4INXA

Structure of pheromone-binding protein 1 in complex with (z,z)-11,13- hexadecadienol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
SPEIMKDLSINFGKALDTCKKELDLPDSINEDFYKFWKEDYEITNRLTGCAIKCLSEKLEMVDADGKLHHGNAREFAMKHGADDAMAKQLVDLIHGCEKSIPPNDDRCMEVLSIAMCFKKEIHNLKWAPNMEVVVGEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein 1
publication title Crystallographic Observation of pH-Induced Conformational Changes in the Amyelois transitella Pheromone-Binding Protein AtraPBP1.
pubmed doi rcsb
source organism Amyelois transitella
molecule tags Pheromone-binding protein
total genus 50
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4inxA00
3V2LA 1GM0A 1OW4A 3NGVA 2JPOA 3N7HA 3S0FA 2PQLA 1TUJA 3PJIA 2GTEA 2QEHA 3R1OA 3BFBA 3NHIA 2P71A 4F7FA 3D75A 1C3ZA 3B7AA 3D77A 3L4AA 3L47A 3NHTA 3B88A 3S0AA 1XFRA 3CYZA 2WCLA 3B87A 3DZTA 2P70A 2WC6A 3CABA 1OOIX 2WCMA 3BJHA 3R1PA 2WCKA 3FE8A 4INXA 3S0GA 3BFHA 3L4LA 3R72A 2WCHA 1OOGA 4OZDA 3S0BA 2KPHA 5EL2A 4INWA 2L2CA 1T14A 3BFAA 2QEOA 2WCJA 1C3YA 3D74A 2ERBA 3S0EA 3S0DA 3RZSA 1QWVA 3CZ2A 1P28A 3B86A 4FQTA 3B6XA 3DY9A 2QEBA 4JD9A 3D78A 1TWOA 3DYEA 3FE6A 3DXLA 1ORGA 2QDIA 5DICA 3CZ1A 3QMEA 3FE9A 3D76A 3D73A 3R1VA 1OOHA 1LS8A 3K1EA 3VB1A 3OGNA 2WC5A 2H8VA 2FJYA 4PT1A 1OOFA 3CZ0A 1DQEA 3Q8IA 3CDNA 2QEVA
chains in the Genus database with same CATH superfamily
5B8IB 2BKIB 2JPOA 2KNEA 1AUIB 1NCXA 2LAPA 3KF9A 1M39A 1TRFA 4P2YB 1QLSA 2OTGB 1ZMZA 1EG3A 1CB1A 2PQLA 1UHKA 1SSEB 1S6IA 4HREE 3VRNA 5K89A 4DUQA 1EXRA 3BFBA 2LP2A 3E3RA 3NHIA 3TS5B 1H8BA 2LV7A 1V1GA 2LUCA 1WRKA 2BCXA 2P71A 2L4IA 2PASA 2A4JA 2WOSA 1YRTB 3BUMB 5FI6A 1SL8A 2JC2A 2JNFA 1SNLA 2LVJA 1LKJA 2QPTA 1SL9A 2KGBC 3AKBA 1CFDA 1QXPA 2JXLA 1S3PA 3D77A 1J55A 1FI5A 5J3XA 4GUKA 3L47A 1DJGA 2BECA 3NHTA 1IRJA 2F2OA 4XJKB 1WDCB 1LA3A 1XVJA 5AERA 1NCZA 5JJGA 4R1EA 2FJUB 2Q91A 4P5OE 1XFRA 4HRGA 3DD4A 1SK6D 2WCLA 3B87A 1UP5A 3CABA 2KYCA 3EK8A 5CSFA 2KFFA 4WQ2A 3K21A 1FF1A 1J7RA 2K61A 4KYNA 4MZLA 5CPVA 3BJHA 4YBHB 4GAOA 5D3OA 5HLOA 3OX6A 1GJYA 1TUZA 1SPYA 1SCVA 2NCOA 3C1VA 1BT6A 2BBMA 3NSLA 1G8IA 3OHMB 1KQMB 3HX4A 4DRWA 3L4LA 2L50A 3R72A 4ZCUA 4PHMA 1WLZA 1M63B 4AOMA 4E68A 1PK0D 2F33A 4OVNF 1B47A 2I18A 2P6BB 5FYXA 3JTDC 1TNWA 1LVCD 1NYAA 2EC6C 2JT3A 2MJWB 2LVKA 2EHBA 1KFXS 1OMVA 3IF7A 1HQVA 1BU3A 4YI8A 4YGBB 5KU1A 1K2HA 1MXEA 2LLSA 1DJYA 1FW4A 1LXFC 2FCDA 2WCJA 3PALA 2L98A 4N5XA 1JF2A 1DELA 3A8RA 3VGOA 1NPQA 4PE0A 5HYDA 1Y0VH 