3DVKA

Crystal structure of ca2+/cam-cav2.3 iq domain complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
143
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvkA00
2EGDA 2K0JA 1M46A 4AOMA 2LLUA 5JJGA 3TUYB 4N5XA 1B47A 1EL4A 2JT8A 1CNPA 2GGMA 3SG3A 1KCYA 1KQVA 2DOQA 2Y4QA 4D1EA 1TRFA 2F33A 2M49B 3SG4A 2JXLA 1YX7A 2M3WA 2PSRA 3KPXA 4OR9B 1QX7A 3PSRA 1SCMC 3LK1A 4M2OA 4NDBA 1KFUL 2WC8A 4ORAB 1DTLA 2JTTA 2KI4B 1OMRA 2K8MB 2K2AA 4CLNA 1OMVA 4YI9A 1PVAA 1B1GA 2PASA 3OX5A 2JRFA 1OE9B 5TNCA 4MZJA 1UWOA 1YR5A 2L51A 1IJ5A 4BY4A 1J7QA 4GPLB 1PVBA 1F4OA 1MR8A 1MWNA 1N0YA 3VGOA 3NSOA 2L2EA 4BY5A 1Y1AA 3CGAA 1DJWA 2SCPA 1CFCA 1JFKA 3BXKA 1KK7Y 3OB2B 1AHRA 1UHIA 3OP0A 1DJIA 1B8LA 2HQ8A 4XYNA 1CKKA 2KHNA 3GK4X 1DJYA 1Y6WA 1KK8B 4I5NB 4ZCUA 4I5KA 3EK8A 2EHBA 1ODBA 1SK6D 3FWCA 4CIDA 1QV0A 1IKUA 2BL0C 3SG7A 3VRQA 2PALA 2KBMA 2LHLA 3I5GC 1SCVA 1L2OB 1J1EA 1HT9A 2JOJA 1NX0A 1DJXA 2NXQA 4OV2A 1IGVA 4DRWA 2LVVA 1WLMA 1KWOC 1UP5A 3NSIA 2JPTA 4GGFA 1YRTB 2FOTA 3GK2A 3NXAA 2KDHA 2JTZA 2KQYA 1XK4C 3GOFA 1X02A 3PALA 3CR4X 3A8RA 1BJFA 1EJ3A 1WRLA 1NSHA 4GUKA 3JVTC 1RJVA 1M45A 2I94A 1OOJA 1CLLA 3EVRA 4MZLA 2LMVA 4ICBA 3CWGA 4ORCB 4YGBB 4YRUA 1N65A 2TN4A 2KAYA 3TZ1A 3CLNA 4YGEB 4U8DA 1Y0VH 2COLB 5AANA 5KTYA 1QIWA 5AFPA 5I8NA 2PVBA 1BLQA 2QPTA 1F8HA 1V1GA 3AAKA 3SG5A 1FW4A 1BF5A 2GV5A 2JC2A 1XFUO 1L7ZA 4YGDB 2L50A 1MXEA 1NP8A 3I5FC 2WORA 1RWYA 3KEVA 2LVJA 3ZWHA 1QV1A 2ZRTA 2OTGB 3SIAA 3I5IC 1C07A 2HETA 4DCKA 4JQ0D 2LC5A 4FQOA 1UHKA 3LLEA 2L98A 2M97A 2KFFA 3BQ3A 2ZN8A 5AXIA 1YUUA 2B1UA 3NSLA 5I2OA 1A4PA 3DVKA 4MLWA 4GGNA 2F3YA 2H61A 2O5GA 3ZNIA 1CDLA 1KK8C 1DVIA 3RM1A 1YUSA 3HX4A 1A03A 1OSAA 5J3XA 4ETOA 2KFGA 1K2HA 3SG2A 1U5IB 1U5IA 1YUTA 5HKZA 2F2PA 1OMDA 3CR5X 1QS7A 2JULA 5CSJA 2KI6C 1WDCB 2JQ6A 4M2QA 1H4BA 1UUSA 2KAXA 3PM8A 1PSBA 4WQ2A 3C1VA 2WCFA 2LP3A 1RECA 2LVKA 4MRXA 3TDIA 1K9KA 3WNXB 4PALA 1RROA 1QXPA 3EVUA 1DT7B 1DGUA 1OQPA 3O2PA 4GGFC 1CDNA 3BOWB 1NCZA 3BOWA 4IL1A 2O60A 2CT9A 1NWDA 1JF0A 1K93D 1QASA 2CCMA 4MBEA 3VRPA 1D1OA 1FI5A 1Y1XA 1EG3A 2VRGA 3PN7B 2NZ0A 4PHJA 2ZNEA 4XJKB 4XJKA 5K89A 1J7OA 2QACA 1A29A 3QRXA 2HQWA 4HRGA 2LAPA 2OS8C 4PHKA 2F8PA 1SW8A 1CFDA 3JTDB 5D69A 4TNCA 4N1GA 1XFYO 1BG1A 4HSZA 3EKJA 5BPJA 3D0YB 3D0YA 3MSEB 2L4IA 2LE9B 2MBXA 1F4QA 1IQ5A 3WHTB 4PE0A 2K7DA 3LL8B 2MA2A 1IWQA 1WY9A 1C7VA 1S6JA 2G9BA 5HKWA 1TN4A 2FJUB 1IG5A 2KFHA 2OTGC 2K7OA 1SBJA 3A4UB 1EG4A 2M1KB 2CTNA 2EC6B 1CTRA 1XFWO 4NDCA 1SL8A 1KFXL 3TS5B 1KSOA 1SNLA 3K21A 1XO5A 1YURA 2WCBA 3RLZA 3I5HB 2GGZA 4HREE 2KYCA 3SJSA 1QLSA 1G8IA 1TCOB 3TDUA 1PRWA 1JWDA 5KU1A 1SR6C 2LHIA 1N2DA 3DF0B 3DF0A 5HYDA 1WDCC 1XVJA 2IS9A 2KGRA 4PHMA 1S1EA 2RGIA 1K96A 2JT0A 1DMOA 3TUYC 1ALWA 2M8UA 2I7AA 2M1UA 1M63B 1KFUS 3EK7A 2KGBC 1KQMB 4CPVA 4MVFA 1TOPA 2AUCA 1W7IB 1CDMA 2JNFA 1QLKA 1R6PA 2JWWA 2G2BA 1LA3A 2M7NA 2F3ZA 3O6BA 1J55A 1QJTA 4L9MA 4PHNA 2H2KA 4PDZA 5CPVA 3IQQA 5AERA 5HLOA 1ZUZA 1PALA 5PALA 1PULA 2AAOA 2KI4C 2LMTA 1ZMZA 1JSAA 2KNEA 1IRJA 3SIBA 1IH0A 1RTP1 1K9UA 4I5JA 4HRHA 1G4YR 1GQMA 1S26D 1YRUB 2KQ6A 2K7BA 3DVJA 2BBMA 1S36A 1QIVA 3F45A 2KYFA 1MQ1A 2Q91A 2M7LA 2NCPA 2Y5IA 4NQGA 3H4SE 1B7TZ 3EK4A 4NDDA 1YX8A 1HQVA 2JT3A 1S5GZ 4ORBB 3GK1A 1ALVA 1K8UA 1ZOTB 1M39A 3FS7A 1ZACA 2KOTA 3I5HC 1JF2A 1LA0A 3AKAA 3WHUB 4AQJA 1JUOA 5AEQA 2NLNA 3WXAA 1A75B 1A75A 1F70A 2LVIA 2LUXA 1L2OC 1MHOA 2CBLA 1SL7A 1YTZC 1DJHA 2JZIA 2ZNDA 4JPZB 1SYMA 3KF9A 3BUMB 3VRRA 4GNKB 1BT6A 4QJ4B 1B7TY 4C0LA 3O4YA 1K95A 5CSNA 1TNWA 4N1FA 2ZFDA 1S5GY 1KQMC 2JU0A 1CDPA 4FTGA 1A2XA 1LVCD 2BL0B 2LCPA 2Q4UA 3KO0A 4MEWA 4C0KA 4QJ5B 2CNPA 3I5GB 3LCPC 1JC2A 1UHNA 4UPGA 1Y1UA 5JOLA 4P5OE 2LLSA 2LNKA 3TDZA 4MN0A 5B8IB 2L5XB 4PE4A 1CFFA 2HPSA 2LP2A 3FIAA 1IQ3A 1QVIZ 4MZKA 1CM1A 2BKIB 1GJYA 1VRKA 1KWOB 1YVHA 4WRIA 1WRKA 2KBIA 3PLFB 4M2PA 5G08A 1CB1A 1TNQA 3CS1A 2Y1NA 1S6IA 2F2OA 1XFZO 2WOSA 1XK4A 1B4CA 2K2FA 5F6TA 2LANA 1J7RA 1CMFA 1FF1A 2K61A 3OX6A 4A4BA 1NPQA 3BUWB 3JVTB 1JFJA 1AJ4A 1KK7Z 3IQOA 2M9GA 3CZTX 4PE1A 4CFRA 1YVLA 2P6BB 4A4CA 3HCMA 1DJGA 2WNDA 4F0ZB 2M0RA 2BECA 2WCEA 4OCIA 1QX5B 1M31A 1AP4A 1SKTA 2LLTA 4YGAA 2ZRSA 2MAZA 4WQ3A 1QVIY 2H61C 1XFXO 2NCOA 1E8AA 1CLMA 1SY9A 1TTXA 3EKHA 2BCBA 5I2QA 2I18A 3EVVA 3I5FB 3IF7A 3DVMA 2KSPA 1V1FA 1JBAA 1PK0D 1QTXA 2PMYA 3VRNA 2AMIA 1H8BA 2LV7A 3I5IB 1SPYA 1B9AA 1MXLC 1SMGA 3LK0A 2BKHB 2KI6D 4DUQA 1AK8A 3FWBA 4YGCB 4I5LB 3VROA 1UURA 3AAJA 1OZSA 2R2IA 5CSIA 1J7PA 1B8CA 1Q80A 2PRUA 1RFJA 2Y1MA 3SG6A 1BMOA 1TNPA 3BUNB 1CMGA 2L4HA 1QATA 5IBWA 1LKJA 1W7JB 1BR1B 2BCAA 4C0JA 5DKRA 4PCWA 3PN7C 5HLVA 4DIRA 2ZKMX 4ZCVA 2E30A 2MJWB 1CM4A 1FPWA 2LM5A 5HKYA 4GBAA 5DKQA 1EXRA 2JXCA 3BUOB 1LINA 1IJ6A 1B8RA 3JTDC 3NSKA 5I2LA 4AQIA 1FI6A 1XYDA 4GAOA 3BYAA 1LXFC 1NYAA 2HF5A 1F71A 3PFVA 1NX1A 4PE7A 1NUBA 3DVEA 1BODA 1ZFSA 4OVNF 1QX2A 1R2UA 1DJZA 4QJ3B 2L0PA 1KFXS 5ER4X 3D10A 1WLZA 3O78A 4MSPA 4JWQA 5ER5A 5GQQC 4R1EA 1CLBA 1BOCA 1K94A 4YI8A 1BR4B 2ISDA 1K90D 1NIWA 1G33A 1SCMB 2KAVA 1BU3A 2OS8B 1EH2A 2BE4A 2EC6C 2FCDA 4P2YB 2LMUA 2MHHA 2MLEC 2A4JA 2SASA 4DS7A 1DF0B 1DF0A 3CR2A 1NCXA 3TS5C 1TNXA 3AKBA 5D7FA 2ZN9A 5KSZA 3ICBA 2D8NA 1DGVA 1S6CA 1UHJA 4GFTA 5CSFA 3BUXB 3DD4A 3OHMB 1MF8B 2E6WA 4E68A 1CFPA 1C7WA 1SL9A 1J1DA 1AUIB 2LUCA 1GGWA 2MRDA 1NX3A 2MLFC 3OB1B 1RK9A 3KHEA 5DKNA 1NCYA 2K7CA 4MRYA 1SRAA 1MUXA 2I2RE 1PSRA 2M29A 3CTNA 1OZOA 4Q04A 2FCEA 1S3PA 1NX2A 1AVSA 3E3RA 1GGZA 1K9PA 1TCFA 1WRZA 4OKHA 2CXJA 3M0WA 1XA5A 1XFVO 1TIZA 1UHHA 2BCXA 4CFQA 1FBVA 5FYXA 2V53A 1F55A 1SR6B 1F54A 1AJ5A 2BBNA 3PATA 2BE6A 2JNXA 4YBHB 1KSMA 4USLA 2OPOA
