2KPHA

Nmr structure of atrapbp1 at ph 4.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
142
structure length
142
Chain Sequence
SPEIMKDLSINFGKALDTCKKELDLPDSINEDFYKFWKEDYEITNRLTGCAIKCLSEKLEMVDADGKLHHGNAREFAMKHGADDAMAKQLVDLIHGCEKSIPPNDDRCMEVLSIAMCFKKEIHNLKWAPNMEVVVGEVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Pheromone binding protein
publication title NMR Structure of Navel Orangeworm Moth Pheromone-Binding Protein (AtraPBP1): Implications for pH-Sensitive Pheromone Detection .
pubmed doi rcsb
source organism Amyelois transitella
total genus 40
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2kphA00
3D73A 4OZDA 2ERBA 1OOFA 3BFAA 2L2CA 3K1EA 1P28A 1OW4A 3CABA 3D74A 3S0GA 3S0BA 2P71A 1C3YA 4INXA 2WCHA 3S0EA 2FJYA 4INWA 3OGNA 2WC6A 4PT1A 3S0FA 3R1OA 3DY9A 3DXLA 1C3ZA 2WCMA 4F7FA 3DYEA 3FE9A 3L47A 3B87A 3N7HA 2GTEA 3CYZA 3FE6A 3QMEA 2QEHA 2WCJA 2PQLA 2H8VA 5DICA 3R1PA 1GM0A 3DZTA 1DQEA 3L4AA 3BFBA 3VB1A 3Q8IA 3CZ2A 1LS8A 1OOHA 5EL2A 1XFRA 3V2LA 1QWVA 3NHTA 3L4LA 3B86A 3R1VA 3PJIA 1TUJA 3S0AA 3NHIA 2QEVA 1TWOA 3CZ1A 3S0DA 3B7AA 3FE8A 2QEBA 2QEOA 2P70A 3D75A 3NGVA 1OOGA 3B88A 4FQTA 1T14A 1OOIX 3BJHA 3D76A 3CDNA 4JD9A 3B6XA 3RZSA 2QDIA 3D77A 3R72A 3BFHA 1ORGA 2WC5A 3CZ0A 2WCKA 2WCLA 2JPOA 3D78A 2KPHA
chains in the Genus database with same CATH superfamily
3WHTB 3BOWB 4C0KA 2FJUB 2Y4QA 3D73A 3M0WA 1YUSA 1E8AA 4JWQA 4OZDA 1H4BA 2JXCA 3EG5B 2LLUA 3PALA 2LCPA 2PALA 4MRXA 1K94A 3OB1B 1S5GY 4QJ5B 1M46A 1B8RA 2DOQA 1PSBA 2LMVA 1QVIZ 3LL8B 1K9KA 1MXEA 1PSRA 2M97A 3CABA 4ORBB 4NQGA 1G33A 1U5IA 3S0BA 2P71A 1YR5A 2KGBC 3CGAA 2L50A 1F54A 1B9AA 4GBAA 2LV7A 3I5GB 2WCHA 3NSLA 4KYNA 2ZKMX 3S0FA 1H8BA 3OGNA 2WC6A 2R2IA 3IF7A 3UNWA 1YTZC 3EK4A 3VRNA 1Y1XA 2VRGA 1C3ZA 2KLEA 1PK0D 3D0YA 2ZN8A 3BYAA 1XFWO 1SRAA 3AKBA 1SYMA 2MBXA 4ICBA 1W9ZA 2ZRTA 4N5XA 3RM1A 1JSAA 2LNKA 2EHBA 1ALVA 4ORAB 2KSPA 2KI6C 1KK8B 2Y1MA 5KSZA 5J3XA 2NXQA 3F45A 1UHHA 1BLQA 2V53A 4DUQA 4FQOA 4XJKB 4JQ0D 1RROA 2HETA 1S6CA 4IL1A 2AAOA 3CYZA 1IG5A 3NXAA 2CT9A 3QMEA 2QEHA 2KOTA 1JF0A 1OMVA 2JWWA 1B7TZ 3SG2A 1FI5A 2KFHA 2F3ZA 1KFXL 5HKZA 1MR8A 1LINA 3BQ3A 1DQEA 4P2YB 1F55A 1ALWA 3A8RA 3BFBA 4NDBA 2BCBA 2KQYA 4P5OE 5IBWA 2M7LA 3CWGA 3ZWHA 1N0YA 3NSIA 1XFRA 1YX7A 3EKJA 3PSRA 1A29A 2OTGB 1UHNA 5AANA 1Z2CB 3BUMB 5AXIA 1OZOA 3GK4X 1JWDA 1B8CA 2JC2A 1SCVA 1EG4A 3CS1A 4JKTA 1CFFA 1CLLA 3DVJA 1K96A 3DF0B 3S0DA 1NP8A 3BUOB 3FE8A 4YI8A 2KBIA 1SCMB 5DKQA 