4INXA

Structure of pheromone-binding protein 1 in complex with (z,z)-11,13- hexadecadienol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
SPEIMKDLSINFGKALDTCKKELDLPDSINEDFYKFWKEDYEITNRLTGCAIKCLSEKLEMVDADGKLHHGNAREFAMKHGADDAMAKQLVDLIHGCEKSIPPNDDRCMEVLSIAMCFKKEIHNLKWAPNMEVVVGEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein 1
publication title Crystallographic Observation of pH-Induced Conformational Changes in the Amyelois transitella Pheromone-Binding Protein AtraPBP1.
pubmed doi rcsb
source organism Amyelois transitella
molecule tags Pheromone-binding protein
total genus 50
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4inxA00
2PQLA 3L47A 1ORGA 3D76A 2WCKA 3R1PA 3Q8IA 1XFRA 2JPOA 2QEBA 3BJHA 3V2LA 3VB1A 1T14A 1OW4A 2GTEA 1GM0A 3B88A 2WCMA 3R72A 4INXA 3D78A 2L2CA 3FE8A 3QMEA 3K1EA 1QWVA 3BFAA 3CDNA 5EL2A 3CZ1A 4JD9A 3CABA 1OOGA 3CYZA 3S0FA 3D73A 2WCHA 4PT1A 3S0BA 2H8VA 5DICA 3R1OA 3CZ0A 3B6XA 2WC5A 3RZSA 2P70A 3NHTA 3L4AA 2WCLA 2ERBA 1P28A 3N7HA 1OOHA 2FJYA 2KPHA 3DY9A 3L4LA 2WCJA 3CZ2A 4F7FA 3S0EA 3D77A 3B7AA 3R1VA 3B87A 2P71A 3PJIA 3D75A 3OGNA 2QEOA 4INWA 1TUJA 3FE6A 3FE9A 3D74A 3NHIA 3DZTA 1LS8A 2QDIA 1OOIX 3BFHA 4OZDA 3S0AA 3B86A 1C3YA 3NGVA 3BFBA 3S0DA 1OOFA 2QEVA 1TWOA 2WC6A 3DXLA 1DQEA 3S0GA 3DYEA 2QEHA 1C3ZA 4FQTA
chains in the Genus database with same CATH superfamily
2CTNA 2LAPA 2PQLA 2WC8A 4JKTA 2M7LA 2P6BB 4MSPA 2Y1NA 1A4PA 4CFQA 2H61C 2WCKA 1Y1XA 1L2OB 1LVCD 1TNPA 2JPOA 3VB1A 1L2OC 1QIWA 2MLFC 3I5IB 1T14A 4CIDA 1J7OA 4I5NB 1OW4A 2PRUA 2CBLA 2GGZA 3WHTB 3K21A 4DRWA 2GTEA 3JVTB 2L5XB 3PM8A 1G4YR 5HLVA 3VGOA 1MQ1A 4AQIA 5I2OA 1KQMB 1RK9A 1NX3A 1RFJA 1KQMC 2WCMA 3AKAA 5IBWA 4JQ0D 1KFXS 3R72A 1F4OA 1DGVA 1M39A 2NLNA 4GAOA 1AP4A 3VROA 2M1KB 4YGAA 3D10A 2F3ZA 1DF0A 1YUSA 2LE9B 2PYQA 2LCPA 2I18A 2KLEA 4FQOA 1U5IA 5HKYA 2K60A 2Y4QA 1BT6A 1DJZA 2L51A 3EVVA 1WRZA 1NX0A 1TCOB 4ICBA 1AHRA 1SY9A 4TNCA 4WRIA 3CZ1A 5HYDA 1DT7B 2L0PA 2RGIA 2LM5A 1E8AA 2KYCA 4JD9A 3CABA 2ZNEA 3S0FA 2KYFA 1CM1A 1SSEB 2K7BA 3D73A 1BR4B 2HQ8A 2PMYA 2WCHA 1CFPA 2JC2A 3PATA 3SG5A 1UHHA 1XFUO 2LVKA 1M31A 1PSBA 1J1DA 1K9PA 1QV1A 2CXJA 2K7CA 3IVTA 1KQVA 1A75B 3EK4A 5DICA 2BL0B 4PHKA 3B6XA 4OVNF 1MF8B 2BL0C 3NHTA 2FCEA 2WCLA 4HREE 1AVSA 1OOHA 1MXEA 1XK4C 3TS5B 3VRPA 3DY9A 5HKWA 5AEQA 4XJKB 2JZIA 3KPXA 3TS5C 3CR2A 1XFVO 1XFXO 3M0WA 3OB2B 1Z2CB 3LCPC 1BG1A 1SNLA 4D1EA 1PVAA 3DF0B 3NSLA 1EH2A 2LHLA 1BR1B 2JRFA 4HSZA 2OPOA 