chains in the Genus database with same CATH superfamily
2EGDA 2K0JA 1OOFA 1M46A 4AOMA 2LLUA 5JJGA 3TUYB 4N5XA 1B47A 1EL4A 2JT8A 1CNPA 3OBVA 2GGMA 3SG3A 1KCYA 2QDIA 1KQVA 2DOQA 2Y4QA 4D1EA 1TRFA 2F33A 2M49B 3SG4A 5DICA 2JXLA 1YX7A 2M3WA 2PSRA 2ERBA 3KPXA 4OR9B 1QX7A 3PSRA 1SCMC 3LK1A 4M2OA 4NDBA 1KFUL 2WC8A 4F7FA 4ORAB 1DTLA 2JTTA 2KI4B 1OMRA 2K8MB 2K2AA 4CLNA 1QWVA 1OMVA 4YI9A 3DXLA 1PVAA 1B1GA 2L5YA 2PASA 3OX5A 2JRFA 1OE9B 5TNCA 4MZJA 1UWOA 1YR5A 2L51A 3EG5B 1IJ5A 1ORGA 4BY4A 2PYQA 1J7QA 4GPLB 1PVBA 1F4OA 1MR8A 1MWNA 1N0YA 3VGOA 3NSOA 2L2EA 4BY5A 1Y1AA 3CGAA 1DJWA 2SCPA 1CFCA 1JFKA 3BXKA 1KK7Y 1W9ZA 1DQEA 3OB2B 1AHRA 1UHIA 3OP0A 1DJIA 1B8LA 2HQ8A 3BFBA 4XYNA 1CKKA 2KHNA 3GK4X 1DJYA 1Y6WA 1KK8B 4I5NB 4ZCUA 4I5KA 3EK8A 2EHBA 1ODBA 1SK6D 2QEVA 3FWCA 1QV0A 4CIDA 1IKUA 2BL0C 3SG7A 3VRQA 1FI6A 2PALA 2KBMA 2LHLA 3I5GC 1SCVA 2K60A 1C3ZA 1L2OB 1J1EA 1HT9A 2JOJA 1NX0A 1DJXA 2NXQA 4OV2A 1IGVA 4DRWA 2LVVA 5I2LA 1WLMA 1KWOC 2QEBA 3L4LA 1UP5A 3NHIA 3NSIA 2JPTA 2YGUA 4GGFA 1YRTB 2FOTA 3GK2A 3NXAA 2KDHA 2JTZA 2KQYA 1XK4C 3GOFA 1X02A 1DC1A 3PALA 3CR4X 3D75A 3A8RA 1BJFA 1EJ3A 1WRLA 1NSHA 4GUKA 3JVTC 1RJVA 1M45A 2I94A 1OOJA 1CLLA 3EVRA 3L47A 4MZLA 2LMVA 4ICBA 3CWGA 4ORCB 4YGBB 4YRUA 1N65A 3OGNA 1CDNA 2TN4A 2KAYA 3TZ1A 3CLNA 2WCLA 4U8DA 4YGEB 1Y0VH 2COLB 5AANA 5KTYA 1QIWA 5AFPA 3DY9A 5I8NA 1OW4A 2PVBA 4JD9A 1BLQA 2QPTA 1F8HA 1V1GA 3AAKA 3SG5A 1FW4A 1BF5A 2GV5A 2JC2A 1XFUO 1L7ZA 4YGDB 2L50A 1MXEA 1NP8A 3I5FC 2WORA 1RWYA 3KEVA 2LVJA 3ZWHA 1QV1A 2ZRTA 4KYNA 2OTGB 3SIAA 3I5IC 1C07A 2HETA 4DCKA 1SSEB 3Q8IA 4JQ0D 2LC5A 4FQOA 1UHKA 3LLEA 2L98A 2M97A 2KFFA 3BQ3A 2WC5A 2ZN8A 5AXIA 1YUUA 2B1UA 3NSLA 5I2OA 1A4PA 3DVKA 4MLWA 4GGNA 2F3YA 3CZ0A 2H61A 2O5GA 3ZNIA 1CDLA 1KK8C 1DVIA 3RM1A 1YUSA 3HX4A 1A03A 1OSAA 5J3XA 3SS3A 4ETOA 2KFGA 1K2HA 3SG2A 3UNWA 3VB1A 1U5IB 1U5IA 1YUTA 5HKZA 2F2PA 2QEHA 1OMDA 3CR5X 2WCMA 1QS7A 2JULA 5D3OA 5CSJA 2KI6C 1WDCB 2JQ6A 4M2QA 1Z4HA 1UUSA 2KAXA 3PM8A 1PSBA 1H4BA 4WQ2A 3BFAA 3C1VA 4INWA 2WCFA 2LP3A 1RECA 2LVKA 4MRXA 3TDIA 1K9KA 3WNXB 4PALA 1RROA 1QXPA 2BAPA 3EVUA 1DGUA 1OQPA 3O2PA 3B88A 4GGFC 1DT7B 2H8VA 3BFHA 3BOWB 1NCZA 3BOWA 4IL1A 2O60A 2CT9A 1NWDA 1JF0A 1K93D 1QASA 2CCMA 4MBEA 3VRPA 1D1OA 1FI5A 1Y1XA 1EG3A 2VRGA 3PN7B 2NZ0A 4PHJA 2ZNEA 4XJKB 4XJKA 5K89A 1J7OA 2QACA 1A29A 3QRXA 2HQWA 4HRGA 2LAPA 5HL1A 2OS8C 4PHKA 2F8PA 1SW8A 2WCKA 1CFDA 3JTDB 5D69A 4TNCA 4N1GA 4OZDA 1XFYO 1BG1A 4HSZA 3EKJA 3S0BA 2P70A 3D0YA 3D0YB 5BPJA 3MSEB 2L4IA 2LE9B 2MBXA 3R72A 1F4QA 1IQ5A 3WHTB 4PE0A 2K7DA 3LL8B 4IJ7A 2MA2A 1IWQA 1WY9A 2GTEA 1C7VA 1S6JA 2G9BA 2KLEA 5HKWA 1TN4A 2FJUB 1IG5A 2KFHA 2OTGC 2K7OA 1SBJA 3A4UB 1EG4A 2M1KB 2CTNA 2EC6B 1CTRA 1XFWO 3D73A 4NDCA 1SL8A 1KFXL 3TS5B 1KSOA 1SNLA 3K21A 1XO5A 1YURA 2WCBA 3RLZA 3I5HB 2GGZA 4HREE 2KYCA 3SJSA 1QLSA 1G8IA 5EL2A 1TCOB 3TDUA 1IIOA 1PRWA 1JWDA 5KU1A 1SR6C 3PM2A 2LHIA 2WCJA 1N2DA 3DF0B 3DF0A 5HYDA 1WDCC 1XVJA 2IS9A 2KGRA 4PHMA 1S1EA 3UO9A 5FI6A 2RGIA 1K96A 2JT0A 1DMOA 3O4XA 3TUYC 1ALWA 2M8UA 2I7AA 2M1UA 1M63B 1KFUS 1LS8A 3EK7A 2KGBC 1KQMB 4CPVA 4MVFA 1TOPA 2AUCA 1W7IB 1CDMA 2JNFA 1QLKA 1R6PA 2BNXA 3D74A 2JWWA 2G2BA 1LA3A 2M7NA 2F3ZA 3O6BA 1J55A 1QJTA 4L9MA 4PHNA 2H2KA 4PDZA 3QMEA 5CPVA 3IQQA 5AERA 5HLOA 1ZUZA 1PALA 5PALA 1PULA 2AAOA 2KI4C 2LMTA 1ZMZA 1JSAA 2KNEA 1IRJA 3SIBA 3V2LA 1IH0A 1RTP1 1K9UA 4I5JA 4HRHA 1G4YR 1GQMA 1S26D 1YRUB 2KQ6A 3CZ2A 2K7BA 3DVJA 2BBMA 3NGVA 1S36A 1QIVA 3F45A 2KYFA 1MQ1A 2Q91A 2M7LA 2NCPA 2Y5IA 4NQGA 3H4SE 1B7TZ 3EK4A 4NDDA 1YX8A 1HQVA 2JT3A 3K1EA 1S5GZ 4ORBB 3GK1A 1ALVA 3D77A 1K8UA 1ZOTB 1M39A 3FS7A 3DYEA 1ZACA 2KOTA 3I5HC 1JF2A 1LA0A 3AKAA 5FI7A 3WHUB 1TWOA 3B7AA 4AQJA 1JUOA 5AEQA 2NLNA 5ER4X 3WXAA 3FE8A 1A75B 1A75A 1F70A 2LVIA 2LUXA 1L2OC 1MHOA 2CBLA 1SL7A 1YTZC 1DJHA 2JZIA 2ZNDA 4JPZB 1SYMA 3KF9A 3BUMB 3VRRA 4GNKB 1BT6A 4QJ4B 1B7TY 4C0LA 3O4YA 1K95A 5CSNA 1TNWA 1TUZA 2ZFDA 1S5GY 1KQMC 2JU0A 1CDPA 3B87A 3CABA 4N1FA 4FTGA 1A2XA 1LVCD 2BL0B 2LCPA 2Q4UA 3KO0A 4MEWA 4C0KA 4QJ5B 2CNPA 3I5GB 3LCPC 1JC2A 2FJYA 1UHNA 4UPGA 1Y1UA 3B6XA 5JOLA 4P5OE 2LLSA 2LNKA 3TDZA 4MN0A 5B8IB 2L5XB 4PE4A 1CFFA 2HPSA 2LP2A 3FIAA 1IQ3A 1QVIZ 4MZKA 1CM1A 1GJYA 2BKIB 1VRKA 1KWOB 1YVHA 4WRIA 1WRKA 2KBIA 3PLFB 4M2PA 5G08A 1CB1A 1TNQA 3CS1A 2Y1NA 1S6IA 2F2OA 1XFZO 2WOSA 1XK4A 1B4CA 2K2FA 5F6TA 2KLDA 2LANA 1J7RA 1CMFA 1FF1A 2K61A 3OX6A 4A4BA 1NPQA 3BUWB 3JVTB 3R1PA 1JFJA 1AJ4A 1KK7Z 3IQOA 2M9GA 3CZTX 4PE1A 4CFRA 1GM0A 1YVLA 2P6BB 4A4CA 2WC6A 3HCMA 1DJGA 2WNDA 4F0ZB 2M0RA 2BECA 2WCEA 4OCIA 1QX5B 1M31A 1AP4A 1SKTA 2LLTA 4YGAA 2ZRSA 2MAZA 4WQ3A 3S0FA 1QVIY 2H61C 1XFXO 2NCOA 1E8AA 1CLMA 1SY9A 1TTXA 3EKHA 2BCBA 5I2QA 2I18A 3EVVA 3I5FB 3IF7A 3DVMA 3SS4A 2KSPA 3SS5A 1V1FA 3BJHA 1PK0D 1JBAA 1QTXA 2PMYA 3VRNA 2AMIA 1H8BA 1DELA 2LV7A 3I5IB 1SPYA 1B9AA 1MXLC 1SMGA 3LK0A 4JKTA 2BKHB 2KI6D 2KPHA 3D78A 3IVTA 4DUQA 3PJIA 1AK8A 3FWBA 3NHTA 4YGCB 4I5LB 3VROA 1UURA 3AAJA 1OZSA 2R2IA 5CSIA 1J7PA 1B8CA 1Q80A 2PRUA 1RFJA 2P71A 2Y1MA 3SG6A 3R1OA 1BMOA 1TNPA 1DEKA 3BUNB 1CMGA 3DZTA 2L4HA 1QATA 5IBWA 1LKJA 1W7JB 1BR1B 2BCAA 4C0JA 5DKRA 3S0AA 4PCWA 3PN7C 5HLVA 5FI2A 4DIRA 2ZKMX 4ZCVA 2L2CA 2E30A 3B86A 2MJWB 1C3YA 1CM4A 3FE9A 