3DVKA

Crystal structure of ca2+/cam-cav2.3 iq domain complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
143
Chain Sequence
b'LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 50
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvkA00
1SNLA 1GGZA 4YGBB 5BPJA 1WDCB 3LLEA 1XFVO 1LA0A 4ORBB 4L9MA 2L5XB 3SIBA 2KI6C 1MUXA 2Q91A 2BCAA 1XFYO 1IRJA 1SKTA 2HETA 1CLLA 2HPSA 3D0YB 3I5GB 1CNPA 5I2QA 1PSRA 1JFKA 2BKIB 2KOTA 4MZLA 1V1GA 1IQ5A 2K61A 4GGFC 5AXIA 2OS8C 1LVCD 2WCBA 3IQOA 4GUKA 1FI6A 1MHOA 2JU0A 4A4BA 1YUSA 4PHKA 2MAZA 1EL4A 1M31A 2I7AA 4MEWA 4WRIA 1IJ5A 2QPTA 2OTGB 2JZIA 1FBVA 2PASA 1N65A 1NX0A 3TDUA 1J55A 1JUOA 1W7JB 1SYMA 3NSKA 3PN7C 2WCEA 2ZRTA 1UHNA 1AP4A 2LMVA 1QX7A 1KSMA 1B8CA 3KEVA 4GFTA 4N1GA 1UP5A 3C1VA 1QVIZ 5ER5A 1NWDA 4ORAB 3CGAA 3JTDB 5K89A 1NCXA 4YGDB 3EVVA 2KBMA 3LL8B 3I5HC 4I5NB 3RM1A 1YUTA 3TUYC 1L7ZA 4MRYA 5I2OA 4I5KA 5CSJA 2BCBA 1K9UA 1B9AA 1EH2A 1UURA 2JOJA 3BOWB 1SL9A 2KQ6A 2RGIA 1DF0A 2LLTA 5JJGA 1K95A 1RROA 3ICBA 1XYDA 4M2PA 1BU3A 2LCPA 4JWQA 4C0JA 2KFHA 2LANA 3BXKA 4ZCUA 3PATA 1DJHA 2K7CA 1MWNA 2LUCA 1RFJA 2MBXA 1XVJA 1EJ3A 2KI4C 2KQYA 1XFWO 2NZ0A 3AKAA 1JF2A 1CFDA 1K96A 1OMDA 1TNWA 2M7NA 1F8HA 2JT0A 5ER4X 2JNFA 2JPTA 2MRDA 3OP0A 4MSPA 1SBJA 1YRTB 1DJGA 2Y1NA 1NYAA 1YTZC 5B8IB 1U5IB 3DVJA 1OQPA 4I5JA 4AQJA 1BR1B 1CKKA 1PSBA 3EK4A 2L4HA 4DS7A 1DT7B 1PRWA 1YVHA 2M8UA 1NIWA 4HRGA 1J1EA 3CWGA 5HKZA 1JFJA 1DJWA 2H61A 3EVRA 1R2UA 1OSAA 3LCPC 1ZMZA 1JF0A 1S6IA 1F4OA 1NCZA 3AKBA 4FTGA 3SG2A 2FCDA 4BY4A 1FI5A 1YVLA 1Y1AA 4MRXA 4PHJA 5I2LA 1SPYA 1IG5A 2VRGA 4MLWA 1XFUO 1D1OA 1YX7A 1TNPA 2MLEC 1DGVA 1MQ1A 4IL1A 1KFUS 2EC6C 3M0WA 1OE9B 1GGWA 5HLVA 3BQ3A 4GAOA 1XFXO 1XO5A 2COLB 4PALA 1AJ5A 2ISDA 3SG4A 1TNQA 1DJXA 2G9BA 4QJ4B 2AMIA 1WRLA 1KQMC 3FWCA 2F8PA 2CBLA 4NDBA 1UHJA 3D0YA 4R1EA 4DCKA 1PVBA 1X02A 3SG5A 1CMFA 4YRUA 3CR4X 2JXLA 2HF5A 3WHUB 2JWWA 3VRRA 1CFCA 4DUQA 2LP3A 3D10A 5HKWA 3BUMB 2HQWA 5IBWA 2KGRA 3O4YA 1KK7Z 3I5IC 3TZ1A 1F71A 2KGBC 5D69A 1WY9A 5KTYA 1IQ3A 3EVUA 4PHMA 2EC6B 5F6TA 3HCMA 2SASA 4WQ3A 5GQQC 4ZCVA 1BJFA 1SCMC 4DRWA 2BECA 2M97A 4NDCA 4CIDA 1A29A 1SR6C 1B7TY 1KQMB 1XFZO 5KU1A 2NCOA 3SJSA 1QATA 1ALVA 2LMTA 3GK2A 3IF7A 4C0LA 2KSPA 1M46A 1PK0D 4YI8A 1G33A 2I94A 2TN4A 1DMOA 1OMRA 1NCYA 1PALA 2F33A 4GGFA 4N5XA 2L2EA 2H2KA 4P2YB 3GK1A 4M2QA 5AFPA 2FOTA 3TDIA 1CMGA 2BE4A 1UUSA 3I5FC 1HQVA 1NSHA 4HSZA 5AANA 1R6PA 3BOWA 4YGCB 1EG3A 1F70A 2JTTA 3TDZA 1A03A 1WRKA 1YR5A 4C0KA 4GGNA 1SCMB 1QLKA 1FPWA 4GPLB 3VRPA 3E3RA 4TNCA 2M29A 2K0JA 2BCXA 2Y1MA 1EXRA 1J7RA 1DGUA 3CS1A 5G08A 4PE7A 1IH0A 3DF0B 2OS8B 1NX3A 2NCPA 1UWOA 2KBIA 2F2PA 1E8AA 1K94A 1TCFA 1U5IA 2M9GA 2BKHB 3I5FB 2BBNA 2I18A 5JOLA 3VRQA 5CSNA 3GK4X 3LK0A 2Y4QA 2BBMA 1ZFSA 3KF9A 5AERA 4YGAA 1DJIA 5HYDA 3PN7B 2M1UA 1K2HA 4GNKB 1KFXL 4MN0A 4WQ2A 3A4UB 1Y1UA 1CFPA 3PALA 2WORA 1NUBA 4PCWA 2FCEA 3AAKA 3BYAA 3OX6A 2KAYA 3O78A 3OB2B 1FF1A 1QIVA 3JVTC 1GJYA 1S6JA 1VRKA 5CSIA 2BE6A 1CM4A 3IQQA 3O6BA 3QRXA 3TUYB 3I5HB 2JNXA 4OR9B 1AHRA 2GV5A 3RLZA 1QX5B 1N2DA 2KI6D 2LP2A 1B8RA 1XA5A 1OMVA 2A4JA 3CLNA 4OV2A 1CDLA 3GOFA 2JULA 1CDPA 4YGEB 4OVNF 3A8RA 1LKJA 4OKHA 4CFRA 1K90D 4ETOA 1ALWA 2Q4UA 1AJ4A 2CNPA 2LLUA 1MR8A 2ZNEA 4PE0A 1A75A 2ZKMX 2NLNA 2KAVA 2LVVA 2KAXA 3OHMB 1TTXA 4AOMA 3PSRA 4FQOA 1CDNA 2KNEA 1TNXA 3HX4A 3OB1B 2PALA 4QJ3B 1S26D 3KHEA 2KI4B 5CPVA 1RWYA 5TNCA 3JVTB 1QLSA 1OZOA 2CT9A 2JTZA 1TOPA 1RTP1 3WXAA 1CDMA 1XK4A 3DVEA 4U8DA 4AQIA 1BLQA 2CTNA 1NX2A 3AAJA 2L98A 3ZWHA 3TS5C 1SMGA 1LINA 1KFUL 1B4CA 4D1EA 1IWQA 1WLZA 1B8LA 3WHTB 4JQ0D 1RK9A 2HQ8A 1IKUA 4ICBA 1A75B 2PSRA 4MZJA 4XJKB 3NSLA 2WNDA 3NSOA 2FJUB 3BUWB 1SL7A 3NSIA 4P5OE 1MXEA 1HT9A 1L2OC 5I8NA 2KFGA 1UHHA 1CM1A 2F3YA 1PULA 4F0ZB 3I5GC 2E30A 3FIAA 1BR4B 3BUNB 2M7LA 2K7BA 1K9KA 5DKQA 1N0YA 2PVBA 2PRUA 3PM8A 3TS5B 1LA3A 2F3ZA 2M1KB 1W7IB 1JSAA 1QX2A 4Q04A 1SY9A 2AUCA 1J7PA 4CFQA 2M49B 3DF0A 2IS9A 2OPOA 1BODA 2JC2A 3EK8A 1Q80A 2JT3A 4XYNA 3MSEB 2KHNA 4JPZB 1H4BA 2MJWB 2B1UA 1DJZA 3I5IB 1QVIY 1LXFC 1TN4A 3DD4A 1EG4A 1K8UA 3EKHA 1M45A 1QV0A 4BY5A 1L2OB 4QJ5B 2R2IA 1JC2A 3F45A 1AK8A 4A4CA 1CTRA 5HKYA 3CR2A 1G8IA 1SR6B 1MF8B 3JTDC 4MZKA 4UPGA 1C7VA 4YI9A 3VROA 4I5LB 3CZTX 2M0RA 1K9PA 5HLOA 2V53A 2MLFC 2MA2A 2NXQA 2LV7A 3BUXB 3PLFB 5FYXA 2DOQA 1KK8C 4MBEA 1IJ6A 3CTNA 4CPVA 1JBAA 1B7TZ 1F55A 5D7FA 1M39A 4USLA 1WRZA 1IGVA 1ZOTB 3SG7A 1SW8A 1YX8A 1YURA 4ORCB 1GQMA 1KQVA 1CLMA 4HRHA 2GGZA 2Y5IA 2JXCA 1BT6A 3FWBA 1B1GA 5CSFA 1TIZA 4YBHB 1QV1A 2L51A 1QJTA 3NXAA 1Y1XA 5DKNA 2K8MB 1NPQA 3K21A 3KPXA 4PHNA 1J7QA 1KWOC 4M2OA 1NP8A 1F54A 2LVJA 4NDDA 3PFVA 2LLSA 1OOJA 1BMOA 1M63B 2LVKA 2O5GA 1KFXS 2G2BA 1NX1A 3WNXB 2WC8A 2JQ6A 1KK8B 1S3PA 2M3WA 4PDZA 1ZUZA 2QACA 1AUIB 1S36A 4HREE 1TCOB 1SK6D 2P6BB 4PE1A 1SRAA 2L50A 1A4PA 2CXJA 1YRUB 3FS7A 1FW4A 1H8BA 1QASA 2I2RE 3KO0A 2KFFA 4NQGA 1RECA 1CB1A 2E6WA 4DIRA 5KSZA 1RJVA 2K7OA 4XJKA 1KWOB 3SG3A 3BUOB 2LC5A 2LNKA 1Y0VH 2GGMA 1QTXA 2KYCA 1OZSA 3OX5A 2D8NA 1S5GY 1DVIA 3VRNA 1KK7Y 2JT8A 2ZFDA 4CLNA 1F4QA 1PVAA 1TRFA 1A2XA 1WLMA 2BL0C 2KYFA 2LE9B 1SL8A 1UHKA 2KDHA 2ZNDA 2CCMA 2ZRSA 4GBAA 2PMYA 1DF0B 1DTLA 2MHHA 2L4IA 2O60A 1KSOA 2ZN9A 5PALA 2WCFA 1QXPA 2H61C 5J3XA 1JWDA 2WOSA 1ODBA 2LVIA 4N1FA 1BG1A 1AVSA 1SCVA 5AEQA 1QS7A 3ZNIA 1K93D 2K2FA 1WDCC 3LK1A 1J1DA 3EKJA 3DVMA 4E68A 3H4SE 2AAOA 1QIWA 1XK4C 5DKRA 2K7DA 3O2PA 2L0PA 1S6CA 2F2OA 4MVFA 2LAPA 1UHIA 1CLBA 2LHLA 2EGDA 1S1EA 2BL0B 2K2AA 1B47A 1C07A 1C7WA 3SIAA 1DJYA 2LM5A 2JRFA 2LMUA 1BOCA 1J7OA 1MXLC 1YUUA 1ZACA 3EK7A 3VGOA 2ZN8A 1S5GZ 1BF5A 2LUXA 3DVKA 1V1FA 1KCYA 1CFFA 4OCIA 3SG6A 2LHIA 2SCPA 1Y6WA 4PE4A 3CR5X 1G4YR 2EHBA 2OTGC