4P5OE 5F6TA 4F7FA 3TDZA 2HPSA 2GV5A 2M29A 3EK8A 2ZRTA 3LK1A 3R1VA 5D69A 2KGBC 3QRXA 2L50A 3GK1A 1MR8A 1WRLA 3WHUB 2COLB 5DKRA 1R6PA 1MWNA 3FS7A 2QEOA 1CLLA 2FJUB 2HF5A 3D0YB 3SJSA 2M97A 1XYDA 4INWA 2KFGA 1UURA 2BBMA 3D74A 3E3RA 1N0YA 3GK4X 3GK2A 4AQJA 4XYNA 2H61A 1FI6A 3NHIA 4PE0A 3SIAA 1DGUA 1QVIY 1LA3A 3SG6A 3TZ1A 1TNXA 5AFPA 3BFHA 2ZRSA 3LK0A 1QX7A 4MN0A 1PULA 4I5JA 2KAXA 3JTDB 1M63B 1GQMA 1IRJA 1QASA 1YTZC 2E6WA 2L4HA 3NGVA 3JTDC 2AMIA 5I94A 1OSAA 1B47A 1QLSA 1SMGA 2JPTA 3O4YA 3OX6A 1D1OA 1UHNA 4GUKA 4PE4A 4YGDB 1FI5A 2LUXA 1W7JB 1H8BA 2OTGB 1C3ZA 2JTZA 1WDCB 2OTGC 2SASA 1WDCC 3D76A 1J7PA 1AJ5A 1LINA 1HQVA 1YUTA 4N1FA 5KSZA 1A2XA 4UPGA 3KF9A 3RM1A 1B1GA 3V2LA 1BJFA 1PALA 1CLBA 3CLNA 1M46A 5BPJA 3SG2A 3O2PA 1NWDA 1GM0A 1H4BA 2PALA 2ZNDA 1F4QA 2EGDA 2BKIB 2MHHA 1IGVA 1B7TY 1S5GZ 2MLEC 4GPLB 2JXLA 3B88A 1A75A 1OMVA 1BU3A 2LANA 2LHIA 5ER5A 1KK7Y 4QJ5B 3TDIA 1QIVA 4PE1A 3D78A 1DC1A 1XK4A 4MZJA 3EVUA 3FE8A 4XJKA 2OS8B 3EK7A 2Y5IA 4OR9B 2KFFA 1Y1UA 1K95A 3BFAA 4IJ7A 4N5XA 1SK6D 5EL2A 1XFYO 3DF0A 4NDBA 4DIRA 5D7FA 1F54A 3SG7A 1F8HA 1S6CA 2JULA 4YGBB 1S26D 3BUMB 4YGCB 1PK0D 3I5IC 1SYMA 5PALA 4MLWA 1JSAA 3MSEB 4GGNA 1V1GA 1GGZA 1S6JA 3JVTC 5CSJA 1J1EA 1DJYA 4PHNA 3D0YA 4GGFC 5GQQC 1NP8A 1JF0A 3BOWB 1RTP1 1CB1A 1M45A 2WC5A 3RZSA 1CDLA 3SS4A 3L4AA 2JWWA 1B8RA 2ERBA 1P28A 3AKBA 1NPQA 2K8MB 1K94A 1RECA 3BUWB 5G08A 2KQ6A 2O5GA 3LL8B 1Q80A 2K61A 2KNEA 4YBHB 4BY4A 1WLZA 1TN4A 1EG4A 5ER4X 3ZNIA 2LVIA 2QPTA 1JFJA 1UHIA 2V53A 3OX5A 1S6IA 1GGWA 3B7AA 1TNQA 2I2RE 4PHMA 1F55A 2F33A 1IWQA 3PLFB 3IF7A 1PVBA 3D75A 1RWYA 2K7OA 3I5FB 5FI2A 3UNWA 3WXAA 4HRGA 3FE9A 3VRQA 2KI6C 2FCDA 3I5HB 1NCZA 2M3WA 3DVMA 4Q04A 1LS8A 1CFDA 3I5HC 1FF1A 2KFHA 2KLDA 4U8DA 4PDZA 1ZOTB 3FWBA 1KFXL 3PN7B 5CSIA 1JWDA 1SL7A 1OOIX 2NCPA 2M7NA 3PN7C 4HRHA 4NDCA 5I2QA 1CDNA 3C1VA 2R2IA 1JBAA 1LA0A 2L5YA 3OHMB 2LLSA 2BKHB 4MZLA 4R1EA 3WNXB 3B86A 1BOCA 4DCKA 1JF2A 3BFBA 1A03A 3S0DA 1NCYA 3BYAA 1KCYA 1QATA 2QEVA 1TWOA 1ZMZA 1XFWO 1OZOA 1XFZO 2WC6A 3DXLA 1DQEA 3S0GA 4DUQA 2LNKA 2QEHA 1IQ3A 4QJ4B 2ZN8A 1IKUA 1EL4A 2TN4A 1ORGA 3OB1B 1WY9A 1XA5A 3CGAA 1CMFA 3O78A 2JQ6A 1PRWA 1SRAA 1QLKA 1YRTB 3Q8IA 2K2AA 1BLQA 2HQWA 2LV7A 1XFRA 3NXAA 4PALA 2D8NA 1JUOA 3RLZA 1IH0A 1Y6WA 2LMVA 1UHKA 3AAJA 2AAOA 3PM2A 1K9KA 2F2PA 1VRKA 1ODBA 3F45A 4MBEA 3FWCA 2KBIA 2PVBA 3PSRA 5HLOA 3UO9A 4GGFA 2CNPA 2JNXA 2KAYA 3PALA 1ALVA 2WORA 3BOWA 5FI6A 2A4JA 2LMTA 2VRGA 4ORBB 1F70A 4PCWA 4INXA 