1FPWA 2JPOA 2LM5A 5HKYA 4GBAA 5DKQA 1EXRA 2JXCA 2JNXA 1LINA 1IJ6A 1B8RA 1OOIX 3BUOB 3JTDC 3NSKA 4AQIA 1XYDA 1Z2CB 4GAOA 3BYAA 1LXFC 1NYAA 2HF5A 3CZ1A 1F71A 3PFVA 3D76A 1NX1A 4PE7A 5I94A 1NUBA 3DVEA 1BODA 1ZFSA 4OVNF 1QX2A 1R2UA 3S0GA 1DJZA 3L4AA 2L0PA 1KFXS 2QEOA 3D10A 4QJ3B 1WLZA 3O78A 4MSPA 4JWQA 5ER5A 5GQQC 4R1EA 1CLBA 1BOCA 1K94A 4YI8A 1BR4B 2ISDA 1K90D 1NIWA 1G33A 1SCMB 2KAVA 1BU3A 1TUJA 2OS8B 1EH2A 2BE4A 2EC6C 2FCDA 4P2YB 2LMUA 2MHHA 2MLEC 2A4JA 2SASA 4DS7A 1DF0B 1DF0A 3CR2A 4FQTA 1NCXA 3TS5C 1TNXA 1T14A 3AKBA 5D7FA 2ZN9A 5KSZA 2WCHA 3CDNA 3ICBA 2D8NA 1DGVA 1S6CA 1UHJA 4GFTA 4INXA 5CSFA 3BUXB 3DD4A 3FE6A 3OHMB 1MF8B 2E6WA 4E68A 1CFPA 1C7WA 1SL9A 1J1DA 1AUIB 2LUCA 1GGWA 2MRDA 1NX3A 2MLFC 3OB1B 1RK9A 3RZSA 3N7HA 3KHEA 5DKNA 3S0DA 1NCYA 2K7CA 4MRYA 1SRAA 1MUXA 1OOHA 2I2RE 1PSRA 2M29A 1OOGA 1P28A 1OZOA 2PQLA 2FCEA 3CTNA 4Q04A 1S3PA 1NX2A 1AVSA 3E3RA 3CYZA 1GGZA 1K9PA 3S0EA 1TCFA 1WRZA 4OKHA 2CXJA 3M0WA 1XA5A 1XFVO 1TIZA 1UHHA 2BCXA 4CFQA 1FBVA 5FYXA 2V53A 1F55A 1SR6B 1F54A 1AJ5A 2BBNA 3PATA 2BE6A 1XFRA 3R1VA 4PT1A 4YBHB 1KSMA 4USLA 2OPOA
chains in the Genus database with same CATH topology
2EGDA 2K0JA 1M46A 4AOMA 2LLUA 5JJGA 3TUYB 4N5XA 1B47A 1EL4A 2JT8A 1CNPA 2GGMA 3SG3A 1KCYA 1KQVA 2DOQA 2Y4QA 4D1EA 1TRFA 2F33A 2M49B 3SG4A 2JXLA 1YX7A 2M3WA 2PSRA 3KPXA 4OR9B 1QX7A 3PSRA 1SCMC 3LK1A 4M2OA 4NDBA 1KFUL 2WC8A 4ORAB 1DTLA 2JTTA 2KI4B 1OMRA 2K8MB 2K2AA 4CLNA 1OMVA 4YI9A 1PVAA 1B1GA 2PASA 3OX5A 2JRFA 1OE9B 5TNCA 4MZJA 1UWOA 1YR5A 2L51A 1IJ5A 4BY4A 1J7QA 4GPLB 1PVBA 1F4OA 1MR8A 1MWNA 1N0YA 3VGOA 3NSOA 2L2EA 4BY5A 1Y1AA 3CGAA 1DJWA 2SCPA 1CFCA 1JFKA 3BXKA 1KK7Y 3OB2B 1AHRA 1UHIA 3OP0A 1DJIA 1B8LA 2HQ8A 4XYNA 1CKKA 2KHNA 3GK4X 1DJYA 1Y6WA 1KK8B 4I5NB 4ZCUA 4I5KA 3EK8A 2EHBA 1ODBA 1SK6D 3FWCA 4CIDA 1QV0A 1IKUA 2BL0C 3SG7A 3VRQA 2PALA 2KBMA 2LHLA 3I5GC 1SCVA 1L2OB 1J1EA 1HT9A 2JOJA 1NX0A 1DJXA 2NXQA 4OV2A 1IGVA 4DRWA 2LVVA 1WLMA 1KWOC 1UP5A 3NSIA 2JPTA 4GGFA 1YRTB 2FOTA 3GK2A 3NXAA 2KDHA 2JTZA 2KQYA 1XK4C 3GOFA 1X02A 3PALA 3CR4X 3A8RA 1BJFA 1EJ3A 1WRLA 1NSHA 4GUKA 3JVTC 1RJVA 1M45A 2I94A 1OOJA 1CLLA 3EVRA 4MZLA 2LMVA 4ICBA 3CWGA 4ORCB 4YGBB 4YRUA 1N65A 2TN4A 2KAYA 3TZ1A 3CLNA 4YGEB 4U8DA 1Y0VH 2COLB 5AANA 5KTYA 1QIWA 5AFPA 5I8NA 2PVBA 1BLQA 2QPTA 1F8HA 1V1GA 3AAKA 3SG5A 1FW4A 1BF5A 2GV5A 2JC2A 1XFUO 1L7ZA 4YGDB 2L50A 1MXEA 1NP8A 3I5FC 2WORA 1RWYA 3KEVA 2LVJA 3ZWHA 1QV1A 2ZRTA 2OTGB 3SIAA 3I5IC 1C07A 2HETA 4DCKA 4JQ0D 2LC5A 4FQOA 1UHKA 3LLEA 2L98A 2M97A 2KFFA 3BQ3A 2ZN8A 5AXIA 1YUUA 2B1UA 3NSLA 5I2OA 1A4PA 3DVKA 4MLWA 4GGNA 2F3YA 2H61A 2O5GA 3ZNIA 1CDLA 1KK8C 1DVIA 3RM1A 1YUSA 3HX4A 1A03A 1OSAA 5J3XA 4ETOA 2KFGA 1K2HA 3SG2A 1U5IB 1U5IA 1YUTA 5HKZA 2F2PA 1OMDA 3CR5X 1QS7A 2JULA 5CSJA 2KI6C 1WDCB 2JQ6A 4M2QA 1H4BA 1UUSA 2KAXA 3PM8A 1PSBA 4WQ2A 3C1VA 2WCFA 2LP3A 1RECA 2LVKA 4MRXA 3TDIA 1K9KA 3WNXB 4PALA 1RROA 1QXPA 3EVUA 1DT7B 1DGUA 1OQPA 3O2PA 4GGFC 1CDNA 3BOWB 1NCZA 3BOWA 4IL1A 2O60A 2CT9A 1NWDA 1JF0A 1K93D 1QASA 2CCMA 4MBEA 3VRPA 1D1OA 1FI5A 1Y1XA 1EG3A 2VRGA 3PN7B 2NZ0A 4PHJA 2ZNEA 4XJKB 4XJKA 5K89A 1J7OA 2QACA 1A29A 3QRXA 2HQWA 4HRGA 2LAPA 2OS8C 4PHKA 2F8PA 1SW8A 1CFDA 3JTDB 5D69A 4TNCA 4N1GA 1XFYO 1BG1A 4HSZA 3EKJA 5BPJA 3D0YB 3D0YA 3MSEB 2L4IA 2LE9B 2MBXA 1F4QA 1IQ5A 3WHTB 4PE0A 2K7DA 3LL8B 2MA2A 1IWQA 1WY9A 1C7VA 1S6JA 2G9BA 5HKWA 1TN4A 2FJUB 1IG5A 2KFHA 2OTGC 2K7OA 1SBJA 3A4UB 1EG4A 2M1KB 2CTNA 2EC6B 1CTRA 1XFWO 4NDCA 1SL8A 1KFXL 3TS5B 1KSOA 1SNLA 3K21A 1XO5A 1YURA 2WCBA 3RLZA 3I5HB 2GGZA 4HREE 2KYCA 3SJSA 1QLSA 1G8IA 1TCOB 3TDUA 1PRWA 1JWDA 5KU1A 1SR6C 2LHIA 1N2DA 3DF0B 3DF0A 5HYDA 1WDCC 1XVJA 2IS9A 2KGRA 4PHMA 1S1EA 2RGIA 1K96A 2JT0A 1DMOA 3TUYC 1ALWA 2M8UA 2I7AA 2M1UA 1M63B 1KFUS 3EK7A 2KGBC 1KQMB 4CPVA 4MVFA 1TOPA 2AUCA 1W7IB 1CDMA 2JNFA 1QLKA 1R6PA 2JWWA 2G2BA 1LA3A 2M7NA 2F3ZA 3O6BA 1J55A 1QJTA 4L9MA 4PHNA 2H2KA 4PDZA 5CPVA 3IQQA 5AERA 5HLOA 1ZUZA 1PALA 5PALA 1PULA 2AAOA 2KI4C 2LMTA 1ZMZA 1JSAA 2KNEA 1IRJA 3SIBA 1IH0A 1RTP1 1K9UA 4I5JA 4HRHA 1G4YR 1GQMA 1S26D 1YRUB 2KQ6A 2K7BA 3DVJA 2BBMA 1S36A 1QIVA 3F45A 2KYFA 1MQ1A 2Q91A 2M7LA 2NCPA 2Y5IA 4NQGA 3H4SE 1B7TZ 3EK4A 4NDDA 1YX8A 1HQVA 2JT3A 1S5GZ 4ORBB 3GK1A 1ALVA 1K8UA 1ZOTB 1M39A 3FS7A 1ZACA 2KOTA 3I5HC 1JF2A 1LA0A 3AKAA 3WHUB 4AQJA 1JUOA 5AEQA 2NLNA 3WXAA 1A75B 1A75A 1F70A 2LVIA 2LUXA 1L2OC 1MHOA 2CBLA 1SL7A 1YTZC 1DJHA 2JZIA 2ZNDA 4JPZB 1SYMA 3KF9A 3BUMB 3VRRA 4GNKB 1BT6A 4QJ4B 1B7TY 4C0LA 3O4YA 1K95A 5CSNA 1TNWA 4N1FA 2ZFDA 1S5GY 1KQMC 2JU0A 1CDPA 4FTGA 1A2XA 1LVCD 2BL0B 2LCPA 2Q4UA 3KO0A 4MEWA 4C0KA 4QJ5B 2CNPA 3I5GB 3LCPC 1JC2A 1UHNA 4UPGA 1Y1UA 5JOLA 4P5OE 2LLSA 2LNKA 3TDZA 4MN0A 5B8IB 2L5XB 4PE4A 1CFFA 2HPSA 2LP2A 3FIAA 1IQ3A 1QVIZ 4MZKA 1CM1A 2BKIB 1GJYA 1VRKA 1KWOB 1YVHA 4WRIA 1WRKA 2KBIA 3PLFB 4M2PA 5G08A 1CB1A 1TNQA 3CS1A 2Y1NA 1S6IA 2F2OA 1XFZO 2WOSA 1XK4A 1B4CA 2K2FA 5F6TA 2LANA 1J7RA 1CMFA 1FF1A 2K61A 3OX6A 4A4BA 1NPQA 3BUWB 3JVTB 1JFJA 1AJ4A 1KK7Z 3IQOA 2M9GA 3CZTX 4PE1A 4CFRA 1YVLA 2P6BB 4A4CA 3HCMA 1DJGA 2WNDA 4F0ZB 2M0RA 2BECA 2WCEA 4OCIA 1QX5B 1M31A 1AP4A 1SKTA 2LLTA 4YGAA 2ZRSA 2MAZA 4WQ3A 1QVIY 2H61C 1XFXO 2NCOA 1E8AA 1CLMA 1SY9A 1TTXA 3EKHA 2BCBA 5I2QA 2I18A 3EVVA 3I5FB 3IF7A 3DVMA 2KSPA 1V1FA 1JBAA 1PK0D 1QTXA 2PMYA 3VRNA 2AMIA 1H8BA 2LV7A 3I5IB 1SPYA 1B9AA 1MXLC 1SMGA 3LK0A 2BKHB 2KI6D 4DUQA 1AK8A 3FWBA 4YGCB 4I5LB 3VROA 