4N1FA 2NZ0A 2L51A 4M2PA 1YURA 2WCFA 1YTZC 3CLNA 4MZJA 3IVTA 2QEBA 3PATA 1Y6WA 1S1EA 4FQOA 2EC6B 1QJTA 2WCEA 1QX7A 1RROA 1TNPA 2LCPA 1MF8B 4FTGA 1PSBA 5G08A 5AANA 1MHOA 1OMDA 1J1DA 1IIOA 1DF0B 1PULA 1AK8A 5DICA 1IKUA 1F54A 1OZSA 1XFUO 1KK8C 1K93D 2FCEA 1BJFA 4PALA 1PRWA 1NX3A 1C7VA 2KYFA 1SCMB 2M97A 2WC5A 4WQ3A 5BPJA 3DF0B 5HL1A 4TNCA 4U8DA 5HKWA 4IJ7A 3CZ0A 4CPVA 4ORCB 2KI6C 1RWYA 1BF5A 3FS7A 4IL1A 1CLBA 1KCYA 2LVVA 2QEVA 4DS7A 3EK7A 1A03A 2I2RE 2MA2A 1OW4A 3NGVA 1TOPA 1L2OB 2L2EA 2CBLA 2PRUA 3N7HA 4A4BA 4CFQA 3OX5A 1TIZA 1N2DA 1MQ1A 1K94A 3EK4A 3H4SE 3WXAA 2GTEA 1DGVA 2KAVA 1S5GZ 1MR8A 2JRFA 1DVIA 2CXJA 2MAZA 3D0YB 3LLEA 2KAXA 1U5IA 5D7FA 3TZ1A 3RM1A 1KFXL 4I5JA 1SMGA 1YUTA 3D75A 5DKNA 2G2BA 3VRPA 4BY4A 1CTRA 1PVBA 1Y1UA 2KQ6A 2KSPA 3PM2A 4MLWA 1EJ3A 2KFHA 3LK0A 3SS4A 2M3WA 1TCOB 2MLFC 2WC8A 2M8UA 1DTLA 5HKYA 1DEKA 3I5HC 5DKRA 2F3ZA 2VRGA 1A4PA 2K8MB 4UPGA 1IWQA 1WDCC 3S0AA 3EKHA 3LCPC 1V1FA 4I5LB 2SCPA 3CYZA 3QRXA 4CLNA 3EVUA 3SIAA 2WC6A 2CTNA 4GBAA 1HT9A 1YVHA 1OOIX 1AJ5A 4NDDA 2WCBA 1EL4A 1JC2A 1K9KA 1QASA 3R1PA 1F8HA 3GK1A 1B8RA 3SG4A 2WCKA 1SBJA 2ZKMX 1XFZO 4INXA 5CSJA 2GGMA 2M1KB 3BFHA 1SKTA 2M1UA 1KQMC 1OOGA 3DVEA 4GGFA 4OZDA 5FI7A 2KBIA 1A29A 3I5HB 3CR4X 3MSEB 1BR1B 2KPHA 1FPWA 2LE9B 2L2CA 3BOWB 1RTP1 2K2AA 1S5GY 2LP3A 1PSRA 1ZUZA 1UUSA 1J7QA 4DCKA 1WLMA 1Y1AA 3CGAA 1S6CA 2JQ6A 4AQJA 1JFJA 2QEOA 2H61A 4DIRA 4YGAA 1OSAA 2HQWA 1BOCA 3S0EA 1LINA 2M49B 2L5YA 2M9GA 1CDNA 1CMGA 3CZ2A 4CIDA 1X02A 4XJKA 3EVRA 3PM8A 4MRXA 3OB1B 1F4OA 1CLLA 1QIWA 2L5XB 1KSMA 3F45A 3NXAA 2K2FA 2AUCA 1W7IB 2JXCA 1OE9B 2F8PA 3D78A 4PE4A 1JFKA 3ZWHA 4PCWA 4WRIA 1DC1A 4OCIA 1K9PA 1TWOA 1XA5A 2KQYA 3DXLA 3KHEA 2YGUA 3KO0A 2LC5A 1DJZA 3QMEA 2O5GA 1RK9A 4MN0A 1YR5A 4QJ5B 1OOHA 3VRQA 2LLTA 5AFPA 1SY9A 1QV0A 3OGNA 1SYMA 2M0RA 3SG5A 3OB2B 2D8NA 3CS1A 2JT8A 1SCMC 2H8VA 1RFJA 2FJYA 4PT1A 3IQQA 1BR4B 1CM1A 3SG2A 1YUSA 1M31A 1XFYO 2LMVA 3FIAA 3I5IC 1B8CA 3M0WA 1J1EA 1XK4C 2BE6A 2OPOA 4QJ4B 1E8AA 2K7CA 4GPLB 3LL8B 1IH0A 2CT9A 1SW8A 3BUWB 1L2OC 3JVTC 1NX2A 1TUJA 3PJIA 1XO5A 2JU0A 2JTZA 2QEHA 3EVVA 3PFVA 1L7ZA 4ZCVA 1QX5B 5I8NA 3LK1A 4F7FA 2BBNA 2JNXA 2K7OA 3BUXB 3VRRA 1C3ZA 3PN7C 3OP0A 4JWQA 2Y4QA 3B7AA 1UHJA 3O78A 1NX1A 3I5IB 1C07A 1JBAA 3SS3A 1QIVA 3BUNB 3I5GC 1TNQA 3BUOB 3CR5X 4PE1A 1DT7B 1CM4A 1IJ6A 5I94A 2ZNEA 3B88A 2JTTA 2GGZA 4USLA 1QX2A 1JF0A 1AJ4A 1QATA 3JVTB 2P70A 3O4XA 1KWOC 2WCMA 4Q04A 1CFCA 1DJIA 2PYQA 1DJXA 1EH2A 2ZRTA 4ORBB 