4L9MA 2LLUA 1CDMA 2K7DA 1YX7A 2KSPA 2SCPA 1B9AA 4PE7A 2YGUA 1F71A 2WCFA 1DJWA 1QWVA 1YURA 2BE4A 2L4IA 3CDNA 1KSOA 4DS7A 1B8CA 1DTLA 3BUNB 1N65A 3SS5A 1OOGA 3CYZA 1N2DA 2ZKMX 2PASA 1YUUA 2KI4B 1OMRA 1SCVA 2H8VA 1C07A 1CDPA 2KI4C 4CFRA 2H2KA 5I2LA 2LP3A 2ZFDA 1DEKA 3CZ0A 1KK8B 1LKJA 4MVFA 1BODA 3CR5X 2HETA 1IIOA 3N7HA 3AAKA 1QS7A 4ORAB 2FJYA 2KPHA 5FI7A 3VRRA 4YRUA 1DJGA 2K0JA 4USLA 1B4CA 5AERA 2OS8C 3L4LA 1MXLC 4NQGA 2IS9A 2ZN9A 1CNPA 4OCIA 1XVJA 2JT8A 1ALWA 2O60A 1OMDA 2WCJA 1NSHA 4CLNA 1L7ZA 3BXKA 2LLTA 4F0ZB 1OOJA 1SW8A 2KDHA 5KTYA 1TCFA 1R2UA 3S0EA 1CM4A 5AANA 1BMOA 1AK8A 1RROA 3D77A 3HX4A 5K89A 1S3PA 3FIAA 2CT9A 2BBNA 2JNFA 4I5LB 2MAZA 2M0RA 1NUBA 5CSNA 3PJIA 1BF5A 1CLMA 2L98A 3IQQA 1G33A 1C7WA 1CTRA 1K96A 3NSKA 1S1EA 3FE6A 2JU0A 1LXFC 1CMGA 5HL1A 1TRFA 3DVEA 2PSRA 1CFFA 3CR4X 3DZTA 4BY5A 3H4SE 5JOLA 3EKJA 1IJ5A 1QJTA 1J7QA 3EKHA 2ISDA 1YRUB 2Q91A 2FOTA 1SR6B 1K2HA 1RJVA 4IL1A 1SL8A 1SR6C 1W7IB 1HT9A 1TNWA 1C3YA 2QACA 2BNXA 1FW4A 2BE6A 4QJ3B 5JJGA 3ZWHA 1B8LA 2EC6B 2BECA 1OOFA 2K2FA 2EC6C 1SKTA 2JTTA 1YX8A 2BCXA 2M8UA 2AUCA 2WOSA 3DVJA 3DYEA 3I5FC 1ZUZA 4I5KA 1QX2A 3TDUA 4E68A 1Y1AA 3L47A 3HCMA 4FTGA 1Z4HA 2B1UA 2JT0A 2LVVA 1OE9B 4OV2A 1B7TZ 1UHJA 2LUCA 2WCBA 3KHEA 3R1PA 4M2QA 3GOFA 1ZACA 2JXCA 1KK7Z 1AJ4A 2M9GA 3BJHA 2QEBA 2JOJA 1QTXA 1K93D 2I94A 4ZCVA 2M49B 1DJHA 4MRXA 5J3XA 1EJ3A 2WNDA 4M2PA 4WQ3A 1KFUS 1SL9A 4A4CA 5DKQA 2G9BA 1UP5A 4JWQA 2I7AA 3CS1A 4N1GA 2MJWB 1MHOA 1JC2A 2KGRA 3BUXB 3ICBA 3NSOA 2LC5A 2KHNA 1K90D 2L2CA 5CSFA 1FPWA 4YI8A 2WCEA 1C7VA 3SS3A 4JPZB 4C0LA 1V1FA 4MEWA 3QMEA 3K1EA 1DJIA 1SCMB 3DVKA 2F2OA 1DMOA 3OP0A 1S5GY 1SCMC 1YVLA 1ZFSA 5I8NA 5KU1A 1WRKA 5B8IB 1AUIB 2LMUA 3CWGA 3BUOB 3O6BA 4ORCB 2NXQA 2KBMA 2KQYA 3A8RA 4C0KA 1J55A 2BCBA 4PT1A 3S0BA 2M1UA 1WLMA 1YR5A 2Q4UA 4OKHA 1UUSA 1IJ6A 1EXRA 3PFVA 1K8UA 1SPYA 3LLEA 1FBVA 3SIBA 5CPVA 1TIZA 2BAPA 2NZ0A 5DKNA 1NIWA 1S36A 1KFUL 2F3YA 3R1OA 4PHJA 3CZTX 2P70A 4YI9A 1EG3A 3I5GB 4GNKB 5D3OA 1NX1A 1QX5B 2CCMA 1DF0B 1NX2A 1W9ZA 3EG5B 1MUXA 3EVRA 2EHBA 3I5GC 3O4XA 3BQ3A 4MRYA 3KO0A 4GBAA 5TNCA 4M2OA 1U5IB 1OQPA 2LP2A 3NSIA 4MZKA 3SG4A 4A4BA 1DVIA 1A29A 3CTNA 2G2BA 2NCOA 4CPVA 1TOPA 2KOTA 4ZCUA 4KYNA 1NCXA 3OBVA 3CZ2A 4AOMA 1TUZA 4ETOA 3B87A 3A4UB 5HKZA 2P71A 1JFKA 3SG3A 1GJYA 3IQOA 4YGEB 2LVJA 3OGNA 3DD4A 1YVHA 1QV0A 4P2YB 1TUJA 1QXPA 2MRDA 1SBJA 1KSMA 1XO5A 2JT3A 1CFCA 1KK8C 2L2EA 2BCAA 1G8IA 3KEVA 2Y1MA 2QDIA 1KWOB 4GFTA 1OZSA 1Y0VH 5AXIA 1KWOC 4OZDA 1CKKA 2MA2A 3TUYB 2E30A 3VRNA 2F8PA 1DELA 2GGMA 1PSRA 2KAVA 3TUYC 3S0AA 2MBXA 2KI6D 1TTXA 1IG5A 5FYXA 1QVIZ 4NDDA 1K9UA 4WQ2A 1J7RA 1NYAA 2DOQA 1DJXA 1UWOA 1X02A 1IQ5A 4C0JA 4FQTA
