3DVKA

Crystal structure of ca2+/cam-cav2.3 iq domain complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
143
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 50
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvkA00
3PM8A 1K94A 1F70A 1S36A 2LAPA 1B7TZ 2H61A 1S6CA 3BUMB 3D10A 2L4IA 3AKBA 1CKKA 4HREE 1SKTA 5I2OA 1SRAA 2G2BA 1S5GZ 1G33A 4HRHA 1A2XA 2WCBA 4GGNA 1SL8A 4M2PA 4AQIA 2KAYA 1J7PA 5TNCA 3TS5C 1EL4A 2CCMA 1B1GA 1YR5A 2KQYA 3O2PA 2COLB 3EK8A 4GUKA 1KFXS 3WNXB 1ALVA 1M63B 4PE0A 4I5JA 1H4BA 2SCPA 1AVSA 5HKWA 1XA5A 2K0JA 3I5GC 1EJ3A 1PVBA 1EG3A 2I94A 2CNPA 2KFFA 4YGAA 1K93D 3BUNB 1OZOA 1CMGA 3O4YA 1ALWA 2MJWB 1IRJA 4D1EA 1MXEA 1SCMC 1YX8A 3LLEA 4NDBA 1DMOA 4USLA 1FPWA 1WRZA 1L2OC 2AUCA 3FS7A 3KEVA 3VRQA 5HKZA 5KSZA 3CR5X 3HCMA 2CBLA 2L0PA 2F2OA 1QIWA 2EGDA 2GGMA 1KFUL 1OOJA 2M8UA 1RK9A 3BUOB 4GNKB 1Y0VH 4MZKA 4BY4A 1QV1A 1VRKA 1U5IA 2H61C 4P2YB 2KQ6A 2PRUA 3IQOA 4IL1A 1NWDA 1QV0A 1DJZA 2KAXA 2BL0B 2OPOA 3BUWB 3ZWHA 4OR9B 5HYDA 1CM4A 1U5IB 1CLBA 2BBNA 2SASA 1NUBA 1DJYA 1SYMA 1JBAA 1B47A 2FOTA 2DOQA 4YRUA 1RTP1 1CMFA 2KNEA 2M97A 1G4YR 1DF0A 1NSHA 3LL8B 2LMTA 3DVEA 1A29A 2MA2A 1PVAA 1FI6A 1TCFA 3AAKA 4YGBB 1AJ4A 4JQ0D 2KI6C 1QATA 1B4CA 1XFWO 1PSBA 1BU3A 1OQPA 2ZNEA 2BKIB 1DF0B 2M1KB 4ORCB 1S5GY 2PMYA 4CPVA 2NCPA 1K8UA 4MSPA 2LLTA 1TTXA 2JULA 3GK4X 1NCXA 2L5XB 1KCYA 4C0JA 1ODBA 1R6PA 4OV2A 1WY9A 4CFQA 1IWQA 2M0RA 3SG6A 5KTYA 3OX6A 1QASA 4MZJA 1BF5A 2JT3A 2L50A 1L7ZA 2L4HA 4M2QA 1BR4B 2BL0C 3SIAA 1NX2A 1AHRA 4ORBB 1WRLA 4A4BA 1UUSA 2ISDA 1UP5A 1BT6A 2HETA 1J55A 2GV5A 3GK2A 1K9UA 2PVBA 5DKNA 2ZN9A 1QX7A 1CLLA 1F4OA 1MXLC 1DJXA 4AQJA 2L2EA 4QJ5B 2H2KA 2JC2A 1J7OA 5HLOA 1X02A 5D7FA 3TDZA 1ZACA 2BKHB 1S6JA 1K96A 1S3PA 4HRGA 1YUSA 3D0YA 4MBEA 2LP2A 4DIRA 1FBVA 1SCVA 2K61A 1PRWA 1QVIY 1F4QA 1V1GA 4I5KA 1Y1AA 1N2DA 4HSZA 1OMRA 1SBJA 2NLNA 3NXAA 3BYAA 3O6BA 5J3XA 1CM1A 1WLZA 3D0YB 1QLSA 5I8NA 3LCPC 1SL9A 1AUIB 5PALA 1J7RA 2IS9A 2MLEC 4PE7A 1QIVA 1OMVA 3EVVA 4GGFC 1XFZO 1KFUS 1SCMB 1SR6B 2JQ6A 4OKHA 1L2OB 1W7IB 2A4JA 2WNDA 3BOWB 4XJKB 5CSIA 1M39A 2LHLA 1CDLA 1JF0A 5JJGA 4ZCVA 2K7OA 1DTLA 4BY5A 1Y6WA 1RROA 2ZN8A 2AMIA 5CSJA 1NIWA 2E30A 1LKJA 2M7LA 1XO5A 2KGRA 3SIBA 4YI9A 4PHMA 2KGBC 1UHNA 4MRYA 1D1OA 2LVVA 3SG2A 2K7BA 3IF7A 3ICBA 3NSLA 1S1EA 3OP0A 1RWYA 1UWOA 3CGAA 3GK1A 2K8MB 1A03A 5HKYA 3PALA 5AANA 2RGIA 5CSFA 3NSIA 3SG7A 1UHKA 3E3RA 4PHNA 1QXPA 1SR6C 4Q04A 1OSAA 1NYAA 1YVLA 1EXRA 2F8PA 2LE9B 2LUXA 3VRPA 5F6TA 2M49B 1QVIZ 4MVFA 2JXLA 1CDNA 2ZRSA 1YVHA 1Y1XA 4NDCA 3CS1A 1RECA 2ZFDA 1WLMA 1LVCD 2MRDA 1GQMA 4C0LA 2M9GA 2M3WA 4YGDB 1XVJA 2L51A 1DJHA 3EVRA 1C7VA 5K89A 1SY9A 2JNFA 3BQ3A 3SJSA 1TNPA 2JNXA 2KDHA 1XFUO 1E8AA 2BCAA 1YRTB 2MBXA 1BG1A 4L9MA 1C07A 1CDPA 1KK7Y 3FWCA 2KFHA 1SW8A 1JWDA 2LVJA 1FW4A 3EK7A 3I5HB 2KI4B 1IH0A 1SPYA 1R2UA 1TNXA 2JU0A 3DF0B 5GQQC 1B8RA 1YUTA 5ER5A 2OS8B 3JTDB 3CZTX 2F3ZA 5BPJA 4C0KA 1CDMA 2KYCA 1K90D 2G9BA 1YTZC 1QS7A 1KWOB 2KSPA 2LMVA 3RM1A 1QLKA 3H4SE 4PHJA 2F3YA 1A75B 2ZRTA 1IQ5A 4CFRA 2LV7A 1N0YA 4CLNA 1SK6D 2LVIA 2BECA 4GGFA 4PE4A 2M7NA 4A4CA 3VRNA 3CLNA 1TNQA 1HT9A 1WDCC 2JTTA 2ZKMX 4JWQA 1IJ5A 4N1GA 4NDDA 5AEQA 3I5FB 1NP8A 3SG4A 1CFDA 1MF8B 1B8CA 3I5IC 1KFXL 1QX5B 1AP4A 2WCEA 2M1UA 3TDIA 4MEWA 1YURA 1UHHA 2R2IA 1LA3A 3PN7B 1IQ3A 1K95A 1MQ1A 3VGOA 4DRWA 1MHOA 2LHIA 3IQQA 2Y1MA 3BUXB 3I5HC 2KI4C 2BCBA 4JPZB 2HQWA 1F55A 2I7AA 4PE1A 2CXJA 4MN0A 3CWGA 1DJWA 2OS8C 3JTDC 1RJVA 2WCFA 4I5NB 2CTNA 1BMOA 1ZOTB 5CSNA 1KWOC 2P6BB 2K7CA 3EKJA 1MWNA 2E6WA 1JC2A 3O78A 2F33A 1KK8B 1QJTA 4FTGA 1RFJA 2JT0A 2F2PA 4ORAB 1TIZA 1NX3A 1ZFSA 1KSMA 1KK7Z 2O5GA 2I18A 3OB2B 