5AXIA 1S1EA 2EC6B 2KQ6A 1CFFA 2KAVA 3L4AA 1DJYA 1M45A 1J7PA 1QV0A 2L98A 1BG1A 1KQMB 1BF5A 3SG6A 3CDNA 3PFVA 4PE1A 2Y1NA 4XYNA 3CZ2A 4L9MA 3EKHA 1F70A 2MHHA 1L2OB 3SG4A 1G8IA 2COLB 3L4LA 2GTEA 3DVJA 1SCMB 3S0AA 1Y1UA 2LVKA 1WRLA 3K21A 4P5OE 3S0GA 1A29A 1XFYO 3EK7A 2BBMA 2WORA 3S0FA 2JPTA 3OX5A 4I5NB 1F8HA 2JT3A 4UPGA 1TNWA 1C7WA 1IGVA 1SRAA 1DF0B 2BL0C 3CS1A 1OOHA 1BU3A 2PQLA 1DTLA 1KQVA
chains in the Genus database with same CATH topology
1ORGA 3R72A 3BFAA 1OOIX 5DICA 3B86A 3D77A 1LS8A 4JD9A 1P28A 1GM0A 4FQTA 3NHIA 2P70A 3BFBA 1OW4A 3DYEA 2WCKA 3OGNA 3CABA 1QWVA 2QDIA 3R1OA 3VB1A 2WCJA 3NHTA 3S0BA 2H8VA 2WCMA 2QEVA 4PT1A 1XFRA 3V2LA 1OOGA 3D73A 3L47A 3CZ1A 3D76A 4INWA 3B88A 2WCHA 3FE9A 3S0DA 3K1EA 3B7AA 3D75A 3R1VA 2WCLA 3BFHA 2WC5A 1TWOA 3B87A 2KPHA 3R1PA 3Q8IA 3DZTA 3RZSA 2ERBA 3DY9A 5EL2A 3FE6A 4INXA 2FJYA 1OOFA 4F7FA 2QEBA 4OZDA 3QMEA 3N7HA 1C3YA 2P71A 2WC6A 3S0EA 3NGVA 3CYZA 3L4AA 3CZ0A 3BJHA 3D78A 1TUJA 3CDNA 2JPOA 3CZ2A 3B6XA 1C3ZA 1DQEA 3L4LA 3D74A 2GTEA 3S0AA 3S0GA 2L2CA 2QEOA 3S0FA 3DXLA 2QEHA 3FE8A 1T14A 1OOHA 2PQLA 3PJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORG A;  3R72 A;  3BFA A;  1OOI X;  5DIC A;  3B86 A;  3D77 A;  1LS8 A;  4JD9 A;  1P28 A;  1GM0 A;  4FQT A;  3NHI A;  2P70 A;  3BFB A;  1OW4 A;  3DYE A;  2WCK A;  3OGN A;  3CAB A;  1QWV A;  2QDI A;  3R1O A;  3VB1 A;  2WCJ A;  3NHT A;  3S0B A;  2H8V A;  2WCM A;  2QEV A;  4PT1 A;  1XFR A;  3V2L A;  1OOG A;  3D73 A;  3L47 A;  3CZ1 A;  3D76 A;  4INW A;  3B88 A;  2WCH A;  3FE9 A;  3S0D A;  3K1E A;  3B7A A;  3D75 A;  3R1V A;  2WCL A;  3BFH A;  2WC5 A;  1TWO A;  3B87 A;  2KPH A;  3R1P A;  3Q8I A;  3DZT A;  3RZS A;  2ERB A;  3DY9 A;  5EL2 A;  3FE6 A;  4INX A;  2FJY A;  1OOF A;  4F7F A;  2QEB A;  4OZD A;  3QME A;  3N7H A;  1C3Y A;  2P71 A;  2WC6 A;  3S0E A;  3NGV A;  3CYZ A;  3L4A A;  3CZ0 A;  3BJH A;  3D78 A;  1TUJ A;  3CDN A;  2JPO A;  3CZ2 A;  3B6X A;  1C3Z A;  1DQE A;  3L4L A;  3D74 A;  2GTE A;  3S0A A;  3S0G A;  2L2C A;  2QEO A;  3S0F A;  3DXL A;  2QEH A;  3FE8 A;  1T14 A;  1OOH A;  2PQL A;  3PJI A; 
