5I8NA

Solution structure of human calcium-binding s100a9 (c3s) protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A9
publication title Blocking the interaction between S100A9 and RAGE V domain using CHAPS molecule: A novel route to drug development against cell proliferation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i8nA00
3PLFB 4NDDA 2BCBA 1CB1A 1B47A 2CCMA 1JBAA 1QX2A 3NSIA 3FIAA 1D1OA 1NSHA 1PSBA 4M2QA 1MHOA 1J1DA 1B8CA 3O6BA 2EC6B 2NZ0A 1CMFA 2M3WA 1WRZA 2ZRTA 4ZCVA 1A29A 3DF0B 2MA2A 4GNKB 4YGBB 1NX2A 1DF0B 1JSAA 1DVIA 1C7VA 2PSRA 2BCAA 1YUUA 2LHIA 3BYAA 2CXJA 1KK8B 2L2EA 1YVHA 2L4HA 3IQOA 4AOMA 3PFVA 2JNFA 2JU0A 4CIDA 1DJIA 4MZKA 1BOCA 1NPQA 2BECA 1NCYA 4MN0A 4DS7A 2QPTA 1NWDA 3I5FB 3NSKA 1J7RA 1TRFA 1AHRA 1RJVA 1M45A 1CFCA 1OE9B 1OMRA 1Y1UA 1NYAA 3OX6A 5FYXA 4UPGA 1AJ5A 2F2PA 4MBEA 1EL4A 3CR5X 1KCYA 3BUXB 3PM8A 1MXLC 5I8NA 3AKAA 1B7TY 3BQ3A 1SL7A 1TTXA 1WLMA 1Y0VH 2LVIA 3CZTX 1DJWA 1L2OC 2LP2A 3HX4A 4A4CA 1WLZA 2E6WA 5F6TA 1VRKA 3CTNA 2BBMA 1YURA 1Y6WA 3A8RA 4NDBA 3MSEB 1CFFA 2FCEA 3PSRA 1QVIY 1DGVA 4HREE 4MLWA 3BUMB 4MSPA 5ER4X 1IJ5A 2LCPA 2NCOA 3SIAA 2B1UA 4OV2A 1YVLA 5HLVA 1LINA 1FW4A 2QACA 3BOWA 3K21A 4M2OA 1RFJA 1S5GZ 2BE4A 2AUCA 3BUOB 1UP5A 1S26D 1A75B 2A4JA 3ZNIA 1BJFA 2CBLA 4I5NB 2PMYA 3EVUA 3WHTB 3NXAA 1J55A 1KFXS 1JFKA 2ZKMX 3O4YA 2LLTA 1TCFA 1UHIA 2M9GA 1HT9A 2H61C 3TZ1A 4DUQA 1QTXA 2E30A 1SRAA 5BPJA 1UWOA 2NCPA 3DVMA 4C0JA 2LUCA 2M7NA 2LVKA 4JWQA 1QLSA 4YI8A 2LM5A 2LMTA 5G08A 5J3XA 1K9PA 1UUSA 5HYDA 2K7DA 1G8IA 1L2OB 2KGRA 2LLSA 2HQWA 1DGUA 4MVFA 1QIVA 1K9UA 4AQIA 2EC6C 2LC5A 1AJ4A 1WRLA 4YBHB 1JF2A 1MUXA 4P5OE 1MXEA 2L51A 1FPWA 3EKJA 2V53A 2LLUA 3GK1A 1SR6C 4ORCB 1JC2A 1B4CA 2L50A 1KQMC 2G9BA 4I5JA 1PSRA 4PE0A 1N0YA 3LL8B 4CFQA 1YR5A 2VRGA 3AAJA 1FF1A 1SL9A 2LMVA 1TIZA 2HPSA 1XFYO 2KYFA 3FS7A 1ODBA 2WNDA 3I5FC 1H8BA 2I7AA 1QX7A 3A4UB 5HLOA 2JWWA 3DVEA 1CFPA 1SK6D 4YGDB 3IQQA 2KNEA 2MLEC 1IQ3A 4ETOA 2BBNA 4Q04A 5AANA 3WHUB 2LV7A 3VRRA 1X02A 5I2LA 2SCPA 1CTRA 4JQ0D 1B9AA 1BODA 5I2OA 1K95A 4GBAA 1S36A 1ZFSA 1SL8A 3VRQA 1S1EA 1SCMB 2KGBC 2PRUA 3PALA 1KK7Z 1LKJA 1XK4A 1LVCD 4IL1A 1SR6B 4ORAB 1S5GY 1CLMA 1A4PA 2M1UA 2M29A 3DF0A 1KQMB 1S6IA 1JF0A 1G33A 1UHHA 2JULA 2KBMA 3M0WA 4DRWA 3TUYC 1DJHA 4WQ2A 4QJ5B 2WORA 1V1GA 3PN7C 1CDNA 3EKHA 1A03A 5PALA 3LK0A 1BR1B 1QX5B 1CDPA 1ZOTB 1K93D 3TDUA 5KTYA 1RECA 1OZOA 3BUWB 1QV1A 1PVAA 4XJKB 1OSAA 2BL0C 2KAVA 4YI9A 2LMUA 4DCKA 2MBXA 3SG5A 1PULA 3GOFA 1K2HA 3OX5A 2JNXA 1LXFC 2KDHA 1YRTB 2JXCA 3F45A 5AXIA 4USLA 1GQMA 1ZUZA 2H2KA 3I5GB 4YGAA 4FTGA 1C7WA 4PE4A 1TNXA 3D0YA 5AEQA 1U5IB 4HSZA 1DTLA 1KFUS 1NP8A 2AAOA 2GGMA 5IBWA 1QXPA 1M46A 2K7CA 1K94A 2JZIA 1WY9A 3H4SE 3E3RA 3EK7A 1B8LA 3PATA 2KSPA 1RWYA 1K96A 2MAZA 1NX0A 1F70A 1UHJA 1R6PA 1SNLA 2M1KB 1F4OA 3LLEA 1B8RA 1NIWA 2I18A 3DVKA 4AQJA 3TUYB 1MF8B 1OOJA 5TNCA 3SG7A 3PN7B 2KQYA 1PVBA 2KYCA 1V1FA 2K7OA 2AMIA 2MRDA 1CLBA 1N65A 3BUNB 4C0LA 5CSNA 3SJSA 1DJYA 2F2OA 2PVBA 2G2BA 1S3PA 4GGFA 1M39A 2K8MB 1CMGA 2JTTA 1XYDA 2BL0B 3VRNA 4PHMA 4N1FA 3AKBA 1QLKA 2KFFA 4OVNF 4WQ3A 1UURA 4P2YB 2M97A 1BF5A 1F71A 1KSOA 1Q80A 2ZRSA 2HQ8A 4CFRA 3KEVA 3CGAA 2SASA 2O60A 1QIWA 3QRXA 1LA3A 4MRXA 2WCBA 3CR2A 4PALA 5CSJA 4E68A 1DT7B 1BG1A 2LP3A 2I94A 1CDLA 1KK7Y 1MQ1A 1SKTA 1SCMC 5D7FA 2MLFC 1KFXL 4HRGA 2ISDA 1XA5A 1NUBA 1YRUB 5HKZA 2GV5A 4PHNA 3TS5B 1IRJA 2EGDA 3C1VA 3KPXA 3O78A 3OB2B 3AAKA 4CPVA 2ZFDA 4NQGA 2BKIB 1XK4C 4N1GA 1EG3A 1CDMA 1H4BA 1DMOA 1M31A 2RGIA 1QATA 1CLLA 2L4IA 1CFDA 1YX7A 4GAOA 5GQQC 2FCDA 1LA0A 1QJTA 2LE9B 3EK8A 2WCFA 4QJ3B 2KAYA 2F3YA 2MHHA 1NX3A 3KO0A 3RM1A 4JPZB 1SMGA 1AUIB 3EVRA 1IH0A 3SIBA 4OCIA 1PALA 1K90D 4GGNA 1W7IB 4ICBA 5CSIA 1J7QA 2D8NA 2KBIA 3I5GC 2KI6D 2JQ6A 1IJ6A 2LANA 2MJWB 3JTDC 4GUKA 4ZCUA 2JRFA 1UHNA 2M7LA 2JTZA 2K2FA 1C07A 1J7PA 1KWOC 3DVJA 4YGEB 1XFUO 1B1GA 4CLNA 1GJYA 4WRIA 4PE1A 2DOQA 2KAXA 4BY5A 2CNPA 1NCXA 2GGZA 2LVJA 1NX1A 1KQVA 4HRHA 3O2PA 1R2UA 3GK2A 5AERA 4M2PA 1DF0A 1E8AA 1DJZA 3JVTB 3I5HC 2ZN9A 4BY4A 1JFJA 2LUXA 1EJ3A 2JPTA 2P6BB 1RTP1 4U8DA 1AP4A 1BLQA 1DJXA 2F8PA 1YUSA 1CM1A 3VRPA 2JC2A 2LHLA 1GGZA 2I2RE 2Q4UA 1FI6A 4GFTA 4DIRA 1BMOA 1J1EA 2Y5IA 1OZSA 1XFZO 1CKKA 2Q91A 2JXLA 2PALA 4FQOA 1RK9A 2CT9A 2F3ZA 2OTGC 1S6CA 1NCZA 2KFHA 4XJKA 5JJGA 4GGFC 2WC8A 3SG6A 3EVVA 1K9KA 1XFVO 2FOTA 3JTDB 1XFWO 3LK1A 4F0ZB 4ORBB 1IG5A 1QV0A 3HCMA 2CTNA 1KWOB 3VROA 1N2DA 1IGVA 2COLB 1FI5A 1FBVA 1M63B 1OMVA 3BXKA 2M49B 1U5IA 1TNPA 2KHNA 1YX8A 3D0YB 3WNXB 2WOSA 3TS5C 5ER5A 1BT6A 2JT8A 4PDZA 2IS9A 2ZN8A 1F8HA 1F55A 3D10A 1SPYA 3SG4A 1CM4A 1KSMA 2BCXA 2KQ6A 3I5HB 4L9MA 2M0RA 2JT3A 1IQ5A 2BKHB 2O5GA 2LVVA 5AFPA 2HF5A 5D69A 1K8UA 4NDCA 4PHKA 4MRYA 2JT0A 3BOWB 5KU1A 5KSZA 2OS8C 2K61A 3ICBA 1A75A 1A2XA 1JUOA 2K0JA 1QASA 1J7OA 1KFUL 2ZNEA 1F4QA 2BE6A 4PHJA 4PCWA 1PRWA 1WDCC 3I5IC 2L0PA 5CPVA 5HKWA 5CSFA 1SCVA 5JOLA 1SYMA 4QJ4B 3LCPC 4OR9B 2ZNDA 3VGOA 3CS1A 2K2AA 2OTGB 3IF7A 3WXAA 4C0KA 3OB1B 4YGCB 4XYNA 4I5LB 3NSOA 5I2QA 5B8IB 3FWBA 2NXQA 3NSLA 3FWCA 2EHBA 2Y1MA 2KI4C 3CWGA 3SG2A 2L5XB 3EK4A 1S6JA 3KHEA 4YRUA 1RROA 1YTZC 1MR8A 5DKQA 1QS7A 1G4YR 4MEWA 2LNKA 2R2IA 5K89A 2WCEA 1DJGA 1L7ZA 1OMDA 3CLNA 4MZLA 3RLZA 1ZMZA 4N5XA 4MZJA 3JVTC 1TNQA 1XFXO 1ZACA 1EXRA 1XVJA 1B7TZ 1OQPA 4GPLB 4OKHA 1HQVA 2F33A 1SBJA 3TDZA 1BU3A 5DKNA 1WRKA 2KOTA 2OS8B 3ZWHA 3SG3A 1TOPA 1PK0D 1GGWA 1QVIZ 1XO5A 1EG4A 2PASA 1TNWA 1Y1XA 4I5KA 1IKUA 1CNPA 1TCOB 4D1EA 1WDCB 1KK8C 3I5IB 1UHKA 1TN4A 1Y1AA 2KI6C 4A4BA 2M8UA 1AVSA 2Y1NA 2JOJA 2LAPA 3KF9A 2H61A 3GK4X 1AK8A 1EH2A 2KFGA 1ALVA 4R1EA 2OPOA 2Y4QA 5DKRA 1YUTA 3OP0A 1ALWA 3DD4A 1IWQA 4PE7A 2FJUB 1JWDA 1SY9A 2NLNA 3OHMB 1MWNA 2HETA 2L98A 2KI4B 2K7BA 1BR4B 3TDIA 1F54A 1SW8A 1W7JB 2TN4A 5HKYA 3CR4X 4TNCA