3HX4A 1XYDA 3BOWA 1DT7B 4XJKA 3CTNA 3I5FC 1AJ5A 3A4UB 2PASA 1SNLA 5G08A 2QPTA 2Y5IA 1DJIA 3CR2A 4NQGA 3TZ1A 2PSRA 1OE9B 3PN7C 1G8IA 1IGVA 4QJ3B 5CPVA 2LUCA 1KSOA 3OX5A 1B8LA 4ZCUA 1DJGA 1K9KA 3SG3A 3VROA 1KQMC 5JOLA 1BODA 3PSRA 2NZ0A 1CB1A 1J1DA 1XFXO 1CLMA 1K9PA 5DKRA 1B9AA 2JXCA 1HQVA 2JTZA 2PALA 1IJ6A 1SL7A 1BR1B 3DD4A 3EVUA 1NCYA 4E68A 1PSRA 1KK8C 1FI5A 2KHNA 3EKHA 4U8DA 1Q80A 4DS7A 2MLFC 4XYNA 1ZUZA 1BLQA 3TUYC 2EC6B 5HLVA 1GJYA 1F71A 1DGUA 1JUOA 1CTRA 1TRFA 3LK0A 1KQVA 5IBWA 5D69A 1M46A 2EHBA 2BBMA 2FCDA 5I2QA 1Y1UA 2BE6A 3CR4X 1ZMZA 1PALA 1CFCA 1H8BA 2V53A 3PATA 2TN4A 1CNPA 4WQ2A 1QX2A 3KHEA 1CFFA 4N1FA 2NXQA 2LLSA 2B1UA 3BXKA 1AK8A 4GAOA 1GGZA 4YI8A 4M2OA 3EK4A 4ICBA 2AAOA 1WDCB 1JSAA 2QACA 2Y4QA 4I5LB 1JFKA 4ETOA 1FF1A 3I5IB 2KAVA 3DF0A 1TCOB 2BCXA 4R1EA 1V1FA 2JRFA 4WQ3A 3WXAA 2I2RE 3SG5A 1OMDA 1XFVO 1YRUB 3C1VA 2EC6C 2MAZA 2WORA 3NSKA 1A75A 1XK4C 2OTGB 4N5XA 1W7JB 4F0ZB 3PLFB 2LP3A 3NSOA 2JPTA 3ZNIA 2JT8A 4PCWA 1QTXA 1NPQA 3DVKA 2O60A 5B8IB 2HPSA 3AAJA 1OZSA 3K21A 4FQOA 1S26D 1UHJA 3WHTB 2KI6D 2JOJA 2M29A 3OHMB 2VRGA 3TDUA 5FYXA 1A4PA 1LXFC 1JF2A 3F45A 1UHIA 4PHKA 4DCKA 2LANA 2HQ8A 2FCEA 2GGZA 2KFGA 4DUQA 2LCPA 1CFPA 1S6IA 5DKQA 4YBHB 2KBIA 5I2LA 4OVNF 1B7TY 3KO0A 3OB1B 5AERA 3JVTB 1WRKA 1IG5A 4TNCA 1PK0D 1J1EA 1XFYO 1F54A 1K2HA 1TNWA 1NCZA 1M31A 3GOFA 2OTGC 1BJFA 1KQMB 2WOSA 1PULA 1M45A 3RLZA 3WHUB 3DVJA 4GPLB 4GBAA 2NCOA 1C7WA 3DVMA 2WC8A 5ER4X 1YX7A 5KU1A 4QJ4B 4PALA 4GFTA 1LINA 4YGEB 3PFVA 4P5OE 4UPGA 1GGWA 2MHHA 2CT9A 1DVIA 3LK1A 3TUYB 2L98A 4MRXA 2FJUB 2K7DA 4MZLA 4PDZA 1N65A 3FIAA 1NX0A 1YUUA 4AOMA 4MLWA 4CIDA 2HF5A 1TOPA 5AFPA 3M0WA 1DGVA 1TN4A 1EH2A 1F8HA 1UURA 3JVTC 3MSEB 2Q91A 1BOCA 1MR8A 4OCIA 3TS5B 1SMGA 3QRXA 1NX1A 5AXIA 1EG4A 2LNKA 2JZIA 2D8NA 2LC5A 2K2AA 2KOTA 1LA0A 4WRIA 2BE4A 2LMUA 3FWBA 3AKAA 2KBMA 2Y1NA 1J7QA 2LVKA 1JFJA 2Q4UA 3A8RA 2JWWA 2K2FA 3I5GB 3KPXA 2ZNDA 2LLUA 2KYFA 1MUXA 2LM5A 1IKUA 3VRRA 1XK4A 3KF9A 4YGCB
chains in the Genus database with same CATH superfamily
2H8VA 3CABA 1K94A 3PM8A 1F70A 1S36A 2LAPA 1B7TZ 2H61A 3R1VA 1S6CA 3BUMB 3D10A 2L4IA 3AKBA 1CKKA 4HREE 1SKTA 5I2OA 1SRAA 2G2BA 1DEKA 1S5GZ 5FI7A 1G33A 4HRHA 1A2XA 2WCBA 4GGNA 3K1EA 1SL8A 3DXLA 4M2PA 4AQIA 2KAYA 1J7PA 5HL1A 5TNCA 5EL2A 3TS5C 1EL4A 2CCMA 2L2CA 1B1GA 1YR5A 2KQYA 3O2PA 2COLB 3EK8A 4GUKA 1KFXS 3WNXB 1ALVA 1M63B 4PE0A 3S0FA 4I5JA 1H4BA 2SCPA 1AVSA 5HKWA 1XA5A 2K0JA 1T14A 3D78A 3I5GC 1EJ3A 1PVBA 1EG3A 2I94A 2CNPA 2KFFA 4YGAA 1K93D 3BUNB 1OZOA 1CMGA 3O4YA 1ALWA 2MJWB 1IRJA 3S0GA 1MXEA 1SCMC 1YX8A 3LLEA 4INXA 4NDBA 4USLA 4D1EA 1WRZA 1L2OC 2AUCA 3FS7A 3KEVA 3Q8IA 3VRQA 5HKZA 5KSZA 3CR5X 3EG5B 3HCMA 2CBLA 2L0PA 2F2OA 1QIWA 2EGDA 1ORGA 1KFUL 1OOJA 2GGMA 1RK9A 2M8UA 3BUOB 1Y0VH 4GNKB 4MZKA 4BY4A 1QV1A 1VRKA 1U5IA 2H61C 4P2YB 2KQ6A 2PRUA 2WCJA 2QEOA 3IQOA 2JPOA 4IL1A 1NWDA 1QV0A 1DJZA 2KAXA 2BL0B 2OPOA 3BUWB 3ZWHA 4OR9B 3R72A 5HYDA 1CM4A 1U5IB 1CLBA 2BBNA 2SASA 1NUBA 1DJYA 1SYMA 1JBAA 1B47A 2FOTA 2DOQA 4YRUA 1RTP1 1CMFA 2KNEA 2M97A 1G4YR 1DF0A 1NSHA 3LL8B 1FPWA 3R1PA 1P28A 2LMTA 3DVEA 1A29A 3CZ2A 2MA2A 1PVAA 1FI6A 1TCFA 3AAKA 4YGBB 1AJ4A 4JQ0D 2KI6C 1QATA 1B4CA 1XFWO 1PSBA 1BU3A 1OQPA 2QEBA 2BKIB 1DF0B 2M1KB 2ZNEA 4ORCB 1S5GY 2PMYA 2QDIA 4CPVA 2NCPA 1K8UA 4MSPA 2LLTA 1TTXA 2JULA 3GK4X 1NCXA 2L5XB 3PJIA 1DC1A 4C0JA 1KCYA 3DZTA 1ODBA 1R6PA 3B87A 2P71A 4OV2A 1WY9A 4CFQA 1IWQA 2M0RA 3D75A 3SG6A 3SS5A 3OX6A 5KTYA 1QASA 4MZJA 1BF5A 2JT3A 2L50A 1L7ZA 2L4HA 4M2QA 2KLEA 1BR4B 4PT1A 2BL0C 3SIAA 3B86A 1NX2A 1AHRA 4ORBB 1WRLA 4A4BA 1UUSA 2ISDA 1UP5A 1BT6A 2HETA 1J55A 2GV5A 3GK2A 1K9UA 2PVBA 5DKNA 2ERBA 