#chains in the Genus database with same CATH topology
 4YGE B;  3R72 A;  4PHJ A;  1QAS A;  2GGM A;  4I5K A;  3I5G C;  2BKH B;  4PDZ A;  1E8A A;  1IJ5 A;  3CLN A;  1X02 A;  2NCO A;  2KI4 C;  2PRU A;  1K8U A;  5AAN A;  1C7V A;  2LAP A;  1W7I B;  3NSI A;  1K9P A;  3KF9 A;  3SS3 A;  3WNX B;  1P28 A;  1LXF C;  3O6B A;  1RJV A;  3NHI A;  3DYE A;  1REC A;  1S3P A;  2KAY A;  1R2U A;  1RK9 A;  1RWY A;  2A4J A;  3OB2 B;  3OGN A;  5IBW A;  3GOF A;  1B7T Z;  1AJ4 A;  1B47 A;  1MR8 A;  1IH0 A;  4CFR A;  3SIA A;  4NQG A;  1NUB A;  1XFZ O;  5CSI A;  3IF7 A;  3EG5 B;  3R1O A;  3CR2 A;  3S0B A;  1KFX L;  1SYM A;  4KYN A;  4GPL B;  2F3Y A;  5BPJ A;  5HLO A;  1LVC D;  1XYD A;  2CCM A;  1UHN A;  5AEQ A;  2LP2 A;  2QEV A;  1LA3 A;  3SG2 A;  3KHE A;  2LCP A;  2LP3 A;  1CMF A;  5G08 A;  2IS9 A;  1SL9 A;  4YGB B;  2ZN9 A;  3L47 A;  1IG5 A;  5ER4 X;  1ODB A;  1PVB A;  4TNC A;  5D69 A;  1IWQ A;  1MXL C;  2P6B B;  3B88 A;  2M0R A;  2Y4Q A;  3I5H C;  2L4I A;  4GGF C;  4NDB A;  2FOT A;  2LVV A;  5AFP A;  2MRD A;  1J7R A;  2KFG A;  2NLN A;  1CLB A;  2Q91 A;  4GGF A;  2BL0 B;  1ZFS A;  3BOW B;  1QX2 A;  1K9U A;  3CZT X;  3D75 A;  1NX0 A;  4JQ0 D;  1QV1 A;  3RLZ A;  2JUL A;  2M1U A;  3I5G B;  3BUN B;  1SBJ A;  2MAZ A;  1CFP A;  2KI4 B;  1JBA A;  3B87 A;  2BBN A;  2ZKM X;  4OV2 A;  4MZK A;  4PHM A;  3R1P A;  4WRI A;  2PMY A;  1CTR A;  1D1O A;  4GFT A;  5HKW A;  5FI2 A;  4YBH B;  1XFV O;  1FW4 A;  3IQO A;  4WQ2 A;  1OMR A;  2H61 C;  3PM8 A;  3DY9 A;  1QX7 A;  1M46 A;  2HF5 A;  3HCM A;  5CPV A;  4USL A;  1L7Z A;  4MVF A;  1B8L A;  3DVE A;  3O4Y A;  1Z2C B;  2BKI B;  3PN7 C;  1PVA A;  2L2E A;  1CDL A;  1WY9 A;  2BNX A;  4INX A;  1QXP A;  4NDC A;  4OKH A;  3WXA A;  1SW8 A;  2JTZ A;  1Y1X A;  1YVH A;  5FI6 A;  5D7F A;  4ORA B;  2LUX A;  3N7H A;  3VGO A;  1OSA A;  1TTX A;  1AJ5 A;  3BUO B;  3NSK A;  1Y0V H;  3S0E A;  3O4X A;  4N1F A;  1CKK A;  1BMO A;  1DJZ A;  3LLE A;  1WRZ A;  3I5H B;  4M2P A;  2BE4 A;  2DOQ A;  1SK6 D;  4JKT A;  3BJH A;  3D78 A;  4PE7 A;  2ZRT A;  4QJ3 B;  2JPO