chains in the Genus database with same CATH topology
2PQLA 3L47A 1ORGA 3D76A 2WCKA 3R1PA 3Q8IA 1XFRA 2JPOA 2QEBA 3BJHA 3V2LA 3VB1A 1T14A 1OW4A 2GTEA 1GM0A 3B88A 2WCMA 3R72A 4INXA 3D78A 2L2CA 3FE8A 3QMEA 3K1EA 1QWVA 3BFAA 3CDNA 5EL2A 3CZ1A 4JD9A 3CABA 1OOGA 3CYZA 3S0FA 3D73A 2WCHA 4PT1A 3S0BA 2H8VA 5DICA 3R1OA 3CZ0A 3B6XA 2WC5A 3RZSA 2P70A 3NHTA 3L4AA 2WCLA 2ERBA 1P28A 3N7HA 1OOHA 2FJYA 2KPHA 3DY9A 3L4LA 2WCJA 3CZ2A 4F7FA 3S0EA 3D77A 3B7AA 3R1VA 3B87A 2P71A 3PJIA 3D75A 3OGNA 2QEOA 4INWA 1TUJA 3FE6A 3FE9A 3D74A 3NHIA 3DZTA 1LS8A 2QDIA 1OOIX 3BFHA 4OZDA 3S0AA 3B86A 1C3YA 3NGVA 3BFBA 3S0DA 1OOFA 2QEVA 1TWOA 2WC6A 3DXLA 1DQEA 3S0GA 3DYEA 2QEHA 1C3ZA 4FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQL A;  3L47 A;  1ORG A;  3D76 A;  2WCK A;  3R1P A;  3Q8I A;  1XFR A;  2JPO A;  2QEB A;  3BJH A;  3V2L A;  3VB1 A;  1T14 A;  1OW4 A;  2GTE A;  1GM0 A;  3B88 A;  2WCM A;  3R72 A;  4INX A;  3D78 A;  2L2C A;  3FE8 A;  3QME A;  3K1E A;  1QWV A;  3BFA A;  3CDN A;  5EL2 A;  3CZ1 A;  4JD9 A;  3CAB A;  1OOG A;  3CYZ A;  3S0F A;  3D73 A;  2WCH A;  4PT1 A;  3S0B A;  2H8V A;  5DIC A;  3R1O A;  3CZ0 A;  3B6X A;  2WC5 A;  3RZS A;  2P70 A;  3NHT A;  3L4A A;  2WCL A;  2ERB A;  1P28 A;  3N7H A;  1OOH A;  2FJY A;  2KPH A;  3DY9 A;  3L4L A;  2WCJ A;  3CZ2 A;  4F7F A;  3S0E A;  3D77 A;  3B7A A;  3R1V A;  3B87 A;  2P71 A;  3PJI A;  3D75 A;  3OGN A;  2QEO A;  4INW A;  1TUJ A;  3FE6 A;  3FE9 A;  3D74 A;  3NHI A;  3DZT A;  1LS8 A;  2QDI A;  1OOI X;  3BFH A;  4OZD A;  3S0A A;  3B86 A;  1C3Y A;  3NGV A;  3BFB A;  3S0D A;  1OOF A;  2QEV A;  1TWO A;  2WC6 A;  3DXL A;  1DQE A;  3S0G A;  3DYE A;  2QEH A;  1C3Z A;  4FQT A; 
#chains in the Genus database with same CATH topology
 2CTN A;  2LAP A;  2PQL A;  2WC8 A;  4JKT A;  2M7L A;  2P6B B;  4MSP A;  2Y1N A;  1A4P A;  4CFQ A;  2H61 C;  2WCK A;  1Y1X A;  1L2O B;  1LVC D;  1TNP A;  2JPO A;  3VB1 A;  1L2O C;  1QIW A;  2MLF C;  3I5I B;  1T14 A;  4CID A;  1J7O A;  4I5N B;  1OW4 A;  2PRU A;  2CBL A;  2GGZ A;  3WHT B;  3K21 A;  4DRW A;  2GTE A;  3JVT B;  2L5X B;  3PM8 A;  1G4Y R;  5HLV A;  3VGO A;  1MQ1 A;  4AQI A;  5I2O A;  1KQM B;  1RK9 A;  1NX3 A;  1RFJ A;  1KQM C;  2WCM A;  3AKA A;  5IBW A;  4JQ0 D;  1KFX S;  3R72 