chains in the Genus database with same CATH superfamily
1SNLA 1GGZA 4YGBB 5BPJA 3FE8A 1WDCB 3LLEA 1XFVO 1LA0A 4ORBB 4L9MA 2L5XB 3SIBA 2KI6C 1MUXA 3K1EA 2Q91A 2BCAA 3VB1A 1XFYO 1W9ZA 1IRJA 1SKTA 2HETA 1CLLA 2HPSA 3D0YB 3I5GB 1CNPA 1TUZA 4IJ7A 5I2QA 3DYEA 1PSRA 1JFKA 2BKIB 2KOTA 3D75A 1V1GA 4MZLA 1IQ5A 2K61A 4GGFC 5AXIA 2OS8C 1LVCD 2WCBA 3IQOA 4GUKA 1FI6A 1MHOA 2JU0A 4A4BA 2P70A 1YUSA 3L4LA 4PHKA 3FE9A 2MAZA 1EL4A 1M31A 2I7AA 4MEWA 4WRIA 1IJ5A 2QPTA 2OTGB 2JZIA 1FBVA 3L4AA 2PASA 1N65A 1NX0A 3TDUA 1J55A 1JUOA 1W7JB 1SYMA 2KLEA 3NSKA 3PN7C 2WCEA 2ZRTA 1UHNA 3CABA 3D77A 1AP4A 2LMVA 1QX7A 1KSMA 1B8CA 3KEVA 4GFTA 2WCJA 4N1GA 1UP5A 2WCLA 1T14A 3C1VA 3CDNA 1QVIZ 2L5YA 5ER5A 1NWDA 4ORAB 3CGAA 3JTDB 5K89A 1NCXA 4YGDB 3EVVA 2KBMA 3LL8B 3I5HC 3R1OA 4I5NB 1YUTA 3RM1A 3TUYC 1L7ZA 1DEKA 4MRYA 5I2OA 4I5KA 5CSJA 1DQEA 2BCBA 1K9UA 1B9AA 1EH2A 1UURA 2JOJA 3BOWB 1SL9A 2KQ6A 2RGIA 3B6XA 1DF0A 2LLTA 5JJGA 3CZ0A 1K95A 1RROA 3ICBA 1XYDA 4M2PA 2ERBA 1BU3A 2LCPA 4JWQA 4C0JA 2KFHA 2QDIA 2LANA 3BXKA 4ZCUA 3PATA 1DJHA 2K7CA 1MWNA 2LUCA 1RFJA 2MBXA 1XVJA 1EJ3A 2KI4C 2KQYA 4INXA 1XFWO 2NZ0A 3AKAA 1JF2A 1CFDA 1K96A 1OMDA 1TNWA 2M7NA 1F8HA 2JT0A 4JKTA 2JNFA 2JPTA 1OOFA 2MRDA 3OP0A 5ER4X 4MSPA 5FI2A 1SBJA 1YRTB 1DJGA 2Y1NA 1NYAA 1YTZC 5B8IB 1OOHA 5FI6A 1U5IB 3DVJA 1OQPA 4I5JA 4AQJA 1BR1B 1CKKA 1PSBA 3EK4A 2L4HA 4DS7A 1DT7B 1PRWA 1YVHA 3BFBA 2M8UA 1NIWA 4HRGA 1J1EA 3CWGA 5HKZA 1JFJA 1DJWA 2H61A 3EVRA 1R2UA 1OSAA 3LCPC 1ZMZA 1JF0A 1OW4A 1S6IA 1F4OA 1NCZA 3AKBA 4FTGA 3SG2A 2FCDA 4BY4A 1FI5A 1YVLA 1Y1AA 2H8VA 4MRXA 5FI7A 4PHJA 5I2LA 1DC1A 1SPYA 1IG5A 2VRGA 4MLWA 1XFUO 1D1OA 1YX7A 1TNPA 2MLEC 1DGVA 1MQ1A 4IL1A 1KFUS 2EC6C 3M0WA 1OE9B 1GGWA 3DXLA 5HLVA 3BQ3A 4GAOA 1XFXO 1XO5A 2COLB 4PALA 1AJ5A 2ISDA 3SG4A 1TNQA 1DJXA 2G9BA 4QJ4B 2AMIA 1WRLA 1KQMC 3FWCA 2F8PA 2CBLA 4NDBA 1UHJA 3BFHA 3D0YA 4R1EA 4DCKA 1Z2CB 1IIOA 1PVBA 1X02A 3SG5A 1CMFA 4YRUA 3CZ2A 3SS3A 3CR4X 2JXLA 2HF5A 3WHUB 2JWWA 3VRRA 1CFCA 4DUQA 2LP3A 3D10A 5HKWA 3BUMB 2HQWA 5IBWA 2KGRA 3O4YA 1KK7Z 3I5IC 3S0AA 3TZ1A 3D74A 2P71A 1F71A 2KGBC 5D69A 1WY9A 5KTYA 1IQ3A 2WCKA 3EVUA 4PHMA 3S0EA 2EC6B 2FJYA 3HCMA 2SASA 5F6TA 4WQ3A 3EG5B 5GQQC 1SSEB 1BJFA 1SCMC 1TWOA 4ZCVA 4DRWA 2BECA 2M97A 4NDCA 4CIDA 1A29A 1SR6C 1B7TY 1KQMB 1XFZO 3PM2A 5KU1A 2NCOA 3SJSA 1QATA 5HL1A 1ALVA 2LMTA 3GK2A 3IF7A 4C0LA 2KSPA 2WCMA 1M46A 1PK0D 4YI8A 1G33A 2I94A 2TN4A 1DMOA 1OMRA 1NCYA 1PALA 2F33A 2WC5A 4GGFA 4N5XA 2L2EA 2H2KA 4P2YB 3GK1A 4M2QA 5AFPA 2YGUA 2FOTA 3TDIA 1CMGA 2BE4A 1UUSA 3I5FC 1HQVA 1NSHA 4HSZA 5AANA 1R6PA 3BOWA 4YGCB 1EG3A 1F70A 2JTTA 3TDZA 1A03A 1WRKA 1YR5A 4C0KA 4GGNA 1SCMB 1QLKA 1FPWA 4GPLB 3VRPA 3E3RA 4TNCA 2M29A 2K0JA 2BCXA 5EL2A 2Y1MA 5I94A 3S0DA 1EXRA 1J7RA 3S0GA 1DGUA 3CS1A 5G08A 2QEVA 3QMEA 4PE7A 1IH0A 3PJIA 3BJHA 3DF0B 2OS8B 1NX3A 2NCPA 1UWOA 2KBIA 2F2PA 1E8AA 1K94A 1TCFA 3NHIA 1GM0A 1U5IA 2M9GA 2BKHB 3I5FB 2BBNA 2I18A 3CYZA 5JOLA 3VRQA 5CSNA 3GK4X 3LK0A 1DELA 2Y4QA 2BBMA 1ZFSA 3KF9A 2QEOA 5AERA 4YGAA 1DJIA 5HYDA 3PN7B 2M1UA 1K2HA 4GNKB 1KFXL 4MN0A 4WQ2A 3A4UB 1Y1UA 1CFPA 3PALA 2WORA 1NUBA 4PCWA 3B86A 2FCEA 3AAKA 3UO9A 3BYAA 3OX6A 2KAYA 3O78A 3OB2B 1FF1A 1QIVA 3IVTA 1GJYA 1S6JA 3JVTC 1VRKA 5CSIA 2BE6A 1CM4A 3IQQA 2QEBA 3O6BA 3QRXA 3I5HB 2JNXA 3TUYB 4OR9B 1AHRA 2GV5A 3RLZA 1QX5B 4PT1A 1N2DA 2KI6D 2LP2A 1B8RA 2BAPA 1XA5A 3B7AA 1OMVA 2A4JA 3CLNA 4OV2A 1CDLA 3GOFA 2JULA 1CDPA 4YGEB 4OVNF 3A8RA 1LKJA 4OKHA 4CFRA 1K90D 4ETOA 1ALWA 2Q4UA 1AJ4A 2CNPA 2LLUA 1MR8A 2ZNEA 4PE0A 1A75A 2ZKMX 2NLNA 2KAVA 4FQTA 2LVVA 2KAXA 3OHMB 1TTXA 4AOMA 3PSRA 4FQOA 1CDNA 2KNEA 1TNXA 3HX4A 3OB1B 2PALA 4QJ3B 1S26D 3KHEA 2KI4B 5CPVA 3SS4A 1RWYA 3D73A 3JVTB 5TNCA 1QLSA 1OZOA 2CT9A 2JTZA 1TOPA 1RTP1 3WXAA 1XK4A 1CDMA 3DVEA 3NGVA 4U8DA 4AQIA 1BLQA 2CTNA 1NX2A 3B88A 3UNWA 3AAJA 2L98A 3ZWHA 3TS5C 1SMGA 1LINA 1KFUL 1B4CA 3Q8IA 4D1EA 1IWQA 1WLZA 1B8LA 3WHTB 4JQ0D 1RK9A 2HQ8A 3R72A 1IKUA 4ICBA 1A75B 2PSRA 2KLDA 3CZ1A 4MZJA 4XJKB 3NSLA 2WNDA 3NSOA 3R1PA 3S0FA 2FJUB 3BUWB 1SL7A 3NSIA 3OBVA 4P5OE 1MXEA 1HT9A 1L2OC 4INWA 5I8NA 2KFGA 1UHHA 1CM1A 2F3YA 1PULA 4F0ZB 3I5GC 2E30A 3FIAA 1BR4B 3BUNB 2M7LA 2K7BA 1K9KA 5DKQA 1N0YA 4KYNA 2BNXA 2PRUA 2PVBA 3PM8A 3TS5B 1LA3A 2F3ZA 2M1KB 1W7IB 1JSAA 1QX2A 1Z4HA 1C3ZA 4Q04A 4F7FA 1SY9A 2AUCA 1J7PA 4CFQA 2M49B 3DF0A 2IS9A 2OPOA 1BODA 2JC2A 3EK8A 1Q80A 2JT3A 3NHTA 4XYNA 3MSEB 2KHNA 4JPZB 1H4BA 2MJWB 2B1UA 1DJZA 3I5IB 1QVIY 1LXFC 3SS5A 1TN4A 3DD4A 1EG4A 1K8UA 3EKHA 1M45A 1QV0A 4BY5A 1L2OB 4QJ5B 2R2IA 1JC2A 3F45A 1AK8A 3V2LA 4A4CA 1CTRA 5HKYA 3CR2A 1G8IA 1SR6B 1MF8B 3JTDC 3DZTA 2JPOA 4MZKA 4UPGA 1C7VA 4YI9A 3VROA 4I5LB 3CZTX 2M0RA 1K9PA 5HLOA 2V53A 2MLFC 2MA2A 2NXQA 2LV7A 3BUXB 3PLFB 5FYXA 2DOQA 1KK8C 4MBEA 1IJ6A 3CTNA 4CPVA 1JBAA 1B7TZ 5D3OA 1F55A 5D7FA 1M39A 4USLA 1WRZA 1IGVA 1ZOTB 3SG7A 1SW8A 1YX8A 1YURA 4ORCB 1GQMA 1KQVA 1CLMA 4HRHA 2GGZA 2Y5IA 2JXCA 1BT6A 3FWBA 1B1GA 5CSFA 1TIZA 4YBHB 4JD9A 1QV1A 2L51A 1QJTA 3NXAA 1Y1XA 3O4XA 5DKNA 2L2CA 2K8MB 1NPQA 3K21A 3KPXA 1QWVA 4PHNA 1J7QA 1KWOC 4GBAA 1NP8A 4M2OA 1F54A 2LVJA 4NDDA 3PFVA 2LLSA 1OOJA 2QEHA 1BMOA 1M63B 2LVKA 2O5GA 1KFXS 