chains in the Genus database with same CATH superfamily
3OGNA 3PLFB 4NDDA 2BCBA 1CB1A 1B47A 4PT1A 2CCMA 2WC5A 3CABA 1JBAA 1QX2A 3NSIA 3FIAA 1D1OA 1NSHA 5I94A 1PSBA 4M2QA 1MHOA 1J1DA 1B8CA 3O6BA 4M2OA 2EC6B 2NZ0A 1CMFA 2M3WA 1WRZA 2ZRTA 4ZCVA 1A29A 3DF0B 2MA2A 4GNKB 4YGBB 1NX2A 1DF0B 1JSAA 1DVIA 1C7VA 2PSRA 2BCAA 1YUUA 2LHIA 3BYAA 2CXJA 1OOIX 1KK8B 3BJHA 2L2EA 1YVHA 2L4HA 3IQOA 4AOMA 2KPHA 3PFVA 1T14A 2JNFA 2JU0A 4CIDA 1DJIA 4MZKA 1BOCA 1NPQA 2BECA 1NCYA 1OOHA 4MN0A 4DS7A 1IIOA 3UO9A 2QPTA 1NWDA 3R1PA 3I5FB 3NSKA 4KYNA 1J7RA 1TRFA 1AHRA 4F7FA 2P70A 3S0EA 1RJVA 1M45A 1CFCA 1OE9B 1OMRA 1Y1UA 1NYAA 3OX6A 5FYXA 4UPGA 1AJ5A 2F2PA 4MBEA 1EL4A 3CR5X 1KCYA 3BUXB 3PM8A 1MXLC 1QWVA 3AKAA 5I8NA 1B7TY 3BQ3A 1SL7A 1TTXA 1WLMA 1Y0VH 2LVIA 3B88A 1DJWA 1L2OC 2LP2A 3CZTX 4A4CA 1WLZA 2E6WA 5F6TA 1VRKA 3CTNA 2BBMA 1YURA 1Y6WA 3DXLA 3A8RA 4NDBA 3MSEB 1CFFA 2FCEA 3PSRA 3S0GA 2WC6A 1QVIY 5DICA 1DGVA 4HREE 4MLWA 3BUMB 4MSPA 5ER4X 1IJ5A 2LCPA 1TWOA 3UNWA 2NCOA 3SIAA 2B1UA 4OV2A 1YVLA 2QEOA 5HLVA 1LINA 1FW4A 2GTEA 2QACA 1DEKA 3BOWA 3K21A 4JD9A 1RFJA 1S5GZ 2BE4A 2AUCA 1DELA 3BUOB 1UP5A 1S26D 1A75B 2A4JA 3ZNIA 1BJFA 2CBLA 4I5NB 2PMYA 3EVUA 3CYZA 3WHTB 3NXAA 1J55A 1KFXS 1JFKA 2YGUA 2ZKMX 3O4YA 2LLTA 2WCJA 1TCFA 1UHIA 2M9GA 3L4AA 1HT9A 2H61C 3TZ1A 4DUQA 1QTXA 2E30A 1SRAA 3VB1A 5BPJA 1UWOA 2NCPA 2H8VA 3DVMA 4C0JA 2LUCA 2M7NA 2LVKA 4JWQA 1QLSA 4YI8A 2LM5A 3DY9A 2LMTA 5G08A 5J3XA 1K9PA 1UUSA 5HYDA 3K1EA 3B87A 2K7DA 2QDIA 1G8IA 1L2OB 2KGRA 2LLSA 2HQWA 1DGUA 4MVFA 1QIVA 1K9UA 4AQIA 2EC6C 2LC5A 1AJ4A 1WRLA 4YBHB 3OBVA 3PJIA 1JF2A 1MUXA 4P5OE 1MXEA 2L51A 3D73A 1FPWA 3EKJA 2V53A 2LLUA 3GK1A 1SR6C 4ORCB 1JC2A 1B4CA 2L50A 2PYQA 3R72A 1KQMC 2G9BA 4I5JA 1PSRA 4PE0A 1N0YA 3LL8B 4CFQA 1YR5A 2VRGA 3AAJA 4INWA 1SL9A 1FF1A 2LMVA 1OOGA 1TIZA 2HPSA 1XFYO 2KYFA 3FS7A 2K60A 1ODBA 1J7QA 2WNDA 3I5FC 3S0BA 1H8BA 1SSEB 1QX7A 2I7AA 3A4UB 2JWWA 3DVEA 5HLOA 1CFPA 4INXA 1SK6D 4YGDB 3IQQA 2KNEA 2MLEC 1IQ3A 1TUZA 4ETOA 2BBNA 4Q04A 1OW4A 5AANA 3WHUB 2LV7A 3VRRA 1X02A 5I2LA 3SS5A 2SCPA 1CTRA 4JQ0D 1B9AA 1BODA 5I2OA 1K95A 4GBAA 1S36A 1ZFSA 1ORGA 1SL8A 3VRQA 1S1EA 1SCMB 2KGBC 3FE6A 2PRUA 3PALA 1KK7Z 1LKJA 1XK4A 1LVCD 4IL1A 2ERBA 1SR6B 4ORAB 1S5GY 1CLMA 1A4PA 2M1UA 2M29A 3DF0A 1KQMB 1S6IA 1JF0A 1G33A 1UHHA 2JULA 2KBMA 3M0WA 4DRWA 3TUYC 1DJHA 4WQ2A 3B6XA 5EL2A 2WORA 1V1GA 3PN7C 4QJ5B 1CDNA 3EKHA 1A03A 3D75A 5PALA 3LK0A 1BR1B 1QX5B 1CDPA 1ZOTB 1K93D 3TDUA 3L47A 5KTYA 1RECA 1OZOA 3BUWB 1QV1A 1PVAA 4XJKB 1OSAA 2BL0C 2KAVA 4YI9A 2LMUA 4DCKA 2MBXA 3SG5A 1PULA 3GOFA 1K2HA 1C3ZA 2JNXA 3OX5A 1LXFC 2KDHA 1YRTB 2JXCA 3F45A 5AXIA 4USLA 1GQMA 1ZUZA 2H2KA 3I5GB 4YGAA 4FTGA 1C7WA 4PE4A 1XFRA 1TNXA 3D0YA 5AEQA 1U5IB 4HSZA 1DTLA 1KFUS 1NP8A 2AAOA 2GGMA 5IBWA 1QXPA 1M46A 2K7CA 1K94A 2JZIA 1WY9A 3H4SE 3Q8IA 3E3RA 3EK7A 1B8LA 3PATA 1C3YA 2KSPA 1RWYA 1K96A 2MAZA 1NX0A 1F70A 1UHJA 2FJYA 3NHTA 1R6PA 1SNLA 2M1KB 1F4OA 3LLEA 1B8RA 1NIWA 2I18A 3DVKA 4AQJA 3TUYB 1MF8B 1OOJA 5TNCA 3SG7A 3PN7B 2KQYA 1PVBA 2WCLA 2KYCA 1V1FA 2K7OA 2AMIA 3DZTA 2MRDA 1CLBA 1N65A 3BUNB 3DYEA 4C0LA 5CSNA 3SJSA 1DJYA 2F2OA 2PVBA 1DQEA 2G2BA 1S3PA 3R1VA 4GGFA 1M39A 2K8MB 1CMGA 2JTTA 1XYDA 2BL0B 3VRNA 4PHMA 4N1FA 3AKBA 4FQTA 3S0AA 1QLKA 2KFFA 4OVNF 4WQ3A 1UURA 4P2YB 2M97A 1BF5A 3PM2A 1F71A 1KSOA 1Q80A 2ZRSA 2HQ8A 4CFRA 3KEVA 3CGAA 2SASA 2O60A 1QIWA 3QRXA 1LA3A 4MRXA 2WCBA 3CR2A 4PALA 5CSJA 4E68A 1DT7B 1BG1A 2LP3A 2I94A 1CDLA 1KK7Y 1MQ1A 1SKTA 1SCMC 5D7FA 2MLFC 1KFXL 4HRGA 2ISDA 1XA5A 1GM0A 1NUBA 1YRUB 5HKZA 3D78A 2GV5A 2BNXA 4PHNA 3TS5B 1IRJA 2EGDA 3C1VA 3KPXA 3O78A 5D3OA 3OB2B 3AAKA 4CPVA 2ZFDA 4NQGA 2BKIB 1XK4C 4N1GA 1EG3A 1CDMA 1H4BA 1DMOA 3D77A 1M31A 2RGIA 1QATA 1CLLA 2L4IA 1CFDA 1LS8A 1YX7A 4GAOA 5GQQC 2FCDA 1LA0A 1QJTA 2LE9B 3EK8A 2WCFA 4QJ3B 2KAYA 2F3YA 2MHHA 1NX3A 3KO0A 3RM1A 4JPZB 1SMGA 1AUIB 3EVRA 1DC1A 1IH0A 3SIBA 4OCIA 1PALA 1K90D 4GGNA 1W7IB 2KLDA 4ICBA 5CSIA 3S0FA 2D8NA 2KBIA 3I5GC 2KI6D 2JQ6A 1IJ6A 1Z4HA 2LANA 2MJWB 3JTDC 4GUKA 3CZ1A 4ZCUA 2JRFA 2QEBA 1UHNA 3NGVA 2M7LA 2JTZA 2K2FA 1C07A 1J7PA 1KWOC 3DVJA 4YGEB 1XFUO 1B1GA 3V2LA 4CLNA 1GJYA 4WRIA 1P28A 2DOQA 4PE1A 2KAXA 3BFHA 4BY5A 2CNPA 1NCXA 2GGZA 2LVJA 1NX1A 1KQVA 4HRHA 4IJ7A 3O2PA 1R2UA 3GK2A 5AERA 4M2PA 1DF0A 1E8AA 3IVTA 1DJZA 3JVTB 3I5HC 2ZN9A 4BY4A 1JFJA 2LUXA 1EJ3A 2JPTA 3S0DA 2P6BB 1RTP1 4U8DA 1AP4A 1BLQA 3FE8A 2L5YA 1DJXA 2F8PA 1YUSA 1TUJA 1CM1A 3VRPA 2JC2A 2KLEA 1GGZA 2LHLA 3RZSA 2I2RE 2Q4UA 1FI6A 4GFTA 2JPOA 4DIRA 1BMOA 1J1EA 2Y5IA 3EG5B 1OZSA 1XFZO 1CKKA 2Q91A 2JXLA 2PALA 4FQOA 1RK9A 2CT9A 2F3ZA 2OTGC 1S6CA 1NCZA 3CZ0A 2KFHA 3O4XA 5FI6A 2WCMA 4XJKA 5JJGA 2PQLA 4GGFC 2WC8A 3SG6A 3CZ2A 3EVVA 1K9KA 1XFVO 2FOTA 3JTDB 1XFWO 3LK1A 4F0ZB 4ORBB 1IG5A 3R1OA 1QV0A 3HCMA 2CTNA 3FE9A 1KWOB 3VROA 3SS4A 1N2DA 3B7AA 1IGVA 2COLB 1FI5A 1FBVA 1M63B 1OMVA 3BXKA 2M49B 1U5IA 1TNPA 2KHNA 1YX8A 3D0YB 3WNXB 2WOSA 3TS5C 5ER5A 1BT6A 2JT8A 4PDZA 2IS9A 2ZN8A 1F8HA 1F55A 3D10A 1SPYA 3SG4A 1CM4A 1KSMA 2BCXA 2KQ6A 3B86A 3I5HB 5HL1A 3SS3A 4L9MA 2M0RA 2JT3A 1IQ5A 2BKHB 2O5GA 2LVVA 