A;  1F4O A;  1DGV A;  1M39 A;  2NLN A;  4GAO A;  1AP4 A;  3VRO A;  2M1K B;  4YGA A;  3D10 A;  2F3Z A;  1DF0 A;  1YUS A;  2LE9 B;  2PYQ A;  2LCP A;  2I18 A;  2KLE A;  4FQO A;  1U5I A;  5HKY A;  2K60 A;  2Y4Q A;  1BT6 A;  1DJZ A;  2L51 A;  3EVV A;  1WRZ A;  1NX0 A;  1TCO B;  4ICB A;  1AHR A;  1SY9 A;  4TNC A;  4WRI A;  3CZ1 A;  5HYD A;  1DT7 B;  2L0P A;  2RGI A;  2LM5 A;  1E8A A;  2KYC A;  4JD9 A;  3CAB A;  2ZNE A;  3S0F A;  2KYF A;  1CM1 A;  1SSE B;  2K7B A;  3D73 A;  1BR4 B;  2HQ8 A;  2PMY A;  2WCH A;  1CFP A;  2JC2 A;  3PAT A;  3SG5 A;  1UHH A;  1XFU O;  2LVK A;  1M31 A;  1PSB A;  1J1D A;  1K9P A;  1QV1 A;  2CXJ A;  2K7C A;  3IVT A;  1KQV A;  1A75 B;  3EK4 A;  5DIC A;  2BL0 B;  4PHK A;  3B6X A;  4OVN F;  1MF8 B;  2BL0 C;  3NHT A;  2FCE A;  2WCL A;  4HRE E;  1AVS A;  1OOH A;  1MXE A;  1XK4 C;  3TS5 B;  3VRP A;  3DY9 A;  5HKW A;  5AEQ A;  4XJK B;  2JZI A;  3KPX A;  3TS5 C;  3CR2 A;  1XFV O;  1XFX O;  3M0W A;  3OB2 B;  1Z2C B;  3LCP C;  1BG1 A;  1SNL A;  4D1E A;  1PVA A;  3DF0 B;  3NSL A;  1EH2 A;  2LHL A;  1BR1 B;  2JRF A;  4HSZ A;  2OPO A;  4P5O E;  5F6T A;  4F7F A;  3TDZ A;  2HPS A;  2GV5 A;  2M29 A;  3EK8 A;  2ZRT A;  3LK1 A;  3R1V A;  5D69 A;  2KGB C;  3QRX A;  2L50 A;  3GK1 A;  1MR8 A;  1WRL A;  3WHU B;  2COL B;  5DKR A;  1R6P A;  1MWN A;  3FS7 A;  2QEO A;  1CLL A;  2FJU B;  2HF5 A;  3D0Y B;  3SJS A;  2M97 A;  1XYD A;  4INW A;  2KFG A;  1UUR A;  2BBM A;  3D74 A;  3E3R A;  1N0Y A;  3GK4 X;  3GK2 A;  4AQJ A;  4XYN A;  2H61 A;  1FI6 A;  3NHI A;  4PE0 A;  3SIA A;  1DGU A;  1QVI Y;  1LA3 A;  3SG6 A;  3TZ1 A;  1TNX A;  5AFP A;  3BFH A;  2ZRS A;  3LK0 A;  1QX7 A;  4MN0 A;  1PUL A;  4I5J A;  2KAX A;  3JTD B;  1M63 B;  1GQM A;  1IRJ A;  1QAS A;  1YTZ C;  2E6W A;  2L4H A;  3NGV A;  3JTD C;  2AMI A;  5I94 A;  1OSA A;  1B47 A;  1QLS A;  1SMG A;  2JPT A;  3O4Y A;  3OX6 A;  1D1O A;  1UHN A;  4GUK A;  4PE4 A;  4YGD B;  1FI5 A;  2LUX A;  1W7J B;  1H8B A;  2OTG B;  1C3Z A;  2JTZ A;  1WDC B;  2OTG C;  2SAS A;  1WDC C;  3D76 A;  1J7P A;  1AJ5 A;  1LIN A;  1HQV A;  1YUT A;  4N1F A;  5KSZ A;  1A2X A;  4UPG A;  3KF9 A;  3RM1 A;  1B1G A;  3V2L A;  1BJF A;  1PAL A;  1CLB A;  3CLN A;  1M46 A;  5BPJ A;  3SG2 A;  3O2P A;  1NWD A;  1GM0 A;  1H4B A;  2PAL A;  2ZND A;  1F4Q A;  2EGD A;  2BKI B;  2MHH A;  1IGV A;  1B7T Y;  1S5G Z;  2MLE C;  4GPL B;  2JXL A;  3B88 A;  1A75 A;  1OMV A;  1BU3 A;  2LAN A;  2LHI A;  5ER5 A;  1KK7 Y;  4QJ5 