1UURA 3AAJA 1OZSA 2R2IA 5CSIA 1J7PA 1B8CA 1Q80A 2PRUA 1RFJA 2Y1MA 3SG6A 1BMOA 1TNPA 3BUNB 1CMGA 2L4HA 1QATA 5IBWA 1LKJA 1W7JB 1BR1B 2BCAA 4C0JA 5DKRA 4PCWA 3PN7C 5HLVA 4DIRA 2ZKMX 4ZCVA 2E30A 2MJWB 1CM4A 1FPWA 2LM5A 5HKYA 4GBAA 5DKQA 1EXRA 2JXCA 3BUOB 1LINA 1IJ6A 1B8RA 3JTDC 3NSKA 5I2LA 4AQIA 1FI6A 1XYDA 4GAOA 3BYAA 1LXFC 1NYAA 2HF5A 1F71A 3PFVA 1NX1A 4PE7A 1NUBA 3DVEA 1BODA 1ZFSA 4OVNF 1QX2A 1R2UA 1DJZA 4QJ3B 2L0PA 1KFXS 5ER4X 3D10A 1WLZA 3O78A 4MSPA 4JWQA 5ER5A 5GQQC 4R1EA 1CLBA 1BOCA 1K94A 4YI8A 1BR4B 2ISDA 1K90D 1NIWA 1G33A 1SCMB 2KAVA 1BU3A 2OS8B 1EH2A 2BE4A 2EC6C 2FCDA 4P2YB 2LMUA 2MHHA 2MLEC 2A4JA 2SASA 4DS7A 1DF0B 1DF0A 3CR2A 1NCXA 3TS5C 1TNXA 3AKBA 5D7FA 2ZN9A 5KSZA 3ICBA 2D8NA 1DGVA 1S6CA 1UHJA 4GFTA 5CSFA 3BUXB 3DD4A 3OHMB 1MF8B 2E6WA 4E68A 1CFPA 1C7WA 1SL9A 1J1DA 1AUIB 2LUCA 1GGWA 2MRDA 1NX3A 2MLFC 3OB1B 1RK9A 3KHEA 5DKNA 1NCYA 2K7CA 4MRYA 1SRAA 1MUXA 2I2RE 1PSRA 2M29A 3CTNA 1OZOA 4Q04A 2FCEA 1S3PA 1NX2A 1AVSA 3E3RA 1GGZA 1K9PA 1TCFA 1WRZA 4OKHA 2CXJA 3M0WA 1XA5A 1XFVO 1TIZA 1UHHA 2BCXA 4CFQA 1FBVA 5FYXA 2V53A 1F55A 1SR6B 1F54A 1AJ5A 2BBNA 3PATA 2BE6A 2JNXA 4YBHB 1KSMA 4USLA 2OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGD A;  2K0J A;  1M46 A;  4AOM A;  2LLU A;  5JJG A;  3TUY B;  4N5X A;  1B47 A;  1EL4 A;  2JT8 A;  1CNP A;  2GGM A;  3SG3 A;  1KCY A;  1KQV A;  2DOQ A;  2Y4Q A;  4D1E A;  1TRF A;  2F33 A;  2M49 B;  3SG4 A;  2JXL A;  1YX7 A;  2M3W A;  2PSR A;  3KPX A;  4OR9 B;  1QX7 A;  3PSR A;  1SCM C;  3LK1 A;  4M2O A;  4NDB A;  1KFU L;  2WC8 A;  4ORA B;  1DTL A;  2JTT A;  2KI4 B;  1OMR A;  2K8M B;  2K2A A;  4CLN A;  1OMV A;  4YI9 A;  1PVA A;  1B1G A;  2PAS A;  3OX5 A;  2JRF A;  1OE9 B;  5TNC A;  4MZJ A;  1UWO A;  1YR5 A;  2L51 A;  1IJ5 A;  4BY4 A;  1J7Q A;  4GPL B;  1PVB A;  1F4O A;  1MR8 A;  1MWN A;  1N0Y A;  3VGO A;  3NSO A;  2L2E A;  4BY5 A;  1Y1A A;  3CGA A;  1DJW A;  2SCP A;  1CFC A;  1JFK A;  3BXK A;  1KK7 Y;  3OB2 B;  1AHR A;  1UHI A;  3OP0 A;  1DJI A;  1B8L A;  2HQ8 A;  4XYN A;  1CKK A;  2KHN A;  3GK4 X;  1DJY A;  1Y6W A;  1KK8 B;  4I5N B;  4ZCU A;  4I5K A;  3EK8 A;  2EHB A;  1ODB A;  1SK6 D;  3FWC A;  4CID A;  1QV0 A;  1IKU A;  2BL0 C;  3SG7 A;  3VRQ A;  2PAL A;  2KBM A;  2LHL A;  3I5G C;  1SCV A;  1L2O B;  1J1E A;  1HT9 A;  2JOJ A;  1NX0 A;  1DJX A;  2NXQ A;  4OV2 A;  1IGV A;  4DRW A;  2LVV A;  1WLM A;  1KWO C;  1UP5 A;  3NSI A;  2JPT A;  4GGF A;  1YRT B;  2FOT A;  3GK2 A;  3NXA A;  2KDH A;  2JTZ A;  2KQY A;  1XK4 C;  3GOF A;  1X02 A;  3PAL A;  3CR4 X;  3A8R A;  1BJF A;  1EJ3 A;  1WRL A;  1NSH A;  4GUK A;  3JVT C;  1RJV A;  1M45 A;  2I94 A;  1OOJ A;  1CLL A;  3EVR A;  4MZL A;  2LMV A;  4ICB A;  3CWG A;  4ORC B;  4YGB B;  4YRU A;  1N65 A;  2TN4 A;  2KAY A;  3TZ1 A;  3CLN A;  4YGE B;  4U8D A;  1Y0V H;  2COL B;  5AAN A;  5KTY A;  1QIW A;  5AFP A;  5I8N A;  2PVB A;  1BLQ A;  2QPT A;  1F8H A;  1V1G A;  3AAK A;  3SG5 A;  1FW4 A;  1BF5 A;  2GV5 A;  2JC2 A;  1XFU O;  1L7Z A;  4YGD B;  2L50 A;  1MXE A;  1NP8 A;  3I5F C;  2WOR A;  1RWY A;  3KEV A;  2LVJ A;  3ZWH A;  1QV1 A;  2ZRT A;  2OTG B;  3SIA A;  3I5I C;  1C07 A;  2HET A;  4DCK A;  4JQ0 D;  2LC5 A;  4FQO A;  1UHK A;  3LLE A;  2L98 A;  2M97 A;  2KFF A;  3BQ3 A;  2ZN8 A;  5AXI A;  1YUU A;  2B1U A;  3NSL A;  5I2O A;  1A4P A;  3DVK A;  4MLW A;  4GGN A;  2F3Y A;  2H61 A;  2O5G A;  3ZNI A;  1CDL A;  1KK8 C;  1DVI A;  3RM1 A;  1YUS A;  3HX4 A;  1A03 A;  1OSA A;  5J3X A;  4ETO A;  2KFG A;  1K2H A;  3SG2 A;  1U5I B;  1U5I A;  1YUT A;  5HKZ A;  2F2P A;  1OMD A;  3CR5 X;  1QS7 A;  2JUL A;  5CSJ A;  2KI6 C;  1WDC B;  2JQ6 A;  4M2Q A;  1H4B A;  1UUS A;  2KAX A;  3PM8 A;  1PSB A;  4WQ2 A;  3C1V A;  2WCF A;  2LP3 A;  1REC A;  2LVK A;  4MRX A;  3TDI A;  1K9K A;  3WNX B;  4PAL A;  1RRO A;  1QXP A;  3EVU A;  1DT7 B;  1DGU A;  1OQP A;  3O2P A;  4GGF C;  1CDN A;  3BOW B;  1NCZ A;  3BOW A;  4IL1 A;  2O60 A;  2CT9 A;  1NWD A;  1JF0 A;  1K93 D;  1QAS A;  2CCM A;  4MBE A;  3VRP A;  1D1O A;  1FI5 A;  1Y1X A;  1EG3 A;  2VRG A;  3PN7 B;  2NZ0 A;  4PHJ A;  2ZNE A;  4XJK B;  4XJK A;  5K89 A;  1J7O A;  2QAC A;  1A29 A;  3QRX A;  2HQW A;  4HRG A;  2LAP A;  2OS8 C;  4PHK A;  2F8P A;  1SW8 A;  1CFD A;  3JTD B;  5D69 A;  4TNC A;  4N1G A;  1XFY O;  1BG1 A;  4HSZ A;  3EKJ A;  5BPJ A;  3D0Y B;  3D0Y A;  3MSE B;  2L4I A;  2LE9 B;  2MBX A;  1F4Q A;  1IQ5 A;  3WHT B;  4PE0 A;  2K7D A;  3LL8 B;  2MA2 A;  1IWQ A;  1WY9 A;  1C7V A;  1S6J A;  2G9B A;  5HKW A;  1TN4 A;  2FJU B;  1IG5 A;  2KFH A;  2OTG C;  2K7O A;  1SBJ A;  3A4U B;  1EG4 A;  2M1K B;  2CTN A;  2EC6 B;  1CTR A;  1XFW O;  4NDC A;  1SL8 A;  1KFX L;  3TS5 B;  1KSO A;  1SNL A;  3K21 A;  1XO5 A;  1YUR A;  2WCB A;  3RLZ A;  3I5H B;  2GGZ A;  4HRE E;  2KYC A;  3SJS A;  1QLS A;  1G8I A;  1TCO B;  3TDU A;  1PRW A;  1JWD A;  5KU1 A;  1SR6 C;  2LHI A;  1N2D A;  3DF0 B;  3DF0 A;  5HYD A;  1WDC C;  1XVJ A;  2IS9 A;  2KGR A;  4PHM A;  1S1E A;  2RGI A;  1K96 A;  2JT0 A;  1DMO A;  3TUY C;  1ALW A;  2M8U A;  2I7A A;  2M1U A;  1M63 B;  1KFU S;  3EK7 A;  2KGB C;  1KQM B;  4CPV A;  4MVF A;  1TOP A;  2AUC A;  1W7I B;  1CDM A;  2JNF A;  1QLK A;  1R6P A;  2JWW A;  2G2B A;  1LA3 A;  2M7N A;  2F3Z A;  3O6B A;  1J55 A;  1QJT A;  4L9M A;  4PHN A;  2H2K A;  4PDZ A;  5CPV A;  3IQQ A;  5AER A;  5HLO A;  1ZUZ A;  1PAL A;  5PAL A;  1PUL