2BAPA 2HF5A 5D69A 5AFPA 1K8UA 4NDCA 4JKTA 4PHKA 4MRYA 2JT0A 3BOWB 5KU1A 5KSZA 2OS8C 2K61A 3ICBA 1A75A 1A2XA 1JUOA 2K0JA 1QASA 1J7OA 1KFUL 3L4LA 2ZNEA 1F4QA 2BE6A 4PHJA 4PCWA 1PRWA 2L2CA 1WDCC 3I5IC 2L0PA 5CPVA 5HKWA 5CSFA 1SCVA 5JOLA 1SYMA 4QJ4B 3LCPC 4OR9B 2ZNDA 3VGOA 3CS1A 2K2AA 2OTGB 3IF7A 4OZDA 3WXAA 3D74A 3OB1B 4YGCB 4C0KA 4XYNA 4I5LB 3NSOA 3HX4A 5I2QA 5B8IB 3FWBA 2NXQA 3D76A 3NSLA 3FWCA 2EHBA 2Y1MA 2KI4C 3CWGA 3SG2A 2L5XB 3NHIA 3EK4A 1S6JA 3KHEA 4YRUA 1RROA 2QEHA 1YTZC 1MR8A 5DKQA 1QS7A 1G4YR 4MEWA 2LNKA 2R2IA 5K89A 2WCEA 1DJGA 1L7ZA 1OMDA 3CLNA 4MZLA 3RLZA 2WCKA 1ZMZA 4N5XA 3N7HA 4MZJA 3JVTC 1TNQA 1XFXO 1ZACA 1EXRA 1W9ZA 1XVJA 1B7TZ 1OQPA 5FI7A 4GPLB 4OKHA 1HQVA 2F33A 1OOFA 1SBJA 3TDZA 1BU3A 5DKNA 1WRKA 2QEVA 2KOTA 2OS8B 3ZWHA 3SG3A 1TOPA 1PK0D 1GGWA 1QVIZ 1XO5A 1EG4A 2PASA 1TNWA 1Y1XA 4I5KA 3QMEA 1IKUA 1CNPA 1TCOB 4D1EA 1WDCB 1KK8C 3I5IB 1UHKA 1TN4A 1Y1AA 3CDNA 2KI6C 4A4BA 2M8UA 1AVSA 2WCHA 2JOJA 2LAPA 2Y1NA 2H61A 3GK4X 3KF9A 1AK8A 1EH2A 2KFGA 1ALVA 4R1EA 2OPOA 2Y4QA 1Z2CB 5DKRA 1YUTA 3OP0A 1ALWA 3DD4A 1IWQA 4PE7A 2FJUB 5FI2A 1JWDA 1SY9A 2NLNA 3OHMB 1MWNA 2HETA 3BFAA 2L98A 2KI4B 2K7BA 2P71A 1BR4B 3TDIA 1F54A 1SW8A 1W7JB 2TN4A 3BFBA 5HKYA 3CR4X 4TNCA
chains in the Genus database with same CATH topology
3PLFB 4NDDA 2BCBA 1CB1A 1B47A 2CCMA 1JBAA 1QX2A 3NSIA 3FIAA 1D1OA 1NSHA 1PSBA 4M2QA 1MHOA 1J1DA 1B8CA 3O6BA 2EC6B 2NZ0A 1CMFA 2M3WA 1WRZA 2ZRTA 4ZCVA 1A29A 3DF0B 2MA2A 4GNKB 4YGBB 1NX2A 1DF0B 1JSAA 1DVIA 1C7VA 2PSRA 2BCAA 1YUUA 2LHIA 3BYAA 2CXJA 1KK8B 2L2EA 1YVHA 2L4HA 3IQOA 4AOMA 3PFVA 2JNFA 2JU0A 4CIDA 1DJIA 4MZKA 1BOCA 1NPQA 2BECA 1NCYA 4MN0A 4DS7A 2QPTA 1NWDA 3I5FB 3NSKA 1J7RA 1TRFA 1AHRA 1RJVA 1M45A 1CFCA 1OE9B 1OMRA 1Y1UA 1NYAA 3OX6A 5FYXA 4UPGA 1AJ5A 2F2PA 4MBEA 1EL4A 3CR5X 1KCYA 3BUXB 3PM8A 1MXLC 5I8NA 3AKAA 1B7TY 3BQ3A 1SL7A 1TTXA 1WLMA 1Y0VH 2LVIA 3CZTX 1DJWA 1L2OC 2LP2A 3HX4A 4A4CA 1WLZA 2E6WA 5F6TA 1VRKA 3CTNA 2BBMA 1YURA 1Y6WA 3A8RA 4NDBA 3MSEB 1CFFA 2FCEA 3PSRA 1QVIY 1DGVA 4HREE 4MLWA 3BUMB 4MSPA 5ER4X 1IJ5A 2LCPA 2NCOA 3SIAA 2B1UA 4OV2A 1YVLA 5HLVA 1LINA 1FW4A 2QACA 3BOWA 3K21A 4M2OA 1RFJA 1S5GZ 2BE4A 2AUCA 3BUOB 1UP5A 1S26D 1A75B 2A4JA 3ZNIA 1BJFA 2CBLA 4I5NB 2PMYA 3EVUA 3WHTB 3NXAA 1J55A 1KFXS 1JFKA 2ZKMX 3O4YA 2LLTA 1TCFA 1UHIA 2M9GA 1HT9A 2H61C 3TZ1A 4DUQA 1QTXA 2E30A 1SRAA 5BPJA 1UWOA 2NCPA 3DVMA 4C0JA 2LUCA 2M7NA 2LVKA 4JWQA 1QLSA 4YI8A 2LM5A 2LMTA 5G08A 5J3XA 1K9PA 1UUSA 5HYDA 2K7DA 1G8IA 1L2OB 2KGRA 2LLSA 2HQWA 1DGUA 4MVFA 1QIVA 1K9UA 4AQIA 2EC6C 2LC5A 1AJ4A 1WRLA 4YBHB 1JF2A 1MUXA 4P5OE 1MXEA 2L51A 1FPWA 3EKJA 2V53A 2LLUA 3GK1A 1SR6C 4ORCB 1JC2A 1B4CA 2L50A 1KQMC 2G9BA 4I5JA 1PSRA 4PE0A 1N0YA 3LL8B 4CFQA 1YR5A 2VRGA 3AAJA 1FF1A 1SL9A 2LMVA 1TIZA 2HPSA 1XFYO 2KYFA 3FS7A 1ODBA 2WNDA 3I5FC 1H8BA 2I7AA 1QX7A 3A4UB 5HLOA 2JWWA 3DVEA 1CFPA 1SK6D 4YGDB 3IQQA 2KNEA 2MLEC 1IQ3A 4ETOA 2BBNA 4Q04A 5AANA 3WHUB 2LV7A 3VRRA 1X02A 5I2LA 2SCPA 1CTRA 4JQ0D 1B9AA 1BODA 5I2OA 1K95A 4GBAA 1S36A 1ZFSA 1SL8A 3VRQA 1S1EA 1SCMB 2KGBC 2PRUA 3PALA 1KK7Z 1LKJA 1XK4A 1LVCD 4IL1A 1SR6B 4ORAB 1S5GY 1CLMA 1A4PA 2M1UA 2M29A 3DF0A 1KQMB 1S6IA 1JF0A 1G33A 1UHHA 2JULA 2KBMA 3M0WA 4DRWA 3TUYC 1DJHA 4WQ2A 4QJ5B 2WORA 1V1GA 3PN7C 1CDNA 3EKHA 1A03A 5PALA 3LK0A 1BR1B 1QX5B 1CDPA 1ZOTB 1K93D 3TDUA 5KTYA 1RECA 1OZOA 3BUWB 1QV1A 1PVAA 4XJKB 1OSAA 2BL0C 2KAVA 4YI9A 2LMUA 4DCKA 2MBXA 3SG5A 1PULA 3GOFA 1K2HA 3OX5A 2JNXA 1LXFC 2KDHA 1YRTB 2JXCA 3F45A 5AXIA 4USLA 1GQMA 1ZUZA 2H2KA 3I5GB 4YGAA 4FTGA 1C7WA 4PE4A 1TNXA 3D0YA 5AEQA 1U5IB 4HSZA 1DTLA 1KFUS 1NP8A 2AAOA 2GGMA 5IBWA 1QXPA 1M46A 2K7CA 1K94A 2JZIA 1WY9A 3H4SE 3E3RA 3EK7A 1B8LA 3PATA 2KSPA 1RWYA 1K96A 2MAZA 1NX0A 1F70A 1UHJA 1R6PA 1SNLA 2M1KB 1F4OA 3LLEA 1B8RA 1NIWA 2I18A 3DVKA 4AQJA 3TUYB 1MF8B 1OOJA 5TNCA 3SG7A 3PN7B 2KQYA 1PVBA 2KYCA 1V1FA 2K7OA 2AMIA 2MRDA 1CLBA 1N65A 3BUNB 4C0LA 5CSNA 3SJSA 1DJYA 2F2OA 2PVBA 2G2BA 1S3PA 4GGFA 1M39A 2K8MB 1CMGA 2JTTA 1XYDA 2BL0B 3VRNA 4PHMA 4N1FA 3AKBA 1QLKA 2KFFA 4OVNF 4WQ3A 1UURA 4P2YB 2M97A 1BF5A 1F71A 1KSOA 1Q80A 2ZRSA 2HQ8A 4CFRA 3KEVA 3CGAA 2SASA 2O60A 1QIWA 3QRXA 1LA3A 4MRXA 2WCBA 3CR2A 4PALA 5CSJA 4E68A 1DT7B 1BG1A 2LP3A 2I94A 1CDLA 1KK7Y 1MQ1A 1SKTA 1SCMC 5D7FA 2MLFC 1KFXL 4HRGA 2ISDA 1XA5A 1NUBA 1YRUB 5HKZA 2GV5A 4PHNA 3TS5B 1IRJA 2EGDA 3C1VA 3KPXA 3O78A 3OB2B 3AAKA 4CPVA 2ZFDA 4NQGA 2BKIB 1XK4C 4N1GA 1EG3A 1CDMA 1H4BA 1DMOA 1M31A 2RGIA 1QATA 1CLLA 2L4IA 1CFDA 1YX7A 4GAOA 5GQQC 2FCDA 1LA0A 1QJTA 2LE9B 3EK8A 2WCFA 4QJ3B 2KAYA 2F3YA 2MHHA 1NX3A 3KO0A 3RM1A 4JPZB 1SMGA 1AUIB 3EVRA 1IH0A 3SIBA 4OCIA 1PALA 1K90D 4GGNA 1W7IB 4ICBA 5CSIA 1J7QA 2D8NA 2KBIA 3I5GC 2KI6D 2JQ6A 1IJ6A 2LANA 2MJWB 3JTDC 4GUKA 4ZCUA 2JRFA 1UHNA 2M7LA 2JTZA 2K2FA 1C07A 1J7PA 1KWOC 3DVJA 4YGEB 1XFUO 1B1GA 4CLNA 1GJYA 4WRIA 4PE1A 2DOQA 2KAXA 4BY5A 2CNPA 1NCXA 2GGZA 2LVJA 1NX1A 1KQVA 4HRHA 3O2PA 1R2UA 3GK2A 5AERA 4M2PA 1DF0A 1E8AA 1DJZA 3JVTB 3I5HC 2ZN9A 4BY4A 1JFJA 2LUXA 1EJ3A 2JPTA 2P6BB 1RTP1 4U8DA 1AP4A 1BLQA 1DJXA 2F8PA 1YUSA 1CM1A 3VRPA 2JC2A 2LHLA 1GGZA 2I2RE 2Q4UA 1FI6A 4GFTA 4DIRA 1BMOA 1J1EA 2Y5IA 1OZSA 1XFZO 1CKKA 2Q91A 2JXLA 2PALA 4FQOA 1RK9A 2CT9A 2F3ZA 2OTGC 1S6CA 1NCZA 2KFHA 4XJKA 5JJGA 4GGFC 2WC8A 3SG6A 3EVVA 1K9KA 1XFVO 2FOTA 3JTDB 1XFWO 3LK1A 4F0ZB 4ORBB 1IG5A 1QV0A 3HCMA 2CTNA 1KWOB 3VROA 1N2DA 1IGVA 2COLB 1FI5A 1FBVA 1M63B 1OMVA 3BXKA 2M49B 1U5IA 