4GGFC 1F71A 1BT6A 4MZKA 5HLVA 1UP5A 2JNXA 2CXJA 2WCBA 3NGVA 4HRHA 5DKRA 3DVEA 2AUCA 3BXKA 2JULA 3JVTC 1DJXA 1CDLA 4YGDB 4GFTA 1NX0A 1WLZA 1DGVA 2F2OA 2I94A 1K2HA 4FTGA 4YBHB 1N2DA 2KNEA 1LXFC 3LK1A 4MZJA 5KU1A 1LKJA 3TDZA 2CCMA 5AERA 3B6XA 5HKYA 1SMGA 2QDIA 4I5NB 2K61A 3UO9A 1CMFA 2WOSA 2WCFA 2JRFA 2P6BB 1TNQA 4PHJA 2NCOA 3HCMA 5FYXA 3VRQA 2K7BA 2KAXA 2L5XB 2LHLA 1WDCB 2WCKA 3FIAA 2L5YA 4M2QA 4JPZB 1B47A 1J1EA 1FW4A 3OX6A 1DJIA 2SASA 1DJHA 4GGNA 1KFXS 3WXAA 2ERBA 1OOFA 1KK8C 4MRYA 5HYDA 4YGEB 1R2UA 1S5GZ 3O4XA 1P28A 2LVKA 1DF0B 1TUZA 3CZTX 3OX5A 3TS5C 3O6BA 4YGAA 2F2PA 3VROA 1M63B 1UURA 3S0GA 4C0LA 4A4CA 1QS7A 2PSRA 1BMOA 2BCXA 2JU0A 1QXPA 1PRWA 1NSHA 1C3YA 2F3YA 1UHKA 2BBNA 2ZFDA 1DMOA 1MQ1A 2FJYA 2BKIB 3BOWA 4N1FA 2JOJA 2ZN9A 1K8UA 1EG3A 1FBVA 1KSOA 4C0JA 1KFUL 3DXLA 1GQMA 4MLWA 1L2OC 2H61A 3GOFA 1SBJA 1IWQA 1S3PA 1SK6D 1TN4A 2JT3A 2OTGC 1S36A 3PM8A 2I7AA 1YRUB 2M49B 4F7FA 3DYEA 1SR6B 5CSNA 1NWDA 4F0ZB 1GJYA 1TIZA 2LHIA 2I18A 3JVTB 1SCMC 3O78A 4PE0A 1A4PA 1XO5A 3H4SE 1XYDA 4WRIA 1UHIA 2K7CA 3FE6A 1J7PA 1DJYA 2MJWB 1J7OA 1CDPA 1BU3A 1UWOA 4PHNA 2Y5IA 3IQOA 2K0JA 3FWBA 1NX2A 1ZOTB 3NSKA 1NUBA 3EVRA 4OKHA 5DICA 3C1VA 3OB2B 2E30A 3DZTA 1G4YR 2K2FA 5CSFA 1QV0A 3IQQA 3TDUA 1CDNA 2PRUA 1WRLA 1VRKA 2K2AA 1TTXA 3OP0A 1Y0VH 4I5JA 2Q4UA 1PULA 4D1EA 2KFFA 4XJKA 2JQ6A 3I5FC 2KAYA 1WDCC 3B86A 4NDCA 2KYCA 1KK7Y 3PLFB 4A4BA 2FOTA 4U8DA 1SSEB 1KQVA 1K9UA 1TUJA 1XFVO 2FCDA 3NHIA 1RK9A 1U5IB 2EGDA 1XFYO 5HL1A 1Q80A 3TS5B 1DJGA 1R6PA 3DD4A 2LVVA 4PE1A 4R1EA 2QEBA 4NDDA 1JBAA 1F70A 5BPJA 1KWOB 3I5IB 1NCYA 1SL9A 2LAPA 1KFUS 1TNWA 3PM2A 1M31A 1SL7A 1OOGA 3D0YB 1EH2A 3FWCA 1JC2A 2JZIA 1F8HA 1S6IA 1T14A 1AHRA 2LMTA 1IIOA 1PVBA 3SS3A 1A75B 1L2OB 2WORA 3D76A 3TUYB 4BY5A 1QIVA 1S26D 2BECA 1UHJA 3RZSA 2L2EA 2M8UA 3DF0A 4MVFA 4L9MA 2MAZA 3R72A 3JTDB 2SCPA 1MF8B 3BFHA 1GGWA 1ORGA 3VRPA 1BOCA 3EVVA 1UUSA 1JUOA 4BY4A 1IKUA 2NZ0A 1K95A 1F4QA 1ZACA 4PHMA 2KPHA 2KBMA 1QTXA 2HF5A 2CNPA 1DT7B 1CFDA 1NX1A 1SR6C 2BCAA 3I5HC 4WQ2A 1ZUZA 3EK8A 3BFAA 2L2CA 1QIWA 2Q91A 2QPTA 3CR5X 3K1EA 3KO0A 3KPXA 4HRGA 2B1UA 4PCWA 1YUUA 1KCYA 3DVMA 2K8MB 4GNKB 1OW4A 4UPGA 1OZSA 2LLTA 2HQWA 1YRTB 1A03A 4DCKA 1CMGA 1Y1AA 1SL8A 4PHKA 4CLNA 2LVJA 1QX5B 2BL0C 2O60A 4YRUA 2M1UA 2HQ8A 3SG7A 1QX2A 2A4JA 3LCPC 2EC6C 1XK4C 2GV5A 1EL4A 4ORCB 1SNLA 3SG4A 4INXA 3I5FB 2BKHB 1RWYA 4GPLB 3S0EA 4DIRA 4INWA 4PT1A 3EVUA 4AOMA 1A2XA 3SG5A 1M45A 5FI6A 2LP3A 1MXLC 1QLSA 3TZ1A 2WCMA 