A;  3JVT C;  1CM1 A;  2JXL A;  3B6X A;  4M2O A;  5FI7 A;  1DEL A;  2KHN A;  3FIA A;  5GQQ C;  1DQE A;  1HT9 A;  1EG3 A;  1RFJ A;  2G9B A;  2AUC A;  1YR5 A;  2ZND A;  1TNX A;  2KQY A;  2LMU A;  2Q4U A;  2KBM A;  1XFX O;  2QEO A;  1N65 A;  3IVT A;  2M7N A;  2LLT A;  2ZFD A;  2EGD A;  3M0W A;  1DGU A;  5DKR A;  2I2R E;  3NSL A;  2HQW A;  3TUY C;  1TCO B;  1AHR A;  3VRR A;  2V53 A;  3FE8 A;  1T14 A;  2LC5 A;  2WC8 A;  1FPW A;  1XA5 A;  4OR9 B;  5K89 A;  3BFB A;  1IRJ A;  2CTN A;  1ZUZ A;  1ORG A;  5D3O A;  3DVM A;  4BY5 A;  1F4O A;  2NXQ A;  2K8M B;  4MBE A;  3BFA A;  1OOI X;  2YGU A;  3PM2 A;  5DIC A;  1IIO A;  1CLL A;  1K90 D;  2R2I A;  3ZWH A;  3I5F C;  4FQT A;  1J7Q A;  2P70 A;  1OW4 A;  2F33 A;  2LLS A;  2JQ6 A;  2KLE A;  2K60 A;  4YGD B;  1ZMZ A;  2E6W A;  1QVI Y;  4DCK A;  1NP8 A;  1YUS A;  1J1E A;  3WHU B;  2JT0 A;  1A4P A;  1XO5 A;  4HRH A;  4PCW A;  1MXE A;  3EVU A;  1F71 A;  3SG5 A;  2WCJ A;  3NHT A;  1K95 A;  4HSZ A;  1KCY A;  4GUK A;  2H8V A;  2KAX A;  2PAS A;  1DJW A;  1MUX A;  1SR6 B;  3E3R A;  4JWQ A;  1FI6 A;  2HET A;  4GNK B;  1CM4 A;  1UUR A;  2MLE C;  5PAL A;  1A2X A;  1KK7 Y;  2MJW B;  3BOW A;  4PT1 A;  1MHO A;  2AAO A;  1XFR A;  1BOD A;  1SPY A;  1J55 A;  1S6C A;  2Y5I A;  1V1F A;  3SG7 A;  1OOG A;  2F3Z A;  4GGN A;  4IJ7 A;  2CXJ A;  2JTT A;  3D73 A;  2D8N A;  3AAJ A;  2LUC A;  2QAC A;  1DT7 B;  1UHI A;  2WCE A;  3PSR A;  1CFC A;  1UUS A;  2M29 A;  3SS5 A;  3TUY B;  1CNP A;  3FE9 A;  3F45 A;  2OS8 C;  1S5G Y;  1EH2 A;  2L51 A;  3K1E A;  1UHJ A;  3B7A A;  2M7L A;  2CBL A;  1CLM A;  4YI8 A;  2KBI A;  1ZAC A;  4FTG A;  1Q80 A;  4QJ4 B;  1AK8 A;  3TS5 C;  2L5X B;  3BYA A;  1EG4 A;  2KPH A;  1OZS A;  4MZJ A;  3I5F B;  1SCV A;  3Q8I A;  1OMV A;  1PRW A;  4MRY A;  3RM1 A;  2KSP A;  3DZT A;  2KYF A;  1EXR A;  2OPO A;  2MBX A;  1JUO A;  1FF1 A;  2K7C A;  1LA0 A;  1J7O A;  3CWG A;  2L4H A;  1V1G A;  1UWO A;  4CFQ A;  1SY9 A;  2LNK A;  1RRO A;  1QJT A;  4I5J A;  2FCD A;  4C0K A;  4CID A;  2GV5 A;  2K2A A;  1JFJ A;  5HYD A;  4D1E A;  1OOF A;  4F7F