1TNPA 2KHNA 1YX8A 3D0YB 3WNXB 2WOSA 3TS5C 5ER5A 1BT6A 2JT8A 4PDZA 2IS9A 2ZN8A 1F8HA 1F55A 3D10A 1SPYA 3SG4A 1CM4A 1KSMA 2BCXA 2KQ6A 3I5HB 4L9MA 2M0RA 2JT3A 1IQ5A 2BKHB 2O5GA 2LVVA 5AFPA 2HF5A 5D69A 1K8UA 4NDCA 4PHKA 4MRYA 2JT0A 3BOWB 5KU1A 5KSZA 2OS8C 2K61A 3ICBA 1A75A 1A2XA 1JUOA 2K0JA 1QASA 1J7OA 1KFUL 2ZNEA 1F4QA 2BE6A 4PHJA 4PCWA 1PRWA 1WDCC 3I5IC 2L0PA 5CPVA 5HKWA 5CSFA 1SCVA 5JOLA 1SYMA 4QJ4B 3LCPC 4OR9B 2ZNDA 3VGOA 3CS1A 2K2AA 2OTGB 3IF7A 3WXAA 4C0KA 3OB1B 4YGCB 4XYNA 4I5LB 3NSOA 5I2QA 5B8IB 3FWBA 2NXQA 3NSLA 3FWCA 2EHBA 2Y1MA 2KI4C 3CWGA 3SG2A 2L5XB 3EK4A 1S6JA 3KHEA 4YRUA 1RROA 1YTZC 1MR8A 5DKQA 1QS7A 1G4YR 4MEWA 2LNKA 2R2IA 5K89A 2WCEA 1DJGA 1L7ZA 1OMDA 3CLNA 4MZLA 3RLZA 1ZMZA 4N5XA 4MZJA 3JVTC 1TNQA 1XFXO 1ZACA 1EXRA 1XVJA 1B7TZ 1OQPA 4GPLB 4OKHA 1HQVA 2F33A 1SBJA 3TDZA 1BU3A 5DKNA 1WRKA 2KOTA 2OS8B 3ZWHA 3SG3A 1TOPA 1PK0D 1GGWA 1QVIZ 1XO5A 1EG4A 2PASA 1TNWA 1Y1XA 4I5KA 1IKUA 1CNPA 1TCOB 4D1EA 1WDCB 1KK8C 3I5IB 1UHKA 1TN4A 1Y1AA 2KI6C 4A4BA 2M8UA 1AVSA 2Y1NA 2JOJA 2LAPA 3KF9A 2H61A 3GK4X 1AK8A 1EH2A 2KFGA 1ALVA 4R1EA 2OPOA 2Y4QA 5DKRA 1YUTA 3OP0A 1ALWA 3DD4A 1IWQA 4PE7A 2FJUB 1JWDA 1SY9A 2NLNA 3OHMB 1MWNA 2HETA 2L98A 2KI4B 2K7BA 1BR4B 3TDIA 1F54A 1SW8A 1W7JB 2TN4A 5HKYA 3CR4X 4TNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLF B;  4NDD A;  2BCB A;  1CB1 A;  1B47 A;  2CCM A;  1JBA A;  1QX2 A;  3NSI A;  3FIA A;  1D1O A;  1NSH A;  1PSB A;  4M2Q A;  1MHO A;  1J1D A;  1B8C A;  3O6B A;  2EC6 B;  2NZ0 A;  1CMF A;  2M3W A;  1WRZ A;  2ZRT A;  4ZCV A;  1A29 A;  3DF0 B;  2MA2 A;  4GNK B;  4YGB B;  1NX2 A;  1DF0 B;  1JSA A;  1DVI A;  1C7V A;  2PSR A;  2BCA A;  1YUU A;  2LHI A;  3BYA A;  2CXJ A;  1KK8 B;  2L2E A;  1YVH A;  2L4H A;  3IQO A;  4AOM A;  3PFV A;  2JNF A;  2JU0 A;  4CID A;  1DJI A;  4MZK A;  1BOC A;  1NPQ A;  2BEC A;  1NCY A;  4MN0 A;  4DS7 A;  2QPT A;  1NWD A;  3I5F B;  3NSK A;  1J7R A;  1TRF A;  1AHR A;  1RJV A;  1M45 A;  1CFC A;  1OE9 B;  1OMR A;  1Y1U A;  1NYA A;  3OX6 A;  5FYX A;  4UPG A;  1AJ5 A;  2F2P A;  4MBE A;  1EL4 A;  3CR5 X;  1KCY A;  3BUX B;  3PM8 A;  1MXL C;  5I8N A;  3AKA A;  1B7T Y;  3BQ3 A;  1SL7 A;  1TTX A;  1WLM A;  1Y0V H;  2LVI A;  3CZT X;  1DJW A;  1L2O C;  2LP2 A;  3HX4 A;  4A4C A;  1WLZ A;  2E6W A;  5F6T A;  1VRK A;  3CTN A;  2BBM A;  1YUR A;  1Y6W A;  3A8R A;  4NDB A;  3MSE B;  1CFF A;  2FCE A;  3PSR A;  1QVI Y;  1DGV A;  4HRE E;  4MLW A;  3BUM B;  4MSP A;  5ER4 X;  1IJ5 A;  2LCP A;  2NCO A;  3SIA A;  2B1U A;  4OV2 A;  1YVL A;  5HLV A;  1LIN A;  1FW4 A;  2QAC A;  3BOW A;  3K21 A;  4M2O A;  1RFJ A;  1S5G Z;  2BE4 A;  2AUC A;  3BUO B;  1UP5 A;  1S26 D;  1A75 B;  2A4J A;  3ZNI A;  1BJF A;  2CBL A;  4I5N B;  2PMY A;  3EVU A;  3WHT B;  3NXA A;  1J55 A;  1KFX S;  1JFK A;  2ZKM X;  3O4Y A;  2LLT A;  1TCF A;  1UHI A;  2M9G A;  1HT9 A;  2H61 C;  3TZ1 A;  4DUQ A;  1QTX A;  2E30 A;  1SRA A;  5BPJ A;  1UWO A;  2NCP A;  3DVM A;  4C0J A;  2LUC A;  2M7N A;  2LVK A;  4JWQ A;  1QLS A;  4YI8 A;  2LM5 A;  2LMT A;  5G08 A;  5J3X A;  1K9P A;  1UUS A;  5HYD A;  2K7D A;  1G8I A;  1L2O B;  2KGR A;  2LLS A;  2HQW A;  1DGU A;  4MVF A;  1QIV A;  1K9U A;  4AQI A;  2EC6 C;  2LC5 A;  1AJ4 A;  1WRL A;  4YBH B;  1JF2 A;  1MUX A;  4P5O E;  1MXE A;  2L51 A;  1FPW A;  3EKJ A;  2V53 A;  2LLU A;  3GK1 A;  1SR6 C;  4ORC B;  1JC2 A;  1B4C A;  2L50 A;  1KQM C;  2G9B A;  4I5J A;  1PSR A;  4PE0 A;  1N0Y A;  3LL8 B;  4CFQ A;  1YR5 A;  2VRG A;  3AAJ A;  1FF1 A;  1SL9 A;  2LMV A;  1TIZ A;  2HPS A;  1XFY O;  2KYF A;  3FS7 A;  1ODB A;  2WND A;  3I5F C;  1H8B A;  2I7A A;  1QX7 A;  3A4U B;  5HLO A;  2JWW A;  3DVE A;  1CFP A;  1SK6 D;  4YGD B;  3IQQ A;  2KNE A;  2MLE C;  1IQ3 A;  4ETO A;  2BBN A;  4Q04 A;  5AAN A;  3WHU B;  2LV7 A;  3VRR A;  1X02 A;  5I2L A;  2SCP A;  1CTR A;  4JQ0 D;  1B9A A;  1BOD A;  5I2O A;  1K95 A;  4GBA A;  1S36 A;  1ZFS A;  1SL8 A;  3VRQ A;  1S1E A;  1SCM B;  2KGB C;  2PRU A;  3PAL A;  1KK7 Z;  1LKJ A;  1XK4 A;  1LVC D;  4IL1 A;  1SR6 B;  4ORA B;  1S5G Y;  1CLM A;  1A4P A;  2M1U A;  2M29 A;  3DF0 A;  1KQM B;  1S6I A;  1JF0 A;  1G33 A;  1UHH A;  2JUL A;  2KBM A;  3M0W A;  4DRW A;  3TUY C;  1DJH A;  4WQ2 A;  4QJ5 B;  2WOR A;  1V1G A;  3PN7 C;  1CDN A;  3EKH A;  1A03 A;  5PAL A;  3LK0 A;  1BR1 B;  1QX5 B;  1CDP A;  1ZOT B;  1K93 D;  3TDU A;  5KTY A;  1REC A;  1OZO A;  3BUW B;  1QV1 A;  1PVA A;  4XJK B;  1OSA A;  2BL0 C;  2KAV A;  4YI9 A;  2LMU A;  4DCK A;  2MBX A;  3SG5 A;  1PUL A;  3GOF A;  1K2H A;  3OX5 A;  2JNX A;  1LXF C;  2KDH A;  1YRT B;  2JXC A;  3F45 A;  5AXI A;  4USL A;  1GQM A;  1ZUZ A;  2H2K A;  3I5G B;  4YGA A;  4FTG A;  1C7W A;  4PE4 A;  1TNX A;  3D0Y A;  5AEQ A;  1U5I B;  4HSZ A;  1DTL A;  1KFU S;  1NP8 A;  2AAO A;  2GGM A;  5IBW A;  1QXP A;  1M46 A;  2K7C A;  1K94 A;  2JZI A;  1WY9 A;  3H4S E;  3E3R A;  3EK7 A;  1B8L A;  3PAT A;  2KSP A;  1RWY A;  1K96 A;  2MAZ A;  1NX0 A;  1F70 A;  1UHJ A;  1R6P A;  1SNL A;  2M1K B;  1F4O A;  3LLE A;  1B8R A;  1NIW A;  2I18 A;  3DVK A;  4AQJ A;  3TUY B;  1MF8 B;  1OOJ A;  5TNC A;  3SG7 A;  3PN7 B;  2KQY A;  1PVB A;  2KYC A;  1V1F A;  2K7O A;  2AMI A;  2MRD A;  1CLB A;  1N65 A;  3BUN B;  4C0L A;  5CSN A;  3SJS A;  1DJY A;  2F2O A;  2PVB A;  2G2B A;  1S3P A;  4GGF A;  1M39 A;  2K8M B;  1CMG A;  2JTT A;  1XYD A;  2BL0 B;  3VRN A;  4PHM A;  4N1F A;  3AKB A;  1QLK