A;  2AAO A;  2KI4 C;  2LMT A;  1ZMZ A;  1JSA A;  2KNE A;  1IRJ A;  3SIB A;  1IH0 A;  1RTP 1;  1K9U A;  4I5J A;  4HRH A;  1G4Y R;  1GQM A;  1S26 D;  1YRU B;  2KQ6 A;  2K7B A;  3DVJ A;  2BBM A;  1S36 A;  1QIV A;  3F45 A;  2KYF A;  1MQ1 A;  2Q91 A;  2M7L A;  2NCP A;  2Y5I A;  4NQG A;  3H4S E;  1B7T Z;  3EK4 A;  4NDD A;  1YX8 A;  1HQV A;  2JT3 A;  1S5G Z;  4ORB B;  3GK1 A;  1ALV A;  1K8U A;  1ZOT B;  1M39 A;  3FS7 A;  1ZAC A;  2KOT A;  3I5H C;  1JF2 A;  1LA0 A;  3AKA A;  3WHU B;  4AQJ A;  1JUO A;  5AEQ A;  2NLN A;  3WXA A;  1A75 B;  1A75 A;  1F70 A;  2LVI A;  2LUX A;  1L2O C;  1MHO A;  2CBL A;  1SL7 A;  1YTZ C;  1DJH A;  2JZI A;  2ZND A;  4JPZ B;  1SYM A;  3KF9 A;  3BUM B;  3VRR A;  4GNK B;  1BT6 A;  4QJ4 B;  1B7T Y;  4C0L A;  3O4Y A;  1K95 A;  5CSN A;  1TNW A;  4N1F A;  2ZFD A;  1S5G Y;  1KQM C;  2JU0 A;  1CDP A;  4FTG A;  1A2X A;  1LVC D;  2BL0 B;  2LCP A;  2Q4U A;  3KO0 A;  4MEW A;  4C0K A;  4QJ5 B;  2CNP A;  3I5G B;  3LCP C;  1JC2 A;  1UHN A;  4UPG A;  1Y1U A;  5JOL A;  4P5O E;  2LLS A;  2LNK A;  3TDZ A;  4MN0 A;  5B8I B;  2L5X B;  4PE4 A;  1CFF A;  2HPS A;  2LP2 A;  3FIA A;  1IQ3 A;  1QVI Z;  4MZK A;  1CM1 A;  2BKI B;  1GJY A;  1VRK A;  1KWO B;  1YVH A;  4WRI A;  1WRK A;  2KBI A;  3PLF B;  4M2P A;  5G08 A;  1CB1 A;  1TNQ A;  3CS1 A;  2Y1N A;  1S6I A;  2F2O A;  1XFZ O;  2WOS A;  1XK4 A;  1B4C A;  2K2F A;  5F6T A;  2LAN A;  1J7R A;  1CMF A;  1FF1 A;  2K61 A;  3OX6 A;  4A4B A;  1NPQ A;  3BUW B;  3JVT B;  1JFJ A;  1AJ4 A;  1KK7 Z;  3IQO A;  2M9G A;  3CZT X;  4PE1 A;  4CFR A;  1YVL A;  2P6B B;  4A4C A;  3HCM A;  1DJG A;  2WND A;  4F0Z B;  2M0R A;  2BEC A;  2WCE A;  4OCI A;  1QX5 B;  1M31 A;  1AP4 A;  1SKT A;  2LLT A;  4YGA A;  2ZRS A;  2MAZ A;  4WQ3 A;  1QVI Y;  2H61 C;  1XFX O;  2NCO A;  1E8A A;  1CLM A;  1SY9 A;  1TTX A;  3EKH A;  2BCB A;  5I2Q A;  2I18 A;  3EVV A;  3I5F B;  3IF7 A;  3DVM A;  2KSP A;  1V1F A;  1JBA A;  1PK0 D;  1QTX A;  2PMY A;  3VRN A;  2AMI A;  1H8B A;  2LV7 A;  3I5I B;  1SPY A;  1B9A A;  1MXL C;  1SMG A;  3LK0 A;  2BKH B;  2KI6 D;  4DUQ A;  1AK8 A;  3FWB A;  4YGC B;  4I5L B;  3VRO A;  1UUR A;  3AAJ A;  1OZS A;  2R2I A;  5CSI A;  1J7P A;  1B8C A;  1Q80 A;  2PRU A;  1RFJ A;  2Y1M A;  3SG6 A;  1BMO A;  1TNP A;  3BUN B;  1CMG A;  2L4H A;  1QAT A;  5IBW A;  1LKJ A;  1W7J B;  1BR1 B;  2BCA A;  4C0J A;  5DKR A;  4PCW A;  3PN7 C;  5HLV A;  4DIR A;  2ZKM X;  4ZCV A;  2E30 A;  2MJW B;  1CM4 A;  1FPW A;  2LM5 A;  5HKY A;  4GBA A;  5DKQ A;  1EXR A;  2JXC A;  3BUO B;  1LIN A;  1IJ6 A;  1B8R A;  3JTD C;  3NSK A;  5I2L A;  4AQI A;  1FI6 A;  1XYD A;  4GAO A;  3BYA A;  1LXF C;  1NYA A;  2HF5 A;  1F71 A;  3PFV A;  1NX1 A;  4PE7 A;  1NUB A;  3DVE A;  1BOD A;  1ZFS A;  4OVN F;  1QX2 A;  1R2U A;  1DJZ A;  4QJ3 B;  2L0P A;  1KFX S;  5ER4 X;  3D10 A;  1WLZ A;  3O78 A;  4MSP A;  4JWQ A;  5ER5 A;  5GQQ C;  4R1E A;  1CLB A;  1BOC A;  1K94 A;  4YI8 A;  1BR4 B;  2ISD A;  1K90 D;  1NIW A;  1G33 A;  1SCM B;  2KAV A;  1BU3 A;  2OS8 B;  1EH2 A;  2BE4 A;  2EC6 C;  2FCD A;  4P2Y B;  2LMU A;  2MHH A;  2MLE C;  2A4J A;  2SAS A;  4DS7 A;  1DF0 B;  1DF0 A;  3CR2 A;  1NCX A;  3TS5 C;  1TNX A;  3AKB A;  5D7F A;  2ZN9 A;  5KSZ A;  3ICB A;  2D8N A;  1DGV A;  1S6C A;  1UHJ A;  4GFT A;  5CSF A;  3BUX B;  3DD4 A;  3OHM B;  1MF8 B;  2E6W A;  4E68 A;  1CFP A;  1C7W A;  1SL9 A;  1J1D A;  1AUI B;  2LUC A;  1GGW A;  2MRD A;  1NX3 A;  2MLF C;  3OB1 B;  1RK9 A;  3KHE A;  5DKN A;  1NCY A;  2K7C A;  4MRY A;  1SRA A;  1MUX A;  2I2R E;  1PSR A;  2M29 A;  3CTN A;  1OZO A;  4Q04 A;  2FCE A;  1S3P A;  1NX2 A;  1AVS A;  3E3R A;  1GGZ A;  1K9P A;  1TCF A;  1WRZ A;  4OKH A;  2CXJ A;  3M0W A;  1XA5 A;  1XFV O;  1TIZ A;  1UHH A;  2BCX A;  4CFQ A;  1FBV A;  5FYX A;  2V53 A;  1F55 A;  1SR6 B;  1F54 A;  1AJ5 A;  2BBN A;  3PAT A;  2BE6 A;  2JNX A;  4YBH B;  1KSM A;  4USL A;  2OPO A; 
#chains in the Genus database with same CATH topology
 2EGD A;  2K0J A;  1OOF A;  1M46 A;  4AOM A;  2LLU A;  5JJG A;  3TUY B;  4N5X A;  1B47 A;  1EL4 A;  2JT8 A;  1CNP A;  3OBV A;  2GGM A;  3SG3 A;  1KCY A;  2QDI A;  1KQV A;  2DOQ A;  2Y4Q A;  4D1E A;  1TRF A;  2F33 A;  2M49 B;  3SG4 A;  5DIC A;  2JXL A;  1YX7 A;  2M3W A;  2PSR A;  2ERB A;  3KPX A;  4OR9 B;  1QX7 A;  3PSR A;  1SCM C;  3LK1 A;  4M2O A;  4NDB A;  1KFU L;  2WC8 A;  4F7F A;  4ORA B;  1DTL A;  2JTT A;  2KI4 B;  1OMR A;  2K8M B;  2K2A A;  4CLN A;  1QWV A;  1OMV A;  4YI9 A;  3DXL A;  1PVA A;  1B1G A;  2L5Y A;  2PAS A;  3OX5 A;  2JRF A;  1OE9 B;  5TNC A;  4MZJ A;  1UWO A;  1YR5 A;  2L51 A;  3EG5 B;  1IJ5 A;  1ORG A;  4BY4 A;  2PYQ A;  1J7Q A;  4GPL B;  1PVB A;  1F4O A;  1MR8 A;  1MWN A;  1N0Y A;  3VGO A;  3NSO A;  2L2E A;  4BY5 A;  1Y1A A;  3CGA A;  1DJW A;  2SCP A;  1CFC A;  1JFK A;  3BXK A;  1KK7 Y;  1W9Z A;  1DQE A;  3OB2 B;  1AHR A;  1UHI A;  3OP0 A;  1DJI A;  1B8L A;  2HQ8 A;  3BFB A;  4XYN A;  1CKK A;  2KHN A;  3GK4 X;  1DJY A;  1Y6W A;  1KK8 B;  4I5N B;  4ZCU A;  4I5K A;  3EK8 A;  2EHB A;  1ODB A;  1SK6 D;  2QEV A;  3FWC A;  1QV0 A;  4CID A;  1IKU A;  2BL0 C;  3SG7 A;  3VRQ A;  1FI6 A;  2PAL A;  2KBM A;  2LHL A;  3I5G C;  1SCV A;  2K60 A;  1C3Z A;  1L2O B;  1J1E A;  1HT9 A;  2JOJ A;  1NX0 A;  1DJX A;  2NXQ A;  4OV2 A;  1IGV A;  4DRW A;  2LVV A;  5I2L A;  1WLM A;  1KWO C;  2QEB A;  3L4L A;  1UP5 A;  3NHI