B;  3TDI A;  1QIV A;  4PE1 A;  3D78 A;  1DC1 A;  1XK4 A;  4MZJ A;  3EVU A;  3FE8 A;  4XJK A;  2OS8 B;  3EK7 A;  2Y5I A;  4OR9 B;  2KFF A;  1Y1U A;  1K95 A;  3BFA A;  4IJ7 A;  4N5X A;  1SK6 D;  5EL2 A;  1XFY O;  3DF0 A;  4NDB A;  4DIR A;  5D7F A;  1F54 A;  3SG7 A;  1F8H A;  1S6C A;  2JUL A;  4YGB B;  1S26 D;  3BUM B;  4YGC B;  1PK0 D;  3I5I C;  1SYM A;  5PAL A;  4MLW A;  1JSA A;  3MSE B;  4GGN A;  1V1G A;  1GGZ A;  1S6J A;  3JVT C;  5CSJ A;  1J1E A;  1DJY A;  4PHN A;  3D0Y A;  4GGF C;  5GQQ C;  1NP8 A;  1JF0 A;  3BOW B;  1RTP 1;  1CB1 A;  1M45 A;  2WC5 A;  3RZS A;  1CDL A;  3SS4 A;  3L4A A;  2JWW A;  1B8R A;  2ERB A;  1P28 A;  3AKB A;  1NPQ A;  2K8M B;  1K94 A;  1REC A;  3BUW B;  5G08 A;  2KQ6 A;  2O5G A;  3LL8 B;  1Q80 A;  2K61 A;  2KNE A;  4YBH B;  4BY4 A;  1WLZ A;  1TN4 A;  1EG4 A;  5ER4 X;  3ZNI A;  2LVI A;  2QPT A;  1JFJ A;  1UHI A;  2V53 A;  3OX5 A;  1S6I A;  1GGW A;  3B7A A;  1TNQ A;  2I2R E;  4PHM A;  1F55 A;  2F33 A;  1IWQ A;  3PLF B;  3IF7 A;  1PVB A;  3D75 A;  1RWY A;  2K7O A;  3I5F B;  5FI2 A;  3UNW A;  3WXA A;  4HRG A;  3FE9 A;  3VRQ A;  2KI6 C;  2FCD A;  3I5H B;  1NCZ A;  2M3W A;  3DVM A;  4Q04 A;  1LS8 A;  1CFD A;  3I5H C;  1FF1 A;  2KFH A;  2KLD A;  4U8D A;  4PDZ A;  1ZOT B;  3FWB A;  1KFX L;  3PN7 B;  5CSI A;  1JWD A;  1SL7 A;  1OOI X;  2NCP A;  2M7N A;  3PN7 C;  4HRH A;  4NDC A;  5I2Q A;  1CDN A;  3C1V A;  2R2I A;  1JBA A;  1LA0 A;  2L5Y A;  3OHM B;  2LLS A;  2BKH B;  4MZL A;  4R1E A;  3WNX B;  3B86 A;  1BOC A;  4DCK A;  1JF2 A;  3BFB A;  1A03 A;  3S0D A;  1NCY A;  3BYA A;  1KCY A;  1QAT A;  2QEV A;  1TWO A;  1ZMZ A;  1XFW O;  1OZO A;  1XFZ O;  2WC6 A;  3DXL A;  1DQE A;  3S0G A;  4DUQ A;  2LNK A;  2QEH A;  1IQ3 A;  4QJ4 B;  2ZN8 A;  1IKU A;  1EL4 A;  2TN4 A;  1ORG A;  3OB1 B;  1WY9 A;  1XA5 A;  3CGA A;  1CMF A;  3O78 A;  2JQ6 A;  1PRW A;  1SRA A;  1QLK A;  1YRT B;  3Q8I A;  2K2A A;  1BLQ A;  2HQW A;  2LV7 A;  1XFR A;  3NXA A;  4PAL A;  2D8N A;  1JUO A;  3RLZ A;  1IH0 A;  1Y6W A;  2LMV A;  1UHK A;  3AAJ A;  2AAO A;  3PM2 A;  1K9K A;  2F2P A;  1VRK A;  1ODB A;  3F45 A;  4MBE A;  3FWC A;  2KBI A;  2PVB A;  3PSR A;  5HLO A;  3UO9 A;  4GGF A;  2CNP A;  2JNX A;  2KAY A;  3PAL A;  1ALV A;  2WOR A;  3BOW A;  5FI6 A;  2A4J A;  2LMT A;  2VRG A;  4ORB B;  1F70 A;  4PCW A;  4INX A;  4L9M A;  2LLU A;  1CDM A;  2K7D A;  1YX7 A;  2KSP A;  2SCP A;  1B9A A;  4PE7 A;  2YGU A;  1F71 A;  2WCF A;  1DJW A;  1QWV