A;  2KFF A;  4OVN F;  4WQ3 A;  1UUR A;  4P2Y B;  2M97 A;  1BF5 A;  1F71 A;  1KSO A;  1Q80 A;  2ZRS A;  2HQ8 A;  4CFR A;  3KEV A;  3CGA A;  2SAS A;  2O60 A;  1QIW A;  3QRX A;  1LA3 A;  4MRX A;  2WCB A;  3CR2 A;  4PAL A;  5CSJ A;  4E68 A;  1DT7 B;  1BG1 A;  2LP3 A;  2I94 A;  1CDL A;  1KK7 Y;  1MQ1 A;  1SKT A;  1SCM C;  5D7F A;  2MLF C;  1KFX L;  4HRG A;  2ISD A;  1XA5 A;  1NUB A;  1YRU B;  5HKZ A;  2GV5 A;  4PHN A;  3TS5 B;  1IRJ A;  2EGD A;  3C1V A;  3KPX A;  3O78 A;  3OB2 B;  3AAK A;  4CPV A;  2ZFD A;  4NQG A;  2BKI B;  1XK4 C;  4N1G A;  1EG3 A;  1CDM A;  1H4B A;  1DMO A;  1M31 A;  2RGI A;  1QAT A;  1CLL A;  2L4I A;  1CFD A;  1YX7 A;  4GAO A;  5GQQ C;  2FCD A;  1LA0 A;  1QJT A;  2LE9 B;  3EK8 A;  2WCF A;  4QJ3 B;  2KAY A;  2F3Y A;  2MHH A;  1NX3 A;  3KO0 A;  3RM1 A;  4JPZ B;  1SMG A;  1AUI B;  3EVR A;  1IH0 A;  3SIB A;  4OCI A;  1PAL A;  1K90 D;  4GGN A;  1W7I B;  4ICB A;  5CSI A;  1J7Q A;  2D8N A;  2KBI A;  3I5G C;  2KI6 D;  2JQ6 A;  1IJ6 A;  2LAN A;  2MJW B;  3JTD C;  4GUK A;  4ZCU A;  2JRF A;  1UHN A;  2M7L A;  2JTZ A;  2K2F A;  1C07 A;  1J7P A;  1KWO C;  3DVJ A;  4YGE B;  1XFU O;  1B1G A;  4CLN A;  1GJY A;  4WRI A;  4PE1 A;  2DOQ A;  2KAX A;  4BY5 A;  2CNP A;  1NCX A;  2GGZ A;  2LVJ A;  1NX1 A;  1KQV A;  4HRH A;  3O2P A;  1R2U A;  3GK2 A;  5AER A;  4M2P A;  1DF0 A;  1E8A A;  1DJZ A;  3JVT B;  3I5H C;  2ZN9 A;  4BY4 A;  1JFJ A;  2LUX A;  1EJ3 A;  2JPT A;  2P6B B;  1RTP 1;  4U8D A;  1AP4 A;  1BLQ A;  1DJX A;  2F8P A;  1YUS A;  1CM1 A;  3VRP A;  2JC2 A;  2LHL A;  1GGZ A;  2I2R E;  2Q4U A;  1FI6 A;  4GFT A;  4DIR A;  1BMO A;  1J1E A;  2Y5I A;  1OZS A;  1XFZ O;  1CKK A;  2Q91 A;  2JXL A;  2PAL A;  4FQO A;  1RK9 A;  2CT9 A;  2F3Z A;  2OTG C;  1S6C A;  1NCZ A;  2KFH A;  4XJK A;  5JJG A;  4GGF C;  2WC8 A;  3SG6 A;  3EVV A;  1K9K A;  1XFV O;  2FOT A;  3JTD B;  1XFW O;  3LK1 A;  4F0Z B;  4ORB B;  1IG5 A;  1QV0 A;  3HCM A;  2CTN A;  1KWO B;  3VRO A;  1N2D A;  1IGV A;  2COL B;  1FI5 A;  1FBV A;  1M63 B;  1OMV A;  3BXK A;  2M49 B;  1U5I A;  1TNP A;  2KHN A;  1YX8 A;  3D0Y B;  3WNX B;  2WOS A;  3TS5 C;  5ER5 A;  1BT6 A;  2JT8 A;  4PDZ A;  2IS9 A;  2ZN8 A;  1F8H A;  1F55 A;  3D10 A;  1SPY A;  3SG4 A;  1CM4 A;  1KSM A;  2BCX A;  2KQ6 A;  3I5H B;  4L9M A;  2M0R A;  2JT3 A;  1IQ5 A;  2BKH B;  2O5G A;  2LVV A;  5AFP A;  2HF5 A;  5D69 A;  1K8U A;  4NDC A;  4PHK A;  4MRY A;  2JT0 A;  3BOW B;  5KU1 A;  5KSZ A;  2OS8 C;  2K61 A;  3ICB A;  1A75 A;  1A2X A;  1JUO A;  2K0J A;  1QAS A;  1J7O A;  1KFU L;  2ZNE A;  1F4Q A;  2BE6 A;  4PHJ A;  4PCW A;  1PRW A;  1WDC C;  3I5I C;  2L0P A;  5CPV A;  5HKW A;  5CSF A;  1SCV A;  5JOL A;  1SYM A;  4QJ4 B;  3LCP C;  4OR9 B;  2ZND A;  3VGO A;  3CS1 A;  2K2A A;  2OTG B;  3IF7 A;  3WXA A;  4C0K A;  3OB1 B;  4YGC B;  4XYN A;  4I5L B;  3NSO A;  5I2Q A;  5B8I B;  3FWB A;  2NXQ A;  3NSL A;  3FWC A;  2EHB A;  2Y1M A;  2KI4 C;  3CWG A;  3SG2 A;  2L5X B;  3EK4 A;  1S6J A;  3KHE A;  4YRU A;  1RRO A;  1YTZ C;  1MR8 A;  5DKQ A;  1QS7 A;  1G4Y R;  4MEW A;  2LNK A;  2R2I A;  5K89 A;  2WCE A;  1DJG A;  1L7Z A;  1OMD A;  3CLN A;  4MZL A;  3RLZ A;  1ZMZ A;  4N5X A;  4MZJ A;  3JVT C;  1TNQ A;  1XFX O;  1ZAC A;  1EXR A;  1XVJ A;  1B7T Z;  1OQP A;  4GPL B;  4OKH A;  1HQV A;  2F33 A;  1SBJ A;  3TDZ A;  1BU3 A;  5DKN A;  1WRK A;  2KOT A;  2OS8 B;  3ZWH A;  3SG3 A;  1TOP A;  1PK0 D;  1GGW A;  1QVI Z;  1XO5 A;  1EG4 A;  2PAS A;  1TNW A;  1Y1X A;  4I5K A;  1IKU A;  1CNP A;  1TCO B;  4D1E A;  1WDC B;  1KK8 C;  3I5I B;  1UHK A;  1TN4 A;  1Y1A A;  2KI6 C;  4A4B A;  2M8U A;  1AVS A;  2Y1N A;  2JOJ A;  2LAP A;  3KF9 A;  2H61 A;  3GK4 X;  1AK8 A;  1EH2 A;  2KFG A;  1ALV A;  4R1E A;  2OPO A;  2Y4Q A;  5DKR A;  1YUT A;  3OP0 A;  1ALW A;  3DD4 A;  1IWQ A;  4PE7 A;  2FJU B;  1JWD A;  1SY9 A;  2NLN A;  3OHM B;  1MWN A;  2HET A;  2L98 A;  2KI4 B;  2K7B A;  1BR4 B;  3TDI A;  1F54 A;  1SW8 A;  1W7J B;  2TN4 A;  5HKY A;  3CR4 X;  4TNC A; 
#chains in the Genus database with same CATH topology
 3OGN A;  3PLF B;  4NDD A;  2BCB A;  1CB1 A;  1B47 A;  4PT1 A;  2CCM A;  2WC5 A;  3CAB A;  1JBA A;  1QX2 A;  3NSI A;  3FIA A;  1D1O A;  1NSH A;  5I94 A;  1PSB A;  4M2Q A;  1MHO A;  1J1D A;  1B8C A;  3O6B A;  4M2O A;  2EC6 B;  2NZ0 A;  1CMF A;  2M3W A;  1WRZ A;  2ZRT A;  4ZCV A;  1A29 A;  3DF0 B;  2MA2 A;  4GNK B;  4YGB B;  1NX2 A;  1DF0 B;  1JSA A;  1DVI A;  1C7V A;  2PSR A;  2BCA A;  1YUU A;  2LHI A;  3BYA A;  2CXJ A;  1OOI X;  1KK8 B;  3BJH A;  2L2E A;  1YVH A;  2L4H A;  3IQO A;  4AOM A;  2KPH A;  3PFV A;  1T14 A;  2JNF A;  2JU0 A;  4CID A;  1DJI A;  4MZK A;  1BOC A;  1NPQ A;  2BEC A;  1NCY A;  1OOH A;  4MN0 A;  4DS7 A;  1IIO A;  3UO9 A;  2QPT A;  1NWD A;  3R1P A;  3I5F B;  3NSK A;  4KYN A;  1J7R A;  1TRF A;  1AHR A;  4F7F A;  2P70 A;  3S0E A;  1RJV A;  1M45 A;  1CFC A;  1OE9 B;  1OMR A;  1Y1U A;  1NYA A;  3OX6 A;  5FYX A;  4UPG A;  1AJ5 A;  2F2P A;  4MBE A;  1EL4 A;  3CR5 X;  1KCY A;  3BUX B;  3PM8 A;  1MXL C;  1QWV A;  3AKA A;  5I8N A;  1B7T Y;  3BQ3 A;  1SL7 A;  1TTX A;  1WLM A;  1Y0V H;  2LVI A;  3B88 A;  1DJW A;  1L2O C;  2LP2 A;  3CZT X;  4A4C A;  1WLZ A;  2E6W A;  5F6T A;  1VRK A;  3CTN A;  2BBM A;  1YUR A;  1Y6W A;  3DXL A;  3A8R A;  4NDB A;  3MSE B;  1CFF A;  2FCE A;  3PSR A;  3S0G A;  2WC6 A;  1QVI Y;  5DIC A;  1DGV A;  4HRE E;  4MLW A;  3BUM