4JPZB 4MSPA 1QVIZ 1Y1XA 3PN7B 3S0GA 1A75B 1MXLC 1SR6C 5AXIA 2ZFDA 4ICBA 2JULA 2WCHA 4I5NB 1U5IB 4JKTA 2BL0B 1XYDA 3S0BA 4CFRA 1C7WA 1K9UA 3D10A 3I5GB 1N65A 1RECA 2HQ8A 1G4YR 2JPTA 4OV2A 3KPXA 4MVFA 1NP8A 2KAYA 2TN4A 1DJWA 5EL2A 3SG3A 1LA0A 4INWA 4ORAB 4A4CA 2JWWA 1T14A 1UURA 1CFFA 3I5FC 1ALWA 3BFAA 1KWOB 5JOLA 1OMRA 2KOTA 3WNXB 1JSAA 1FBVA 5KSZA 1IQ5A 1C3YA 3D74A 1UWOA 2SASA 1K90D 1N0YA 3BYAA 4OR9B 2PVBA 3UO9A 2I7AA 4I5KA 1YRUB 2E30A 1K8UA 3BQ3A 3S0DA 1CKKA 3WHUB 1QWVA 1SR6B 2AMIA 2GV5A 1QV1A 5CSIA 1Z4HA 3B86A 2LHLA 1XFXO 4FQTA 1WRZA 2CCMA 3B6XA 5PALA 1JUOA 4MRYA 2EGDA 3CZTX 2PMYA 1H4BA 1Q80A 3A4UB 3OBVA 4ETOA 2AAOA 2OS8B 2COLB 2K7DA 1QTXA 3I5FB 2LNKA 1EG4A 4QJ3B 1BG1A 2M7LA 3DYEA 3FE6A 2WNDA 1KSOA 1S6JA 1QVIY 1UHNA 1ORGA 4M2QA 5FI2A 2QDIA 5GQQC 2ISDA 3TDIA 1CNPA 1XFWO 1OZOA 2QACA 3D73A 1ALVA 1AVSA 1B9AA 1MWNA 3R1VA 3TUYC 1R2UA 1NUBA 3BOWA 4XYNA 1LS8A 3K1EA 3VB1A 2L4HA 3FWCA 2JOJA 4NQGA 4YGDB 2WORA 3HCMA 3ICBA 2KI4C 1YVLA 1RJVA 3VROA 3PLFB 2KHNA 2Q4UA 2BKHB 1DMOA 4YGEB 1DQEA 1OOJA 1S26D 2HETA 3GOFA 5CSNA 5ER5A 2MHHA 3TDUA 5I2OA 3DVJA 2BAPA 1F71A 2I94A 4PDZA 3O2PA 3SIBA 3V2LA 1GM0A 2Y1MA 4C0LA 4N1GA 4D1EA 1CDPA 1M46A 1QS7A 1AHRA 4L9MA 3O4YA 3S0FA 1W9ZA 2MLEC 4JQ0D 3TUYB 1CMFA 1AP4A 4MZKA 2PALA 4PHNA 2BCAA 1IJ5A 1NWDA 1J7OA 3R1OA 3AAKA 3SG7A 1B7TZ 2ZN8A 1K95A 1M45A 2KI4B 2NCPA 4YI9A 2RGIA 3GK2A 3IQOA 2Y5IA 2L0PA 1TTXA 2MRDA 2LMTA 3L4AA 2HPSA 1DGUA 4C0KA 2ZN9A 1NIWA 1IQ3A 1D1OA 2O60A 1G33A 1KK7Z 5D69A 1FI6A 4PHJA 5HKZA 3NSKA 5IBWA 1YX8A 2FOTA 1F70A 3DZTA 2LVIA 3SS5A 1S36A 4YRUA 1WRLA 1VRKA 1KFUL 2H2KA 2LUXA 2E6WA 2BCBA 3AKAA 1BODA 4AQIA 1KQVA 4GFTA 1UHIA 3FE8A 4NDBA 1J7PA 5DKQA 2NXQA 2KI6D 4HSZA 1NCYA 2JT0A 1CLMA 1ZFSA 3O6BA 3JTDB 1MUXA 3CTNA 1GGZA 1A2XA 1QLKA 4C0JA 5AEQA 2LM5A 2LLUA 1W7JB 1BLQA 2BL0C 2K7BA 1NX0A 3EKJA 1IGVA 1DF0A 2JZIA 2CNPA 1B4CA 5ER4X 1B7TY 4GGNA 3FWBA 2DOQA 2KLDA 2KFGA 1SRAA 1CDMA 1TCFA 2F3YA 2K0JA 2M7NA 3KEVA 4MBEA 3SJSA 1GGWA 2HF5A 4HRHA 2ERBA 1ZOTB 2ZNDA 3DVKA 3TDZA 5I2LA 2K60A 1ZACA 3WHTB 3RZSA 1K96A 4M2OA 3DF0A 1GQMA 5F6TA 1P28A 2M29A 1XK4A 1B1GA 1KK7Y 2B1UA 4PHKA 3DY9A 2G9BA 1XFVO 1BMOA 2NLNA 4NDCA 4YGCB 5TNCA 1DJHA 1IG5A 4JD9A 2KDHA 2PSRA 3UNWA 3ZNIA 1F55A 2KBMA 3GK4X 2BE4A 2V53A 4PE7A 1F4QA 2BNXA 2OS8C 4OKHA 2LANA 2KGRA 1UHHA 4GNKB 4GGFC 1PALA 1SL7A 1KK8B 2Y1NA 1PVAA 2IS9A 5HLVA 3CZ1A 3SG6A 5I2QA 1CDLA 2R2IA 3FE9A 3D76A 2OTGC 1YUUA 3D0YA 5KTYA 1A75A 3CR2A 1TNXA 3RLZA 1CFPA 1WY9A 2KLEA 3NSIA 2LMUA 2F2PA 2MBXA 2H61C 3BXKA 3TS5C 3AAJA 3DVMA 1KFUS 3EG5B 1YX7A 3PSRA 3CWGA 1TN4A 1ODBA 1OOFA 2LHIA 1B8LA 2ZRSA 3CDNA 1Z2CB 3Q8IA 4BY5A 1JWDA 1R6PA 1NSHA 4MEWA 1OQPA 3NSOA 4F0ZB