A;  3NSI A;  2JPT A;  2YGU A;  4GGF A;  1YRT B;  2FOT A;  3GK2 A;  3NXA A;  2KDH A;  2JTZ A;  2KQY A;  1XK4 C;  3GOF A;  1X02 A;  1DC1 A;  3PAL A;  3CR4 X;  3D75 A;  3A8R A;  1BJF A;  1EJ3 A;  1WRL A;  1NSH A;  4GUK A;  3JVT C;  1RJV A;  1M45 A;  2I94 A;  1OOJ A;  1CLL A;  3EVR A;  3L47 A;  4MZL A;  2LMV A;  4ICB A;  3CWG A;  4ORC B;  4YGB B;  4YRU A;  1N65 A;  3OGN A;  1CDN A;  2TN4 A;  2KAY A;  3TZ1 A;  3CLN A;  2WCL A;  4U8D A;  4YGE B;  1Y0V H;  2COL B;  5AAN A;  5KTY A;  1QIW A;  5AFP A;  3DY9 A;  5I8N A;  1OW4 A;  2PVB A;  4JD9 A;  1BLQ A;  2QPT A;  1F8H A;  1V1G A;  3AAK A;  3SG5 A;  1FW4 A;  1BF5 A;  2GV5 A;  2JC2 A;  1XFU O;  1L7Z A;  4YGD B;  2L50 A;  1MXE A;  1NP8 A;  3I5F C;  2WOR A;  1RWY A;  3KEV A;  2LVJ A;  3ZWH A;  1QV1 A;  2ZRT A;  4KYN A;  2OTG B;  3SIA A;  3I5I C;  1C07 A;  2HET A;  4DCK A;  1SSE B;  3Q8I A;  4JQ0 D;  2LC5 A;  4FQO A;  1UHK A;  3LLE A;  2L98 A;  2M97 A;  2KFF A;  3BQ3 A;  2WC5 A;  2ZN8 A;  5AXI A;  1YUU A;  2B1U A;  3NSL A;  5I2O A;  1A4P A;  3DVK A;  4MLW A;  4GGN A;  2F3Y A;  3CZ0 A;  2H61 A;  2O5G A;  3ZNI A;  1CDL A;  1KK8 C;  1DVI A;  3RM1 A;  1YUS A;  3HX4 A;  1A03 A;  1OSA A;  5J3X A;  3SS3 A;  4ETO A;  2KFG A;  1K2H A;  3SG2 A;  3UNW A;  3VB1 A;  1U5I B;  1U5I A;  1YUT A;  5HKZ A;  2F2P A;  2QEH A;  1OMD A;  3CR5 X;  2WCM A;  1QS7 A;  2JUL A;  5D3O A;  5CSJ A;  2KI6 C;  1WDC B;  2JQ6 A;  4M2Q A;  1Z4H A;  1UUS A;  2KAX A;  3PM8 A;  1PSB A;  1H4B A;  4WQ2 A;  3BFA A;  3C1V A;  4INW A;  2WCF A;  2LP3 A;  1REC A;  2LVK A;  4MRX A;  3TDI A;  1K9K A;  3WNX B;  4PAL A;  1RRO A;  1QXP A;  2BAP A;  3EVU A;  1DGU A;  1OQP A;  3O2P A;  3B88 A;  4GGF C;  1DT7 B;  2H8V A;  3BFH A;  3BOW B;  1NCZ A;  3BOW A;  4IL1 A;  2O60 A;  2CT9 A;  1NWD A;  1JF0 A;  1K93 D;  1QAS A;  2CCM A;  4MBE A;  3VRP A;  1D1O A;  1FI5 A;  1Y1X A;  1EG3 A;  2VRG A;  3PN7 B;  2NZ0 A;  4PHJ A;  2ZNE A;  4XJK B;  4XJK A;  5K89 A;  1J7O A;  2QAC A;  1A29 A;  3QRX A;  2HQW A;  4HRG A;  2LAP A;  5HL1 A;  2OS8 C;  4PHK A;  2F8P A;  1SW8 A;  2WCK A;  1CFD A;  3JTD B;  5D69 A;  4TNC A;  4N1G A;  4OZD A;  1XFY O;  1BG1 A;  4HSZ A;  3EKJ A;  3S0B A;  2P70 A;  3D0Y A;  3D0Y B;  5BPJ A;  3MSE B;  2L4I A;  2LE9 B;  2MBX A;  3R72 A;  1F4Q A;  1IQ5 A;  3WHT B;  4PE0 A;  2K7D A;  3LL8 B;  4IJ7 A;  2MA2 A;  1IWQ A;  1WY9 A;  2GTE A;  1C7V A;  1S6J A;  2G9B A;  2KLE A;  5HKW A;  1TN4 A;  2FJU B;  1IG5 A;  2KFH A;  2OTG C;  2K7O A;  1SBJ A;  3A4U B;  1EG4 A;  2M1K B;  2CTN A;  2EC6 B;  1CTR A;  1XFW O;  3D73 A;  4NDC A;  1SL8 A;  1KFX L;  3TS5 B;  1KSO A;  1SNL A;  3K21 A;  1XO5 A;  1YUR A;  2WCB A;  3RLZ A;  3I5H B;  2GGZ A;  4HRE E;  2KYC A;  3SJS A;  1QLS A;  1G8I A;  5EL2 A;  1TCO B;  3TDU A;  1IIO A;  1PRW A;  1JWD A;  5KU1 A;  1SR6 C;  3PM2 A;  2LHI A;  2WCJ A;  1N2D A;  3DF0 B;  3DF0 A;  5HYD A;  1WDC C;  1XVJ A;  2IS9 A;  2KGR A;  4PHM A;  1S1E A;  3UO9 A;  5FI6 A;  2RGI A;  1K96 A;  2JT0 A;  1DMO A;  3O4X A;  3TUY C;  1ALW A;  2M8U A;  2I7A A;  2M1U A;  1M63 B;  1KFU S;  1LS8 A;  3EK7 A;  2KGB C;  1KQM B;  4CPV A;  4MVF A;  1TOP A;  2AUC A;  1W7I B;  1CDM A;  2JNF A;  1QLK A;  1R6P A;  2BNX A;  3D74 A;  2JWW A;  2G2B A;  1LA3 A;  2M7N A;  2F3Z A;  3O6B A;  1J55 A;  1QJT A;  4L9M A;  4PHN A;  2H2K A;  4PDZ A;  3QME A;  5CPV A;  3IQQ A;  5AER A;  5HLO A;  1ZUZ A;  1PAL A;  5PAL A;  1PUL A;  2AAO A;  2KI4 C;  2LMT A;  1ZMZ A;  1JSA A;  2KNE A;  1IRJ A;  3SIB A;  3V2L A;  1IH0 A;  1RTP 1;  1K9U A;  4I5J A;  4HRH A;  1G4Y R;  1GQM A;  1S26 D;  1YRU B;  2KQ6 A;  3CZ2 A;  2K7B A;  3DVJ A;  2BBM A;  3NGV A;  1S36 A;  1QIV A;  3F45 A;  2KYF A;  1MQ1 A;  2Q91 A;  2M7L A;  2NCP A;  2Y5I A;  4NQG A;  3H4S E;  1B7T Z;  3EK4 A;  4NDD A;  1YX8 A;  1HQV A;  2JT3 A;  3K1E A;  1S5G Z;  4ORB B;  3GK1 A;  1ALV A;  3D77 A;  1K8U A;  1ZOT B;  1M39 A;  3FS7 A;  3DYE A;  1ZAC A;  2KOT A;  3I5H C;  1JF2 A;  1LA0 A;  3AKA A;  5FI7 A;  3WHU B;  1TWO A;  3B7A A;  4AQJ A;  1JUO A;  5AEQ A;  2NLN A;  5ER4 X;  3WXA A;  3FE8 A;  1A75 B;  1A75 A;  1F70 A;  2LVI A;  2LUX A;  1L2O C;  1MHO A;  2CBL A;  1SL7 A;  1YTZ C;  1DJH A;  2JZI A;  2ZND A;  4JPZ B;  1SYM A;  3KF9 A;  3BUM B;  3VRR A;  4GNK B;  1BT6 A;  4QJ4 B;  1B7T Y;  4C0L A;  3O4Y A;  1K95 A;  5CSN A;  1TNW A;  1TUZ A;  2ZFD A;  1S5G Y;  1KQM C;  2JU0 A;  1CDP A;  3B87 A;  3CAB A;  4N1F A;  4FTG A;  1A2X A;  1LVC D;  2BL0 B;  2LCP A;  2Q4U A;  3KO0 A;  4MEW A;  4C0K A;  4QJ5 B;  2CNP A;  3I5G B;  3LCP C;  1JC2 A;  2FJY A;  1UHN A;  4UPG A;  1Y1U A;  3B6X A;  5JOL A;  4P5O E;  2LLS A;  2LNK A;  3TDZ A;  4MN0 A;  5B8I B;  2L5X B;  4PE4 A;  1CFF A;  2HPS A;  2LP2 A;  3FIA A;  1IQ3 A;  1QVI Z;  4MZK A;  1CM1 A;  1GJY A;  2BKI B;  1VRK A;  1KWO B;  1YVH A;  4WRI A;  1WRK A;  2KBI A;  3PLF B;  4M2P A;  5G08 A;  1CB1 A;  1TNQ A;  3CS1 A;  2Y1N A;  1S6I A;  2F2O A;  1XFZ O;  2WOS A;  1XK4 A;  1B4C A;  2K2F A;  5F6T A;  2KLD A;  2LAN A;  1J7R A;  1CMF A;  1FF1 A;  2K61 A;  3OX6 A;  4A4B A;  1NPQ A;  3BUW B;  3JVT B;  3R1P A;  1JFJ A;  1AJ4 A;  1KK7 Z;  3IQO A;  2M9G A;  3CZT X;  4PE1 A;  4CFR A;  1GM0 A;  1YVL A;  2P6B B;  4A4C A;  2WC6 A;  3HCM A;  1DJG A;  2WND A;  4F0Z B;  2M0R A;  2BEC A;  2WCE A;  4OCI A;  1QX5 B;  1M31 A;  1AP4 A;  1SKT A;  2LLT A;  4YGA A;  2ZRS A;  2MAZ A;  4WQ3 