B;  4MSP A;  5ER4 X;  1IJ5 A;  2LCP A;  1TWO A;  3UNW A;  2NCO A;  3SIA A;  2B1U A;  4OV2 A;  1YVL A;  2QEO A;  5HLV A;  1LIN A;  1FW4 A;  2GTE A;  2QAC A;  1DEK A;  3BOW A;  3K21 A;  4JD9 A;  1RFJ A;  1S5G Z;  2BE4 A;  2AUC A;  1DEL A;  3BUO B;  1UP5 A;  1S26 D;  1A75 B;  2A4J A;  3ZNI A;  1BJF A;  2CBL A;  4I5N B;  2PMY A;  3EVU A;  3CYZ A;  3WHT B;  3NXA A;  1J55 A;  1KFX S;  1JFK A;  2YGU A;  2ZKM X;  3O4Y A;  2LLT A;  2WCJ A;  1TCF A;  1UHI A;  2M9G A;  3L4A A;  1HT9 A;  2H61 C;  3TZ1 A;  4DUQ A;  1QTX A;  2E30 A;  1SRA A;  3VB1 A;  5BPJ A;  1UWO A;  2NCP A;  2H8V A;  3DVM A;  4C0J A;  2LUC A;  2M7N A;  2LVK A;  4JWQ A;  1QLS A;  4YI8 A;  2LM5 A;  3DY9 A;  2LMT A;  5G08 A;  5J3X A;  1K9P A;  1UUS A;  5HYD A;  3K1E A;  3B87 A;  2K7D A;  2QDI A;  1G8I A;  1L2O B;  2KGR A;  2LLS A;  2HQW A;  1DGU A;  4MVF A;  1QIV A;  1K9U A;  4AQI A;  2EC6 C;  2LC5 A;  1AJ4 A;  1WRL A;  4YBH B;  3OBV A;  3PJI A;  1JF2 A;  1MUX A;  4P5O E;  1MXE A;  2L51 A;  3D73 A;  1FPW A;  3EKJ A;  2V53 A;  2LLU A;  3GK1 A;  1SR6 C;  4ORC B;  1JC2 A;  1B4C A;  2L50 A;  2PYQ A;  3R72 A;  1KQM C;  2G9B A;  4I5J A;  1PSR A;  4PE0 A;  1N0Y A;  3LL8 B;  4CFQ A;  1YR5 A;  2VRG A;  3AAJ A;  4INW A;  1SL9 A;  1FF1 A;  2LMV A;  1OOG A;  1TIZ A;  2HPS A;  1XFY O;  2KYF A;  3FS7 A;  2K60 A;  1ODB A;  1J7Q A;  2WND A;  3I5F C;  3S0B A;  1H8B A;  1SSE B;  1QX7 A;  2I7A A;  3A4U B;  2JWW A;  3DVE A;  5HLO A;  1CFP A;  4INX A;  1SK6 D;  4YGD B;  3IQQ A;  2KNE A;  2MLE C;  1IQ3 A;  1TUZ A;  4ETO A;  2BBN A;  4Q04 A;  1OW4 A;  5AAN A;  3WHU B;  2LV7 A;  3VRR A;  1X02 A;  5I2L A;  3SS5 A;  2SCP A;  1CTR A;  4JQ0 D;  1B9A A;  1BOD A;  5I2O A;  1K95 A;  4GBA A;  1S36 A;  1ZFS A;  1ORG A;  1SL8 A;  3VRQ A;  1S1E A;  1SCM B;  2KGB C;  3FE6 A;  2PRU A;  3PAL A;  1KK7 Z;  1LKJ A;  1XK4 A;  1LVC D;  4IL1 A;  2ERB A;  1SR6 B;  4ORA B;  1S5G Y;  1CLM A;  1A4P A;  2M1U A;  2M29 A;  3DF0 A;  1KQM B;  1S6I A;  1JF0 A;  1G33 A;  1UHH A;  2JUL A;  2KBM A;  3M0W A;  4DRW A;  3TUY C;  1DJH A;  4WQ2 A;  3B6X A;  5EL2 A;  2WOR A;  1V1G A;  3PN7 C;  4QJ5 B;  1CDN A;  3EKH A;  1A03 A;  3D75 A;  5PAL A;  3LK0 A;  1BR1 B;  1QX5 B;  1CDP A;  1ZOT B;  1K93 D;  3TDU A;  3L47 A;  5KTY A;  1REC A;  1OZO A;  3BUW B;  1QV1 A;  1PVA A;  4XJK B;  1OSA A;  2BL0 C;  2KAV A;  4YI9 A;  2LMU A;  4DCK A;  2MBX A;  3SG5 A;  1PUL A;  3GOF A;  1K2H A;  1C3Z A;  2JNX A;  3OX5 A;  1LXF C;  2KDH A;  1YRT B;  2JXC A;  3F45 A;  5AXI A;  4USL A;  1GQM A;  1ZUZ A;  2H2K A;  3I5G B;  4YGA A;  4FTG A;  1C7W A;  4PE4 A;  1XFR A;  1TNX A;  3D0Y A;  5AEQ A;  1U5I B;  4HSZ A;  1DTL A;  1KFU S;  1NP8 A;  2AAO A;  2GGM A;  5IBW A;  1QXP A;  1M46 A;  2K7C A;  1K94 A;  2JZI A;  1WY9 A;  3H4S E;  3Q8I A;  3E3R A;  3EK7 A;  1B8L A;  3PAT A;  1C3Y A;  2KSP A;  1RWY A;  1K96 A;  2MAZ A;  1NX0 A;  1F70 A;  1UHJ A;  2FJY A;  3NHT A;  1R6P A;  1SNL A;  2M1K B;  1F4O A;  3LLE A;  1B8R A;  1NIW A;  2I18 A;  3DVK A;  4AQJ A;  3TUY B;  1MF8 B;  1OOJ A;  5TNC A;  3SG7 A;  3PN7 B;  2KQY A;  1PVB A;  2WCL A;  2KYC A;  1V1F A;  2K7O A;  2AMI A;  3DZT A;  2MRD A;  1CLB A;  1N65 A;  3BUN B;  3DYE A;  4C0L A;  5CSN A;  3SJS A;  1DJY A;  2F2O A;  2PVB A;  1DQE A;  2G2B A;  1S3P A;  3R1V A;  4GGF A;  1M39 A;  2K8M B;  1CMG A;  2JTT A;  1XYD A;  2BL0 B;  3VRN A;  4PHM A;  4N1F A;  3AKB A;  4FQT A;  3S0A A;  1QLK A;  2KFF A;  4OVN F;  4WQ3 A;  1UUR A;  4P2Y B;  2M97 A;  1BF5 A;  3PM2 A;  1F71 A;  1KSO A;  1Q80 A;  2ZRS A;  2HQ8 A;  4CFR A;  3KEV A;  3CGA A;  2SAS A;  2O60 A;  1QIW A;  3QRX A;  1LA3 A;  4MRX A;  2WCB A;  3CR2 A;  4PAL A;  5CSJ A;  4E68 A;  1DT7 B;  1BG1 A;  2LP3 A;  2I94 A;  1CDL A;  1KK7 Y;  1MQ1 A;  1SKT A;  1SCM C;  5D7F A;  2MLF C;  1KFX L;  4HRG A;  2ISD A;  1XA5 A;  1GM0 A;  1NUB A;  1YRU B;  5HKZ A;  3D78 A;  2GV5 A;  2BNX A;  4PHN A;  3TS5 B;  1IRJ A;  2EGD A;  3C1V A;  3KPX A;  3O78 A;  5D3O A;  3OB2 B;  3AAK A;  4CPV A;  2ZFD A;  4NQG A;  2BKI B;  1XK4 C;  4N1G A;  1EG3 A;  1CDM A;  1H4B A;  1DMO A;  3D77 A;  1M31 A;  2RGI A;  1QAT A;  1CLL A;  2L4I A;  1CFD A;  1LS8 A;  1YX7 A;  4GAO A;  5GQQ C;  2FCD A;  1LA0 A;  1QJT A;  2LE9 B;  3EK8 A;  2WCF A;  4QJ3 B;  2KAY A;  2F3Y A;  2MHH A;  1NX3 A;  3KO0 A;  3RM1 A;  4JPZ B;  1SMG A;  1AUI B;  3EVR A;  1DC1 A;  1IH0 A;  3SIB A;  4OCI A;  1PAL A;  1K90 D;  4GGN A;  1W7I B;  2KLD A;  4ICB A;  5CSI A;  3S0F A;  2D8N A;  2KBI A;  3I5G C;  2KI6 D;  2JQ6 A;  1IJ6 A;  1Z4H A;  2LAN A;  2MJW B;  3JTD C;  4GUK A;  3CZ1 A;  4ZCU A;  2JRF A;  2QEB A;  1UHN A;  3NGV A;  2M7L A;  2JTZ A;  2K2F A;  1C07 A;  1J7P A;  1KWO C;  3DVJ A;  4YGE B;  1XFU O;  1B1G A;  3V2L A;  4CLN A;  1GJY A;  4WRI A;  1P28 A;  2DOQ A;  4PE1 A;  2KAX A;  3BFH A;  4BY5 A;  2CNP A;  1NCX A;  2GGZ A;  2LVJ A;  1NX1 A;  1KQV A;  4HRH A;  4IJ7 A;  3O2P A;  1R2U A;  3GK2 A;  5AER A;  4M2P A;  1DF0 A;  1E8A A;  3IVT A;  1DJZ A;  3JVT B;  3I5H C;  2ZN9 A;  4BY4 A;  1JFJ A;  2LUX A;  1EJ3 A;  2JPT A;  3S0D A;  2P6B B;  1RTP 1;  4U8D A;  1AP4 A;  1BLQ A;  3FE8 A;  2L5Y A;  1DJX A;  2F8P A;  1YUS A;  1TUJ A;  1CM1 A;  3VRP A;  2JC2 A;  2KLE A;  1GGZ A;  2LHL A;  3RZS A;  2I2R E;  2Q4U A;  1FI6 A;  4GFT A;  2JPO A;  4DIR A;  1BMO A;  1J1E A;  2Y5I A;  3EG5 B;  1OZS A;  1XFZ O;  1CKK A;  2Q91 A;  2JXL A;  2PAL A;  4FQO A;  