chains in the Genus database with same CATH topology
3V2LA 1GM0A 1OW4A 3NGVA 2JPOA 3N7HA 3S0FA 2PQLA 1TUJA 3PJIA 2GTEA 2QEHA 3R1OA 3BFBA 3NHIA 2P71A 4F7FA 3D75A 1C3ZA 3B7AA 3D77A 3L4AA 3L47A 3NHTA 3B88A 3S0AA 1XFRA 3CYZA 2WCLA 3B87A 3DZTA 2P70A 2WC6A 3CABA 1OOIX 2WCMA 3BJHA 3R1PA 2WCKA 3FE8A 4INXA 3S0GA 3BFHA 3L4LA 3R72A 2WCHA 1OOGA 4OZDA 3S0BA 2KPHA 5EL2A 4INWA 2L2CA 1T14A 3BFAA 2QEOA 2WCJA 1C3YA 3D74A 2ERBA 3S0EA 3S0DA 3RZSA 1QWVA 3CZ2A 1P28A 3B86A 4FQTA 3B6XA 3DY9A 2QEBA 4JD9A 3D78A 1TWOA 3DYEA 3FE6A 3DXLA 1ORGA 2QDIA 5DICA 3CZ1A 3QMEA 3FE9A 3D76A 3D73A 3R1VA 1OOHA 1LS8A 3K1EA 3VB1A 3OGNA 2WC5A 2H8VA 2FJYA 4PT1A 1OOFA 3CZ0A 1DQEA 3Q8IA 3CDNA 2QEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2L A;  1GM0 A;  1OW4 A;  3NGV A;  2JPO A;  3N7H A;  3S0F A;  2PQL A;  1TUJ A;  3PJI A;  2GTE A;  2QEH A;  3R1O A;  3BFB A;  3NHI A;  2P71 A;  4F7F A;  3D75 A;  1C3Z A;  3B7A A;  3D77 A;  3L4A A;  3L47 A;  3NHT A;  3B88 A;  3S0A A;  1XFR A;  3CYZ A;  2WCL A;  3B87 A;  3DZT A;  2P70 A;  2WC6 A;  3CAB A;  1OOI X;  2WCM A;  3BJH A;  3R1P A;  2WCK A;  3FE8 A;  4INX A;  3S0G A;  3BFH A;  3L4L A;  3R72 A;  2WCH A;  1OOG A;  4OZD A;  3S0B A;  2KPH A;  5EL2 A;  4INW A;  2L2C A;  1T14 A;  3BFA A;  2QEO A;  2WCJ A;  1C3Y A;  3D74 A;  2ERB A;  3S0E A;  3S0D A;  3RZS A;  1QWV A;  3CZ2 A;  1P28 A;  3B86 A;  4FQT A;  3B6X A;  3DY9 A;  2QEB A;  4JD9 A;  3D78 A;  1TWO A;  3DYE A;  3FE6 A;  3DXL A;  1ORG A;  2QDI A;  5DIC A;  3CZ1 A;  3QME A;  3FE9 A;  3D76 A;  3D73 A;  3R1V A;  1OOH A;  1LS8 A;  3K1E A;  3VB1 A;  3OGN A;  2WC5 A;  2H8V A;  2FJY A;  4PT1 A;  1OOF A;  3CZ0 A;  1DQE A;  3Q8I A;  3CDN A;  2QEV A; 
#chains in the Genus database with same CATH topology
 5B8I B;  2BKI B;  2JPO A;  2KNE A;  1AUI B;  1NCX A;  2LAP A;  3KF9 A;  1M39 A;  1TRF A;  4P2Y B;  1QLS A;  2OTG B;  1ZMZ A;  1EG3 A;  1CB1 A;  2PQL A;  1UHK A;  1SSE B;  1S6I A;  4HRE E;  3VRN A;  5K89 A;  4DUQ A;  1EXR A;  3BFB A;  2LP2 A;  3E3R A;  3NHI A;  3TS5 B;  1H8B A;  2LV7 A;  1V1G A;  2LUC A;  1WRK A;  2BCX A;  2P71 A;  2L4I A;  2PAS A;  2A4J A;  2WOS A;  1YRT B;  3BUM B;  5FI6 A;  1SL8 A;  2JC2 A;  2JNF A;  1SNL A;  2LVJ A;  1LKJ A;  2QPT A;  1SL9 A;  2KGB C;  3AKB A;  1CFD