2G2BA 1NX1A 3WNXB 2WC8A 2JQ6A 1KK8B 1S3PA 2M3WA 3D76A 4PDZA 1OOIX 1ZUZA 2QACA 1AUIB 1S36A 4HREE 3RZSA 1TCOB 1SK6D 2P6BB 4PE1A 1SRAA 2L50A 1A4PA 2CXJA 1YRUB 3FS7A 1FW4A 1H8BA 1QASA 2I2RE 3KO0A 2KFFA 4NQGA 1RECA 1CB1A 2E6WA 3B87A 4DIRA 5KSZA 1RJVA 4OZDA 2K7OA 4XJKA 1KWOB 3SG3A 3BUOB 2LC5A 2LNKA 1Y0VH 2GGMA 3DY9A 1QTXA 2KYCA 1OZSA 3OX5A 5DICA 2D8NA 1XFRA 1S5GY 1DVIA 3VRNA 1KK7Y 3R1VA 2JT8A 2ZFDA 4CLNA 1F4QA 1ORGA 1PVAA 1TRFA 1A2XA 1WLMA 2BL0C 2KYFA 2KPHA 1SL8A 1UHKA 2KDHA 2LE9B 2CCMA 2ZNDA 2ZRSA 2PMYA 1DF0B 1DTLA 2GTEA 2L4IA 2MHHA 1KSOA 2O60A 2ZN9A 5PALA 2WCFA 1QXPA 3FE6A 3S0BA 2H61C 5J3XA 1JWDA 2WOSA 1ODBA 2LVIA 1C3YA 4N1FA 1BG1A 1AVSA 1SCVA 5AEQA 1QS7A 3ZNIA 1K93D 2K2FA 3L47A 1WDCC 3LK1A 1J1DA 2WC6A 3D78A 3EKJA 3DVMA 4E68A 3H4SE 2AAOA 1QIWA 1XK4C 2WCHA 1P28A 2K7DA 5DKRA 3O2PA 2L0PA 1S6CA 2F2OA 4MVFA 2LAPA 1UHIA 1CLBA 2LHLA 2EGDA 1S1EA 2BL0B 2K2AA 1B47A 2PQLA 2PYQA 1C7WA 1OOGA 3SIAA 1C07A 1DJYA 2LM5A 2JRFA 2LMUA 1BOCA 1J7OA 1MXLC 1YUUA 1ZACA 3EK7A 3VGOA 2ZN8A 1S5GZ 1BF5A 2LUXA 1TUJA 3DVKA 3OGNA 1V1FA 3BFAA 1KCYA 1CFFA 3N7HA 4OCIA 3SG6A 2K60A 2LHIA 2SCPA 1Y6WA 1LS8A 4PE4A 3CR5X 1G4YR 2EHBA 2OTGC
chains in the Genus database with same CATH topology
1SNLA 1GGZA 4YGBB 5BPJA 1WDCB 3LLEA 1XFVO 1LA0A 4ORBB 4L9MA 2L5XB 3SIBA 2KI6C 1MUXA 2Q91A 2BCAA 1XFYO 1IRJA 1SKTA 2HETA 1CLLA 2HPSA 3D0YB 3I5GB 1CNPA 5I2QA 1PSRA 1JFKA 2BKIB 2KOTA 4MZLA 1V1GA 1IQ5A 2K61A 4GGFC 5AXIA 2OS8C 1LVCD 2WCBA 3IQOA 4GUKA 1FI6A 1MHOA 2JU0A 4A4BA 1YUSA 4PHKA 2MAZA 1EL4A 1M31A 2I7AA 4MEWA 4WRIA 1IJ5A 2QPTA 2OTGB 2JZIA 1FBVA 2PASA 1N65A 1NX0A 3TDUA 1J55A 1JUOA 1W7JB 1SYMA 3NSKA 3PN7C 2WCEA 2ZRTA 1UHNA 1AP4A 2LMVA 1QX7A 1KSMA 1B8CA 3KEVA 4GFTA 4N1GA 1UP5A 3C1VA 1QVIZ 5ER5A 1NWDA 4ORAB 3CGAA 3JTDB 5K89A 1NCXA 4YGDB 3EVVA 2KBMA 3LL8B 3I5HC 4I5NB 3RM1A 1YUTA 3TUYC 1L7ZA 4MRYA 5I2OA 4I5KA 5CSJA 2BCBA 1K9UA 1B9AA 1EH2A 1UURA 2JOJA 3BOWB 1SL9A 2KQ6A 2RGIA 1DF0A 2LLTA 5JJGA 1K95A 1RROA 3ICBA 1XYDA 4M2PA 1BU3A 2LCPA 4JWQA 4C0JA 2KFHA 2LANA 3BXKA 4ZCUA 3PATA 1DJHA 2K7CA 1MWNA 2LUCA 1RFJA 2MBXA 1XVJA 1EJ3A 2KI4C 2KQYA 1XFWO 2NZ0A 3AKAA 1JF2A 1CFDA 1K96A 1OMDA 1TNWA 2M7NA 1F8HA 2JT0A 5ER4X 2JNFA 2JPTA 2MRDA 3OP0A 4MSPA 1SBJA 1YRTB 1DJGA 2Y1NA 1NYAA 1YTZC 5B8IB 1U5IB 3DVJA 1OQPA 4I5JA 4AQJA 1BR1B 1CKKA 1PSBA 3EK4A 2L4HA 4DS7A 1DT7B 1PRWA 1YVHA 2M8UA 1NIWA 4HRGA 1J1EA 3CWGA 5HKZA 1JFJA 1DJWA 2H61A 3EVRA 1R2UA 1OSAA 3LCPC 1ZMZA 1JF0A 1S6IA 1F4OA 1NCZA 3AKBA 4FTGA 3SG2A 2FCDA 4BY4A 1FI5A 1YVLA 1Y1AA 4MRXA 4PHJA 5I2LA 1SPYA 1IG5A 2VRGA 4MLWA 1XFUO 1D1OA 1YX7A 1TNPA 2MLEC 1DGVA 1MQ1A 4IL1A 1KFUS 2EC6C 3M0WA 1OE9B 1GGWA 5HLVA 3BQ3A 4GAOA 1XFXO 1XO5A 2COLB 4PALA 1AJ5A 2ISDA 3SG4A 1TNQA 1DJXA 2G9BA 4QJ4B 2AMIA 1WRLA 1KQMC 3FWCA 2F8PA 2CBLA 4NDBA 1UHJA 3D0YA 4R1EA 4DCKA 1PVBA 1X02A 3SG5A 1CMFA 4YRUA 3CR4X 2JXLA 2HF5A 3WHUB 2JWWA 3VRRA 1CFCA 4DUQA 2LP3A 3D10A 5HKWA 3BUMB 2HQWA 5IBWA 2KGRA 3O4YA 1KK7Z 3I5IC 3TZ1A 1F71A 2KGBC 5D69A 1WY9A 5KTYA 1IQ3A 3EVUA 4PHMA 2EC6B 5F6TA 3HCMA 2SASA 4WQ3A 5GQQC 4ZCVA 1BJFA 1SCMC 4DRWA 2BECA 2M97A 4NDCA 4CIDA 1A29A 1SR6C 1B7TY 1KQMB 1XFZO 5KU1A 2NCOA 3SJSA 1QATA 1ALVA 2LMTA 3GK2A 3IF7A 4C0LA 2KSPA 1M46A 1PK0D 4YI8A 1G33A 2I94A 2TN4A 1DMOA 1OMRA 1NCYA 1PALA 2F33A 4GGFA 4N5XA 2L2EA 2H2KA 4P2YB 3GK1A 4M2QA 5AFPA 2FOTA 3TDIA 1CMGA 2BE4A 1UUSA 3I5FC 1HQVA 1NSHA 4HSZA 5AANA 1R6PA 3BOWA 4YGCB 1EG3A 1F70A 2JTTA 3TDZA 1A03A 1WRKA 1YR5A 4C0KA 4GGNA 1SCMB 1QLKA 1FPWA 4GPLB 3VRPA 3E3RA 4TNCA 2M29A 2K0JA 2BCXA 2Y1MA 1EXRA 1J7RA 1DGUA 3CS1A 5G08A 4PE7A 1IH0A 3DF0B 2OS8B 1NX3A 2NCPA 1UWOA 2KBIA 2F2PA 1E8AA 1K94A 1TCFA 1U5IA 2M9GA 2BKHB 3I5FB 2BBNA 2I18A 5JOLA 3VRQA 5CSNA 3GK4X 3LK0A 2Y4QA 2BBMA 1ZFSA 3KF9A 5AERA 4YGAA 1DJIA 5HYDA 3PN7B 2M1UA 1K2HA 4GNKB 1KFXL 4MN0A 4WQ2A 3A4UB 1Y1UA 1CFPA 3PALA 2WORA 1NUBA 4PCWA 2FCEA 3AAKA 3BYAA 3OX6A 2KAYA 3O78A 3OB2B 1FF1A 1QIVA 3JVTC 1GJYA 1S6JA 1VRKA 5CSIA 2BE6A 1CM4A 3IQQA 3O6BA 3QRXA 3TUYB 3I5HB 2JNXA 4OR9B 1AHRA 2GV5A 3RLZA 1QX5B 1N2DA 2KI6D 2LP2A 1B8RA 1XA5A 1OMVA 2A4JA 3CLNA 4OV2A 1CDLA 3GOFA 2JULA 1CDPA 4YGEB 4OVNF 3A8RA 1LKJA 4OKHA 4CFRA 1K90D 4ETOA 1ALWA 2Q4UA 1AJ4A 2CNPA 2LLUA 1MR8A 2ZNEA 4PE0A 1A75A 2ZKMX 2NLNA 2KAVA 2LVVA 2KAXA 3OHMB 1TTXA 4AOMA 3PSRA 4FQOA 1CDNA 2KNEA 1TNXA 3HX4A 3OB1B 2PALA 4QJ3B 1S26D 3KHEA 2KI4B 5CPVA 1RWYA 5TNCA 3JVTB 1QLSA 1OZOA 2CT9A 2JTZA 1TOPA 1RTP1 3WXAA 1CDMA 1XK4A 3DVEA 4U8DA 4AQIA 1BLQA 2CTNA 1NX2A 3AAJA 2L98A 3ZWHA 3TS5C 1SMGA 1LINA 1KFUL 1B4CA 4D1EA 1IWQA 1WLZA 1B8LA 3WHTB 4JQ0D 1RK9A 2HQ8A 1IKUA 4ICBA 1A75B 2PSRA 4MZJA 4XJKB 3NSLA 2WNDA 3NSOA 2FJUB 3BUWB 1SL7A 3NSIA 4P5OE 1MXEA 1HT9A 1L2OC 5I8NA 2KFGA 1UHHA 1CM1A 2F3YA 1PULA 4F0ZB 3I5GC 2E30A 3FIAA 1BR4B 3BUNB 2M7LA 2K7BA 1K9KA 5DKQA 1N0YA 2PVBA 2PRUA 3PM8A 3TS5B 1LA3A 2F3ZA 2M1KB 1W7IB 1JSAA 1QX2A 4Q04A 1SY9A 2AUCA 1J7PA 4CFQA 2M49B 3DF0A 2IS9A 2OPOA 1BODA 2JC2A 3EK8A 1Q80A 2JT3A 4XYNA 3MSEB 2KHNA 4JPZB 1H4BA 2MJWB 2B1UA 1DJZA 3I5IB 1QVIY 1LXFC 1TN4A 3DD4A 1EG4A 1K8UA 3EKHA 1M45A 1QV0A 4BY5A 1L2OB 4QJ5B 2R2IA 1JC2A 3F45A 1AK8A 4A4CA 1CTRA 5HKYA 3CR2A 1G8IA 1SR6B 1MF8B 3JTDC 4MZKA 4UPGA 1C7VA 4YI9A 3VROA 4I5LB 3CZTX 2M0RA 1K9PA 5HLOA 2V53A 2MLFC 2MA2A 2NXQA 2LV7A 3BUXB 3PLFB 5FYXA 2DOQA 1KK8C 4MBEA 1IJ6A 3CTNA 4CPVA 1JBAA 1B7TZ 1F55A 5D7FA 1M39A 4USLA 1WRZA 1IGVA 1ZOTB 3SG7A 1SW8A 1YX8A 1YURA 4ORCB 1GQMA 1KQVA 1CLMA 4HRHA 