1RK9 A;  2CT9 A;  2F3Z A;  2OTG C;  1S6C A;  1NCZ A;  3CZ0 A;  2KFH A;  3O4X A;  5FI6 A;  2WCM A;  4XJK A;  5JJG A;  2PQL A;  4GGF C;  2WC8 A;  3SG6 A;  3CZ2 A;  3EVV A;  1K9K A;  1XFV O;  2FOT A;  3JTD B;  1XFW O;  3LK1 A;  4F0Z B;  4ORB B;  1IG5 A;  3R1O A;  1QV0 A;  3HCM A;  2CTN A;  3FE9 A;  1KWO B;  3VRO A;  3SS4 A;  1N2D A;  3B7A A;  1IGV A;  2COL B;  1FI5 A;  1FBV A;  1M63 B;  1OMV A;  3BXK A;  2M49 B;  1U5I A;  1TNP A;  2KHN A;  1YX8 A;  3D0Y B;  3WNX B;  2WOS A;  3TS5 C;  5ER5 A;  1BT6 A;  2JT8 A;  4PDZ A;  2IS9 A;  2ZN8 A;  1F8H A;  1F55 A;  3D10 A;  1SPY A;  3SG4 A;  1CM4 A;  1KSM A;  2BCX A;  2KQ6 A;  3B86 A;  3I5H B;  5HL1 A;  3SS3 A;  4L9M A;  2M0R A;  2JT3 A;  1IQ5 A;  2BKH B;  2O5G A;  2LVV A;  2BAP A;  2HF5 A;  5D69 A;  5AFP A;  1K8U A;  4NDC A;  4JKT A;  4PHK A;  4MRY A;  2JT0 A;  3BOW B;  5KU1 A;  5KSZ A;  2OS8 C;  2K61 A;  3ICB A;  1A75 A;  1A2X A;  1JUO A;  2K0J A;  1QAS A;  1J7O A;  1KFU L;  3L4L A;  2ZNE A;  1F4Q A;  2BE6 A;  4PHJ A;  4PCW A;  1PRW A;  2L2C A;  1WDC C;  3I5I C;  2L0P A;  5CPV A;  5HKW A;  5CSF A;  1SCV A;  5JOL A;  1SYM A;  4QJ4 B;  3LCP C;  4OR9 B;  2ZND A;  3VGO A;  3CS1 A;  2K2A A;  2OTG B;  3IF7 A;  4OZD A;  3WXA A;  3D74 A;  3OB1 B;  4YGC B;  4C0K A;  4XYN A;  4I5L B;  3NSO A;  3HX4 A;  5I2Q A;  5B8I B;  3FWB A;  2NXQ A;  3D76 A;  3NSL A;  3FWC A;  2EHB A;  2Y1M A;  2KI4 C;  3CWG A;  3SG2 A;  2L5X B;  3NHI A;  3EK4 A;  1S6J A;  3KHE A;  4YRU A;  1RRO A;  2QEH A;  1YTZ C;  1MR8 A;  5DKQ A;  1QS7 A;  1G4Y R;  4MEW A;  2LNK A;  2R2I A;  5K89 A;  2WCE A;  1DJG A;  1L7Z A;  1OMD A;  3CLN A;  4MZL A;  3RLZ A;  2WCK A;  1ZMZ A;  4N5X A;  3N7H A;  4MZJ A;  3JVT C;  1TNQ A;  1XFX O;  1ZAC A;  1EXR A;  1W9Z A;  1XVJ A;  1B7T Z;  1OQP A;  5FI7 A;  4GPL B;  4OKH A;  1HQV A;  2F33 A;  1OOF A;  1SBJ A;  3TDZ A;  1BU3 A;  5DKN A;  1WRK A;  2QEV A;  2KOT A;  2OS8 B;  3ZWH A;  3SG3 A;  1TOP A;  1PK0 D;  1GGW A;  1QVI Z;  1XO5 A;  1EG4 A;  2PAS A;  1TNW A;  1Y1X A;  4I5K A;  3QME A;  1IKU A;  1CNP A;  1TCO B;  4D1E A;  1WDC B;  1KK8 C;  3I5I B;  1UHK A;  1TN4 A;  1Y1A A;  3CDN A;  2KI6 C;  4A4B A;  2M8U A;  1AVS A;  2WCH A;  2JOJ A;  2LAP A;  2Y1N A;  2H61 A;  3GK4 X;  3KF9 A;  1AK8 A;  1EH2 A;  2KFG A;  1ALV A;  4R1E A;  2OPO A;  2Y4Q A;  1Z2C B;  5DKR A;  1YUT A;  3OP0 A;  1ALW A;  3DD4 A;  1IWQ A;  4PE7 A;  2FJU B;  5FI2 A;  1JWD A;  1SY9 A;  2NLN A;  3OHM B;  1MWN A;  2HET A;  3BFA A;  2L98 A;  2KI4 B;  2K7B A;  2P71 A;  1BR4 B;  3TDI A;  1F54 A;  1SW8 A;  1W7J B;  2TN4 A;  3BFB A;  5HKY A;  3CR4 X;  4TNC A; 
#chains in the Genus database with same CATH homology
 3PLF B;  4NDD A;  2BCB A;  1CB1 A;  1B47 A;  2CCM A;  1JBA A;  1QX2 A;  3NSI A;  3FIA A;  1D1O A;  1NSH A;  1PSB A;  4M2Q A;  1MHO A;  1J1D A;  1B8C A;  3O6B A;  2EC6 B;  2NZ0 A;  1CMF A;  2M3W A;  1WRZ A;  2ZRT A;  4ZCV A;  1A29 A;  3DF0 B;  2MA2 A;  4GNK B;  4YGB B;  1NX2 A;  1DF0 B;  1JSA A;  1DVI A;  1C7V A;  2PSR A;  2BCA A;  1YUU A;  2LHI A;  3BYA A;  2CXJ A;  1KK8 B;  2L2E A;  1YVH A;  2L4H A;  3IQO A;  4AOM A;  3PFV A;  2JNF A;  2JU0 A;  4CID A;  1DJI A;  4MZK A;  1BOC A;  1NPQ A;  2BEC A;  1NCY A;  4MN0 A;  4DS7 A;  2QPT A;  1NWD A;  3I5F B;  3NSK A;  1J7R A;  1TRF A;  1AHR A;  1RJV A;  1M45 A;  1CFC A;  1OE9 B;  1OMR A;  1Y1U A;  1NYA A;  3OX6 A;  5FYX A;  4UPG A;  1AJ5 A;  2F2P A;  4MBE A;  1EL4 A;  3CR5 X;  1KCY A;  3BUX B;  3PM8 A;  1MXL C;  5I8N A;  3AKA A;  1B7T Y;  3BQ3 A;  1SL7 A;  1TTX A;  1WLM A;  1Y0V H;  2LVI A;  3CZT X;  1DJW A;  1L2O C;  2LP2 A;  3HX4 A;  4A4C A;  1WLZ A;  2E6W A;  5F6T A;  1VRK A;  3CTN A;  2BBM A;  1YUR A;  1Y6W A;  3A8R A;  4NDB A;  3MSE B;  1CFF A;  2FCE A;  3PSR A;  1QVI Y;  1DGV A;  4HRE E;  4MLW A;  3BUM B;  4MSP A;  5ER4 X;  1IJ5 A;  2LCP A;  2NCO A;  3SIA A;  2B1U A;  4OV2 A;  1YVL A;  5HLV A;  1LIN A;  1FW4 A;  2QAC A;  3BOW A;  3K21 A;  4M2O A;  1RFJ A;  1S5G Z;  2BE4 A;  2AUC A;  3BUO B;  1UP5 A;  1S26 D;  1A75 B;  2A4J A;  3ZNI A;  1BJF A;  2CBL A;  4I5N B;  2PMY A;  3EVU A;  3WHT B;  3NXA A;  1J55 A;  1KFX S;  1JFK A;  2ZKM X;  3O4Y A;  2LLT A;  1TCF A;  1UHI A;  2M9G A;  1HT9 A;  2H61 C;  3TZ1 A;  4DUQ A;  1QTX A;  2E30 A;  1SRA A;  5BPJ A;  1UWO A;  2NCP A;  3DVM A;  4C0J A;  2LUC A;  2M7N A;  2LVK A;  4JWQ A;  1QLS A;  4YI8 A;  2LM5 A;  2LMT A;  5G08 A;  5J3X A;  1K9P A;  1UUS A;  5HYD A;  2K7D A;  1G8I A;  1L2O B;  2KGR A;  2LLS A;  2HQW A;  1DGU A;  4MVF A;  1QIV A;  1K9U A;  4AQI A;  2EC6 C;  2LC5 A;  1AJ4 A;  1WRL A;  4YBH B;  1JF2 A;  1MUX A;  4P5O E;  1MXE A;  2L51 A;  1FPW A;  3EKJ A;  2V53 A;  2LLU A;  3GK1 A;  1SR6 C;  4ORC B;  1JC2 A;  1B4C A;  2L50 A;  1KQM C;  2G9B A;  4I5J A;  1PSR A;  4PE0 A;  1N0Y A;  3LL8 B;  4CFQ A;  1YR5 A;  2VRG A;  3AAJ A;  1FF1 A;  1SL9 A;  2LMV A;  1TIZ A;  2HPS A;  1XFY O;  2KYF A;  3FS7 A;  1ODB A;  2WND A;  3I5F C;  1H8B A;  2I7A A;  1QX7 A;  3A4U B;  5HLO A;  2JWW A;  3DVE A;  1CFP A;  1SK6 D;  4YGD B;  3IQQ A;  2KNE A;  2MLE C;  1IQ3 A;  4ETO A;  2BBN A;  4Q04 A;  5AAN A;  3WHU B;  2LV7 A;  3VRR A;  1X02 A;  5I2L A;  2SCP A;  1CTR A;  4JQ0 D;  1B9A A;  1BOD A;  5I2O A;  1K95 A;  4GBA A;  1S36 A;  1ZFS A;  1SL8 A;  3VRQ A;  1S1E A;  1SCM B;  2KGB C;  2PRU A;  3PAL A;  1KK7 Z;  1LKJ A;  1XK4 A;  1LVC D;  4IL1 A;  1SR6 B;  4ORA B;  