A;  1QXP A;  2JXL A;  1S3P A;  3D77 A;  1J55 A;  1FI5 A;  5J3X A;  4GUK A;  3L47 A;  1DJG A;  2BEC A;  3NHT A;  1IRJ A;  2F2O A;  4XJK B;  1WDC B;  1LA3 A;  1XVJ A;  5AER A;  1NCZ A;  5JJG A;  4R1E A;  2FJU B;  2Q91 A;  4P5O E;  1XFR A;  4HRG A;  3DD4 A;  1SK6 D;  2WCL A;  3B87 A;  1UP5 A;  3CAB A;  2KYC A;  3EK8 A;  5CSF A;  2KFF A;  4WQ2 A;  3K21 A;  1FF1 A;  1J7R A;  2K61 A;  4KYN A;  4MZL A;  5CPV A;  3BJH A;  4YBH B;  4GAO A;  5D3O A;  5HLO A;  3OX6 A;  1GJY A;  1TUZ A;  1SPY A;  1SCV A;  2NCO A;  3C1V A;  1BT6 A;  2BBM A;  3NSL A;  1G8I A;  3OHM B;  1KQM B;  3HX4 A;  4DRW A;  3L4L A;  2L50 A;  3R72 A;  4ZCU A;  4PHM A;  1WLZ A;  1M63 B;  4AOM A;  4E68 A;  1PK0 D;  2F33 A;  4OVN F;  1B47 A;  2I18 A;  2P6B B;  5FYX A;  3JTD C;  1TNW A;  1LVC D;  1NYA A;  2EC6 C;  2JT3 A;  2MJW B;  2LVK A;  2EHB A;  1KFX S;  1OMV A;  3IF7 A;  1HQV A;  1BU3 A;  4YI8 A;  4YGB B;  5KU1 A;  1K2H A;  1MXE A;  2LLS A;  1DJY A;  1FW4 A;  1LXF C;  2FCD A;  2WCJ A;  3PAL A;  2L98 A;  4N5X A;  1JF2 A;  1DEL A;  3A8R A;  3VGO A;  1NPQ A;  4PE0 A;  5HYD A;  1Y0V H;  4N1F A;  2NZ0 A;  2L51 A;  4M2P A;  1YUR A;  2WCF A;  1YTZ C;  3CLN A;  4MZJ A;  3IVT A;  2QEB A;  3PAT A;  1Y6W A;  1S1E A;  4FQO A;  2EC6 B;  1QJT A;  2WCE A;  1QX7 A;  1RRO A;  1TNP A;  2LCP A;  1MF8 B;  4FTG A;  1PSB A;  5G08 A;  5AAN A;  1MHO A;  1OMD A;  1J1D A;  1IIO A;  1DF0 B;  1PUL A;  1AK8 A;  5DIC A;  1IKU A;  1F54 A;  1OZS A;  1XFU O;  1KK8 C;  1K93 D;  2FCE A;  1BJF A;  4PAL A;  1PRW A;  1NX3 A;  1C7V A;  2KYF A;  1SCM B;  2M97 A;  2WC5 A;  4WQ3 A;  5BPJ A;  3DF0 B;  5HL1 A;  4TNC A;  4U8D A;  5HKW A;  4IJ7 A;  3CZ0 A;  4CPV A;  4ORC B;  2KI6 C;  1RWY A;  1BF5 A;  3FS7 A;  4IL1 A;  1CLB A;  1KCY A;  2LVV A;  2QEV A;  4DS7 A;  3EK7 A;  1A03 A;  2I2R E;  2MA2 A;  1OW4 A;  3NGV A;  1TOP A;  1L2O B;  2L2E A;  2CBL A;  2PRU A;  3N7H A;  4A4B A;  4CFQ A;  3OX5 A;  1TIZ A;  1N2D A;  1MQ1 A;  1K94 A;  3EK4 A;  3H4S E;  3WXA A;  2GTE A;  1DGV A;  2KAV A;  1S5G Z;  1MR8 A;  2JRF A;  1DVI A;  2CXJ A;  2MAZ A;  3D0Y B;  3LLE A;  2KAX A;  1U5I A;  5D7F A;  3TZ1 A;  3RM1 A;  1KFX L;  4I5J A;  1SMG A;  1YUT A;  3D75 A;  5DKN A;  2G2B A;  3VRP A;  4BY4 A;  1CTR A;  1PVB A;  1Y1U A;  2KQ6 A;  2KSP A;  3PM2 A;  4MLW A;  1EJ3 A;  2KFH A;  3LK0 A;  3SS4 A;  2M3W A;  1TCO B;  2MLF C;  2WC8 A;  2M8U A;  1DTL A;  5HKY A;  1DEK A;  3I5H C;  5DKR A;  2F3Z A;  2VRG A;  1A4P A;  2K8M