2ZN9A 4IJ7A 1QX7A 1CLLA 1F4OA 1MXLC 1TUJA 1DJXA 4AQJA 2L2EA 4QJ5B 2H2KA 2JC2A 1J7OA 5HLOA 1X02A 5D7FA 3TDZA 1ZACA 2BKHB 1S6JA 1K96A 1S3PA 4HRGA 1YUSA 3D0YA 4MBEA 2LP2A 1W9ZA 4DIRA 1FBVA 1SCVA 2K61A 1PRWA 1QVIY 1F4QA 1V1GA 4I5KA 1Y1AA 1N2DA 2KPHA 1OMRA 1SBJA 4HSZA 2NLNA 2WCHA 3NXAA 3BYAA 3O6BA 5J3XA 1CM1A 1WLZA 3D0YB 1QLSA 5I8NA 3LCPC 3NGVA 1SL9A 1AUIB 3IVTA 5PALA 1J7RA 2IS9A 2MLEC 4PE7A 1QIVA 1OMVA 3EVVA 4GGFC 1XFZO 1KFUS 1SCMB 1SR6B 2JQ6A 4OKHA 1L2OB 1W7IB 2A4JA 2WNDA 3BOWB 3NHTA 4XJKB 5CSIA 4INWA 1M39A 2BNXA 2LHLA 1CDLA 1JF0A 5JJGA 4ZCVA 2K7OA 3DYEA 1DTLA 2K60A 1Y6WA 4BY5A 1IIOA 1RROA 2BAPA 2ZN8A 1TWOA 2AMIA 5CSJA 1NIWA 2E30A 3S0BA 1LKJA 2M7LA 1XO5A 5FI6A 3SS4A 2KGRA 3B88A 3UNWA 3SIBA 4YI9A 4PHMA 2KGBC 1UHNA 4MRYA 1D1OA 2LVVA 3SG2A 2K7BA 3IF7A 3ICBA 3NSLA 1S1EA 3OP0A 1RWYA 1UWOA 3CGAA 3GK1A 2K8MB 1A03A 5HKYA 3PALA 5AANA 2RGIA 5CSFA 3NSIA 3SG7A 3D73A 1UHKA 3R1OA 2WC6A 3E3RA 4PHNA 1QXPA 1SR6C 4Q04A 1OSAA 1NYAA 1YVLA 1EXRA 2F8PA 2LE9B 2LUXA 3VRPA 2L5YA 5F6TA 2M49B 1QVIZ 4MVFA 2JXLA 1CDNA 2ZRSA 3S0EA 1YVHA 1Y1XA 4NDCA 3CS1A 1RECA 2ZFDA 1WLMA 1LVCD 2MRDA 1GQMA 2WCMA 3PM2A 2M9GA 2M3WA 4C0LA 4YGDB 1DELA 1XVJA 2L51A 1DJHA 3EVRA 1C7VA 5K89A 1SY9A 2JNFA 3BQ3A 3SJSA 1TNPA 2JNXA 2KDHA 1XFUO 1E8AA 2BCAA 1YRTB 2MBXA 1BG1A 4L9MA 1C07A 1CDPA 1KK7Y 3FWCA 2KFHA 3L4AA 2WCLA 1SW8A 1JWDA 2LVJA 1FW4A 1DMOA 3D76A 3EK7A 3I5HB 2KI4B 1IH0A 1SPYA 1OOGA 1R2UA 1TNXA 2JU0A 3DF0B 5GQQC 1B8RA 2PYQA 1YUTA 5ER5A 2OS8B 3JTDB 3CZTX 2F3ZA 5FI2A 5BPJA 4C0KA 1CDMA 2KYCA 1K90D 1Z4HA 2G9BA 1YTZC 1QS7A 4F7FA 1KWOB 2KSPA 2LMVA 3RM1A 1QLKA 3H4SE 4PHJA 1TUZA 2F3YA 1A75B 2ZRTA 1IQ5A 4CFRA 2LV7A 1N0YA 4CLNA 3L4LA 1OOFA 1SK6D 2LVIA 2BECA 4GGFA 4PE4A 2M7NA 3FE8A 4A4CA 3VRNA 3CLNA 3S0AA 1TNQA 1HT9A 1WDCC 2JTTA 2ZKMX 3CYZA 4JWQA 1IJ5A 2QEHA 4N1GA 4NDDA 5AEQA 3I5FB 1NP8A 3SG4A 1CFDA 1MF8B 1B8CA 3I5IC 1KFXL 1QX5B 3B6XA 1AP4A 2WCEA 2M1UA 3TDIA 4MEWA 1YURA 3CDNA 1UHHA 2P70A 2R2IA 1LA3A 3PN7B 3V2LA 1IQ3A 1K95A 1MQ1A 1Z2CB 3VGOA 2KLDA 4DRWA 1MHOA 2LHIA 3IQQA 2Y1MA 3BUXB 3I5HC 2KI4C 2BCBA 4JPZB 2HQWA 1F55A 2I7AA 4PE1A 5DICA 2CXJA 4MN0A 3CWGA 1DJWA 2OS8C 3JTDC 1RJVA 2WCFA 4I5NB 2CTNA 1BMOA 1ZOTB 5CSNA 1OOHA 3N7HA 1KWOC 2P6BB 2K7CA 3FE9A 3EKJA 1MWNA 3QMEA 2E6WA 1JC2A 3O78A 2F33A 1KK8B 1QJTA 4FTGA 1RFJA 2JT0A 2F2PA 4ORAB 1TIZA 1NX3A 1ZFSA 1KSMA 1KK7Z 2WCKA 1DQEA 2O5GA 3OGNA 2I18A 3OB2B 4KYNA 3HX4A 1XYDA 3BOWA 1DT7B 4XJKA 3CTNA 3I5FC 1AJ5A 3A4UB 1SSEB 2PASA 1SNLA 4FQTA 5G08A 2QPTA 2Y5IA 1DJIA 3CR2A 4NQGA 3TZ1A 2PSRA 3CZ1A 1OE9B 3PN7C 3RZSA 1G8IA 3BFAA 1IGVA 4QJ3B 5CPVA 2LUCA 1KSOA 3OX5A 1B8LA 4ZCUA 1DJGA 1K9KA 3SG3A 3VROA 1KQMC 5JOLA 1BODA 3PSRA 2NZ0A 3NHIA 1J1DA 1CB1A 1XFXO 1CLMA 1K9PA 3BJHA 5DKRA 1B9AA 2JXCA 1HQVA 2JTZA 2PALA 3O4XA 1IJ6A 1SL7A 1BR1B 3DD4A 3EVUA 1NCYA 4E68A 1PSRA 1KK8C 1FI5A 2PQLA 2KHNA 3EKHA 4JKTA 1Q80A 4U8DA 4DS7A 2MLFC 4XYNA 1ZUZA 1BLQA 3TUYC 2EC6B 5HLVA 1GJYA 1F71A 1DGUA 1JUOA 1CTRA 1TRFA 3LK0A 1KQVA 5IBWA 5D69A 1M46A 2EHBA 2BBMA 2FCDA 5I2QA 1Y1UA 2BE6A 3CR4X 1ZMZA 1PALA 1CFCA 1H8BA 2V53A 3PATA 3VB1A 3BFHA 2TN4A 1CNPA 4WQ2A 1QX2A 3KHEA 1CFFA 4N1FA 2NXQA 2LLSA 2B1UA 3BXKA 1AK8A 4GAOA 1GGZA 4YI8A 4M2OA 3EK4A 4ICBA 2AAOA 1WDCB 1JSAA 3SS3A 1XFRA 2QACA 1C3ZA 2Y4QA 4I5LB 1JFKA 4ETOA 1FF1A 3I5IB 2KAVA 3DF0A 1TCOB 2BCXA 4R1EA 1V1FA 2JRFA 4WQ3A 3WXAA 2I2RE 3SG5A 1OMDA 1XFVO 4JD9A 1YRUB 1GM0A 3C1VA 2EC6C 2MAZA 2WORA 3NSKA 1A75A 1XK4C 2OTGB 4N5XA 1W7JB 4F0ZB 3PLFB 2LP3A 3NSOA 2JPTA 3ZNIA 2JT8A 4PCWA 1QTXA 1NPQA 3DVKA 2O60A 5B8IB 2HPSA 2YGUA 3AAJA 1OZSA 2GTEA 3K21A 4FQOA 1S26D 1UHJA 3WHTB 2KI6D 2JOJA 2M29A 3OHMB 2VRGA 3TDUA 5FYXA 5I94A 