1CB1A 1BR1B 2LMUA 3RLZA 1G8IA 1IJ5A 1WY9A 3FE9A 1AUIB 1AJ4A 2RGIA 4QJ3B 5JOLA 2ZNDA 3L47A 1CLBA 1N65A 2O5GA 4PALA 2JTTA 1V1GA 1TCFA 2LM5A 2KI6D 1J7RA 3E3RA 3LLEA 2BBMA 4HSZA 4USLA 5I2OA 2MRDA 4TNCA 1OMRA 1NIWA 1KWOC 2I2RE 2PMYA 1C7VA 1QJTA 3I5IC 1ZMZA 1CFPA 4YGBB 2M3WA 2D8NA 2WCJA 1F4OA 2BE6A 1JFJA 4N1GA 5CSJA 1GM0A 1RECA 1CTRA 4PE4A 1YVHA 2E6WA 2COLB 3D10A 1QLKA 1DEKA 1IQ5A 2L98A 4ZCVA 1LA3A 3TUYC 2M1KB 1RFJA 1W7JB 2Y1NA 2G2BA 1NX3A 4YGCB 3SIAA 1NPQA 3CZ2A 4E68A 1LS8A 4CFQA 4PE7A 1AK8A 1JFKA 1SPYA 2BNXA 2BAPA 3JTDC 5EL2A 1QASA 3V2LA 1FI6A 3NHTA 3I5HB 5ER5A 1B4CA 3GK1A 3L4LA 2TN4A 4CPVA 2JT8A 1KK7Z 2OPOA 3R1VA 3VGOA 3PJIA 5G08A 3VRRA 1YURA 3CLNA 5PALA 3S0AA 2MLFC 1TWOA 3KF9A 2ISDA 3CTNA 1BJFA 3ICBA 1EXRA 5D3OA 2HPSA 1KSMA 1X02A 2BL0B 2KGRA 2P70A 3D75A 5K89A 2EC6B 1TCOB 2LP2A 2LUCA 3SIBA 2LVIA 5JJGA 1IRJA 1TNPA 1IJ6A 1Z4HA 4AQJA 1OOIX 3HX4A 1B1GA 1C7WA 2JPTA 3WHUB 1QV1A 5F6TA 4JD9A 5D7FA 1DJZA 2NCPA 2F8PA 4AQIA 1XA5A 1YVLA 1SY9A 1M39A 1OE9B 4OR9B 1XVJA 2WC5A 1CLMA 3CZ0A 1FPWA 3PN7C 3BUXB 3NSOA 1OOJA 3SG3A 1MHOA 2WCLA 3A4UB 2MA2A 1MUXA 1BF5A 1PVAA 3GK2A 2F33A 3EK7A 5FI7A 1PALA 1OMDA 1NCZA 4GUKA 4DRWA 1AVSA 1GGZA 2NLNA 2BE4A 5I2LA 5KTYA 4PDZA 1CM4A 2M9GA 1A75A 2WCEA 2KI4C 1Y1UA 4MBEA 4OV2A 1CKKA 3IVTA 4M2PA 1S6JA 1L7ZA 2L4HA 1QVIY 2GGMA 3CR2A 1DELA 2K7DA 3CR4X 4CFRA 1NYAA 5D69A 2CTNA 5ER4X 3D74A 4I5LB 1XFXO 2LANA 2JXLA 2AMIA 1V1FA 1TOPA 2LUXA 1IH0A 2LE9B 1HQVA 1LA0A 2JTZA 2LC5A 3O2PA 3KEVA 1NCXA 2ZRSA 1BODA 1RTP1 1OSAA 4OVNF 1HT9A 3R1OA 1K9PA 4HREE 3K21A 1BG1A 1AJ5A 2PYQA 3DY9A 1YX8A 1WRKA 1DGUA 1J55A 1DJWA 2JT0A 1BR4B 1KQMC 4OCIA 1EJ3A 3AKAA 4WQ3A 1CM1A 1IGVA 1ODBA 1JF2A 2OS8C 1J7QA 5DKNA 4QJ4B 3AAKA 1YUTA 1S1EA 2KQ6A 2PASA 1TRFA 2KLDA 1DC1A 2YGUA 4ETOA 2KFGA 3B87A 5I8NA 3N7HA 3TDIA 1MWNA 2GTEA 2KDHA 1CNPA 3BUNB 3MSEB 1K93D 4MSPA 2KHNA 4XYNA 5CPVA 2PQLA 3FS7A 1DTLA 4I5KA 3AAJA 3SG6A 1B7TY 2H61C 2H8VA 3R1PA 5TNCA 1W7IB 4YI9A 3L4AA 3VB1A 5CSIA 1J1DA 3PN7B 4MEWA 2FCEA 4IJ7A 5AEQA 1IQ3A 1K90D 3Q8IA 1DF0A 2WNDA 5I94A 1OOHA 2QACA 4Q04A 3WNXB 1QWVA 1B8LA 4MZLA 3I5GC 3PFVA 3QRXA 1WLMA 2GGZA 2CBLA 4MN0A 1D1OA 2KI4B 2QEVA 2JNFA 2IS9A 2L0PA 3CZ1A 2WC8A 3DVKA 4M2OA 1QATA 3B7AA 5GQQC 1AP4A 2PVBA 1QX7A 2QEOA 2G9BA 2KAVA 3KHEA 3SS5A 2L51A 5B8IB 4GAOA 3PATA 4GGFA 1DVIA 2M7NA 1C07A 5HLOA 1OQPA 2MLEC 2M0RA 3OHMB 3B88A 2LLSA 4FQTA 1Y6WA 5I2QA 2H2KA 3BJHA 1TNXA 3ZNIA 2ZNEA 1ZFSA 3CDNA 1CFCA 1KQMB 3LK0A 1CDMA 2OS8B 3EKHA 1RJVA 1XFUO 2L4IA 4ZCUA 3D77A 3SJSA 5AFPA 5HKWA 3BUWB 2K7OA 1SW8A 4DS7A 2MHHA 1FF1A 2M29A 3SS4A 1XK4A 5FI2A 2JPOA 2K60A 3D78A 1WRZA 1SKTA 1LVCD 1XFZO 2KYFA 3OBVA 4CIDA 3O4YA