A;  3S0F A;  1QVI Y;  2H61 C;  1XFX O;  2NCO A;  1E8A A;  1CLM A;  1SY9 A;  1TTX A;  3EKH A;  2BCB A;  5I2Q A;  2I18 A;  3EVV A;  3I5F B;  3IF7 A;  3DVM A;  3SS4 A;  2KSP A;  3SS5 A;  1V1F A;  3BJH A;  1PK0 D;  1JBA A;  1QTX A;  2PMY A;  3VRN A;  2AMI A;  1H8B A;  1DEL A;  2LV7 A;  3I5I B;  1SPY A;  1B9A A;  1MXL C;  1SMG A;  3LK0 A;  4JKT A;  2BKH B;  2KI6 D;  2KPH A;  3D78 A;  3IVT A;  4DUQ A;  3PJI A;  1AK8 A;  3FWB A;  3NHT A;  4YGC B;  4I5L B;  3VRO A;  1UUR A;  3AAJ A;  1OZS A;  2R2I A;  5CSI A;  1J7P A;  1B8C A;  1Q80 A;  2PRU A;  1RFJ A;  2P71 A;  2Y1M A;  3SG6 A;  3R1O A;  1BMO A;  1TNP A;  1DEK A;  3BUN B;  1CMG A;  3DZT A;  2L4H A;  1QAT A;  5IBW A;  1LKJ A;  1W7J B;  1BR1 B;  2BCA A;  4C0J A;  5DKR A;  3S0A A;  4PCW A;  3PN7 C;  5HLV A;  5FI2 A;  4DIR A;  2ZKM X;  4ZCV A;  2L2C A;  2E30 A;  3B86 A;  2MJW B;  1C3Y A;  1CM4 A;  3FE9 A;  1FPW A;  2JPO A;  2LM5 A;  5HKY A;  4GBA A;  5DKQ A;  1EXR A;  2JXC A;  2JNX A;  1LIN A;  1IJ6 A;  1B8R A;  1OOI X;  3BUO B;  3JTD C;  3NSK A;  4AQI A;  1XYD A;  1Z2C B;  4GAO A;  3BYA A;  1LXF C;  1NYA A;  2HF5 A;  3CZ1 A;  1F71 A;  3PFV A;  3D76 A;  1NX1 A;  4PE7 A;  5I94 A;  1NUB A;  3DVE A;  1BOD A;  1ZFS A;  4OVN F;  1QX2 A;  1R2U A;  3S0G A;  1DJZ A;  3L4A A;  2L0P A;  1KFX S;  2QEO A;  3D10 A;  4QJ3 B;  1WLZ A;  3O78 A;  4MSP A;  4JWQ A;  5ER5 A;  5GQQ C;  4R1E A;  1CLB A;  1BOC A;  1K94 A;  4YI8 A;  1BR4 B;  2ISD A;  1K90 D;  1NIW A;  1G33 A;  1SCM B;  2KAV A;  1BU3 A;  1TUJ A;  2OS8 B;  1EH2 A;  2BE4 A;  2EC6 C;  2FCD A;  4P2Y B;  2LMU A;  2MHH A;  2MLE C;  2A4J A;  2SAS A;  4DS7 A;  1DF0 B;  1DF0 A;  3CR2 A;  4FQT A;  1NCX A;  3TS5 C;  1TNX A;  1T14 A;  3AKB A;  5D7F A;  2ZN9 A;  5KSZ A;  2WCH A;  3CDN A;  3ICB A;  2D8N A;  1DGV A;  1S6C A;  1UHJ A;  4GFT A;  4INX A;  5CSF A;  3BUX B;  3DD4 A;  3FE6 A;  3OHM B;  1MF8 B;  2E6W A;  4E68 A;  1CFP A;  1C7W A;  1SL9 A;  1J1D A;  1AUI B;  2LUC A;  1GGW A;  2MRD A;  1NX3 A;  2MLF C;  3OB1 B;  1RK9 A;  3RZS A;  3N7H A;  3KHE A;  5DKN A;  3S0D A;  1NCY A;  2K7C A;  4MRY A;  1SRA A;  1MUX A;  1OOH A;  2I2R E;  1PSR A;  2M29 A;  1OOG A;  1P28 A;  1OZO A;  2PQL A;  2FCE A;  3CTN A;  4Q04 A;  1S3P A;  1NX2 A;  1AVS A;  3E3R A;  3CYZ A;  1GGZ A;  1K9P A;  3S0E A;  1TCF A;  1WRZ A;  4OKH A;  2CXJ A;  3M0W A;  1XA5 A;  1XFV O;  1TIZ A;  1UHH A;  2BCX A;  4CFQ A;  1FBV A;  5FYX A;  2V53 A;  1F55 A;  1SR6 B;  1F54 A;  1AJ5 A;  2BBN A;  3PAT A;  2BE6 A;  1XFR A;  3R1V A;  4PT1 A;  4YBH B;  1KSM A;  4USL A;  2OPO A; 
#chains in the Genus database with same CATH homology
 2EGD A;  2K0J A;  1M46 A;  4AOM A;  2LLU A;  5JJG A;  3TUY B;  4N5X A;  1B47 A;  1EL4 A;  2JT8 A;  1CNP A;  2GGM A;  3SG3 A;  1KCY A;  1KQV A;  2DOQ A;  2Y4Q A;  4D1E A;  1TRF A;  2F33 A;  2M49 B;  3SG4 A;  2JXL A;  1YX7 A;  2M3W A;  2PSR A;  3KPX A;  4OR9 B;  1QX7 A;  3PSR A;  1SCM C;  3LK1 A;  4M2O A;  4NDB A;  1KFU L;  2WC8 A;  4ORA B;  1DTL A;  2JTT A;  2KI4 B;  1OMR A;  2K8M B;  2K2A A;  4CLN A;  1OMV A;  4YI9 A;  1PVA A;  1B1G A;  2PAS A;  3OX5 A;  2JRF A;  1OE9 B;  5TNC A;  4MZJ A;  1UWO A;  1YR5 A;  2L51 A;  1IJ5 A;  4BY4 A;  1J7Q A;  4GPL B;  1PVB A;  1F4O A;  1MR8 A;  1MWN A;  1N0Y A;  3VGO A;  3NSO A;  2L2E A;  4BY5 A;  1Y1A A;  3CGA A;  1DJW A;  2SCP A;  1CFC A;  1JFK A;  3BXK A;  1KK7 Y;  3OB2 B;  1AHR A;  1UHI A;  3OP0 A;  1DJI A;  1B8L A;  2HQ8 A;  4XYN A;  1CKK A;  2KHN A;  3GK4 X;  1DJY A;  1Y6W A;  1KK8 B;  4I5N B;  4ZCU A;  4I5K A;  3EK8 A;  2EHB A;  1ODB A;  1SK6 D;  3FWC A;  4CID A;  1QV0 A;  1IKU A;  2BL0 C;  3SG7 A;  3VRQ A;  2PAL A;  2KBM A;  2LHL A;  3I5G C;  1SCV A;  1L2O B;  1J1E A;  1HT9 A;  2JOJ A;  1NX0 A;  1DJX A;  2NXQ A;  4OV2 A;  1IGV A;  4DRW A;  2LVV A;  1WLM A;  1KWO C;  1UP5 A;  3NSI A;  2JPT A;  4GGF A;  1YRT B;  2FOT A;  3GK2 A;  3NXA A;  2KDH A;  2JTZ A;  2KQY A;  1XK4 C;  3GOF A;  1X02 A;  3PAL A;  3CR4 X;  3A8R A;  1BJF A;  1EJ3 A;  1WRL A;  1NSH A;  4GUK A;  3JVT C;  1RJV A;  1M45 A;  2I94 A;  1OOJ A;  1CLL A;  3EVR A;  4MZL A;  2LMV A;  4ICB A;  3CWG A;  4ORC B;  4YGB B;  4YRU A;  1N65 A;  2TN4 A;  2KAY A;  3TZ1 A;  3CLN A;  4YGE B;  4U8D A;  1Y0V H;  2COL B;  5AAN A;  5KTY A;  1QIW A;  5AFP A;  5I8N A;  2PVB A;  1BLQ A;  2QPT A;  1F8H A;  1V1G A;  3AAK A;  3SG5 A;  1FW4 A;  1BF5 A;  2GV5 A;  2JC2 A;  1XFU O;  1L7Z A;  4YGD B;  2L50 A;  1MXE A;  1NP8 A;  3I5F C;  2WOR A;  1RWY A;  3KEV A;  2LVJ A;  3ZWH A;  1QV1 A;  2ZRT A;  2OTG B;  3SIA A;  3I5I C;  1C07 A;  2HET A;  4DCK A;  4JQ0 D;  2LC5 A;  4FQO A;  1UHK A;  3LLE A;  2L98 A;  2M97 A;  2KFF A;  3BQ3 A;  2ZN8 A;  5AXI A;  1YUU A;  2B1U A;  3NSL A;  5I2O A;  1A4P A;  3DVK A;  4MLW A;  4GGN A;  2F3Y A;  2H61 A;  2O5G A;  3ZNI A;  1CDL A;  1KK8 C;  1DVI A;  3RM1 A;  1YUS A;  3HX4 A;  1A03 A;  1OSA A;  5J3X A;  4ETO A;  2KFG A;  1K2H A;  3SG2 A;  1U5I B;  1U5I A;  1YUT A;  5HKZ A;  2F2P A;  1OMD A;  3CR5 X;  1QS7 A;  2JUL A;  5CSJ A;  2KI6 C;  1WDC B;  2JQ6 A;  4M2Q A;  1H4B A;  1UUS A;  2KAX A;  3PM8 A;  1PSB A;  4WQ2 A;  3C1V A;  2WCF A;  2LP3 A;  1REC A;  2LVK A;  4MRX A;  3TDI A;  1K9K A;  3WNX B;  4PAL A;  1RRO A;  1QXP A;  3EVU A;  1DT7 B;  1DGU A;  1OQP A;  3O2P A;  4GGF C;  1CDN A;  3BOW B;  1NCZ A;  3BOW A;  4IL1 A;  2O60 A;  2CT9 A;  1NWD A;  1JF0 