1A4PA 1LXFC 1JF2A 3F45A 1UHIA 4PHKA 4DCKA 2LANA 2HQ8A 2FCEA 2GGZA 2KFGA 4DUQA 2LCPA 1CFPA 1S6IA 5DKQA 4YBHB 2KBIA 3OBVA 5I2LA 4OVNF 1B7TY 3KO0A 3OB1B 5AERA 3JVTB 1WRKA 1IG5A 3BFBA 4TNCA 1PK0D 1J1EA 1XFYO 4OZDA 1F54A 1K2HA 1TNWA 1OW4A 1NCZA 1M31A 3GOFA 2OTGC 1BJFA 1KQMB 2WOSA 1PULA 1M45A 3RLZA 3WHUB 2QEVA 3UO9A 3DVJA 4GPLB 1OOIX 2NCOA 1C7WA 4GBAA 3DVMA 2WC8A 5ER4X 3CZ0A 1YX7A 5KU1A 4QJ4B 4PALA 4GFTA 1LINA 4YGEB 3PFVA 3B7AA 4P5OE 4UPGA 1GGWA 2MHHA 2CT9A 5D3OA 1DVIA 3LK1A 3TUYB 2L98A 3DY9A 4MRXA 2FJUB 2K7DA 4MZLA 3FE6A 4PDZA 1N65A 3L47A 3FIAA 1NX0A 1YUUA 4AOMA 4MLWA 4CIDA 2HF5A 1TOPA 1C3YA 5AFPA 2WC5A 3M0WA 1DGVA 1TN4A 1EH2A 1F8HA 1LS8A 1UURA 3JVTC 3MSEB 2Q91A 1BOCA 1MR8A 4OCIA 3TS5B 1SMGA 3QRXA 1NX1A 5AXIA 1EG4A 2LNKA 2JZIA 2D8NA 2LC5A 2K2AA 2KOTA 1LA0A 4WRIA 2BE4A 2LMUA 2FJYA 3FWBA 3AKAA 3D74A 2KBMA 2Y1NA 1J7QA 2LVKA 1JFJA 2Q4UA 3A8RA 3D77A 2JWWA 1QWVA 2K2FA 3I5GB 3KPXA 2ZNDA 3S0DA 2LLUA 2KYFA 1MUXA 2LM5A 1IKUA 3VRRA 1XK4A 3KF9A 4YGCB
chains in the Genus database with same CATH topology
3PM8A 1K94A 1F70A 1S36A 2LAPA 1B7TZ 2H61A 1S6CA 3BUMB 3D10A 2L4IA 3AKBA 1CKKA 4HREE 1SKTA 5I2OA 1SRAA 2G2BA 1S5GZ 1G33A 4HRHA 1A2XA 2WCBA 4GGNA 1SL8A 4M2PA 4AQIA 2KAYA 1J7PA 5TNCA 3TS5C 1EL4A 2CCMA 1B1GA 1YR5A 2KQYA 3O2PA 2COLB 3EK8A 4GUKA 1KFXS 3WNXB 1ALVA 1M63B 4PE0A 4I5JA 1H4BA 2SCPA 1AVSA 5HKWA 1XA5A 2K0JA 3I5GC 1EJ3A 1PVBA 1EG3A 2I94A 2CNPA 2KFFA 4YGAA 1K93D 3BUNB 1OZOA 1CMGA 3O4YA 1ALWA 2MJWB 1IRJA 4D1EA 1MXEA 1SCMC 1YX8A 3LLEA 4NDBA 1DMOA 4USLA 1FPWA 1WRZA 1L2OC 2AUCA 3FS7A 3KEVA 3VRQA 5HKZA 5KSZA 3CR5X 3HCMA 2CBLA 2L0PA 2F2OA 1QIWA 2EGDA 2GGMA 1KFUL 1OOJA 2M8UA 1RK9A 3BUOB 4GNKB 1Y0VH 4MZKA 4BY4A 1QV1A 1VRKA 1U5IA 2H61C 4P2YB 2KQ6A 2PRUA 3IQOA 4IL1A 1NWDA 1QV0A 1DJZA 2KAXA 2BL0B 2OPOA 3BUWB 3ZWHA 4OR9B 5HYDA 1CM4A 1U5IB 1CLBA 2BBNA 2SASA 1NUBA 1DJYA 1SYMA 1JBAA 1B47A 2FOTA 2DOQA 4YRUA 1RTP1 1CMFA 2KNEA 2M97A 1G4YR 1DF0A 1NSHA 3LL8B 2LMTA 3DVEA 1A29A 2MA2A 1PVAA 1FI6A 1TCFA 3AAKA 4YGBB 1AJ4A 4JQ0D 2KI6C 1QATA 1B4CA 1XFWO 1PSBA 1BU3A 1OQPA 2ZNEA 2BKIB 1DF0B 2M1KB 4ORCB 1S5GY 2PMYA 4CPVA 2NCPA 1K8UA 4MSPA 2LLTA 1TTXA 2JULA 3GK4X 1NCXA 2L5XB 1KCYA 4C0JA 1ODBA 1R6PA 4OV2A 1WY9A 4CFQA 1IWQA 2M0RA 3SG6A 5KTYA 3OX6A 1QASA 4MZJA 1BF5A 2JT3A 2L50A 1L7ZA 2L4HA 4M2QA 1BR4B 2BL0C 3SIAA 1NX2A 1AHRA 4ORBB 1WRLA 4A4BA 1UUSA 2ISDA 1UP5A 1BT6A 2HETA 1J55A 2GV5A 3GK2A 1K9UA 2PVBA 5DKNA 2ZN9A 1QX7A 1CLLA 1F4OA 1MXLC 1DJXA 4AQJA 2L2EA 4QJ5B 2H2KA 2JC2A 1J7OA 5HLOA 1X02A 5D7FA 3TDZA 1ZACA 2BKHB 1S6JA 1K96A 1S3PA 4HRGA 1YUSA 3D0YA 4MBEA 2LP2A 4DIRA 1FBVA 1SCVA 2K61A 1PRWA 1QVIY 1F4QA 1V1GA 4I5KA 1Y1AA 1N2DA 4HSZA 1OMRA 1SBJA 2NLNA 3NXAA 3BYAA 3O6BA 5J3XA 1CM1A 1WLZA 3D0YB 1QLSA 5I8NA 3LCPC 1SL9A 1AUIB 5PALA 1J7RA 2IS9A 2MLEC 4PE7A 1QIVA 1OMVA 3EVVA 4GGFC 1XFZO 1KFUS 1SCMB 1SR6B 2JQ6A 4OKHA 1L2OB 1W7IB 2A4JA 2WNDA 3BOWB 4XJKB 5CSIA 1M39A 2LHLA 1CDLA 1JF0A 5JJGA 4ZCVA 2K7OA 1DTLA 4BY5A 1Y6WA 1RROA 2ZN8A 2AMIA 5CSJA 1NIWA 2E30A 1LKJA 2M7LA 1XO5A 2KGRA 3SIBA 4YI9A 4PHMA 2KGBC 1UHNA 4MRYA 1D1OA 2LVVA 3SG2A 2K7BA 3IF7A 3ICBA 3NSLA 1S1EA 3OP0A 1RWYA 1UWOA 3CGAA 3GK1A 2K8MB 1A03A 5HKYA 3PALA 5AANA 2RGIA 5CSFA 3NSIA 3SG7A 1UHKA 3E3RA 4PHNA 1QXPA 1SR6C 4Q04A 1OSAA 1NYAA 1YVLA 1EXRA 2F8PA 2LE9B 2LUXA 3VRPA 5F6TA 2M49B 1QVIZ 4MVFA 2JXLA 1CDNA 2ZRSA 1YVHA 1Y1XA 4NDCA 3CS1A 1RECA 2ZFDA 1WLMA 1LVCD 2MRDA 1GQMA 4C0LA 2M9GA 2M3WA 4YGDB 1XVJA 2L51A 1DJHA 3EVRA 1C7VA 5K89A 1SY9A 2JNFA 3BQ3A 3SJSA 1TNPA 2JNXA 2KDHA 1XFUO 1E8AA 2BCAA 1YRTB 2MBXA 1BG1A 4L9MA 1C07A 1CDPA 1KK7Y 3FWCA 2KFHA 1SW8A 1JWDA 2LVJA 1FW4A 3EK7A 3I5HB 2KI4B 1IH0A 1SPYA 