chains in the Genus database with same CATH topology
3D73A 4OZDA 2ERBA 1OOFA 3BFAA 2L2CA 3K1EA 1P28A 1OW4A 3CABA 3D74A 3S0GA 3S0BA 2P71A 1C3YA 4INXA 2WCHA 3S0EA 2FJYA 4INWA 3OGNA 2WC6A 4PT1A 3S0FA 3R1OA 3DY9A 3DXLA 1C3ZA 2WCMA 4F7FA 3DYEA 3FE9A 3L47A 3B87A 3N7HA 2GTEA 3CYZA 3FE6A 3QMEA 2QEHA 2WCJA 2PQLA 2H8VA 5DICA 3R1PA 1GM0A 3DZTA 1DQEA 3L4AA 3BFBA 3VB1A 3Q8IA 3CZ2A 1LS8A 1OOHA 5EL2A 1XFRA 3V2LA 1QWVA 3NHTA 3L4LA 3B86A 3R1VA 3PJIA 1TUJA 3S0AA 3NHIA 2QEVA 1TWOA 3CZ1A 3S0DA 3B7AA 3FE8A 2QEBA 2QEOA 2P70A 3D75A 3NGVA 1OOGA 3B88A 4FQTA 1T14A 1OOIX 3BJHA 3D76A 3CDNA 4JD9A 3B6XA 3RZSA 2QDIA 3D77A 3R72A 3BFHA 1ORGA 2WC5A 3CZ0A 2WCKA 2WCLA 2JPOA 3D78A 2KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D73 A;  4OZD A;  2ERB A;  1OOF A;  3BFA A;  2L2C A;  3K1E A;  1P28 A;  1OW4 A;  3CAB A;  3D74 A;  3S0G A;  3S0B A;  2P71 A;  1C3Y A;  4INX A;  2WCH A;  3S0E A;  2FJY A;  4INW A;  3OGN A;  2WC6 A;  4PT1 A;  3S0F A;  3R1O A;  3DY9 A;  3DXL A;  1C3Z A;  2WCM A;  4F7F A;  3DYE A;  3FE9 A;  3L47 A;  3B87 A;  3N7H A;  2GTE A;  3CYZ A;  3FE6 A;  3QME A;  2QEH A;  2WCJ A;  2PQL A;  2H8V A;  5DIC A;  3R1P A;  1GM0 A;  3DZT A;  1DQE A;  3L4A A;  3BFB A;  3VB1 A;  3Q8I A;  3CZ2 A;  1LS8 A;  1OOH A;  5EL2 A;  1XFR A;  3V2L A;  1QWV A;  3NHT A;  3L4L A;  3B86 A;  3R1V A;  3PJI A;  1TUJ A;  3S0A A;  3NHI A;  2QEV A;  1TWO A;  3CZ1 A;  3S0D A;  3B7A A;  3FE8 A;  2QEB A;  2QEO A;  2P70 A;  3D75 A;  3NGV A;  1OOG A;  3B88 A;  4FQT A;  1T14 A;  1OOI X;  3BJH A;  3D76 A;  3CDN A;  4JD9 A;  3B6X A;  3RZS A;  2QDI A;  3D77 A;  3R72 A;  3BFH A;  1ORG A;  2WC5 A;  3CZ0 A;  2WCK A;  2WCL A;  2JPO A;  3D78 A;  2KPH A; 
#chains in the Genus database with same CATH topology
 3WHT B;  3BOW B;  4C0K A;  2FJU B;  2Y4Q A;  3D73 A;  3M0W A;  1YUS A;  1E8A A;  4JWQ A;  4OZD A;  1H4B A;  2JXC A;  3EG5 B;  2LLU A;  3PAL A;  2LCP A;  2PAL A;  4MRX A;  1K94 A;  3OB1 B;  1S5G Y;  4QJ5 B;  1M46 A;  1B8R A;  2DOQ A;  1PSB A;  2LMV A;  1QVI Z;  3LL8 B;  1K9K A;  1MXE A;  1PSR A;  2M97 A;  3CAB A;  4ORB B;  4NQG A;  1G33 A;  1U5I A;  3S0B A;  2P71 A;  1YR5 A;  2KGB C;  3CGA A;  2L50 A;  1F54 A;  1B9A A;  4GBA A;  2LV7 A;  3I5G B;  2WCH A;  3NSL A;  4KYN A;  2ZKM X;  3S0F A;  1H8B A;  