2GGZA 2Y5IA 2JXCA 1BT6A 3FWBA 1B1GA 5CSFA 1TIZA 4YBHB 1QV1A 2L51A 1QJTA 3NXAA 1Y1XA 5DKNA 2K8MB 1NPQA 3K21A 3KPXA 4PHNA 1J7QA 1KWOC 4M2OA 1NP8A 1F54A 2LVJA 4NDDA 3PFVA 2LLSA 1OOJA 1BMOA 1M63B 2LVKA 2O5GA 1KFXS 2G2BA 1NX1A 3WNXB 2WC8A 2JQ6A 1KK8B 1S3PA 2M3WA 4PDZA 1ZUZA 2QACA 1AUIB 1S36A 4HREE 1TCOB 1SK6D 2P6BB 4PE1A 1SRAA 2L50A 1A4PA 2CXJA 1YRUB 3FS7A 1FW4A 1H8BA 1QASA 2I2RE 3KO0A 2KFFA 4NQGA 1RECA 1CB1A 2E6WA 4DIRA 5KSZA 1RJVA 2K7OA 4XJKA 1KWOB 3SG3A 3BUOB 2LC5A 2LNKA 1Y0VH 2GGMA 1QTXA 2KYCA 1OZSA 3OX5A 2D8NA 1S5GY 1DVIA 3VRNA 1KK7Y 2JT8A 2ZFDA 4CLNA 1F4QA 1PVAA 1TRFA 1A2XA 1WLMA 2BL0C 2KYFA 2LE9B 1SL8A 1UHKA 2KDHA 2ZNDA 2CCMA 2ZRSA 4GBAA 2PMYA 1DF0B 1DTLA 2MHHA 2L4IA 2O60A 1KSOA 2ZN9A 5PALA 2WCFA 1QXPA 2H61C 5J3XA 1JWDA 2WOSA 1ODBA 2LVIA 4N1FA 1BG1A 1AVSA 1SCVA 5AEQA 1QS7A 3ZNIA 1K93D 2K2FA 1WDCC 3LK1A 1J1DA 3EKJA 3DVMA 4E68A 3H4SE 2AAOA 1QIWA 1XK4C 5DKRA 2K7DA 3O2PA 2L0PA 1S6CA 2F2OA 4MVFA 2LAPA 1UHIA 1CLBA 2LHLA 2EGDA 1S1EA 2BL0B 2K2AA 1B47A 1C07A 1C7WA 3SIAA 1DJYA 2LM5A 2JRFA 2LMUA 1BOCA 1J7OA 1MXLC 1YUUA 1ZACA 3EK7A 3VGOA 2ZN8A 1S5GZ 1BF5A 2LUXA 3DVKA 1V1FA 1KCYA 1CFFA 4OCIA 3SG6A 2LHIA 2SCPA 1Y6WA 4PE4A 3CR5X 1G4YR 2EHBA 2OTGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNL A;  1GGZ A;  4YGB B;  5BPJ A;  1WDC B;  3LLE A;  1XFV O;  1LA0 A;  4ORB B;  4L9M A;  2L5X B;  3SIB A;  2KI6 C;  1MUX A;  2Q91 A;  2BCA A;  1XFY O;  1IRJ A;  1SKT A;  2HET A;  1CLL A;  2HPS A;  3D0Y B;  3I5G B;  1CNP A;  5I2Q A;  1PSR A;  1JFK A;  2BKI B;  2KOT A;  4MZL A;  1V1G A;  1IQ5 A;  2K61 A;  4GGF C;  5AXI A;  2OS8 C;  1LVC D;  2WCB A;  3IQO A;  4GUK A;  1FI6 A;  1MHO A;  2JU0 A;  4A4B A;  1YUS A;  4PHK A;  2MAZ A;  1EL4 A;  1M31 A;  2I7A A;  4MEW A;  4WRI A;  1IJ5 A;  2QPT A;  2OTG B;  2JZI A;  1FBV A;  2PAS A;  1N65 A;  1NX0 A;  3TDU A;  1J55 A;  1JUO A;  1W7J B;  1SYM A;  3NSK A;  3PN7 C;  2WCE A;  2ZRT A;  1UHN A;  1AP4 A;  2LMV A;  1QX7 A;  1KSM A;  1B8C A;  3KEV A;  4GFT A;  4N1G A;  1UP5 A;  3C1V A;  1QVI Z;  5ER5 A;  1NWD A;  4ORA B;  3CGA A;  3JTD B;  5K89 A;  1NCX A;  4YGD B;  3EVV A;  2KBM A;  3LL8 B;  3I5H C;  4I5N B;  3RM1 A;  1YUT A;  3TUY C;  1L7Z A;  4MRY A;  5I2O A;  4I5K A;  5CSJ A;  2BCB A;  1K9U A;  1B9A A;  1EH2 A;  1UUR A;  2JOJ A;  3BOW B;  1SL9 A;  2KQ6 A;  2RGI A;  1DF0 A;  2LLT A;  5JJG A;  1K95 A;  1RRO A;  3ICB A;  1XYD A;  4M2P A;  1BU3 A;  2LCP A;  4JWQ A;  4C0J A;  2KFH A;  2LAN A;  3BXK A;  4ZCU A;  3PAT A;  1DJH A;  2K7C A;  1MWN A;  2LUC A;  1RFJ A;  2MBX A;  1XVJ A;  1EJ3 A;  2KI4 C;  2KQY A;  1XFW O;  2NZ0 A;  3AKA A;  1JF2 A;  1CFD A;  1K96 A;  1OMD A;  1TNW A;  2M7N A;  1F8H A;  2JT0 A;  5ER4 X;  2JNF A;  2JPT A;  2MRD A;  3OP0 A;  4MSP A;  1SBJ A;  1YRT B;  1DJG A;  2Y1N A;  1NYA A;  1YTZ C;  5B8I B;  1U5I B;  3DVJ A;  1OQP A;  4I5J A;  4AQJ A;  1BR1 B;  1CKK A;  1PSB A;  3EK4 A;  2L4H A;  4DS7 A;  1DT7 B;  1PRW A;  1YVH A;  2M8U A;  1NIW A;  4HRG A;  1J1E A;  3CWG A;  5HKZ A;  1JFJ A;  1DJW A;  2H61 A;  3EVR A;  1R2U A;  1OSA A;  3LCP C;  1ZMZ A;  1JF0 A;  1S6I A;  1F4O A;  1NCZ A;  3AKB A;  4FTG A;  3SG2 A;  2FCD A;  4BY4 A;  1FI5 A;  1YVL A;  1Y1A A;  4MRX A;  4PHJ A;  5I2L A;  1SPY A;  1IG5 A;  2VRG A;  4MLW A;  1XFU O;  1D1O A;  1YX7 A;  1TNP A;  2MLE C;  1DGV A;  1MQ1 A;  4IL1 A;  1KFU S;  2EC6 C;  3M0W A;  1OE9 B;  1GGW A;  5HLV A;  3BQ3 A;  4GAO A;  1XFX O;  1XO5 A;  2COL B;  4PAL A;  1AJ5 A;  2ISD A;  3SG4 A;  1TNQ A;  1DJX A;  2G9B A;  4QJ4 B;  2AMI A;  1WRL A;  1KQM C;  3FWC A;  2F8P A;  2CBL A;  4NDB A;  1UHJ A;  3D0Y A;  4R1E A;  4DCK A;  1PVB A;  1X02 A;  3SG5 A;  1CMF A;  4YRU A;  3CR4 X;  2JXL A;  2HF5 A;  3WHU B;  2JWW A;  3VRR A;  1CFC A;  4DUQ A;  2LP3 A;  3D10 A;  5HKW A;  3BUM B;  2HQW A;  5IBW A;  2KGR A;  3O4Y A;  1KK7 Z;  3I5I C;  3TZ1 A;  1F71 A;  2KGB C;  5D69 A;  1WY9 A;  5KTY A;  1IQ3 A;  3EVU A;  4PHM A;  2EC6 B;  5F6T A;  3HCM A;  2SAS A;  4WQ3 A;  5GQQ C;  4ZCV A;  1BJF A;  1SCM C;  4DRW A;  2BEC A;  2M97 A;  4NDC A;  4CID A;  1A29 A;  1SR6 C;  1B7T Y;  1KQM B;  1XFZ O;  5KU1 A;  2NCO A;  3SJS A;  1QAT A;  1ALV A;  2LMT A;  3GK2 A;  3IF7 A;  4C0L A;  2KSP A;  1M46 A;  1PK0 D;  4YI8 A;  1G33 A;  2I94 A;  2TN4 A;  1DMO A;  1OMR A;  1NCY A;  1PAL A;  2F33 A;  4GGF A;  4N5X A;  2L2E A;  2H2K A;  4P2Y B;  3GK1 A;  4M2Q A;  5AFP A;  2FOT A;  3TDI A;  1CMG A;  2BE4 A;  1UUS A;  3I5F C;  1HQV A;  1NSH A;  4HSZ A;  5AAN A;  1R6P A;  3BOW A;  4YGC B;  1EG3 A;  1F70 A;  2JTT A;  3TDZ A;  1A03 A;  1WRK A;  1YR5 A;  4C0K A;  4GGN A;  1SCM B;  1QLK A;  1FPW A;  4GPL B;  3VRP A;  3E3R A;  4TNC A;  2M29 A;  2K0J A;  2BCX A;  2Y1M A;  1EXR A;  1J7R A;  1DGU A;  3CS1 A;  5G08 A;  4PE7 A;  1IH0 A;  3DF0 B;  2OS8 B;  1NX3 A;  2NCP A;  1UWO A;  2KBI A;  2F2P A;  1E8A A;  1K94 A;  1TCF A;  1U5I A;  2M9G A;  2BKH B;  3I5F B;  2BBN A;  2I18 A;  5JOL A;  3VRQ A;  5CSN A;  3GK4 X;  3LK0 A;  2Y4Q A;  2BBM A;  1ZFS A;  3KF9 A;  5AER A;  4YGA A;  1DJI A;  5HYD A;  3PN7 B;  2M1U A;  1K2H A;  4GNK B;  1KFX L;  4MN0 A;  4WQ2 A;  3A4U B;  1Y1U A;  1CFP A;  3PAL A;  2WOR A;  1NUB A;  4PCW A;  2FCE A;  3AAK A;  3BYA A;  3OX6 A;  2KAY A;  3O78 A;  3OB2 B;  1FF1 A;  1QIV A;  3JVT C;  1GJY A;  1S6J A;  1VRK A;  5CSI A;  2BE6 A;  1CM4 A;  3IQQ A;  3O6B A;  3QRX A;  3TUY B;  3I5H B;  2JNX