A;  4OZD A;  3OX6 A;  2P71 A;  1WDC C;  4QJ5 B;  3CR4 X;  1GJY A;  3SJS A;  2BE6 A;  2WC6 A;  3OBV A;  4AOM A;  2JOJ A;  1BR1 B;  3GK4 X;  1NYA A;  1S6I A;  4WQ3 A;  1IKU A;  1CMG A;  1JF2 A;  2QPT A;  2I94 A;  1JC2 A;  1NSH A;  2M49 B;  3CZ0 A;  1TUJ A;  2OS8 B;  2M8U A;  2O5G A;  4M2Q A;  2L5Y A;  3PAT A;  3OHM B;  2H61 A;  5ER5 A;  1XVJ A;  5CSF A;  2O60 A;  5CSJ A;  1A75 A;  4AQI A;  4C0J A;  2KDH A;  1WLM A;  2CNP A;  1IQ5 A;  3TS5 B;  2MA2 A;  5HKY A;  1F54 A;  2WND A;  1JSA A;  2LMV A;  2PVB A;  2JNX A;  3AKB A;  4MSP A;  2PAL A;  1C07 A;  1NCY A;  1NX2 A;  2FJU B;  3NXA A;  1DJG A;  1TIZ A;  2K61 A;  3PJI A;  1QS7 A;  4PAL A;  2RGI A;  2PSR A;  4C0L A;  1F4Q A;  1N2D A;  2JU0 A;  1PUL A;  3B86 A;  1DVI A;  3D77 A;  3O78 A;  1CDP A;  1DGV A;  1LS8 A;  4I5L B;  2F8P A;  1N0Y A;  1YX7 A;  3BXK A;  1GM0 A;  2LHL A;  1GGZ A;  5HKZ A;  3BQ3 A;  2VRG A;  1ALW A;  2LVJ A;  5KSZ A;  1TUZ A;  3DVK A;  1BT6 A;  4YRU A;  2JT8 A;  1B8R A;  1QWV A;  2QDI A;  1QIW A;  3EKJ A;  2B1U A;  2SCP A;  3VRO A;  1IQ3 A;  1YUU A;  2WCM A;  4F0Z B;  1IJ6 A;  2GGZ A;  5FYX A;  1AP4 A;  4DRW A;  2Y1M A;  3DD4 A;  1A75 B;  1M39 A;  1K9K A;  2KOT A;  3PN7 B;  2BEC A;  3TZ1 A;  3V2L A;  3FS7 A;  1H8B A;  1PK0 D;  1SKT A;  5AER A;  2JZI A;  1KFU S;  1RTP 1;  1YUR A;  1YX8 A;  3CZ1 A;  2MLF C;  4GAO A;  4A4C A;  2EHB A;  3AKA A;  3NSO A;  4ORC B;  1AUI B;  4P2Y B;  1W9Z A;  1PSR A;  2KI6 C;  1CB1 A;  4U8D A;  2LLU A;  2WCF A;  4PE0 A;  1R6P A;  1OMD A;  1PSB A;  3KEV A;  3A4U B;  3O2P A;  2KYC A;  1XFW O;  3R1V A;  2WCL A;  3VRN A;  5I2O A;  3KO0 A;  2HQ8 A;  3BFH A;  4GBA A;  1UP5 A;  1W7J B;  2OTG C;  5TNC A;  1PAL A;  2LV7 A;  1QLK A;  1YUT A;  3JVT B;  1TRF A;  2E30 A;  1G33 A;  3VRQ A;  1QIV A;  3CR5 X;  1BR4 B;  1K93 D;  2KGB C;  2ZNE A;  1Y1A A;  5I94 A;  1GGW A;  1KK8 C;  1LKJ A;  4CPV A;  3UNW A;  2KGR A;  4HRE E;  1K2H A;  2JWW A;  2NZ0 A;  5HL1 A;  4MEW A;  3FWB A;  4YI9 A;  2BCA A;  3EK8 A;  1TOP A;  1XK4 C;  1DJH A;  5JJG A;  1KSM A;  1HQV A;  1Z4H A;  3QME A;  3D0Y A;  