3OGN A;  2WC6 A;  2R2I A;  3IF7 A;  3UNW A;  1YTZ C;  3EK4 A;  3VRN A;  1Y1X A;  2VRG A;  1C3Z A;  2KLE A;  1PK0 D;  3D0Y A;  2ZN8 A;  3BYA A;  1XFW O;  1SRA A;  3AKB A;  1SYM A;  2MBX A;  4ICB A;  1W9Z A;  2ZRT A;  4N5X A;  3RM1 A;  1JSA A;  2LNK A;  2EHB A;  1ALV A;  4ORA B;  2KSP A;  2KI6 C;  1KK8 B;  2Y1M A;  5KSZ A;  5J3X A;  2NXQ A;  3F45 A;  1UHH A;  1BLQ A;  2V53 A;  4DUQ A;  4FQO A;  4XJK B;  4JQ0 D;  1RRO A;  2HET A;  1S6C A;  4IL1 A;  2AAO A;  3CYZ A;  1IG5 A;  3NXA A;  2CT9 A;  3QME A;  2QEH A;  2KOT A;  1JF0 A;  1OMV A;  2JWW A;  1B7T Z;  3SG2 A;  1FI5 A;  2KFH A;  2F3Z A;  1KFX L;  5HKZ A;  1MR8 A;  1LIN A;  3BQ3 A;  1DQE A;  4P2Y B;  1F55 A;  1ALW A;  3A8R A;  3BFB A;  4NDB A;  2BCB A;  2KQY A;  4P5O E;  5IBW A;  2M7L A;  3CWG A;  3ZWH A;  1N0Y A;  3NSI A;  1XFR A;  1YX7 A;  3EKJ A;  3PSR A;  1A29 A;  2OTG B;  1UHN A;  5AAN A;  1Z2C B;  3BUM B;  5AXI A;  1OZO A;  3GK4 X;  1JWD A;  1B8C A;  2JC2 A;  1SCV A;  1EG4 A;  3CS1 A;  4JKT A;  1CFF A;  1CLL A;  3DVJ A;  1K96 A;  3DF0 B;  3S0D A;  1NP8 A;  3BUO B;  3FE8 A;  4YI8 A;  2KBI A;  1SCM B;  5DKQ A;  4GGF C;  1F71 A;  1BT6 A;  4MZK A;  5HLV A;  1UP5 A;  2JNX A;  2CXJ A;  2WCB A;  3NGV A;  4HRH A;  5DKR A;  3DVE A;  2AUC A;  3BXK A;  2JUL A;  3JVT C;  1DJX A;  1CDL A;  4YGD B;  4GFT A;  1NX0 A;  1WLZ A;  1DGV A;  2F2O A;  2I94 A;  1K2H A;  4FTG A;  4YBH B;  1N2D A;  2KNE A;  1LXF C;  3LK1 A;  4MZJ A;  5KU1 A;  1LKJ A;  3TDZ A;  2CCM A;  5AER A;  3B6X A;  5HKY A;  1SMG A;  2QDI A;  4I5N B;  2K61 A;  3UO9 A;  1CMF A;  2WOS A;  2WCF A;  2JRF A;  2P6B B;  1TNQ A;  4PHJ A;  2NCO A;  3HCM A;  5FYX A;  3VRQ A;  2K7B A;  2KAX A;  2L5X B;  2LHL A;  1WDC B;  2WCK A;  3FIA A;  2L5Y A;  4M2Q A;  4JPZ B;  1B47 A;  1J1E A;  1FW4 A;  3OX6 A;  1DJI A;  2SAS A;  1DJH A;  4GGN A;  1KFX S;  3WXA A;  2ERB A;  1OOF A;  1KK8 C;  4MRY A;  5HYD A;  4YGE B;  1R2U A;  1S5G Z;  3O4X A;  1P28 A;  2LVK A;  1DF0 B;  1TUZ A;  3CZT X;  3OX5 A;  3TS5 C;  3O6B A;  4YGA A;  2F2P A;  3VRO A;  1M63 B;  1UUR A;  3S0G A;  4C0L A;  4A4C A;  1QS7 A;  2PSR A;  1BMO A;  2BCX A;  2JU0 A;  1QXP A;  1PRW A;  1NSH A;  1C3Y A;  2F3Y A;  1UHK A;  2BBN A;  2ZFD A;  1DMO A;  1MQ1 A;  2FJY A;  2BKI B;  3BOW A;  4N1F A;  2JOJ A;  2ZN9 A;  1K8U A;  1EG3 A;  1FBV A;  1KSO A;  4C0J A;  1KFU L;  3DXL A;  1GQM A;  4MLW A;  1L2O C;  2H61 A;  3GOF A;  1SBJ A;  1IWQ A;  1S3P A;  1SK6 D;  1TN4 A;  2JT3 A;  2OTG C;  1S36 A;  3PM8 A;  2I7A A;  1YRU B;  2M49 B;  4F7F A;  3DYE A;  1SR6 B;  5CSN A;  1NWD A;  4F0Z B;  1GJY A;  1TIZ A;  2LHI A;  2I18 A;  3JVT B;  1SCM C;  3O78 A;  4PE0 A;  1A4P A;  1XO5 A;  3H4S E;  1XYD A;  4WRI A;  1UHI A;  2K7C A;  3FE6 A;  1J7P A;  1DJY A;  2MJW B;  1J7O A;  1CDP A;  1BU3 A;  1UWO A;  4PHN A;  2Y5I A;  3IQO A;  2K0J A;  3FWB A;  1NX2 A;  1ZOT B;  3NSK A;  1NUB A;  3EVR A;  4OKH A;  5DIC A;  3C1V A;  3OB2 B;  2E30 A;  3DZT A;  1G4Y R;  2K2F A;  5CSF A;  1QV0 A;  3IQQ A;  3TDU A;  1CDN A;  2PRU A;  1WRL A;  1VRK A;  2K2A A;  1TTX A;  3OP0 A;  1Y0V H;  4I5J A;  2Q4U A;  1PUL A;  4D1E A;  2KFF A;  4XJK A;  2JQ6 A;  3I5F C;  2KAY A;  1WDC C;  3B86 A;  4NDC A;  2KYC A;  1KK7 Y;  3PLF B;  4A4B A;  2FOT A;  4U8D A;  1SSE B;  1KQV A;  1K9U A;  1TUJ A;  1XFV O;  2FCD A;  3NHI A;  1RK9 A;  1U5I B;  2EGD A;  1XFY O;  5HL1 A;  1Q80 A;  3TS5 B;  1DJG A;  1R6P A;  3DD4 A;  2LVV A;  4PE1 A;  4R1E A;  2QEB A;  4NDD A;  1JBA A;  1F70 A;  5BPJ A;  1KWO B;  3I5I B;  1NCY A;  1SL9 A;  2LAP A;  1KFU S;  1TNW A;  3PM2 A;  1M31 A;  1SL7 A;  1OOG A;  3D0Y B;  1EH2 A;  3FWC A;  1JC2 A;  2JZI A;  1F8H A;  1S6I A;  1T14 A;  1AHR A;  2LMT A;  1IIO A;  1PVB A;  3SS3 A;  1A75 B;  1L2O B;  2WOR A;  3D76 A;  3TUY B;  4BY5 A;  1QIV A;  1S26 D;  2BEC A;  1UHJ A;  3RZS A;  2L2E A;  2M8U A;  3DF0 A;  4MVF A;  4L9M A;  2MAZ A;  3R72 A;  3JTD B;  2SCP A;  1MF8 B;  3BFH A;  1GGW A;  1ORG A;  3VRP A;  1BOC A;  3EVV A;  1UUS A;  1JUO A;  4BY4 A;  1IKU A;  2NZ0 A;  1K95 A;  1F4Q A;  1ZAC A;  4PHM A;  2KPH A;  2KBM A;  1QTX A;  2HF5 A;  2CNP A;  1DT7 B;  1CFD A;  1NX1 A;  1SR6 C;  2BCA A;  3I5H C;  4WQ2 A;  1ZUZ A;  3EK8 A;  3BFA A;  2L2C A;  1QIW A;  2Q91 A;  2QPT A;  3CR5 X;  3K1E A;  3KO0 A;  3KPX A;  4HRG A;  2B1U A;  4PCW A;  1YUU A;  1KCY A;  3DVM A;  2K8M B;  4GNK B;  1OW4 A;  4UPG A;  1OZS A;  2LLT A;  2HQW A;  1YRT B;  1A03 A;  4DCK A;  1CMG A;  1Y1A A;  1SL8 A;  4PHK A;  4CLN A;  2LVJ A;  1QX5 B;  2BL0 C;  2O60 A;  4YRU A;  2M1U A;  2HQ8 A;  3SG7 A;  1QX2 A;  2A4J A;  3LCP C;  2EC6 C;  1XK4 C;  2GV5 A;  1EL4 A;  4ORC B;  1SNL A;  3SG4 A;  4INX A;  3I5F B;  2BKH B;  1RWY A;  4GPL B;  3S0E A;  4DIR A;  4INW A;  4PT1 A;  3EVU A;  4AOM A;  1A2X A;  3SG5 A;  1M45 A;  5FI6 A;  2LP3 A;  1MXL C;  1QLS A;  3TZ1 A;  2WCM A;  1CB1 A;  1BR1 B;  2LMU A;  3RLZ A;  1G8I A;  1IJ5 A;  1WY9 A;  3FE9 A;  1AUI B;  1AJ4 A;  2RGI A;  4QJ3 B;  5JOL A;  2ZND A;  3L47 A;  1CLB A;  1N65 A;  2O5G A;  4PAL A;  2JTT A;  1V1G A;  1TCF A;  2LM5 A;  2KI6 D;  1J7R A;  3E3R A;  3LLE A;  2BBM A;  4HSZ A;  4USL A;  5I2O A;  2MRD A;  4TNC A;  1OMR A;  1NIW A;  1KWO C;  2I2R E;  2PMY A;  1C7V A;  1QJT A;  3I5I C;  1ZMZ A;  1CFP A;  4YGB B;  2M3W A;  2D8N A;  2WCJ A;  1F4O A;  2BE6 A;  1JFJ A;  4N1G A;  5CSJ A;  1GM0 A;  1REC A;  1CTR A;  4PE4 A;  1YVH A;  2E6W A;  2COL B;  3D10 A;  1QLK A;  1DEK A;  1IQ5 A;  2L98 A;  4ZCV A;  1LA3 A;  3TUY C;  2M1K B;  1RFJ A;  1W7J B;  2Y1N A;  2G2B A;  1NX3 A;  4YGC B;  3SIA A;  1NPQ A;  3CZ2 A;  4E68 A;  1LS8 A;  4CFQ A;  4PE7 A;  1AK8 A;  1JFK A;  1SPY A;  2BNX A;  2BAP A;  3JTD C;  5EL2 A;  1QAS A;  3V2L A;  1FI6 A;  3NHT A;  3I5H B;  5ER5 A;  1B4C A;  3GK1 A;  3L4L A;  2TN4 A;  4CPV A;  2JT8 A;  1KK7 Z;  2OPO A;  3R1V A;  3VGO A;  3PJI A;  5G08 A;  3VRR A;  1YUR A;  3CLN A;  5PAL A;  3S0A A;  2MLF C;  1TWO A;  3KF9 A;  2ISD A;  3CTN A;  1BJF A;  3ICB A;  1EXR A;  5D3O A;  2HPS A;  1KSM A;  1X02 A;  2BL0 B;  2KGR A;  2P70 A;  3D75 A;  5K89 A;  2EC6 B;  1TCO B;  2LP2 A;  2LUC A;  3SIB A;  2LVI A;  5JJG A;  1IRJ A;  1TNP A;  1IJ6 A;  1Z4H A;  4AQJ A;  1OOI X;  3HX4 A;  1B1G A;  1C7W A;  2JPT A;  3WHU B;  1QV1 A;  5F6T A;  4JD9 A;  5D7F A;  1DJZ A;  2NCP A;  2F8P A;  4AQI A;  1XA5 A;  1YVL A;  1SY9 A;  1M39 A;  1OE9 B;  4OR9 B;  1XVJ A;  2WC5 A;  1CLM A;  3CZ0 A;  1FPW A;  3PN7 C;  3BUX B;  3NSO A;  1OOJ A;  3SG3 A;  1MHO A;  2WCL A;  3A4U B;  2MA2 A;  1MUX A;  1BF5 A;  1PVA A;  3GK2 A;  2F33 A;  3EK7 A;  5FI7 A;  1PAL A;  1OMD A;  1NCZ A;  4GUK A;  4DRW A;  1AVS A;  1GGZ A;  2NLN A;  2BE4 A;  5I2L A;  5KTY A;  4PDZ A;  1CM4 A;  2M9G A;  1A75 A;  2WCE A;  2KI4 C;  1Y1U A;  4MBE A;  4OV2 A;  1CKK A;  3IVT A;  4M2P A;  1S6J A;  1L7Z A;  2L4H A;  1QVI Y;  2GGM A;  3CR2 A;  1DEL A;  2K7D A;  3CR4 X;  4CFR A;  1NYA A;  5D69 A;  2CTN A;  5ER4 X;  3D74 A;  4I5L B;  1XFX O;  2LAN A;  2JXL A;  2AMI A;  1V1F A;  1TOP A;  2LUX A;  1IH0 A;  2LE9 B;  1HQV A;  1LA0 A;  2JTZ A;  2LC5 A;  3O2P A;  3KEV A;  1NCX A;  2ZRS A;  1BOD A;  1RTP 1;  1OSA A;  4OVN F;  1HT9 A;  3R1O A;  1K9P A;  4HRE E;  3K21 A;  1BG1 A;  1AJ5 A;  2PYQ A;  3DY9 A;  1YX8 A;  1WRK A;  1DGU A;  1J55 A;  1DJW A;  2JT0 A;  1BR4 B;  1KQM C;  4OCI A;  1EJ3 A;  3AKA A;  4WQ3 A;  1CM1 A;  1IGV A;  1ODB A;  1JF2 A;  2OS8 C;  1J7Q A;  5DKN A;  4QJ4 B;  3AAK A;  