A;  4OR9 B;  1AHR A;  2GV5 A;  3RLZ A;  1QX5 B;  1N2D A;  2KI6 D;  2LP2 A;  1B8R A;  1XA5 A;  1OMV A;  2A4J A;  3CLN A;  4OV2 A;  1CDL A;  3GOF A;  2JUL A;  1CDP A;  4YGE B;  4OVN F;  3A8R A;  1LKJ A;  4OKH A;  4CFR A;  1K90 D;  4ETO A;  1ALW A;  2Q4U A;  1AJ4 A;  2CNP A;  2LLU A;  1MR8 A;  2ZNE A;  4PE0 A;  1A75 A;  2ZKM X;  2NLN A;  2KAV A;  2LVV A;  2KAX A;  3OHM B;  1TTX A;  4AOM A;  3PSR A;  4FQO A;  1CDN A;  2KNE A;  1TNX A;  3HX4 A;  3OB1 B;  2PAL A;  4QJ3 B;  1S26 D;  3KHE A;  2KI4 B;  5CPV A;  1RWY A;  5TNC A;  3JVT B;  1QLS A;  1OZO A;  2CT9 A;  2JTZ A;  1TOP A;  1RTP 1;  3WXA A;  1CDM A;  1XK4 A;  3DVE A;  4U8D A;  4AQI A;  1BLQ A;  2CTN A;  1NX2 A;  3AAJ A;  2L98 A;  3ZWH A;  3TS5 C;  1SMG A;  1LIN A;  1KFU L;  1B4C A;  4D1E A;  1IWQ A;  1WLZ A;  1B8L A;  3WHT B;  4JQ0 D;  1RK9 A;  2HQ8 A;  1IKU A;  4ICB A;  1A75 B;  2PSR A;  4MZJ A;  4XJK B;  3NSL A;  2WND A;  3NSO A;  2FJU B;  3BUW B;  1SL7 A;  3NSI A;  4P5O E;  1MXE A;  1HT9 A;  1L2O C;  5I8N A;  2KFG A;  1UHH A;  1CM1 A;  2F3Y A;  1PUL A;  4F0Z B;  3I5G C;  2E30 A;  3FIA A;  1BR4 B;  3BUN B;  2M7L A;  2K7B A;  1K9K A;  5DKQ A;  1N0Y A;  2PVB A;  2PRU A;  3PM8 A;  3TS5 B;  1LA3 A;  2F3Z A;  2M1K B;  1W7I B;  1JSA A;  1QX2 A;  4Q04 A;  1SY9 A;  2AUC A;  1J7P A;  4CFQ A;  2M49 B;  3DF0 A;  2IS9 A;  2OPO A;  1BOD A;  2JC2 A;  3EK8 A;  1Q80 A;  2JT3 A;  4XYN A;  3MSE B;  2KHN A;  4JPZ B;  1H4B A;  2MJW B;  2B1U A;  1DJZ A;  3I5I B;  1QVI Y;  1LXF C;  1TN4 A;  3DD4 A;  1EG4 A;  1K8U A;  3EKH A;  1M45 A;  1QV0 A;  4BY5 A;  1L2O B;  4QJ5 B;  2R2I A;  1JC2 A;  3F45 A;  1AK8 A;  4A4C A;  1CTR A;  5HKY A;  3CR2 A;  1G8I A;  1SR6 B;  1MF8 B;  3JTD C;  4MZK A;  4UPG A;  1C7V A;  4YI9 A;  3VRO A;  4I5L B;  3CZT X;  2M0R A;  1K9P A;  5HLO A;  2V53 A;  2MLF C;  2MA2 A;  2NXQ A;  2LV7 A;  3BUX B;  3PLF B;  5FYX A;  2DOQ A;  1KK8 C;  4MBE A;  1IJ6 A;  3CTN A;  4CPV A;  1JBA A;  1B7T Z;  1F55 A;  5D7F A;  1M39 A;  4USL A;  1WRZ A;  1IGV A;  1ZOT B;  3SG7 A;  1SW8 A;  1YX8 A;  1YUR A;  4ORC B;  1GQM A;  1KQV A;  1CLM A;  4HRH A;  2GGZ A;  2Y5I A;  2JXC A;  1BT6 A;  3FWB A;  1B1G A;  5CSF A;  1TIZ A;  4YBH B;  1QV1 A;  2L51 A;  1QJT A;  3NXA A;  1Y1X A;  5DKN A;  2K8M B;  1NPQ A;  3K21 A;  3KPX A;  4PHN A;  1J7Q A;  1KWO C;  4M2O A;  1NP8 A;  1F54 A;  2LVJ A;  4NDD A;  3PFV A;  2LLS A;  1OOJ A;  1BMO A;  1M63 B;  2LVK A;  2O5G A;  1KFX S;  2G2B A;  1NX1 A;  3WNX B;  2WC8 A;  2JQ6 A;  1KK8 B;  1S3P A;  2M3W A;  4PDZ A;  1ZUZ A;  2QAC A;  1AUI B;  1S36 A;  4HRE E;  1TCO B;  1SK6 D;  2P6B B;  4PE1 A;  1SRA A;  2L50 A;  1A4P A;  2CXJ A;  1YRU B;  3FS7 A;  1FW4 A;  1H8B A;  1QAS A;  2I2R E;  3KO0 A;  2KFF A;  4NQG A;  1REC A;  1CB1 A;  2E6W A;  4DIR A;  5KSZ A;  1RJV A;  2K7O A;  4XJK A;  1KWO B;  3SG3 A;  3BUO B;  2LC5 A;  2LNK A;  1Y0V H;  2GGM A;  1QTX A;  2KYC A;  1OZS A;  3OX5 A;  2D8N A;  1S5G Y;  1DVI A;  3VRN A;  1KK7 Y;  2JT8 A;  2ZFD A;  4CLN A;  1F4Q A;  1PVA A;  1TRF A;  1A2X A;  1WLM A;  2BL0 C;  2KYF A;  2LE9 B;  1SL8 A;  1UHK A;  2KDH A;  2ZND A;  2CCM A;  2ZRS A;  4GBA A;  2PMY A;  1DF0 B;  1DTL A;  2MHH A;  2L4I A;  2O60 A;  1KSO A;  2ZN9 A;  5PAL A;  2WCF A;  1QXP A;  2H61 C;  5J3X A;  1JWD A;  2WOS A;  1ODB A;  2LVI A;  4N1F A;  1BG1 A;  1AVS A;  1SCV A;  5AEQ A;  1QS7 A;  3ZNI A;  1K93 D;  2K2F A;  1WDC C;  3LK1 A;  1J1D A;  3EKJ A;  3DVM A;  4E68 A;  3H4S E;  2AAO A;  1QIW A;  1XK4 C;  5DKR A;  2K7D A;  3O2P A;  2L0P A;  1S6C A;  2F2O A;  4MVF A;  2LAP A;  1UHI A;  1CLB A;  2LHL A;  2EGD A;  1S1E A;  2BL0 B;  2K2A A;  1B47 A;  1C07 A;  1C7W A;  3SIA A;  1DJY A;  2LM5 A;  2JRF A;  2LMU A;  1BOC A;  1J7O A;  1MXL C;  1YUU A;  1ZAC A;  3EK7 A;  3VGO A;  2ZN8 A;  1S5G Z;  1BF5 A;  2LUX A;  3DVK A;  1V1F A;  1KCY A;  1CFF A;  4OCI A;  3SG6 A;  2LHI A;  2SCP A;  1Y6W A;  4PE4 A;  3CR5 X;  1G4Y R;  2EHB A;  2OTG C; 
#chains in the Genus database with same CATH topology
 1SNL A;  1GGZ A;  4YGB B;  5BPJ A;  3FE8 A;  1WDC B;  3LLE A;  1XFV O;  1LA0 A;  4ORB B;  4L9M A;  2L5X B;  3SIB A;  2KI6 C;  1MUX A;  3K1E A;  2Q91 A;  2BCA A;  3VB1 A;  1XFY O;  1W9Z A;  1IRJ A;  1SKT A;  2HET A;  1CLL A;  2HPS A;  3D0Y B;  3I5G B;  1CNP A;  1TUZ A;  4IJ7 A;  5I2Q A;  3DYE A;  1PSR A;  1JFK A;  2BKI B;  2KOT A;  3D75 A;  1V1G A;  4MZL A;  1IQ5 A;  2K61 A;  4GGF C;  5AXI A;  2OS8 C;  1LVC D;  2WCB A;  3IQO A;  4GUK A;  1FI6 A;  1MHO A;  2JU0 A;  4A4B A;  2P70 A;  1YUS A;  3L4L A;  4PHK A;  3FE9 A;  2MAZ A;  1EL4 A;  1M31 A;  2I7A A;  4MEW A;  4WRI A;  1IJ5 A;  2QPT A;  2OTG B;  2JZI A;  1FBV A;  3L4A A;  2PAS A;  1N65 A;  1NX0 A;  3TDU A;  1J55 A;  1JUO A;  1W7J B;  1SYM A;  2KLE A;  3NSK A;  3PN7 C;  2WCE A;  2ZRT A;  1UHN A;  3CAB A;  3D77 A;  1AP4 A;  2LMV A;  1QX7 A;  1KSM A;  1B8C A;  3KEV A;  4GFT A;  2WCJ A;  4N1G A;  1UP5 A;  2WCL A;  1T14 A;  3C1V A;  3CDN A;  1QVI Z;  2L5Y A;  5ER5 A;  1NWD A;  4ORA B;  3CGA A;  3JTD B;  5K89 A;  1NCX A;  4YGD B;  3EVV A;  2KBM A;  3LL8 B;  3I5H C;  3R1O A;  4I5N B;  1YUT A;  3RM1 A;  3TUY C;  1L7Z A;  1DEK A;  4MRY A;  5I2O A;  4I5K A;  5CSJ A;  1DQE A;  2BCB A;  1K9U A;  1B9A A;  1EH2 A;  1UUR A;  2JOJ A;  3BOW B;  1SL9 A;  2KQ6 A;  2RGI A;  3B6X A;  1DF0 A;  2LLT A;  5JJG A;  3CZ0 A;  1K95 A;  1RRO A;  3ICB A;  1XYD A;  4M2P