A;  1K93 D;  1QAS A;  2CCM A;  4MBE A;  3VRP A;  1D1O A;  1FI5 A;  1Y1X A;  1EG3 A;  2VRG A;  3PN7 B;  2NZ0 A;  4PHJ A;  2ZNE A;  4XJK B;  4XJK A;  5K89 A;  1J7O A;  2QAC A;  1A29 A;  3QRX A;  2HQW A;  4HRG A;  2LAP A;  2OS8 C;  4PHK A;  2F8P A;  1SW8 A;  1CFD A;  3JTD B;  5D69 A;  4TNC A;  4N1G A;  1XFY O;  1BG1 A;  4HSZ A;  3EKJ A;  5BPJ A;  3D0Y B;  3D0Y A;  3MSE B;  2L4I A;  2LE9 B;  2MBX A;  1F4Q A;  1IQ5 A;  3WHT B;  4PE0 A;  2K7D A;  3LL8 B;  2MA2 A;  1IWQ A;  1WY9 A;  1C7V A;  1S6J A;  2G9B A;  5HKW A;  1TN4 A;  2FJU B;  1IG5 A;  2KFH A;  2OTG C;  2K7O A;  1SBJ A;  3A4U B;  1EG4 A;  2M1K B;  2CTN A;  2EC6 B;  1CTR A;  1XFW O;  4NDC A;  1SL8 A;  1KFX L;  3TS5 B;  1KSO A;  1SNL A;  3K21 A;  1XO5 A;  1YUR A;  2WCB A;  3RLZ A;  3I5H B;  2GGZ A;  4HRE E;  2KYC A;  3SJS A;  1QLS A;  1G8I A;  1TCO B;  3TDU A;  1PRW A;  1JWD A;  5KU1 A;  1SR6 C;  2LHI A;  1N2D A;  3DF0 B;  3DF0 A;  5HYD A;  1WDC C;  1XVJ A;  2IS9 A;  2KGR A;  4PHM A;  1S1E A;  2RGI A;  1K96 A;  2JT0 A;  1DMO A;  3TUY C;  1ALW A;  2M8U A;  2I7A A;  2M1U A;  1M63 B;  1KFU S;  3EK7 A;  2KGB C;  1KQM B;  4CPV A;  4MVF A;  1TOP A;  2AUC A;  1W7I B;  1CDM A;  2JNF A;  1QLK A;  1R6P A;  2JWW A;  2G2B A;  1LA3 A;  2M7N A;  2F3Z A;  3O6B A;  1J55 A;  1QJT A;  4L9M A;  4PHN A;  2H2K A;  4PDZ A;  5CPV A;  3IQQ A;  5AER A;  5HLO A;  1ZUZ A;  1PAL A;  5PAL A;  1PUL A;  2AAO A;  2KI4 C;  2LMT A;  1ZMZ A;  1JSA A;  2KNE A;  1IRJ A;  3SIB A;  1IH0 A;  1RTP 1;  1K9U A;  4I5J A;  4HRH A;  1G4Y R;  1GQM A;  1S26 D;  1YRU B;  2KQ6 A;  2K7B A;  3DVJ A;  2BBM A;  1S36 A;  1QIV A;  3F45 A;  2KYF A;  1MQ1 A;  2Q91 A;  2M7L A;  2NCP A;  2Y5I A;  4NQG A;  3H4S E;  1B7T Z;  3EK4 A;  4NDD A;  1YX8 A;  1HQV A;  2JT3 A;  1S5G Z;  4ORB B;  3GK1 A;  1ALV A;  1K8U A;  1ZOT B;  1M39 A;  3FS7 A;  1ZAC A;  2KOT A;  3I5H C;  1JF2 A;  1LA0 A;  3AKA A;  3WHU B;  4AQJ A;  1JUO A;  5AEQ A;  2NLN A;  3WXA A;  1A75 B;  1A75 A;  1F70 A;  2LVI A;  2LUX A;  1L2O C;  1MHO A;  2CBL A;  1SL7 A;  1YTZ C;  1DJH A;  2JZI A;  2ZND A;  4JPZ B;  1SYM A;  3KF9 A;  3BUM B;  3VRR A;  4GNK B;  1BT6 A;  4QJ4 B;  1B7T Y;  4C0L A;  3O4Y A;  1K95 A;  5CSN A;  1TNW A;  4N1F A;  2ZFD A;  1S5G Y;  1KQM C;  2JU0 A;  1CDP A;  4FTG A;  1A2X A;  1LVC D;  2BL0 B;  2LCP A;  2Q4U A;  3KO0 A;  4MEW A;  4C0K A;  4QJ5 B;  2CNP A;  3I5G B;  3LCP C;  1JC2 A;  1UHN A;  4UPG A;  1Y1U A;  5JOL A;  4P5O E;  2LLS A;  2LNK A;  3TDZ A;  4MN0 A;  5B8I B;  2L5X B;  4PE4 A;  1CFF A;  2HPS A;  2LP2 A;  3FIA A;  1IQ3 A;  1QVI Z;  4MZK A;  1CM1 A;  2BKI B;  1GJY A;  1VRK A;  1KWO B;  1YVH A;  4WRI A;  1WRK A;  2KBI A;  3PLF B;  4M2P A;  5G08 A;  1CB1 A;  1TNQ A;  3CS1 A;  2Y1N A;  1S6I A;  2F2O A;  1XFZ O;  2WOS A;  1XK4 A;  1B4C A;  2K2F A;  5F6T A;  2LAN A;  1J7R A;  1CMF A;  1FF1 A;  2K61 A;  3OX6 A;  4A4B A;  1NPQ A;  3BUW B;  3JVT B;  1JFJ A;  1AJ4 A;  1KK7 Z;  3IQO A;  2M9G A;  3CZT X;  4PE1 A;  4CFR A;  1YVL A;  2P6B B;  4A4C A;  3HCM A;  1DJG A;  2WND A;  4F0Z B;  2M0R A;  2BEC A;  2WCE A;  4OCI A;  1QX5 B;  1M31 A;  1AP4 A;  1SKT A;  2LLT A;  4YGA A;  2ZRS A;  2MAZ A;  4WQ3 A;  1QVI Y;  2H61 C;  1XFX O;  2NCO A;  1E8A A;  1CLM A;  1SY9 A;  1TTX A;  3EKH A;  2BCB A;  5I2Q A;  2I18 A;  3EVV A;  3I5F B;  3IF7 A;  3DVM A;  2KSP A;  1V1F A;  1JBA A;  1PK0 D;  1QTX A;  2PMY A;  3VRN A;  2AMI A;  1H8B A;  2LV7 A;  3I5I B;  1SPY A;  1B9A A;  1MXL C;  1SMG A;  3LK0 A;  2BKH B;  2KI6 D;  4DUQ A;  1AK8 A;  3FWB A;  4YGC B;  4I5L B;  3VRO A;  1UUR A;  3AAJ A;  1OZS A;  2R2I A;  5CSI A;  1J7P A;  1B8C A;  1Q80 A;  2PRU A;  1RFJ A;  2Y1M A;  3SG6 A;  1BMO A;  1TNP A;  3BUN B;  1CMG A;  2L4H A;  1QAT A;  5IBW A;  1LKJ A;  1W7J B;  1BR1 B;  2BCA A;  4C0J A;  5DKR A;  4PCW A;  3PN7 C;  5HLV A;  4DIR A;  2ZKM X;  4ZCV A;  2E30 A;  2MJW B;  1CM4 A;  1FPW A;  2LM5 A;  5HKY A;  4GBA A;  5DKQ A;  1EXR A;  2JXC A;  3BUO B;  1LIN A;  1IJ6 A;  1B8R A;  3JTD C;  3NSK A;  5I2L A;  4AQI A;  1FI6 A;  1XYD A;  4GAO A;  3BYA A;  1LXF C;  1NYA A;  2HF5 A;  1F71 A;  3PFV A;  1NX1 A;  4PE7 A;  1NUB A;  3DVE A;  1BOD A;  1ZFS A;  4OVN F;  1QX2 A;  1R2U A;  1DJZ A;  4QJ3 B;  2L0P A;  1KFX S;  5ER4 X;  3D10 A;  1WLZ A;  3O78 A;  4MSP A;  4JWQ A;  5ER5 A;  5GQQ C;  4R1E A;  1CLB A;  1BOC A;  1K94 A;  4YI8 A;  1BR4 B;  2ISD A;  1K90 D;  1NIW A;  1G33 A;  1SCM B;  2KAV A;  1BU3 A;  2OS8 B;  1EH2 A;  2BE4 A;  2EC6 C;  2FCD A;  4P2Y B;  2LMU A;  2MHH A;  2MLE C;  2A4J A;  2SAS A;  4DS7 A;  1DF0 B;  1DF0 A;  3CR2 A;  1NCX A;  3TS5 C;  1TNX A;  3AKB A;  5D7F A;  2ZN9 A;  5KSZ A;  3ICB A;  2D8N A;  1DGV A;  1S6C A;  1UHJ A;  4GFT A;  5CSF A;  3BUX B;  3DD4 A;  3OHM B;  1MF8 B;  2E6W A;  4E68 A;  1CFP A;  1C7W A;  1SL9 A;  1J1D A;  1AUI B;  2LUC A;  1GGW A;  2MRD A;  1NX3 A;  2MLF C;  3OB1 B;  1RK9 A;  3KHE A;  5DKN A;  1NCY A;  2K7C A;  4MRY A;  1SRA A;  1MUX A;  2I2R E;  1PSR A;  2M29 A;  3CTN A;  1OZO A;  4Q04 A;  2FCE A;  1S3P A;  1NX2 A;  1AVS A;  3E3R A;  1GGZ A;  1K9P A;  1TCF A;  1WRZ A;  4OKH A;  2CXJ A;  3M0W A;  1XA5 A;  1XFV O;  1TIZ A;  1UHH A;  2BCX A;  4CFQ A;  1FBV A;  5FYX A;  2V53 A;  1F55 A;  1SR6 B;  1F54 A;  1AJ5 A;  2BBN A;  3PAT A;  2BE6 A;  2JNX A;  4YBH B;  1KSM A;  4USL A;  2OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...