1YUT A;  1S1E A;  2KQ6 A;  2PAS A;  1TRF A;  2KLD A;  1DC1 A;  2YGU A;  4ETO A;  2KFG A;  3B87 A;  5I8N A;  3N7H A;  3TDI A;  1MWN A;  2GTE A;  2KDH A;  1CNP A;  3BUN B;  3MSE B;  1K93 D;  4MSP A;  2KHN A;  4XYN A;  5CPV A;  2PQL A;  3FS7 A;  1DTL A;  4I5K A;  3AAJ A;  3SG6 A;  1B7T Y;  2H61 C;  2H8V A;  3R1P A;  5TNC A;  1W7I B;  4YI9 A;  3L4A A;  3VB1 A;  5CSI A;  1J1D A;  3PN7 B;  4MEW A;  2FCE A;  4IJ7 A;  5AEQ A;  1IQ3 A;  1K90 D;  3Q8I A;  1DF0 A;  2WND A;  5I94 A;  1OOH A;  2QAC A;  4Q04 A;  3WNX B;  1QWV A;  1B8L A;  4MZL A;  3I5G C;  3PFV A;  3QRX A;  1WLM A;  2GGZ A;  2CBL A;  4MN0 A;  1D1O A;  2KI4 B;  2QEV A;  2JNF A;  2IS9 A;  2L0P A;  3CZ1 A;  2WC8 A;  3DVK A;  4M2O A;  1QAT A;  3B7A A;  5GQQ C;  1AP4 A;  2PVB A;  1QX7 A;  2QEO A;  2G9B A;  2KAV A;  3KHE A;  3SS5 A;  2L51 A;  5B8I B;  4GAO A;  3PAT A;  4GGF A;  1DVI A;  2M7N A;  1C07 A;  5HLO A;  1OQP A;  2MLE C;  2M0R A;  3OHM B;  3B88 A;  2LLS A;  4FQT A;  1Y6W A;  5I2Q A;  2H2K A;  3BJH A;  1TNX A;  3ZNI A;  2ZNE A;  1ZFS A;  3CDN A;  1CFC A;  1KQM B;  3LK0 A;  1CDM A;  2OS8 B;  3EKH A;  1RJV A;  1XFU O;  2L4I A;  4ZCU A;  3D77 A;  3SJS A;  5AFP A;  5HKW A;  3BUW B;  2K7O A;  1SW8 A;  4DS7 A;  2MHH A;  1FF1 A;  2M29 A;  3SS4 A;  1XK4 A;  5FI2 A;  2JPO A;  2K60 A;  3D78 A;  1WRZ A;  1SKT A;  1LVC D;  1XFZ O;  2KYF A;  3OBV A;  4CID A;  3O4Y A; 
#chains in the Genus database with same CATH homology
 3D73 A;  4OZD A;  2ERB A;  1OOF A;  3BFA A;  2L2C A;  3K1E A;  1P28 A;  1OW4 A;  3CAB A;  3D74 A;  3S0G A;  3S0B A;  2P71 A;  1C3Y A;  4INX A;  2WCH A;  3S0E A;  2FJY A;  4INW A;  3OGN A;  2WC6 A;  4PT1 A;  3S0F A;  3R1O A;  3DY9 A;  3DXL A;  1C3Z A;  2WCM A;  4F7F A;  3DYE A;  3FE9 A;  3L47 A;  3B87 A;  3N7H A;  2GTE A;  3CYZ A;  3FE6 A;  3QME A;  2QEH A;  2WCJ A;  2PQL A;  2H8V A;  5DIC A;  3R1P A;  1GM0 A;  3DZT A;  1DQE A;  3L4A A;  3BFB A;  3VB1 A;  3Q8I A;  3CZ2 A;  1LS8 A;  1OOH A;  5EL2 A;  1XFR A;  3V2L A;  1QWV A;  3NHT A;  3L4L A;  3B86 A;  3R1V A;  3PJI A;  1TUJ A;  3S0A A;  3NHI A;  2QEV A;  1TWO A;  3CZ1 A;  3S0D A;  3B7A A;  3FE8 A;  2QEB A;  2QEO A;  2P70 A;  3D75 A;  3NGV A;  1OOG A;  3B88 A;  4FQT A;  1T14 A;  1OOI X;  3BJH A;  3D76 A;  3CDN A;  4JD9 A;  3B6X A;  3RZS A;  2QDI A;  3D77 A;  3R72 A;  3BFH A;  1ORG A;  2WC5 A;  3CZ0 A;  2WCK A;  2WCL A;  2JPO A;  3D78 A;  2KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...