A;  2ERB A;  1BU3 A;  2LCP A;  4JWQ A;  4C0J A;  2KFH A;  2QDI A;  2LAN A;  3BXK A;  4ZCU A;  3PAT A;  1DJH A;  2K7C A;  1MWN A;  2LUC A;  1RFJ A;  2MBX A;  1XVJ A;  1EJ3 A;  2KI4 C;  2KQY A;  4INX A;  1XFW O;  2NZ0 A;  3AKA A;  1JF2 A;  1CFD A;  1K96 A;  1OMD A;  1TNW A;  2M7N A;  1F8H A;  2JT0 A;  4JKT A;  2JNF A;  2JPT A;  1OOF A;  2MRD A;  3OP0 A;  5ER4 X;  4MSP A;  5FI2 A;  1SBJ A;  1YRT B;  1DJG A;  2Y1N A;  1NYA A;  1YTZ C;  5B8I B;  1OOH A;  5FI6 A;  1U5I B;  3DVJ A;  1OQP A;  4I5J A;  4AQJ A;  1BR1 B;  1CKK A;  1PSB A;  3EK4 A;  2L4H A;  4DS7 A;  1DT7 B;  1PRW A;  1YVH A;  3BFB A;  2M8U A;  1NIW A;  4HRG A;  1J1E A;  3CWG A;  5HKZ A;  1JFJ A;  1DJW A;  2H61 A;  3EVR A;  1R2U A;  1OSA A;  3LCP C;  1ZMZ A;  1JF0 A;  1OW4 A;  1S6I A;  1F4O A;  1NCZ A;  3AKB A;  4FTG A;  3SG2 A;  2FCD A;  4BY4 A;  1FI5 A;  1YVL A;  1Y1A A;  2H8V A;  4MRX A;  5FI7 A;  4PHJ A;  5I2L A;  1DC1 A;  1SPY A;  1IG5 A;  2VRG A;  4MLW A;  1XFU O;  1D1O A;  1YX7 A;  1TNP A;  2MLE C;  1DGV A;  1MQ1 A;  4IL1 A;  1KFU S;  2EC6 C;  3M0W A;  1OE9 B;  1GGW A;  3DXL A;  5HLV A;  3BQ3 A;  4GAO A;  1XFX O;  1XO5 A;  2COL B;  4PAL A;  1AJ5 A;  2ISD A;  3SG4 A;  1TNQ A;  1DJX A;  2G9B A;  4QJ4 B;  2AMI A;  1WRL A;  1KQM C;  3FWC A;  2F8P A;  2CBL A;  4NDB A;  1UHJ A;  3BFH A;  3D0Y A;  4R1E A;  4DCK A;  1Z2C B;  1IIO A;  1PVB A;  1X02 A;  3SG5 A;  1CMF A;  4YRU A;  3CZ2 A;  3SS3 A;  3CR4 X;  2JXL A;  2HF5 A;  3WHU B;  2JWW A;  3VRR A;  1CFC A;  4DUQ A;  2LP3 A;  3D10 A;  5HKW A;  3BUM B;  2HQW A;  5IBW A;  2KGR A;  3O4Y A;  1KK7 Z;  3I5I C;  3S0A A;  3TZ1 A;  3D74 A;  2P71 A;  1F71 A;  2KGB C;  5D69 A;  1WY9 A;  5KTY A;  1IQ3 A;  2WCK A;  3EVU A;  4PHM A;  3S0E A;  2EC6 B;  2FJY A;  3HCM A;  2SAS A;  5F6T A;  4WQ3 A;  3EG5 B;  5GQQ C;  1SSE B;  1BJF A;  1SCM C;  1TWO A;  4ZCV A;  4DRW A;  2BEC A;  2M97 A;  4NDC A;  4CID A;  1A29 A;  1SR6 C;  1B7T Y;  1KQM B;  1XFZ O;  3PM2 A;  5KU1 A;  2NCO A;  3SJS A;  1QAT A;  5HL1 A;  1ALV A;  2LMT A;  3GK2 A;  3IF7 A;  4C0L A;  2KSP A;  2WCM A;  1M46 A;  1PK0 D;  4YI8 A;  1G33 A;  2I94 A;  2TN4 A;  1DMO A;  1OMR A;  1NCY A;  1PAL A;  2F33 A;  2WC5 A;  4GGF A;  4N5X A;  2L2E A;  2H2K A;  4P2Y B;  3GK1 A;  4M2Q A;  5AFP A;  2YGU A;  2FOT A;  3TDI A;  1CMG A;  2BE4 A;  1UUS A;  3I5F C;  1HQV A;  1NSH A;  4HSZ A;  5AAN A;  1R6P A;  3BOW A;  4YGC B;  1EG3 A;  1F70 A;  2JTT A;  3TDZ A;  1A03 A;  1WRK A;  1YR5 A;  4C0K A;  4GGN A;  1SCM B;  1QLK A;  1FPW A;  4GPL B;  3VRP A;  3E3R A;  4TNC A;  2M29 A;  2K0J A;  2BCX A;  5EL2 A;  2Y1M A;  5I94 A;  3S0D A;  1EXR A;  1J7R A;  3S0G A;  1DGU A;  3CS1 A;  5G08 A;  2QEV A;  3QME A;  4PE7 A;  1IH0 A;  3PJI A;  3BJH A;  3DF0 B;  2OS8 B;  1NX3 A;  2NCP A;  1UWO A;  2KBI A;  2F2P A;  1E8A A;  1K94 A;  1TCF A;  3NHI A;  1GM0 A;  1U5I A;  2M9G A;  2BKH B;  3I5F B;  2BBN A;  2I18 A;  3CYZ A;  5JOL A;  3VRQ A;  5CSN A;  3GK4 X;  3LK0 A;  1DEL A;  2Y4Q A;  2BBM A;  1ZFS A;  3KF9 A;  2QEO A;  5AER A;  4YGA A;  1DJI A;  5HYD A;  3PN7 B;  2M1U A;  1K2H A;  4GNK B;  1KFX L;  4MN0 A;  4WQ2 A;  3A4U B;  1Y1U A;  1CFP A;  3PAL A;  2WOR A;  1NUB A;  4PCW A;  3B86 A;  2FCE A;  3AAK A;  3UO9 A;  3BYA A;  3OX6 A;  2KAY A;  3O78 A;  3OB2 B;  1FF1 A;  1QIV A;  3IVT A;  1GJY A;  1S6J A;  3JVT C;  1VRK A;  5CSI A;  2BE6 A;  1CM4 A;  3IQQ A;  2QEB A;  3O6B A;  3QRX A;  3I5H B;  2JNX A;  3TUY B;  4OR9 B;  1AHR A;  2GV5 A;  3RLZ A;  1QX5 B;  4PT1 A;  1N2D A;  2KI6 D;  2LP2 A;  1B8R A;  2BAP A;  1XA5 A;  3B7A A;  1OMV A;  2A4J A;  3CLN A;  4OV2 A;  1CDL A;  3GOF A;  2JUL A;  1CDP A;  4YGE B;  4OVN F;  3A8R A;  1LKJ A;  4OKH A;  4CFR A;  1K90 D;  4ETO A;  1ALW A;  2Q4U A;  1AJ4 A;  2CNP A;  2LLU A;  1MR8 A;  2ZNE A;  4PE0 A;  1A75 A;  2ZKM X;  2NLN A;  2KAV A;  4FQT A;  2LVV A;  2KAX A;  3OHM B;  1TTX A;  4AOM A;  3PSR A;  4FQO A;  1CDN A;  2KNE A;  1TNX A;  3HX4 A;  3OB1 B;  2PAL A;  4QJ3 B;  1S26 D;  3KHE A;  2KI4 B;  5CPV A;  3SS4 A;  1RWY A;  3D73 A;  3JVT B;  5TNC A;  1QLS A;  1OZO A;  2CT9 A;  2JTZ A;  1TOP A;  1RTP 1;  3WXA A;  1XK4 A;  1CDM A;  3DVE A;  3NGV A;  4U8D A;  4AQI A;  1BLQ A;  2CTN A;  1NX2 A;  3B88 A;  3UNW A;  3AAJ A;  2L98 A;  3ZWH A;  3TS5 C;  1SMG A;  1LIN A;  1KFU L;  1B4C A;  3Q8I A;  4D1E A;  1IWQ A;  1WLZ A;  1B8L A;  3WHT B;  4JQ0 D;  1RK9 A;  2HQ8 A;  3R72 A;  1IKU A;  4ICB A;  1A75 B;  2PSR A;  2KLD A;  3CZ1 A;  4MZJ A;  4XJK B;  3NSL A;  2WND A;  3NSO A;  3R1P A;  3S0F A;  2FJU B;  3BUW B;  1SL7 A;  3NSI A;  3OBV A;  4P5O E;  1MXE A;  1HT9 A;  1L2O C;  4INW A;  5I8N A;  2KFG A;  1UHH A;  1CM1 A;  2F3Y A;  1PUL A;  4F0Z B;  3I5G C;  2E30 A;  3FIA A;  1BR4 B;  3BUN B;  2M7L A;  2K7B A;  1K9K A;  5DKQ A;  1N0Y A;  4KYN A;  2BNX A;  2PRU A;  2PVB A;  3PM8 A;  3TS5 B;  1LA3 A;  2F3Z A;  2M1K B;  1W7I B;  1JSA A;  1QX2 A;  1Z4H A;  1C3Z A;  4Q04 A;  4F7F A;  1SY9 A;  2AUC A;  1J7P A;  4CFQ A;  2M49 B;  3DF0 A;  2IS9 A;  2OPO A;  1BOD A;  2JC2 A;  3EK8 A;  1Q80 A;  2JT3 A;  3NHT A;  4XYN A;  3MSE B;  2KHN A;  4JPZ B;  1H4B A;  2MJW B;  2B1U A;  1DJZ A;  3I5I B;  1QVI Y;  1LXF C;  3SS5 A;  1TN4 A;  3DD4 A;  1EG4 A;  1K8U A;  3EKH A;  1M45 A;  1QV0 A;  4BY5 A;  1L2O B;  4QJ5 B;  2R2I A;  1JC2 A;  3F45 A;  1AK8 A;  3V2L A;  4A4C A;  1CTR A;  5HKY A;  3CR2 A;  1G8I A;  1SR6 