1TN4 A;  3D10 A;  4IL1 A;  3ZNI A;  5KTY A;  3SS4 A;  1XK4 A;  4N5X A;  2LM5 A;  1KWO C;  1M31 A;  4PHK A;  1C3Y A;  2JRF A;  2LVI A;  3HX4 A;  2I18 A;  2LE9 B;  1DEK A;  1JF0 A;  3GK1 A;  3NGV A;  3EVR A;  2CT9 A;  3JTD C;  3OB1 B;  3CYZ A;  2HPS A;  3BUX B;  4MZL A;  4MN0 A;  1DJI A;  5B8I B;  3FWC A;  2BCX A;  2I7A A;  2KFH A;  1DJX A;  4A4B A;  2TN4 A;  3A8R A;  3KPX A;  1C3Z A;  3ICB A;  4DS7 A;  2ZN8 A;  3D74 A;  2H2K A;  1KFU L;  3LK1 A;  2L2C A;  3TDU A;  1OQP A;  2OTG B;  1NCX A;  1TNP A;  1S6J A;  3CGA A;  2AMI A;  4ICB A;  4NDD A;  3DXL A;  5I2Q A;  2WOS A;  2QEH A;  5I2L A;  1KSO A;  1SNL A;  5I8N A;  2JXC A;  1TCF A;  2JNF A;  1BOC A;  1SSE B;  4N1G A;  1KK8 B;  2F2P A;  2M1K B;  1G4Y R;  2L0P A;  2KFF A;  1NX3 A;  1TNQ A;  3UO9 A;  1UHK A;  3AAK A;  1ZOT B;  3QRX A;  3TDI A;  1YTZ C;  3D0Y B;  4JD9 A;  1NX1 A;  2JC2 A;  3OP0 A;  1A03 A;  2F2O A;  1MF8 B;  1S36 A;  4JPZ B;  1FBV A;  2WCK A;  2G2B A;  1KWO B;  4YGC B;  1AVS A;  1B8C A;  1CFD A;  3CAB A;  1QLS A;  1MWN A;  3MSE B;  4E68 A;  1MQ1 A;  2KLD A;  1B7T Y;  3C1V A;  1VRK A;  3JTD B;  2KNE A;  5DKQ A;  3VB1 A;  1QAT A;  1FI5 A;  5HLV A;  2WCB A;  1SL8 A;  4Q04 A;  1Y6W A;  1YVL A;  4ZCU A;  4ZCV A;  1EJ3 A;  1CDN A;  3BUW B;  2NCP A;  2ZRS A;  4PHN A;  3DF0 A;  1DMO A;  4MRX A;  2K7B A;  1F55 A;  1OOJ A;  3I5I C;  1K96 A;  4XJK A;  2M97 A;  1BLQ A;  1U5I A;  1SMG A;  2EC6 C;  3D76 A;  4BY4 A;  3LL8 B;  3WHT B;  2K2F A;  2PYQ A;  1NIW A;  2K0J A;  2M3W A;  3CTN A;  1QVI Z;  2M9G A;  1LIN A;  4INW A;  1KQM C;  2BCB A;  5KU1 A;  2WCH A;  4OCI A;  4R1E A;  3SG3 A;  4OVN F;  4PE4 A;  2FCE A;  1WDC B;  3S0D A;  1QX5 B;  1J1D A;  2ISD A;  1H4B A;  1L2O C;  1WLZ A;  1NWD A;  2LAN A;  4YGA A;  1SCM C;  4ETO A;  2WC5 A;  4DIR A;  3GK2 A;  4FQO A;  5DKN A;  3LCP C;  1TWO A;  3LK0 A;  1KK7 Z;  4DUQ A;  1K94 A;  5JOL A;  4HRG A;  5CSN A;  1BJF A;  3PAL A;  3TDZ A;  2SAS A;  1WRK A;  3RZS A;  3IQQ A;  1QTX A;  2L50 A;  1SR6 C;  2ERB A;  1OE9 B;  1SL7 A;  2LHI A;  5J3X A;  5EL2 A;  1DF0 A;  1UHH A;  4AQJ A;  1JFK A;  1ALV A;  1CDM A;  1S26 D;  3FE6 A;  1S5G Z;  4MLW A;  1B9A A;  3PLF B;  2KI6 D;  1XFU O;  4ORB B;  2FJY A;  1KFX S;  3DF0 B;  3SIB A;  1M63 B;  1DC1 A;  5F6T A;  1OZO A;  3EK4 A;  2BAP A;  1NPQ A;  2QEB A;  1EL4 A;  4XJK B;  3VRP A;  4CLN A;  1JWD A;  2K7D A;  1GQM A;  1YRT B;  2K7O A;  3EVV A;  1U5I B;  3BUM B;  2LMT A;  1B1G A;  1NCZ A;  3I5I B;  1B4C A;  3H4S E;  1YRU B;  5AXI A;  1S1E A;  2EC6 B;  2KQ6 A;  1CFF A;  2KAV A;  3L4A A;  1DJY A;  1M45 A;  1J7P A;  1QV0 A;  2L98 A;  1BG1 A;  1KQM B;  1BF5 A;  3SG6 A;  3CDN A;  3PFV A;  4PE1 A;  2Y1N A;  4XYN A;  3CZ2 A;  4L9M A;  3EKH A;  1F70 A;  2MHH A;  1L2O B;  3SG4 A;  1G8I A;  2COL B;  3L4L A;  2GTE A;  3DVJ A;  1SCM B;  3S0A A;  1Y1U A;  2LVK A;  1WRL A;  3K21 A;  4P5O E;  3S0G A;  1A29 A;  1XFY O;  3EK7 A;  2BBM A;  2WOR A;  3S0F A;  2JPT A;  3OX5 A;  4I5N B;  1F8H A;  2JT3 A;  4UPG A;  1TNW A;  1C7W A;  1IGV A;  1SRA A;  1DF0 B;  2BL0 C;  3CS1 A;  1OOH A;  1BU3 A;  2PQL A;  1DTL A;  1KQV A; 
#chains in the Genus database with same CATH homology
 1ORG A;  3R72 A;  3BFA A;  1OOI X;  5DIC A;  3B86 A;  3D77 A;  1LS8 A;  4JD9 A;  1P28 A;  1GM0 A;  4FQT A;  3NHI A;  2P70 A;  3BFB A;  1OW4 A;  3DYE A;  2WCK A;  3OGN A;  3CAB A;  1QWV A;  2QDI A;  3R1O A;  3VB1 A;  2WCJ A;  3NHT A;  3S0B A;  2H8V A;  2WCM A;  2QEV A;  4PT1 A;  1XFR A;  3V2L A;  1OOG A;  3D73 A;  3L47 A;  3CZ1 A;  3D76 A;  4INW A;  3B88 A;  2WCH A;  3FE9 A;  3S0D A;  3K1E A;  3B7A A;  3D75 A;  3R1V A;  2WCL A;  3BFH A;  2WC5 A;  1TWO A;  3B87 A;  2KPH A;  3R1P A;  3Q8I A;  3DZT A;  3RZS A;  2ERB A;  3DY9 A;  5EL2 A;  3FE6 A;  4INX A;  2FJY A;  1OOF A;  4F7F A;  2QEB A;  4OZD A;  3QME A;  3N7H A;  1C3Y A;  2P71 A;  2WC6 A;  3S0E A;  3NGV A;  3CYZ A;  3L4A A;  3CZ0 A;  3BJH A;  3D78 A;  1TUJ A;  3CDN A;  2JPO A;  3CZ2 A;  3B6X A;  1C3Z A;  1DQE A;  3L4L A;  3D74 A;  2GTE A;  3S0A A;  3S0G A;  2L2C A;  2QEO A;  3S0F A;  3DXL A;  2QEH A;  3FE8 A;  1T14 A;  1OOH A;  2PQL A;  3PJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...