1R2UA 1TNXA 2JU0A 3DF0B 5GQQC 1B8RA 1YUTA 5ER5A 2OS8B 3JTDB 3CZTX 2F3ZA 5BPJA 4C0KA 1CDMA 2KYCA 1K90D 2G9BA 1YTZC 1QS7A 1KWOB 2KSPA 2LMVA 3RM1A 1QLKA 3H4SE 4PHJA 2F3YA 1A75B 2ZRTA 1IQ5A 4CFRA 2LV7A 1N0YA 4CLNA 1SK6D 2LVIA 2BECA 4GGFA 4PE4A 2M7NA 4A4CA 3VRNA 3CLNA 1TNQA 1HT9A 1WDCC 2JTTA 2ZKMX 4JWQA 1IJ5A 4N1GA 4NDDA 5AEQA 3I5FB 1NP8A 3SG4A 1CFDA 1MF8B 1B8CA 3I5IC 1KFXL 1QX5B 1AP4A 2WCEA 2M1UA 3TDIA 4MEWA 1YURA 1UHHA 2R2IA 1LA3A 3PN7B 1IQ3A 1K95A 1MQ1A 3VGOA 4DRWA 1MHOA 2LHIA 3IQQA 2Y1MA 3BUXB 3I5HC 2KI4C 2BCBA 4JPZB 2HQWA 1F55A 2I7AA 4PE1A 2CXJA 4MN0A 3CWGA 1DJWA 2OS8C 3JTDC 1RJVA 2WCFA 4I5NB 2CTNA 1BMOA 1ZOTB 5CSNA 1KWOC 2P6BB 2K7CA 3EKJA 1MWNA 2E6WA 1JC2A 3O78A 2F33A 1KK8B 1QJTA 4FTGA 1RFJA 2JT0A 2F2PA 4ORAB 1TIZA 1NX3A 1ZFSA 1KSMA 1KK7Z 2O5GA 2I18A 3OB2B 3HX4A 1XYDA 3BOWA 1DT7B 4XJKA 3CTNA 3I5FC 1AJ5A 3A4UB 2PASA 1SNLA 5G08A 2QPTA 2Y5IA 1DJIA 3CR2A 4NQGA 3TZ1A 2PSRA 1OE9B 3PN7C 1G8IA 1IGVA 4QJ3B 5CPVA 2LUCA 1KSOA 3OX5A 1B8LA 4ZCUA 1DJGA 1K9KA 3SG3A 3VROA 1KQMC 5JOLA 1BODA 3PSRA 2NZ0A 1CB1A 1J1DA 1XFXO 1CLMA 1K9PA 5DKRA 1B9AA 2JXCA 1HQVA 2JTZA 2PALA 1IJ6A 1SL7A 1BR1B 3DD4A 3EVUA 1NCYA 4E68A 1PSRA 1KK8C 1FI5A 2KHNA 3EKHA 4U8DA 1Q80A 4DS7A 2MLFC 4XYNA 1ZUZA 1BLQA 3TUYC 2EC6B 5HLVA 1GJYA 1F71A 1DGUA 1JUOA 1CTRA 1TRFA 3LK0A 1KQVA 5IBWA 5D69A 1M46A 2EHBA 2BBMA 2FCDA 5I2QA 1Y1UA 2BE6A 3CR4X 1ZMZA 1PALA 1CFCA 1H8BA 2V53A 3PATA 2TN4A 1CNPA 4WQ2A 1QX2A 3KHEA 1CFFA 4N1FA 2NXQA 2LLSA 2B1UA 3BXKA 1AK8A 4GAOA 1GGZA 4YI8A 4M2OA 3EK4A 4ICBA 2AAOA 1WDCB 1JSAA 2QACA 2Y4QA 4I5LB 1JFKA 4ETOA 1FF1A 3I5IB 2KAVA 3DF0A 1TCOB 2BCXA 4R1EA 1V1FA 2JRFA 4WQ3A 3WXAA 2I2RE 3SG5A 1OMDA 1XFVO 1YRUB 3C1VA 2EC6C 2MAZA 2WORA 3NSKA 1A75A 1XK4C 2OTGB 4N5XA 1W7JB 4F0ZB 3PLFB 2LP3A 3NSOA 2JPTA 3ZNIA 2JT8A 4PCWA 1QTXA 1NPQA 3DVKA 2O60A 5B8IB 2HPSA 3AAJA 1OZSA 3K21A 4FQOA 1S26D 1UHJA 3WHTB 2KI6D 2JOJA 2M29A 3OHMB 2VRGA 3TDUA 5FYXA 1A4PA 1LXFC 1JF2A 3F45A 1UHIA 4PHKA 4DCKA 2LANA 2HQ8A 2FCEA 2GGZA 2KFGA 4DUQA 2LCPA 1CFPA 1S6IA 5DKQA 4YBHB 2KBIA 5I2LA 4OVNF 1B7TY 3KO0A 3OB1B 5AERA 3JVTB 1WRKA 1IG5A 4TNCA 1PK0D 1J1EA 1XFYO 1F54A 1K2HA 1TNWA 1NCZA 1M31A 3GOFA 2OTGC 1BJFA 1KQMB 2WOSA 1PULA 1M45A 3RLZA 3WHUB 3DVJA 4GPLB 4GBAA 2NCOA 1C7WA 3DVMA 2WC8A 5ER4X 1YX7A 5KU1A 4QJ4B 4PALA 4GFTA 1LINA 4YGEB 3PFVA 4P5OE 4UPGA 1GGWA 2MHHA 2CT9A 1DVIA 3LK1A 3TUYB 2L98A 4MRXA 2FJUB 2K7DA 4MZLA 4PDZA 1N65A 3FIAA 1NX0A 1YUUA 4AOMA 4MLWA 4CIDA 2HF5A 1TOPA 5AFPA 3M0WA 1DGVA 1TN4A 1EH2A 1F8HA 1UURA 3JVTC 3MSEB 2Q91A 1BOCA 1MR8A 4OCIA 3TS5B 1SMGA 3QRXA 1NX1A 5AXIA 1EG4A 2LNKA 2JZIA 2D8NA 2LC5A 2K2AA 2KOTA 1LA0A 4WRIA 2BE4A 2LMUA 3FWBA 3AKAA 2KBMA 2Y1NA 1J7QA 2LVKA 1JFJA 2Q4UA 3A8RA 2JWWA 2K2FA 3I5GB 3KPXA 2ZNDA 2LLUA 2KYFA 1MUXA 2LM5A 1IKUA 3VRRA 1XK4A 3KF9A 4YGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PM8 A;  1K94 A;  1F70 A;  1S36 A;  2LAP A;  1B7T Z;  2H61 A;  1S6C A;  3BUM B;  3D10 A;  2L4I A;  3AKB A;  1CKK A;  4HRE E;  1SKT A;  5I2O A;  1SRA A;  2G2B A;  1S5G Z;  1G33 A;  4HRH A;  1A2X A;  2WCB A;  4GGN A;  1SL8 A;  4M2P A;  4AQI A;  2KAY A;  1J7P A;  5TNC A;  3TS5 C;  1EL4 A;  2CCM A;  1B1G A;  1YR5 A;  2KQY A;  3O2P A;  2COL B;  3EK8 A;  4GUK A;  1KFX S;  3WNX B;  1ALV A;  1M63 B;  4PE0 A;  4I5J A;  1H4B A;  2SCP A;  1AVS A;  5HKW A;  1XA5 A;  2K0J A;  3I5G C;  1EJ3 A;  1PVB A;  1EG3 A;  2I94 A;  2CNP A;  2KFF A;  4YGA A;  1K93 D;  3BUN B;  1OZO A;  1CMG A;  3O4Y A;  1ALW A;  2MJW B;  1IRJ A;  4D1E A;  1MXE A;  1SCM C;  1YX8 A;  3LLE A;  4NDB A;  1DMO A;  4USL A;  1FPW A;  1WRZ A;  1L2O C;  2AUC A;  3FS7 A;  3KEV A;  3VRQ A;  5HKZ A;  5KSZ A;  3CR5 X;  3HCM A;  2CBL A;  2L0P A;  2F2O A;  1QIW A;  2EGD A;  2GGM A;  1KFU L;  1OOJ A;  2M8U A;  1RK9 A;  3BUO B;  4GNK B;  1Y0V H;  4MZK A;  4BY4 A;  1QV1 A;  1VRK A;  1U5I A;  2H61 C;  4P2Y B;  2KQ6 A;  2PRU A;  3IQO A;  4IL1 A;  1NWD A;  1QV0 A;  1DJZ A;  2KAX A;  2BL0 B;  2OPO A;  3BUW B;  3ZWH A;  4OR9 B;  5HYD A;  1CM4 A;  1U5I B;  1CLB A;  2BBN A;  2SAS A;  1NUB A;  1DJY A;  1SYM A;  1JBA A;  1B47 A;  2FOT A;  2DOQ A;  4YRU A;  1RTP 1;  1CMF A;  2KNE A;  2M97 A;  1G4Y R;  1DF0 A;  1NSH A;  3LL8 B;  2LMT A;  3DVE A;  1A29 A;  2MA2 A;  1PVA A;  1FI6 A;  1TCF A;  3AAK A;  4YGB B;  1AJ4 A;  4JQ0 D;  2KI6 C;  1QAT A;  1B4C A;  1XFW O;  1PSB A;  1BU3 A;  1OQP A;  2ZNE A;  2BKI B;  1DF0 B;  2M1K B;  4ORC B;  1S5G Y;  2PMY A;  4CPV A;  2NCP A;  1K8U A;  4MSP A;  2LLT A;  1TTX A;  2JUL A;  3GK4 X;  1NCX A;  2L5X B;  1KCY A;  4C0J A;  1ODB A;  1R6P A;  4OV2 A;  1WY9 A;  4CFQ A;  1IWQ A;  2M0R A;  3SG6 A;  5KTY A;  3OX6 A;  1QAS A;  4MZJ A;  1BF5 A;  2JT3 A;  2L50 A;  1L7Z A;  2L4H A;  4M2Q A;  1BR4 B;  2BL0 C;  3SIA A;  1NX2 A;  1AHR A;  4ORB B;  1WRL A;  4A4B A;  1UUS A;  2ISD A;  1UP5 A;  1BT6 A;  2HET A;  1J55 A;  2GV5 A;  3GK2 A;  1K9U A;  2PVB A;  5DKN A;  2ZN9 A;  1QX7 A;  1CLL A;  1F4O A;  1MXL C;  1DJX A;  4AQJ A;  2L2E A;  4QJ5 B;  2H2K A;  2JC2 A;  1J7O A;  5HLO A;  1X02 A;  5D7F A;  3TDZ A;  1ZAC A;  2BKH B;  1S6J A;  1K96 A;  1S3P A;  4HRG A;  1YUS A;  3D0Y A;  4MBE A;  2LP2 A;  4DIR A;  1FBV A;  1SCV A;  2K61 A;  1PRW A;  1QVI Y;  1F4Q A;  1V1G A;  4I5K A;  1Y1A A;  1N2D A;  4HSZ A;  1OMR A;  1SBJ A;  2NLN A;  3NXA A;  3BYA A;  3O6B A;  5J3X A;  1CM1 A;  1WLZ A;  3D0Y B;  1QLS A;  5I8N A;  3LCP C;  1SL9 A;  1AUI B;  5PAL A;  1J7R A;  2IS9 A;  2MLE C;  4PE7 A;  1QIV A;  1OMV A;  3EVV A;  4GGF C;  1XFZ O;  1KFU S;  1SCM B;  1SR6 B;  2JQ6 A;  4OKH A;  1L2O B;  1W7I B;  2A4J A;  2WND A;  3BOW B;  4XJK B;  5CSI A;  1M39 A;  2LHL A;  1CDL A;  1JF0 A;  5JJG A;  4ZCV A;  2K7O A;  1DTL A;  4BY5 A;  1Y6W A;  1RRO A;  2ZN8 A;  2AMI A;  5CSJ A;  1NIW A;  2E30 A;  1LKJ A;  2M7L A;  1XO5 A;  2KGR A;  3SIB A;  4YI9 A;  4PHM A;  2KGB C;  1UHN A;  4MRY A;  1D1O A;  2LVV A;  3SG2 A;  2K7B A;  3IF7 A;  3ICB A;  3NSL A;  1S1E A;  3OP0 A;  1RWY A;  1UWO A;  3CGA A;  3GK1 A;  2K8M B;  1A03 A;  5HKY A;  3PAL A;  5AAN A;  2RGI A;  5CSF A;  3NSI A;  3SG7 A;  1UHK A;  3E3R A;  4PHN A;  1QXP A;  1SR6 C;  4Q04 A;  1OSA A;  1NYA A;  1YVL A;  1EXR A;  2F8P A;  2LE9 B;  2LUX A;  3VRP A;  5F6T A;  2M49 B;  1QVI Z;  4MVF A;  2JXL A;  1CDN A;  2ZRS A;  1YVH A;  1Y1X A;  4NDC A;  3CS1 A;  1REC A;  2ZFD A;  1WLM A;  1LVC D;  2MRD A;  1GQM A;  4C0L A;  2M9G A;  2M3W A;  4YGD B;  1XVJ A;  2L51 A;  1DJH A;  3EVR A;  1C7V A;  5K89 A;  1SY9 A;  2JNF A;  3BQ3 A;  3SJS A;  1TNP A;  2JNX A;  2KDH A;  1XFU O;  1E8A A;  2BCA A;  1YRT B;  2MBX A;  1BG1 A;  4L9M A;  1C07 A;  1CDP A;  1KK7 Y;  3FWC A;  2KFH A;  1SW8 A;  1JWD A;  2LVJ A;  1FW4 A;  3EK7 A;  3I5H B;  2KI4 B;  1IH0 A;  1SPY A;  1R2U A;  1TNX A;  2JU0 A;  3DF0 B;  5GQQ C;  1B8R A;  1YUT A;  5ER5 A;  2OS8 B;  3JTD B;  3CZT X;  2F3Z A;  5BPJ A;  4C0K A;  1CDM A;  2KYC A;  1K90 D;  2G9B A;  1YTZ C;  1QS7 A;  1KWO B;  2KSP A;  2LMV A;  3RM1 A;  1QLK A;  3H4S E;  4PHJ A;  2F3Y A;  1A75 B;  2ZRT A;  1IQ5 A;  4CFR A;  2LV7 A;  1N0Y A;  4CLN A;  1SK6 D;  2LVI A;  2BEC A;  4GGF A;  4PE4 A;  2M7N A;  4A4C A;  3VRN A;  3CLN A;  1TNQ A;  1HT9 A;  1WDC C;  2JTT A;  2ZKM X;  4JWQ A;  1IJ5 A;  4N1G A;  4NDD A;  5AEQ A;  3I5F B;  1NP8 A;  3SG4 A;  1CFD A;  1MF8 B;  1B8C