A;  1YUR A;  2BE4 A;  2L4I A;  3CDN A;  1KSO A;  4DS7 A;  1B8C A;  1DTL A;  3BUN B;  1N65 A;  3SS5 A;  1OOG A;  3CYZ A;  1N2D A;  2ZKM X;  2PAS A;  1YUU A;  2KI4 B;  1OMR A;  1SCV A;  2H8V A;  1C07 A;  1CDP A;  2KI4 C;  4CFR A;  2H2K A;  5I2L A;  2LP3 A;  2ZFD A;  1DEK A;  3CZ0 A;  1KK8 B;  1LKJ A;  4MVF A;  1BOD A;  3CR5 X;  2HET A;  1IIO A;  3N7H A;  3AAK A;  1QS7 A;  4ORA B;  2FJY A;  2KPH A;  5FI7 A;  3VRR A;  4YRU A;  1DJG A;  2K0J A;  4USL A;  1B4C A;  5AER A;  2OS8 C;  3L4L A;  1MXL C;  4NQG A;  2IS9 A;  2ZN9 A;  1CNP A;  4OCI A;  1XVJ A;  2JT8 A;  1ALW A;  2O60 A;  1OMD A;  2WCJ A;  1NSH A;  4CLN A;  1L7Z A;  3BXK A;  2LLT A;  4F0Z B;  1OOJ A;  1SW8 A;  2KDH A;  5KTY A;  1TCF A;  1R2U A;  3S0E A;  1CM4 A;  5AAN A;  1BMO A;  1AK8 A;  1RRO A;  3D77 A;  3HX4 A;  5K89 A;  1S3P A;  3FIA A;  2CT9 A;  2BBN A;  2JNF A;  4I5L B;  2MAZ A;  2M0R A;  1NUB A;  5CSN A;  3PJI A;  1BF5 A;  1CLM A;  2L98 A;  3IQQ A;  1G33 A;  1C7W A;  1CTR A;  1K96 A;  3NSK A;  1S1E A;  3FE6 A;  2JU0 A;  1LXF C;  1CMG A;  5HL1 A;  1TRF A;  3DVE A;  2PSR A;  1CFF A;  3CR4 X;  3DZT A;  4BY5 A;  3H4S E;  5JOL A;  3EKJ A;  1IJ5 A;  1QJT A;  1J7Q A;  3EKH A;  2ISD A;  1YRU B;  2Q91 A;  2FOT A;  1SR6 B;  1K2H A;  1RJV A;  4IL1 A;  1SL8 A;  1SR6 C;  1W7I B;  1HT9 A;  1TNW A;  1C3Y A;  2QAC A;  2BNX A;  1FW4 A;  2BE6 A;  4QJ3 B;  5JJG A;  3ZWH A;  1B8L A;  2EC6 B;  2BEC A;  1OOF A;  2K2F A;  2EC6 C;  1SKT A;  2JTT A;  1YX8 A;  2BCX A;  2M8U A;  2AUC A;  2WOS A;  3DVJ A;  3DYE A;  3I5F C;  1ZUZ A;  4I5K A;  1QX2 A;  3TDU A;  4E68 A;  1Y1A A;  3L47 A;  3HCM A;  4FTG A;  1Z4H A;  2B1U A;  2JT0 A;  2LVV A;  1OE9 B;  4OV2 A;  1B7T Z;  1UHJ A;  2LUC A;  2WCB A;  3KHE A;  3R1P A;  4M2Q A;  3GOF A;  1ZAC A;  2JXC A;  1KK7 Z;  1AJ4 A;  2M9G A;  3BJH A;  2QEB A;  2JOJ A;  1QTX A;  1K93 D;  2I94 A;  4ZCV A;  2M49 B;  1DJH A;  4MRX A;  5J3X A;  1EJ3 A;  2WND A;  4M2P A;  4WQ3 A;  1KFU S;  1SL9 A;  4A4C A;  5DKQ A;  2G9B A;  1UP5 A;  4JWQ A;  2I7A A;  3CS1 A;  4N1G A;  2MJW B;  1MHO A;  1JC2 A;  2KGR A;  3BUX B;  3ICB A;  3NSO A;  2LC5 A;  2KHN A;  1K90 D;  2L2C A;  5CSF A;  1FPW A;  4YI8 A;  2WCE A;  1C7V A;  3SS3 A;  4JPZ B;  4C0L A;  1V1F A;  4MEW A;  3QME A;  3K1E A;  1DJI A;  1SCM B;  3DVK A;  2F2O A;  1DMO A;  3OP0 A;  1S5G Y;  1SCM C;  1YVL A;  1ZFS A;  5I8N A;  5KU1 A;  1WRK A;  5B8I B;  1AUI B;  2LMU A;  3CWG A;  3BUO B;  3O6B A;  4ORC B;  2NXQ A;  2KBM A;  2KQY A;  3A8R A;  4C0K A;  1J55 A;  2BCB A;  4PT1 A;  3S0B A;  2M1U A;  1WLM A;  1YR5 A;  2Q4U A;  4OKH A;  1UUS A;  1IJ6 A;  1EXR A;  3PFV A;  1K8U A;  1SPY A;  3LLE A;  1FBV A;  3SIB A;  5CPV A;  1TIZ A;  2BAP A;  2NZ0 A;  5DKN A;  1NIW A;  1S36 A;  1KFU L;  2F3Y A;  3R1O A;  4PHJ A;  3CZT X;  2P70 A;  4YI9 A;  1EG3 A;  3I5G B;  4GNK B;  5D3O A;  1NX1 A;  1QX5 B;  2CCM A;  1DF0 B;  1NX2 A;  1W9Z A;  3EG5 B;  1MUX A;  3EVR A;  2EHB A;  3I5G C;  3O4X A;  3BQ3 A;  4MRY A;  3KO0 A;  4GBA A;  5TNC A;  4M2O A;  1U5I B;  1OQP A;  2LP2 A;  3NSI A;  4MZK A;  3SG4 A;  4A4B A;  1DVI A;  1A29 A;  3CTN A;  2G2B A;  2NCO A;  4CPV A;  1TOP A;  2KOT A;  4ZCU A;  4KYN A;  1NCX A;  3OBV A;  3CZ2 A;  4AOM A;  1TUZ A;  4ETO A;  3B87 A;  3A4U B;  5HKZ A;  2P71 A;  1JFK A;  3SG3 A;  1GJY A;  3IQO A;  4YGE B;  2LVJ A;  3OGN A;  3DD4 A;  1YVH A;  1QV0 A;  4P2Y B;  1TUJ A;  1QXP A;  2MRD A;  1SBJ A;  1KSM A;  1XO5 A;  2JT3 A;  1CFC A;  1KK8 C;  2L2E A;  2BCA A;  1G8I A;  3KEV A;  2Y1M A;  2QDI A;  1KWO B;  4GFT A;  1OZS A;  1Y0V H;  5AXI A;  1KWO C;  4OZD A;  1CKK A;  2MA2 A;  3TUY B;  2E30 A;  3VRN A;  2F8P A;  1DEL A;  2GGM A;  1PSR A;  2KAV A;  3TUY C;  3S0A A;  2MBX A;  2KI6 D;  1TTX A;  1IG5 A;  5FYX A;  1QVI Z;  4NDD A;  1K9U A;  4WQ2 A;  1J7R A;  1NYA A;  2DOQ A;  1DJX A;  1UWO A;  1X02 A;  1IQ5 A;  4C0J A;  4FQT A; 
#chains in the Genus database with same CATH homology
 2PQL A;  3L47 A;  1ORG A;  3D76 A;  2WCK A;  3R1P A;  3Q8I A;  1XFR A;  2JPO A;  2QEB A;  3BJH A;  3V2L A;  3VB1 A;  1T14 A;  1OW4 A;  2GTE A;  1GM0 A;  3B88 A;  2WCM A;  3R72 A;  4INX A;  3D78 A;  2L2C A;  3FE8 A;  3QME A;  3K1E A;  1QWV A;  3BFA A;  3CDN A;  5EL2 A;  3CZ1 A;  4JD9 A;  3CAB A;  1OOG A;  3CYZ A;  3S0F A;  3D73 A;  2WCH A;  4PT1 A;  3S0B A;  2H8V A;  5DIC A;  3R1O A;  3CZ0 A;  3B6X A;  2WC5 A;  3RZS A;  2P70 A;  3NHT A;  3L4A A;  2WCL A;  2ERB A;  1P28 A;  3N7H A;  1OOH A;  2FJY A;  2KPH A;  3DY9 A;  3L4L A;  2WCJ A;  3CZ2 A;  4F7F A;  3S0E A;  3D77 A;  3B7A A;  3R1V A;  3B87 A;  2P71 A;  3PJI A;  3D75 A;  3OGN A;  2QEO A;  4INW A;  1TUJ A;  3FE6 A;  3FE9 A;  3D74 A;  3NHI A;  3DZT A;  1LS8 A;  2QDI A;  1OOI X;  3BFH A;  4OZD A;  3S0A A;  3B86 A;  1C3Y A;  3NGV A;  3BFB A;  3S0D A;  1OOF A;  2QEV A;  1TWO A;  2WC6 A;  3DXL A;  1DQE A;  3S0G A;  3DYE A;  2QEH A;  1C3Z A;  4FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...