1S5G Y;  1CLM A;  1A4P A;  2M1U A;  2M29 A;  3DF0 A;  1KQM B;  1S6I A;  1JF0 A;  1G33 A;  1UHH A;  2JUL A;  2KBM A;  3M0W A;  4DRW A;  3TUY C;  1DJH A;  4WQ2 A;  4QJ5 B;  2WOR A;  1V1G A;  3PN7 C;  1CDN A;  3EKH A;  1A03 A;  5PAL A;  3LK0 A;  1BR1 B;  1QX5 B;  1CDP A;  1ZOT B;  1K93 D;  3TDU A;  5KTY A;  1REC A;  1OZO A;  3BUW B;  1QV1 A;  1PVA A;  4XJK B;  1OSA A;  2BL0 C;  2KAV A;  4YI9 A;  2LMU A;  4DCK A;  2MBX A;  3SG5 A;  1PUL A;  3GOF A;  1K2H A;  3OX5 A;  2JNX A;  1LXF C;  2KDH A;  1YRT B;  2JXC A;  3F45 A;  5AXI A;  4USL A;  1GQM A;  1ZUZ A;  2H2K A;  3I5G B;  4YGA A;  4FTG A;  1C7W A;  4PE4 A;  1TNX A;  3D0Y A;  5AEQ A;  1U5I B;  4HSZ A;  1DTL A;  1KFU S;  1NP8 A;  2AAO A;  2GGM A;  5IBW A;  1QXP A;  1M46 A;  2K7C A;  1K94 A;  2JZI A;  1WY9 A;  3H4S E;  3E3R A;  3EK7 A;  1B8L A;  3PAT A;  2KSP A;  1RWY A;  1K96 A;  2MAZ A;  1NX0 A;  1F70 A;  1UHJ A;  1R6P A;  1SNL A;  2M1K B;  1F4O A;  3LLE A;  1B8R A;  1NIW A;  2I18 A;  3DVK A;  4AQJ A;  3TUY B;  1MF8 B;  1OOJ A;  5TNC A;  3SG7 A;  3PN7 B;  2KQY A;  1PVB A;  2KYC A;  1V1F A;  2K7O A;  2AMI A;  2MRD A;  1CLB A;  1N65 A;  3BUN B;  4C0L A;  5CSN A;  3SJS A;  1DJY A;  2F2O A;  2PVB A;  2G2B A;  1S3P A;  4GGF A;  1M39 A;  2K8M B;  1CMG A;  2JTT A;  1XYD A;  2BL0 B;  3VRN A;  4PHM A;  4N1F A;  3AKB A;  1QLK A;  2KFF A;  4OVN F;  4WQ3 A;  1UUR A;  4P2Y B;  2M97 A;  1BF5 A;  1F71 A;  1KSO A;  1Q80 A;  2ZRS A;  2HQ8 A;  4CFR A;  3KEV A;  3CGA A;  2SAS A;  2O60 A;  1QIW A;  3QRX A;  1LA3 A;  4MRX A;  2WCB A;  3CR2 A;  4PAL A;  5CSJ A;  4E68 A;  1DT7 B;  1BG1 A;  2LP3 A;  2I94 A;  1CDL A;  1KK7 Y;  1MQ1 A;  1SKT A;  1SCM C;  5D7F A;  2MLF C;  1KFX L;  4HRG A;  2ISD A;  1XA5 A;  1NUB A;  1YRU B;  5HKZ A;  2GV5 A;  4PHN A;  3TS5 B;  1IRJ A;  2EGD A;  3C1V A;  3KPX A;  3O78 A;  3OB2 B;  3AAK A;  4CPV A;  2ZFD A;  4NQG A;  2BKI B;  1XK4 C;  4N1G A;  1EG3 A;  1CDM A;  1H4B A;  1DMO A;  1M31 A;  2RGI A;  1QAT A;  1CLL A;  2L4I A;  1CFD A;  1YX7 A;  4GAO A;  5GQQ C;  2FCD A;  1LA0 A;  1QJT A;  2LE9 B;  3EK8 A;  2WCF A;  4QJ3 B;  2KAY A;  2F3Y A;  2MHH A;  1NX3 A;  3KO0 A;  3RM1 A;  4JPZ B;  1SMG A;  1AUI B;  3EVR A;  1IH0 A;  3SIB A;  4OCI A;  1PAL A;  1K90 D;  4GGN A;  1W7I B;  4ICB A;  5CSI A;  1J7Q A;  2D8N A;  2KBI A;  3I5G C;  2KI6 D;  2JQ6 A;  1IJ6 A;  2LAN A;  2MJW B;  3JTD C;  4GUK A;  4ZCU A;  2JRF A;  1UHN A;  2M7L A;  2JTZ A;  2K2F A;  1C07 A;  1J7P A;  1KWO C;  3DVJ A;  4YGE B;  1XFU O;  1B1G A;  4CLN A;  1GJY A;  4WRI A;  4PE1 A;  2DOQ A;  2KAX A;  4BY5 A;  2CNP A;  1NCX A;  2GGZ A;  2LVJ A;  1NX1 A;  1KQV A;  4HRH A;  3O2P A;  1R2U A;  3GK2 A;  5AER A;  4M2P A;  1DF0 A;  1E8A A;  1DJZ A;  3JVT B;  3I5H C;  2ZN9 A;  4BY4 A;  1JFJ A;  2LUX A;  1EJ3 A;  2JPT A;  2P6B B;  1RTP 1;  4U8D A;  1AP4 A;  1BLQ A;  1DJX A;  2F8P A;  1YUS A;  1CM1 A;  3VRP A;  2JC2 A;  2LHL A;  1GGZ A;  2I2R E;  2Q4U A;  1FI6 A;  4GFT A;  4DIR A;  1BMO A;  1J1E A;  2Y5I A;  1OZS A;  1XFZ O;  1CKK A;  2Q91 A;  2JXL A;  2PAL A;  4FQO A;  1RK9 A;  2CT9 A;  2F3Z A;  2OTG C;  1S6C A;  1NCZ A;  2KFH A;  4XJK A;  5JJG A;  4GGF C;  2WC8 A;  3SG6 A;  3EVV A;  1K9K A;  1XFV O;  2FOT A;  3JTD B;  1XFW O;  3LK1 A;  4F0Z B;  4ORB B;  1IG5 A;  1QV0 A;  3HCM A;  2CTN A;  1KWO B;  3VRO A;  1N2D A;  1IGV A;  2COL B;  1FI5 A;  1FBV A;  1M63 B;  1OMV A;  3BXK A;  2M49 B;  1U5I A;  1TNP A;  2KHN A;  1YX8 A;  3D0Y B;  3WNX B;  2WOS A;  3TS5 C;  5ER5 A;  1BT6 A;  2JT8 A;  4PDZ A;  2IS9 A;  2ZN8 A;  1F8H A;  1F55 A;  3D10 A;  1SPY A;  3SG4 A;  1CM4 A;  1KSM A;  2BCX A;  2KQ6 A;  3I5H B;  4L9M A;  2M0R A;  2JT3 A;  1IQ5 A;  2BKH B;  2O5G A;  2LVV A;  5AFP A;  2HF5 A;  5D69 A;  1K8U A;  4NDC A;  4PHK A;  4MRY A;  2JT0 A;  3BOW B;  5KU1 A;  5KSZ A;  2OS8 C;  2K61 A;  3ICB A;  1A75 A;  1A2X A;  1JUO A;  2K0J A;  1QAS A;  1J7O A;  1KFU L;  2ZNE A;  1F4Q A;  2BE6 A;  4PHJ A;  4PCW A;  1PRW A;  1WDC C;  3I5I C;  2L0P A;  5CPV A;  5HKW A;  5CSF A;  1SCV A;  5JOL A;  1SYM A;  4QJ4 B;  3LCP C;  4OR9 B;  2ZND A;  3VGO A;  3CS1 A;  2K2A A;  2OTG B;  3IF7 A;  3WXA A;  4C0K A;  3OB1 B;  4YGC B;  4XYN A;  4I5L B;  3NSO A;  5I2Q A;  5B8I B;  3FWB A;  2NXQ A;  3NSL A;  3FWC A;  2EHB A;  2Y1M A;  2KI4 C;  3CWG A;  3SG2 A;  2L5X B;  3EK4 A;  1S6J A;  3KHE A;  4YRU A;  1RRO A;  1YTZ C;  1MR8 A;  5DKQ A;  1QS7 A;  1G4Y R;  4MEW A;  2LNK A;  2R2I A;  5K89 A;  2WCE A;  1DJG A;  1L7Z A;  1OMD A;  3CLN A;  4MZL A;  3RLZ A;  1ZMZ A;  4N5X A;  4MZJ A;  3JVT C;  1TNQ A;  1XFX O;  1ZAC A;  1EXR A;  1XVJ A;  1B7T Z;  1OQP A;  4GPL B;  4OKH A;  1HQV A;  2F33 A;  1SBJ A;  3TDZ A;  1BU3 A;  5DKN A;  1WRK A;  2KOT A;  2OS8 B;  3ZWH A;  3SG3 A;  1TOP A;  1PK0 D;  1GGW A;  1QVI Z;  1XO5 A;  1EG4 A;  2PAS A;  1TNW A;  1Y1X A;  4I5K A;  1IKU A;  1CNP A;  1TCO B;  4D1E A;  1WDC B;  1KK8 C;  3I5I B;  1UHK A;  1TN4 A;  1Y1A A;  2KI6 C;  4A4B A;  2M8U A;  1AVS A;  2Y1N A;  2JOJ A;  2LAP A;  3KF9 A;  2H61 A;  3GK4 X;  1AK8 A;  1EH2 A;  2KFG A;  1ALV A;  4R1E A;  2OPO A;  2Y4Q A;  5DKR A;  1YUT A;  3OP0 A;  1ALW A;  3DD4 A;  1IWQ A;  4PE7 A;  2FJU B;  1JWD A;  1SY9 A;  2NLN A;  3OHM B;  1MWN A;  2HET A;  2L98 A;  2KI4 B;  2K7B A;  1BR4 B;  3TDI A;  1F54 A;  1SW8 A;  1W7J B;  2TN4 A;  5HKY A;  3CR4 X;  4TNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...