A;  3I5I C;  1KFX L;  1QX5 B;  1AP4 A;  2WCE A;  2M1U A;  3TDI A;  4MEW A;  1YUR A;  1UHH A;  2R2I A;  1LA3 A;  3PN7 B;  1IQ3 A;  1K95 A;  1MQ1 A;  3VGO A;  4DRW A;  1MHO A;  2LHI A;  3IQQ A;  2Y1M A;  3BUX B;  3I5H C;  2KI4 C;  2BCB A;  4JPZ B;  2HQW A;  1F55 A;  2I7A A;  4PE1 A;  2CXJ A;  4MN0 A;  3CWG A;  1DJW A;  2OS8 C;  3JTD C;  1RJV A;  2WCF A;  4I5N B;  2CTN A;  1BMO A;  1ZOT B;  5CSN A;  1KWO C;  2P6B B;  2K7C A;  3EKJ A;  1MWN A;  2E6W A;  1JC2 A;  3O78 A;  2F33 A;  1KK8 B;  1QJT A;  4FTG A;  1RFJ A;  2JT0 A;  2F2P A;  4ORA B;  1TIZ A;  1NX3 A;  1ZFS A;  1KSM A;  1KK7 Z;  2O5G A;  2I18 A;  3OB2 B;  3HX4 A;  1XYD A;  3BOW A;  1DT7 B;  4XJK A;  3CTN A;  3I5F C;  1AJ5 A;  3A4U B;  2PAS A;  1SNL A;  5G08 A;  2QPT A;  2Y5I A;  1DJI A;  3CR2 A;  4NQG A;  3TZ1 A;  2PSR A;  1OE9 B;  3PN7 C;  1G8I A;  1IGV A;  4QJ3 B;  5CPV A;  2LUC A;  1KSO A;  3OX5 A;  1B8L A;  4ZCU A;  1DJG A;  1K9K A;  3SG3 A;  3VRO A;  1KQM C;  5JOL A;  1BOD A;  3PSR A;  2NZ0 A;  1CB1 A;  1J1D A;  1XFX O;  1CLM A;  1K9P A;  5DKR A;  1B9A A;  2JXC A;  1HQV A;  2JTZ A;  2PAL A;  1IJ6 A;  1SL7 A;  1BR1 B;  3DD4 A;  3EVU A;  1NCY A;  4E68 A;  1PSR A;  1KK8 C;  1FI5 A;  2KHN A;  3EKH A;  4U8D A;  1Q80 A;  4DS7 A;  2MLF C;  4XYN A;  1ZUZ A;  1BLQ A;  3TUY C;  2EC6 B;  5HLV A;  1GJY A;  1F71 A;  1DGU A;  1JUO A;  1CTR A;  1TRF A;  3LK0 A;  1KQV A;  5IBW A;  5D69 A;  1M46 A;  2EHB A;  2BBM A;  2FCD A;  5I2Q A;  1Y1U A;  2BE6 A;  3CR4 X;  1ZMZ A;  1PAL A;  1CFC A;  1H8B A;  2V53 A;  3PAT A;  2TN4 A;  1CNP A;  4WQ2 A;  1QX2 A;  3KHE A;  1CFF A;  4N1F A;  2NXQ A;  2LLS A;  2B1U A;  3BXK A;  1AK8 A;  4GAO A;  1GGZ A;  4YI8 A;  4M2O A;  3EK4 A;  4ICB A;  2AAO A;  1WDC B;  1JSA A;  2QAC A;  2Y4Q A;  4I5L B;  1JFK A;  4ETO A;  1FF1 A;  3I5I B;  2KAV A;  3DF0 A;  1TCO B;  2BCX A;  4R1E A;  1V1F A;  2JRF A;  4WQ3 A;  3WXA A;  2I2R E;  3SG5 A;  1OMD A;  1XFV O;  1YRU B;  3C1V A;  2EC6 C;  2MAZ A;  2WOR A;  3NSK A;  1A75 A;  1XK4 C;  2OTG B;  4N5X A;  1W7J B;  4F0Z B;  3PLF B;  2LP3 A;  3NSO A;  2JPT A;  3ZNI A;  2JT8 A;  4PCW A;  1QTX A;  1NPQ A;  3DVK A;  2O60 A;  5B8I B;  2HPS A;  3AAJ A;  1OZS A;  3K21 A;  4FQO A;  1S26 D;  1UHJ A;  3WHT B;  2KI6 D;  2JOJ A;  2M29 A;  3OHM B;  2VRG A;  3TDU A;  5FYX A;  1A4P A;  1LXF C;  1JF2 A;  3F45 A;  1UHI A;  4PHK A;  4DCK A;  2LAN A;  2HQ8 A;  2FCE A;  2GGZ A;  2KFG A;  4DUQ A;  2LCP A;  1CFP A;  1S6I A;  5DKQ A;  4YBH B;  2KBI A;  5I2L A;  4OVN F;  1B7T Y;  3KO0 A;  3OB1 B;  5AER A;  3JVT B;  1WRK A;  1IG5 A;  4TNC A;  1PK0 D;  1J1E A;  1XFY O;  1F54 A;  1K2H A;  1TNW A;  1NCZ A;  1M31 A;  3GOF A;  2OTG C;  1BJF A;  1KQM B;  2WOS A;  1PUL A;  1M45 A;  3RLZ A;  3WHU B;  3DVJ A;  4GPL B;  4GBA A;  2NCO A;  1C7W A;  3DVM A;  2WC8 A;  5ER4 X;  1YX7 A;  5KU1 A;  4QJ4 B;  4PAL A;  4GFT A;  1LIN A;  4YGE B;  3PFV A;  4P5O E;  4UPG A;  1GGW A;  2MHH A;  2CT9 A;  1DVI A;  3LK1 A;  3TUY B;  2L98 A;  4MRX A;  2FJU B;  2K7D A;  4MZL A;  4PDZ A;  1N65 A;  3FIA A;  1NX0 A;  1YUU A;  4AOM A;  4MLW A;  4CID A;  2HF5 A;  1TOP A;  5AFP A;  3M0W A;  1DGV A;  1TN4 A;  1EH2 A;  1F8H A;  1UUR A;  3JVT C;  3MSE B;  2Q91 A;  1BOC A;  1MR8 A;  4OCI A;  3TS5 B;  1SMG A;  3QRX A;  1NX1 A;  5AXI A;  1EG4 A;  2LNK A;  2JZI A;  2D8N A;  2LC5 A;  2K2A A;  2KOT A;  1LA0 A;  4WRI A;  2BE4 A;  2LMU A;  3FWB A;  3AKA A;  2KBM A;  2Y1N A;  1J7Q A;  2LVK A;  1JFJ A;  2Q4U A;  3A8R A;  2JWW A;  2K2F A;  3I5G B;  3KPX A;  2ZND A;  2LLU A;  2KYF A;  1MUX A;  2LM5 A;  1IKU A;  3VRR A;  1XK4 A;  3KF9 A;  4YGC B; 