B;  4UPG A;  1IWQ A;  1WDC C;  3S0A A;  3EKH A;  3LCP C;  1V1F A;  4I5L B;  2SCP A;  3CYZ A;  3QRX A;  4CLN A;  3EVU A;  3SIA A;  2WC6 A;  2CTN A;  4GBA A;  1HT9 A;  1YVH A;  1OOI X;  1AJ5 A;  4NDD A;  2WCB A;  1EL4 A;  1JC2 A;  1K9K A;  1QAS A;  3R1P A;  1F8H A;  3GK1 A;  1B8R A;  3SG4 A;  2WCK A;  1SBJ A;  2ZKM X;  1XFZ O;  4INX A;  5CSJ A;  2GGM A;  2M1K B;  3BFH A;  1SKT A;  2M1U A;  1KQM C;  1OOG A;  3DVE A;  4GGF A;  4OZD A;  5FI7 A;  2KBI A;  1A29 A;  3I5H B;  3CR4 X;  3MSE B;  1BR1 B;  2KPH A;  1FPW A;  2LE9 B;  2L2C A;  3BOW B;  1RTP 1;  2K2A A;  1S5G Y;  2LP3 A;  1PSR A;  1ZUZ A;  1UUS A;  1J7Q A;  4DCK A;  1WLM A;  1Y1A A;  3CGA A;  1S6C A;  2JQ6 A;  4AQJ A;  1JFJ A;  2QEO A;  2H61 A;  4DIR A;  4YGA A;  1OSA A;  2HQW A;  1BOC A;  3S0E A;  1LIN A;  2M49 B;  2L5Y A;  2M9G A;  1CDN A;  1CMG A;  3CZ2 A;  4CID A;  1X02 A;  4XJK A;  3EVR A;  3PM8 A;  4MRX A;  3OB1 B;  1F4O A;  1CLL A;  1QIW A;  2L5X B;  1KSM A;  3F45 A;  3NXA A;  2K2F A;  2AUC A;  1W7I B;  2JXC A;  1OE9 B;  2F8P A;  3D78 A;  4PE4 A;  1JFK A;  3ZWH A;  4PCW A;  4WRI A;  1DC1 A;  4OCI A;  1K9P A;  1TWO A;  1XA5 A;  2KQY A;  3DXL A;  3KHE A;  2YGU A;  3KO0 A;  2LC5 A;  1DJZ A;  3QME A;  2O5G A;  1RK9 A;  4MN0 A;  1YR5 A;  4QJ5 B;  1OOH A;  3VRQ A;  2LLT A;  5AFP A;  1SY9 A;  1QV0 A;  3OGN A;  1SYM A;  2M0R A;  3SG5 A;  3OB2 B;  2D8N A;  3CS1 A;  2JT8 A;  1SCM C;  2H8V A;  1RFJ A;  2FJY A;  4PT1 A;  3IQQ A;  1BR4 B;  1CM1 A;  3SG2 A;  1YUS A;  1M31 A;  1XFY O;  2LMV A;  3FIA A;  3I5I C;  1B8C A;  3M0W A;  1J1E A;  1XK4 C;  2BE6 A;  2OPO A;  4QJ4 B;  1E8A A;  2K7C A;  4GPL B;  3LL8 B;  1IH0 A;  2CT9 A;  1SW8 A;  3BUW B;  1L2O C;  3JVT C;  1NX2 A;  1TUJ A;  3PJI A;  1XO5 A;  2JU0 A;  2JTZ A;  2QEH A;  3EVV A;  3PFV A;  1L7Z A;  4ZCV A;  1QX5 B;  5I8N A;  3LK1 A;  4F7F A;  2BBN A;  2JNX A;  2K7O A;  3BUX B;  3VRR A;  1C3Z A;  3PN7 C;  3OP0 A;  4JWQ A;  2Y4Q A;  3B7A A;  1UHJ A;  3O78 A;  1NX1 A;  3I5I B;  1C07 A;  1JBA A;  3SS3 A;  1QIV A;  3BUN B;  3I5G C;  1TNQ A;  3BUO B;  3CR5 X;  4PE1 A;  1DT7 B;  1CM4 A;  1IJ6 A;  5I94 A;  2ZNE A;  3B88 A;  2JTT A;  2GGZ A;  4USL A;  1QX2 A;  1JF0 A;  1AJ4 A;  1QAT A;  3JVT B;  2P70 A;  3O4X A;  1KWO C;  2WCM A;  4Q04 A;  1CFC A;  1DJI A;  2PYQ A;  1DJX A;  1EH2 A;  2ZRT A;  4ORB B;  4JPZ B;  4MSP A;  1QVI Z;  1Y1X A;  3PN7 B;  3S0G A;  1A75 B;  1MXL C;  1SR6 C;  5AXI A;  2ZFD A;  4ICB A;  2JUL A;  2WCH A;  4I5N B;  1U5I B;  4JKT A;  2BL0 B;  1XYD A;  3S0B A;  4CFR A;  1C7W A;  1K9U A;  3D10 A;  3I5G B;  1N65 A;  1REC A;  2HQ8 A;  1G4Y R;  2JPT A;  4OV2 A;  3KPX A;  4MVF A;  1NP8 A;  2KAY A;  2TN4 A;  1DJW A;  5EL2 A;  3SG3 A;  1LA0 A;  4INW A;  4ORA B;  4A4C A;  2JWW A;  1T14 A;  1UUR A;  1CFF A;  3I5F C;  1ALW A;  3BFA A;  1KWO B;  5JOL A;  1OMR A;  2KOT A;  3WNX B;  1JSA A;  1FBV A;  5KSZ A;  1IQ5 A;  1C3Y A;  3D74 A;  1UWO A;  2SAS A;  1K90 D;  1N0Y A;  3BYA A;  4OR9 B;  2PVB A;  3UO9 A;  2I7A A;  4I5K A;  1YRU B;  2E30 A;  1K8U A;  3BQ3 A;  3S0D A;  1CKK A;  3WHU B;  1QWV A;  1SR6 B;  2AMI A;  2GV5 A;  1QV1 A;  5CSI A;  1Z4H A;  3B86 A;  2LHL A;  1XFX O;  4FQT A;  1WRZ A;  2CCM A;  3B6X A;  5PAL A;  1JUO A;  4MRY A;  2EGD A;  3CZT X;  2PMY A;  1H4B A;  1Q80 A;  3A4U B;  3OBV A;  4ETO A;  2AAO A;  2OS8 B;  2COL B;  2K7D A;  1QTX A;  3I5F B;  2LNK A;  1EG4 A;  4QJ3 B;  1BG1 A;  2M7L A;  3DYE A;  3FE6 A;  2WND A;  1KSO A;  1S6J A;  1QVI Y;  1UHN A;  1ORG A;  4M2Q A;  5FI2 A;  2QDI A;  5GQQ C;  2ISD A;  3TDI A;  1CNP A;  1XFW O;  1OZO A;  2QAC A;  3D73 A;  1ALV A;  1AVS A;  1B9A A;  1MWN A;  3R1V A;  3TUY C;  1R2U A;  1NUB A;  3BOW A;  4XYN A;  1LS8 A;  3K1E A;  3VB1 A;  2L4H A;  3FWC A;  2JOJ A;  4NQG A;  4YGD B;  2WOR A;  3HCM A;  3ICB A;  2KI4 C;  1YVL A;  1RJV A;  3VRO A;  3PLF B;  2KHN A;  2Q4U A;  2BKH B;  1DMO A;  4YGE B;  1DQE A;  1OOJ A;  1S26 D;  2HET A;  3GOF A;  5CSN A;  5ER5 A;  2MHH A;  3TDU A;  5I2O A;  3DVJ A;  2BAP A;  1F71 A;  2I94 A;  4PDZ A;  3O2P A;  3SIB A;  3V2L A;  1GM0 A;  2Y1M A;  4C0L A;  4N1G A;  4D1E A;  1CDP A;  1M46 A;  1QS7 A;  1AHR A;  4L9M A;  3O4Y A;  3S0F A;  1W9Z A;  2MLE C;  4JQ0 D;  3TUY B;  1CMF A;  1AP4 A;  4MZK A;  2PAL A;  4PHN A;  2BCA A;  1IJ5 A;  1NWD A;  1J7O A;  3R1O A;  3AAK A;  3SG7 A;  1B7T Z;  2ZN8 A;  1K95 A;  1M45 A;  2KI4 B;  2NCP A;  4YI9 A;  2RGI A;  3GK2 A;  3IQO A;  2Y5I A;  2L0P A;  1TTX A;  2MRD A;  2LMT A;  3L4A A;  2HPS A;  1DGU A;  4C0K A;  2ZN9 A;  1NIW A;  1IQ3 A;  1D1O A;  2O60 A;  1G33 A;  1KK7 Z;  5D69 A;  1FI6 A;  4PHJ A;  5HKZ A;  3NSK A;  5IBW A;  1YX8 A;  2FOT A;  1F70 A;  3DZT A;  2LVI A;  3SS5 A;  1S36 A;  4YRU A;  1WRL A;  1VRK A;  1KFU L;  2H2K A;  2LUX A;  2E6W A;  2BCB A;  3AKA A;  1BOD A;  4AQI A;  1KQV A;  4GFT A;  1UHI A;  3FE8 A;  4NDB A;  1J7P A;  5DKQ A;  2NXQ A;  2KI6 D;  4HSZ A;  1NCY A;  2JT0 A;  1CLM A;  1ZFS A;  3O6B