B;  1MF8 B;  3JTD C;  3DZT A;  2JPO A;  4MZK A;  4UPG A;  1C7V A;  4YI9 A;  3VRO A;  4I5L B;  3CZT X;  2M0R A;  1K9P A;  5HLO A;  2V53 A;  2MLF C;  2MA2 A;  2NXQ A;  2LV7 A;  3BUX B;  3PLF B;  5FYX A;  2DOQ A;  1KK8 C;  4MBE A;  1IJ6 A;  3CTN A;  4CPV A;  1JBA A;  1B7T Z;  5D3O A;  1F55 A;  5D7F A;  1M39 A;  4USL A;  1WRZ A;  1IGV A;  1ZOT B;  3SG7 A;  1SW8 A;  1YX8 A;  1YUR A;  4ORC B;  1GQM A;  1KQV A;  1CLM A;  4HRH A;  2GGZ A;  2Y5I A;  2JXC A;  1BT6 A;  3FWB A;  1B1G A;  5CSF A;  1TIZ A;  4YBH B;  4JD9 A;  1QV1 A;  2L51 A;  1QJT A;  3NXA A;  1Y1X A;  3O4X A;  5DKN A;  2L2C A;  2K8M B;  1NPQ A;  3K21 A;  3KPX A;  1QWV A;  4PHN A;  1J7Q A;  1KWO C;  4GBA A;  1NP8 A;  4M2O A;  1F54 A;  2LVJ A;  4NDD A;  3PFV A;  2LLS A;  1OOJ A;  2QEH A;  1BMO A;  1M63 B;  2LVK A;  2O5G A;  1KFX S;  2G2B A;  1NX1 A;  3WNX B;  2WC8 A;  2JQ6 A;  1KK8 B;  1S3P A;  2M3W A;  3D76 A;  4PDZ A;  1OOI X;  1ZUZ A;  2QAC A;  1AUI B;  1S36 A;  4HRE E;  3RZS A;  1TCO B;  1SK6 D;  2P6B B;  4PE1 A;  1SRA A;  2L50 A;  1A4P A;  2CXJ A;  1YRU B;  3FS7 A;  1FW4 A;  1H8B A;  1QAS A;  2I2R E;  3KO0 A;  2KFF A;  4NQG A;  1REC A;  1CB1 A;  2E6W A;  3B87 A;  4DIR A;  5KSZ A;  1RJV A;  4OZD A;  2K7O A;  4XJK A;  1KWO B;  3SG3 A;  3BUO B;  2LC5 A;  2LNK A;  1Y0V H;  2GGM A;  3DY9 A;  1QTX A;  2KYC A;  1OZS A;  3OX5 A;  5DIC A;  2D8N A;  1XFR A;  1S5G Y;  1DVI A;  3VRN A;  1KK7 Y;  3R1V A;  2JT8 A;  2ZFD A;  4CLN A;  1F4Q A;  1ORG A;  1PVA A;  1TRF A;  1A2X A;  1WLM A;  2BL0 C;  2KYF A;  2KPH A;  1SL8 A;  1UHK A;  2KDH A;  2LE9 B;  2CCM A;  2ZND A;  2ZRS A;  2PMY A;  1DF0 B;  1DTL A;  2GTE A;  2L4I A;  2MHH A;  1KSO A;  2O60 A;  2ZN9 A;  5PAL A;  2WCF A;  1QXP A;  3FE6 A;  3S0B A;  2H61 C;  5J3X A;  1JWD A;  2WOS A;  1ODB A;  2LVI A;  1C3Y A;  4N1F A;  1BG1 A;  1AVS A;  1SCV A;  5AEQ A;  1QS7 A;  3ZNI A;  1K93 D;  2K2F A;  3L47 A;  1WDC C;  3LK1 A;  1J1D A;  2WC6 A;  3D78 A;  3EKJ A;  3DVM A;  4E68 A;  3H4S E;  2AAO A;  1QIW A;  1XK4 C;  2WCH A;  1P28 A;  2K7D A;  5DKR A;  3O2P A;  2L0P A;  1S6C A;  2F2O A;  4MVF A;  2LAP A;  1UHI A;  1CLB A;  2LHL A;  2EGD A;  1S1E A;  2BL0 B;  2K2A A;  1B47 A;  2PQL A;  2PYQ A;  1C7W A;  1OOG A;  3SIA A;  1C07 A;  1DJY A;  2LM5 A;  2JRF A;  2LMU A;  1BOC A;  1J7O A;  1MXL C;  1YUU A;  1ZAC A;  3EK7 A;  3VGO A;  2ZN8 A;  1S5G Z;  1BF5 A;  2LUX A;  1TUJ A;  3DVK A;  3OGN A;  1V1F A;  3BFA A;  1KCY A;  1CFF A;  3N7H A;  4OCI A;  3SG6 A;  2K60 A;  2LHI A;  2SCP A;  1Y6W A;  1LS8 A;  4PE4 A;  3CR5 X;  1G4Y R;  2EHB A;  2OTG C; 
#chains in the Genus database with same CATH homology
 1SNL A;  1GGZ A;  4YGB B;  5BPJ A;  1WDC B;  3LLE A;  1XFV O;  1LA0 A;  4ORB B;  4L9M A;  2L5X B;  3SIB A;  2KI6 C;  1MUX A;  2Q91 A;  2BCA A;  1XFY O;  1IRJ A;  1SKT A;  2HET A;  1CLL A;  2HPS A;  3D0Y B;  3I5G B;  1CNP A;  5I2Q A;  1PSR A;  1JFK A;  2BKI B;  2KOT A;  4MZL A;  1V1G A;  1IQ5 A;  2K61 A;  4GGF C;  5AXI A;  2OS8 C;  1LVC D;  2WCB A;  3IQO A;  4GUK A;  1FI6 A;  1MHO A;  2JU0 A;  4A4B A;  1YUS A;  4PHK A;  2MAZ A;  1EL4 A;  1M31 A;  2I7A A;  4MEW A;  4WRI A;  1IJ5 A;  2QPT A;  2OTG B;  2JZI A;  1FBV A;  2PAS A;  1N65 A;  1NX0 A;  3TDU A;  1J55 A;  1JUO A;  1W7J B;  1SYM A;  3NSK A;  3PN7 C;  2WCE A;  2ZRT A;  1UHN A;  1AP4 A;  2LMV A;  1QX7 A;  1KSM A;  1B8C A;  3KEV A;  4GFT A;  4N1G A;  1UP5 A;  3C1V A;  1QVI Z;  5ER5 A;  1NWD A;  4ORA B;  3CGA A;  3JTD B;  5K89 A;  1NCX A;  4YGD B;  3EVV A;  2KBM A;  3LL8 B;  3I5H C;  4I5N B;  3RM1 A;  1YUT A;  3TUY C;  1L7Z A;  4MRY A;  5I2O A;  4I5K A;  5CSJ A;  2BCB A;  1K9U A;  1B9A A;  1EH2 A;  1UUR A;  2JOJ A;  3BOW B;  1SL9 A;  2KQ6 A;  2RGI A;  1DF0 A;  2LLT A;  5JJG A;  1K95 A;  1RRO A;  3ICB A;  1XYD A;  4M2P A;  1BU3 A;  2LCP A;  4JWQ A;  4C0J A;  2KFH A;  2LAN A;  3BXK A;  4ZCU A;  3PAT A;  1DJH A;  2K7C A;  1MWN A;  2LUC A;  1RFJ A;  2MBX A;  1XVJ A;  1EJ3 A;  2KI4 C;  2KQY A;  1XFW O;  2NZ0 A;  3AKA A;  1JF2 A;  1CFD A;  1K96 A;  1OMD A;  1TNW A;  2M7N A;  1F8H A;  2JT0 A;  5ER4 X;  2JNF A;  2JPT A;  2MRD A;  3OP0 A;  4MSP A;  1SBJ A;  1YRT B;  1DJG A;  2Y1N A;  1NYA A;  1YTZ C;  5B8I B;  1U5I B;  3DVJ A;  1OQP A;  4I5J A;  4AQJ A;  1BR1 B;  1CKK A;  1PSB A;  3EK4 A;  2L4H A;  4DS7 A;  1DT7 B;  1PRW A;  1YVH A;  2M8U A;  1NIW A;  4HRG A;  1J1E A;  3CWG A;  5HKZ A;  1JFJ A;  1DJW A;  2H61 A;  3EVR A;  1R2U A;  1OSA A;  3LCP C;  1ZMZ A;  1JF0 A;  1S6I A;  1F4O A;  1NCZ A;  3AKB A;  4FTG A;  3SG2 A;  2FCD A;  4BY4 A;  1FI5 A;  1YVL A;  1Y1A A;  4MRX A;  4PHJ A;  5I2L A;  1SPY A;  1IG5 A;  2VRG A;  4MLW A;  1XFU O;  1D1O A;  1YX7 A;  1TNP A;  2MLE C;  1DGV A;  1MQ1 A;  4IL1 A;  1KFU S;  2EC6 C;  3M0W A;  1OE9 B;  1GGW A;  5HLV A;  3BQ3 A;  4GAO A;  1XFX O;  1XO5 A;  2COL B;  4PAL A;  1AJ5 A;  2ISD A;  3SG4 A;  1TNQ A;  1DJX A;  2G9B A;  4QJ4 B;  2AMI A;  1WRL A;  1KQM C;  3FWC A;  2F8P A;  2CBL A;  4NDB A;  1UHJ A;  3D0Y A;  4R1E A;  4DCK A;  1PVB A;  1X02 A;  3SG5 A;  1CMF A;  4YRU A;  3CR4 X;  2JXL A;  2HF5 A;  3WHU B;  2JWW A;  3VRR A;  1CFC A;  4DUQ A;  2LP3 A;  3D10 A;  5HKW A;  3BUM B;  2HQW A;  5IBW A;  2KGR A;  3O4Y A;  1KK7 Z;  3I5I C;  3TZ1 A;  1F71 A;  2KGB C;  5D69 A;  1WY9 A;  5KTY A;  1IQ3 A;  3EVU A;  4PHM A;  2EC6 B;  5F6T A;  3HCM A;  2SAS A;  4WQ3 A;  5GQQ C;  4ZCV