A;  3JTD B;  1MUX A;  3CTN A;  1GGZ A;  1A2X A;  1QLK A;  4C0J A;  5AEQ A;  2LM5 A;  2LLU A;  1W7J B;  1BLQ A;  2BL0 C;  2K7B A;  1NX0 A;  3EKJ A;  1IGV A;  1DF0 A;  2JZI A;  2CNP A;  1B4C A;  5ER4 X;  1B7T Y;  4GGN A;  3FWB A;  2DOQ A;  2KLD A;  2KFG A;  1SRA A;  1CDM A;  1TCF A;  2F3Y A;  2K0J A;  2M7N A;  3KEV A;  4MBE A;  3SJS A;  1GGW A;  2HF5 A;  4HRH A;  2ERB A;  1ZOT B;  2ZND A;  3DVK A;  3TDZ A;  5I2L A;  2K60 A;  1ZAC A;  3WHT B;  3RZS A;  1K96 A;  4M2O A;  3DF0 A;  1GQM A;  5F6T A;  1P28 A;  2M29 A;  1XK4 A;  1B1G A;  1KK7 Y;  2B1U A;  4PHK A;  3DY9 A;  2G9B A;  1XFV O;  1BMO A;  2NLN A;  4NDC A;  4YGC B;  5TNC A;  1DJH A;  1IG5 A;  4JD9 A;  2KDH A;  2PSR A;  3UNW A;  3ZNI A;  1F55 A;  2KBM A;  3GK4 X;  2BE4 A;  2V53 A;  4PE7 A;  1F4Q A;  2BNX A;  2OS8 C;  4OKH A;  2LAN A;  2KGR A;  1UHH A;  4GNK B;  4GGF C;  1PAL A;  1SL7 A;  1KK8 B;  2Y1N A;  1PVA A;  2IS9 A;  5HLV A;  3CZ1 A;  3SG6 A;  5I2Q A;  1CDL A;  2R2I A;  3FE9 A;  3D76 A;  2OTG C;  1YUU A;  3D0Y A;  5KTY A;  1A75 A;  3CR2 A;  1TNX A;  3RLZ A;  1CFP A;  1WY9 A;  2KLE A;  3NSI A;  2LMU A;  2F2P A;  2MBX A;  2H61 C;  3BXK A;  3TS5 C;  3AAJ A;  3DVM A;  1KFU S;  3EG5 B;  1YX7 A;  3PSR A;  3CWG A;  1TN4 A;  1ODB A;  1OOF A;  2LHI A;  1B8L A;  2ZRS A;  3CDN A;  1Z2C B;  3Q8I A;  4BY5 A;  1JWD A;  1R6P A;  1NSH A;  4MEW A;  1OQP A;  3NSO A;  4F0Z B; 
#chains in the Genus database with same CATH homology
 3V2L A;  1GM0 A;  1OW4 A;  3NGV A;  2JPO A;  3N7H A;  3S0F A;  2PQL A;  1TUJ A;  3PJI A;  2GTE A;  2QEH A;  3R1O A;  3BFB A;  3NHI A;  2P71 A;  4F7F A;  3D75 A;  1C3Z A;  3B7A A;  3D77 A;  3L4A A;  3L47 A;  3NHT A;  3B88 A;  3S0A A;  1XFR A;  3CYZ A;  2WCL A;  3B87 A;  3DZT A;  2P70 A;  2WC6 A;  3CAB A;  1OOI X;  2WCM A;  3BJH A;  3R1P A;  2WCK A;  3FE8 A;  4INX A;  3S0G A;  3BFH A;  3L4L A;  3R72 A;  2WCH A;  1OOG A;  4OZD A;  3S0B A;  2KPH A;  5EL2 A;  4INW A;  2L2C A;  1T14 A;  3BFA A;  2QEO A;  2WCJ A;  1C3Y A;  3D74 A;  2ERB A;  3S0E A;  3S0D A;  3RZS A;  1QWV A;  3CZ2 A;  1P28 A;  3B86 A;  4FQT A;  3B6X A;  3DY9 A;  2QEB A;  4JD9 A;  3D78 A;  1TWO A;  3DYE A;  3FE6 A;  3DXL A;  1ORG A;  2QDI A;  5DIC A;  3CZ1 A;  3QME A;  3FE9 A;  3D76 A;  3D73 A;  3R1V A;  1OOH A;  1LS8 A;  3K1E A;  3VB1 A;  3OGN A;  2WC5 A;  2H8V A;  2FJY A;  4PT1 A;  1OOF A;  3CZ0 A;  1DQE A;  3Q8I A;  3CDN A;  2QEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...