A;  1BJF A;  1SCM C;  4DRW A;  2BEC A;  2M97 A;  4NDC A;  4CID A;  1A29 A;  1SR6 C;  1B7T Y;  1KQM B;  1XFZ O;  5KU1 A;  2NCO A;  3SJS A;  1QAT A;  1ALV A;  2LMT A;  3GK2 A;  3IF7 A;  4C0L A;  2KSP A;  1M46 A;  1PK0 D;  4YI8 A;  1G33 A;  2I94 A;  2TN4 A;  1DMO A;  1OMR A;  1NCY A;  1PAL A;  2F33 A;  4GGF A;  4N5X A;  2L2E A;  2H2K A;  4P2Y B;  3GK1 A;  4M2Q A;  5AFP A;  2FOT A;  3TDI A;  1CMG A;  2BE4 A;  1UUS A;  3I5F C;  1HQV A;  1NSH A;  4HSZ A;  5AAN A;  1R6P A;  3BOW A;  4YGC B;  1EG3 A;  1F70 A;  2JTT A;  3TDZ A;  1A03 A;  1WRK A;  1YR5 A;  4C0K A;  4GGN A;  1SCM B;  1QLK A;  1FPW A;  4GPL B;  3VRP A;  3E3R A;  4TNC A;  2M29 A;  2K0J A;  2BCX A;  2Y1M A;  1EXR A;  1J7R A;  1DGU A;  3CS1 A;  5G08 A;  4PE7 A;  1IH0 A;  3DF0 B;  2OS8 B;  1NX3 A;  2NCP A;  1UWO A;  2KBI A;  2F2P A;  1E8A A;  1K94 A;  1TCF A;  1U5I A;  2M9G A;  2BKH B;  3I5F B;  2BBN A;  2I18 A;  5JOL A;  3VRQ A;  5CSN A;  3GK4 X;  3LK0 A;  2Y4Q A;  2BBM A;  1ZFS A;  3KF9 A;  5AER A;  4YGA A;  1DJI A;  5HYD A;  3PN7 B;  2M1U A;  1K2H A;  4GNK B;  1KFX L;  4MN0 A;  4WQ2 A;  3A4U B;  1Y1U A;  1CFP A;  3PAL A;  2WOR A;  1NUB A;  4PCW A;  2FCE A;  3AAK A;  3BYA A;  3OX6 A;  2KAY A;  3O78 A;  3OB2 B;  1FF1 A;  1QIV A;  3JVT C;  1GJY A;  1S6J A;  1VRK A;  5CSI A;  2BE6 A;  1CM4 A;  3IQQ A;  3O6B A;  3QRX A;  3TUY B;  3I5H B;  2JNX A;  4OR9 B;  1AHR A;  2GV5 A;  3RLZ A;  1QX5 B;  1N2D A;  2KI6 D;  2LP2 A;  1B8R A;  1XA5 A;  1OMV A;  2A4J A;  3CLN A;  4OV2 A;  1CDL A;  3GOF A;  2JUL A;  1CDP A;  4YGE B;  4OVN F;  3A8R A;  1LKJ A;  4OKH A;  4CFR A;  1K90 D;  4ETO A;  1ALW A;  2Q4U A;  1AJ4 A;  2CNP A;  2LLU A;  1MR8 A;  2ZNE A;  4PE0 A;  1A75 A;  2ZKM X;  2NLN A;  2KAV A;  2LVV A;  2KAX A;  3OHM B;  1TTX A;  4AOM A;  3PSR A;  4FQO A;  1CDN A;  2KNE A;  1TNX A;  3HX4 A;  3OB1 B;  2PAL A;  4QJ3 B;  1S26 D;  3KHE A;  2KI4 B;  5CPV A;  1RWY A;  5TNC A;  3JVT B;  1QLS A;  1OZO A;  2CT9 A;  2JTZ A;  1TOP A;  1RTP 1;  3WXA A;  1CDM A;  1XK4 A;  3DVE A;  4U8D A;  4AQI A;  1BLQ A;  2CTN A;  1NX2 A;  3AAJ A;  2L98 A;  3ZWH A;  3TS5 C;  1SMG A;  1LIN A;  1KFU L;  1B4C A;  4D1E A;  1IWQ A;  1WLZ A;  1B8L A;  3WHT B;  4JQ0 D;  1RK9 A;  2HQ8 A;  1IKU A;  4ICB A;  1A75 B;  2PSR A;  4MZJ A;  4XJK B;  3NSL A;  2WND A;  3NSO A;  2FJU B;  3BUW B;  1SL7 A;  3NSI A;  4P5O E;  1MXE A;  1HT9 A;  1L2O C;  5I8N A;  2KFG A;  1UHH A;  1CM1 A;  2F3Y A;  1PUL A;  4F0Z B;  3I5G C;  2E30 A;  3FIA A;  1BR4 B;  3BUN B;  2M7L A;  2K7B A;  1K9K A;  5DKQ A;  1N0Y A;  2PVB A;  2PRU A;  3PM8 A;  3TS5 B;  1LA3 A;  2F3Z A;  2M1K B;  1W7I B;  1JSA A;  1QX2 A;  4Q04 A;  1SY9 A;  2AUC A;  1J7P A;  4CFQ A;  2M49 B;  3DF0 A;  2IS9 A;  2OPO A;  1BOD A;  2JC2 A;  3EK8 A;  1Q80 A;  2JT3 A;  4XYN A;  3MSE B;  2KHN A;  4JPZ B;  1H4B A;  2MJW B;  2B1U A;  1DJZ A;  3I5I B;  1QVI Y;  1LXF C;  1TN4 A;  3DD4 A;  1EG4 A;  1K8U A;  3EKH A;  1M45 A;  1QV0 A;  4BY5 A;  1L2O B;  4QJ5 B;  2R2I A;  1JC2 A;  3F45 A;  1AK8 A;  4A4C A;  1CTR A;  5HKY A;  3CR2 A;  1G8I A;  1SR6 B;  1MF8 B;  3JTD C;  4MZK A;  4UPG A;  1C7V A;  4YI9 A;  3VRO A;  4I5L B;  3CZT X;  2M0R A;  1K9P A;  5HLO A;  2V53 A;  2MLF C;  2MA2 A;  2NXQ A;  2LV7 A;  3BUX B;  3PLF B;  5FYX A;  2DOQ A;  1KK8 C;  4MBE A;  1IJ6 A;  3CTN A;  4CPV A;  1JBA A;  1B7T Z;  1F55 A;  5D7F A;  1M39 A;  4USL A;  1WRZ A;  1IGV A;  1ZOT B;  3SG7 A;  1SW8 A;  1YX8 A;  1YUR A;  4ORC B;  1GQM A;  1KQV A;  1CLM A;  4HRH A;  2GGZ A;  2Y5I A;  2JXC A;  1BT6 A;  3FWB A;  1B1G A;  5CSF A;  1TIZ A;  4YBH B;  1QV1 A;  2L51 A;  1QJT A;  3NXA A;  1Y1X A;  5DKN A;  2K8M B;  1NPQ A;  3K21 A;  3KPX A;  4PHN A;  1J7Q A;  1KWO C;  4M2O A;  1NP8 A;  1F54 A;  2LVJ A;  4NDD A;  3PFV A;  2LLS A;  1OOJ A;  1BMO A;  1M63 B;  2LVK A;  2O5G A;  1KFX S;  2G2B A;  1NX1 A;  3WNX B;  2WC8 A;  2JQ6 A;  1KK8 B;  1S3P A;  2M3W A;  4PDZ A;  1ZUZ A;  2QAC A;  1AUI B;  1S36 A;  4HRE E;  1TCO B;  1SK6 D;  2P6B B;  4PE1 A;  1SRA A;  2L50 A;  1A4P A;  2CXJ A;  1YRU B;  3FS7 A;  1FW4 A;  1H8B A;  1QAS A;  2I2R E;  3KO0 A;  2KFF A;  4NQG A;  1REC A;  1CB1 A;  2E6W A;  4DIR A;  5KSZ A;  1RJV A;  2K7O A;  4XJK A;  1KWO B;  3SG3 A;  3BUO B;  2LC5 A;  2LNK A;  1Y0V H;  2GGM A;  1QTX A;  2KYC A;  1OZS A;  3OX5 A;  2D8N A;  1S5G Y;  1DVI A;  3VRN A;  1KK7 Y;  2JT8 A;  2ZFD A;  4CLN A;  1F4Q A;  1PVA A;  1TRF A;  1A2X A;  1WLM A;  2BL0 C;  2KYF A;  2LE9 B;  1SL8 A;  1UHK A;  2KDH A;  2ZND A;  2CCM A;  2ZRS A;  4GBA A;  2PMY A;  1DF0 B;  1DTL A;  2MHH A;  2L4I A;  2O60 A;  1KSO A;  2ZN9 A;  5PAL A;  2WCF A;  1QXP A;  2H61 C;  5J3X A;  1JWD A;  2WOS A;  1ODB A;  2LVI A;  4N1F A;  1BG1 A;  1AVS A;  1SCV A;  5AEQ A;  1QS7 A;  3ZNI A;  1K93 D;  2K2F A;  1WDC C;  3LK1 A;  1J1D A;  3EKJ A;  3DVM A;  4E68 A;  3H4S E;  2AAO A;  1QIW A;  1XK4 C;  5DKR A;  2K7D A;  3O2P A;  2L0P A;  1S6C A;  2F2O A;  4MVF A;  2LAP A;  1UHI A;  1CLB A;  2LHL A;  2EGD A;  1S1E A;  2BL0 B;  2K2A A;  1B47 A;  1C07 A;  1C7W A;  3SIA A;  1DJY A;  2LM5 A;  2JRF A;  2LMU A;  1BOC A;  1J7O A;  1MXL C;  1YUU A;  1ZAC A;  3EK7 A;  3VGO A;  2ZN8 A;  1S5G Z;  1BF5 A;  2LUX A;  3DVK A;  1V1F A;  1KCY A;  1CFF A;  4OCI A;  3SG6 A;  2LHI A;  2SCP A;  1Y6W A;  4PE4 A;  3CR5 X;  1G4Y R;  2EHB A;  2OTG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...