#chains in the Genus database with same CATH topology
 2H8V A;  3CAB A;  1K94 A;  3PM8 A;  1F70 A;  1S36 A;  2LAP A;  1B7T Z;  2H61 A;  3R1V A;  1S6C A;  3BUM B;  3D10 A;  2L4I A;  3AKB A;  1CKK A;  4HRE E;  1SKT A;  5I2O A;  1SRA A;  2G2B A;  1DEK A;  1S5G Z;  5FI7 A;  1G33 A;  4HRH A;  1A2X A;  2WCB A;  4GGN A;  3K1E A;  1SL8 A;  3DXL A;  4M2P A;  4AQI A;  2KAY A;  1J7P A;  5HL1 A;  5TNC A;  5EL2 A;  3TS5 C;  1EL4 A;  2CCM A;  2L2C A;  1B1G A;  1YR5 A;  2KQY A;  3O2P A;  2COL B;  3EK8 A;  4GUK A;  1KFX S;  3WNX B;  1ALV A;  1M63 B;  4PE0 A;  3S0F A;  4I5J A;  1H4B A;  2SCP A;  1AVS A;  5HKW A;  1XA5 A;  2K0J A;  1T14 A;  3D78 A;  3I5G C;  1EJ3 A;  1PVB A;  1EG3 A;  2I94 A;  2CNP A;  2KFF A;  4YGA A;  1K93 D;  3BUN B;  1OZO A;  1CMG A;  3O4Y A;  1ALW A;  2MJW B;  1IRJ A;  3S0G A;  1MXE A;  1SCM C;  1YX8 A;  3LLE A;  4INX A;  4NDB A;  4USL A;  4D1E A;  1WRZ A;  1L2O C;  2AUC A;  3FS7 A;  3KEV A;  3Q8I A;  3VRQ A;  5HKZ A;  5KSZ A;  3CR5 X;  3EG5 B;  3HCM A;  2CBL A;  2L0P A;  2F2O A;  1QIW A;  2EGD A;  1ORG A;  1KFU L;  1OOJ A;  2GGM A;  1RK9 A;  2M8U A;  3BUO B;  1Y0V H;  4GNK B;  4MZK A;  4BY4 A;  1QV1 A;  1VRK A;  1U5I A;  2H61 C;  4P2Y B;  2KQ6 A;  2PRU A;  2WCJ A;  2QEO A;  3IQO A;  2JPO A;  4IL1 A;  1NWD A;  1QV0 A;  1DJZ A;  2KAX A;  2BL0 B;  2OPO A;  3BUW B;  3ZWH A;  4OR9 B;  3R72 A;  5HYD A;  1CM4 A;  1U5I B;  1CLB A;  2BBN A;  2SAS A;  1NUB A;  1DJY A;  1SYM A;  1JBA A;  1B47 A;  2FOT A;  2DOQ A;  4YRU A;  1RTP 1;  1CMF A;  2KNE A;  2M97 A;  1G4Y R;  1DF0 A;  1NSH A;  3LL8 B;  1FPW A;  3R1P A;  1P28 A;  2LMT A;  3DVE A;  1A29 A;  3CZ2 A;  2MA2 A;  1PVA A;  1FI6 A;  1TCF A;  3AAK A;  4YGB B;  1AJ4 A;  4JQ0 D;  2KI6 C;  1QAT A;  1B4C A;  1XFW O;  1PSB A;  1BU3 A;  1OQP A;  2QEB A;  2BKI B;  1DF0 B;  2M1K B;  2ZNE A;  4ORC B;  1S5G Y;  2PMY A;  2QDI A;  4CPV A;  2NCP A;  1K8U A;  4MSP A;  2LLT A;  1TTX A;  2JUL A;  3GK4 X;  1NCX A;  2L5X B;  3PJI A;  1DC1 A;  4C0J A;  1KCY A;  3DZT A;  1ODB A;  1R6P A;  3B87 A;  2P71 A;  4OV2 A;  1WY9 A;  4CFQ A;  1IWQ A;  2M0R A;  3D75 A;  3SG6 A;  3SS5 A;  3OX6 A;  5KTY A;  1QAS A;  4MZJ A;  1BF5 A;  2JT3 A;  2L50 A;  1L7Z A;  2L4H A;  4M2Q A;  2KLE A;  1BR4 B;  4PT1 A;  2BL0 C;  3SIA A;  3B86 A;  1NX2 A;  1AHR A;  4ORB B;  1WRL A;  4A4B A;  1UUS A;  2ISD A;  1UP5 A;  1BT6 A;  2HET A;  1J55 A;  2GV5 A;  3GK2 A;  1K9U A;  2PVB A;  5DKN A;  2ERB A;  2ZN9 A;  4IJ7 A;  1QX7 A;  1CLL A;  1F4O A;  1MXL C;  1TUJ A;  1DJX A;  4AQJ A;  2L2E A;  4QJ5 B;  2H2K A;  2JC2 A;  1J7O A;  5HLO A;  1X02 A;  5D7F A;  3TDZ A;  1ZAC A;  2BKH B;  1S6J A;  1K96 A;  1S3P A;  4HRG A;  1YUS A;  3D0Y A;  4MBE A;  2LP2 A;  1W9Z A;  4DIR A;  1FBV A;  1SCV A;  2K61 A;  1PRW A;  1QVI Y;  1F4Q A;  1V1G A;  4I5K A;  1Y1A A;  1N2D A;  2KPH A;  1OMR A;  1SBJ A;  4HSZ A;  2NLN A;  2WCH A;  3NXA A;  3BYA A;  3O6B A;  5J3X A;  1CM1 A;  1WLZ A;  3D0Y B;  1QLS A;  5I8N A;  3LCP C;  3NGV A;  1SL9 A;  1AUI B;  3IVT A;  5PAL A;  1J7R A;  2IS9 A;  2MLE C;  4PE7 A;  1QIV A;  1OMV A;  3EVV A;  4GGF C;  1XFZ O;  1KFU S;  1SCM B;  1SR6 B;  2JQ6 A;  4OKH A;  1L2O B;  1W7I B;  2A4J A;  2WND A;  3BOW B;  3NHT A;  4XJK B;  5CSI A;  4INW A;  1M39 A;  2BNX A;  2LHL A;  1CDL A;  1JF0 A;  5JJG A;  4ZCV A;  2K7O A;  3DYE A;  1DTL A;  2K60 A;  1Y6W A;  4BY5 A;  1IIO A;  1RRO A;  2BAP A;  2ZN8 A;  1TWO A;  2AMI A;  5CSJ A;  1NIW A;  2E30 A;  3S0B A;  1LKJ A;  2M7L A;  1XO5 A;  5FI6 A;  3SS4 A;  2KGR A;  3B88 A;  3UNW A;  3SIB A;  4YI9 A;  4PHM A;  2KGB C;  1UHN A;  4MRY A;  1D1O A;  2LVV A;  3SG2 A;  2K7B A;  3IF7 A;  3ICB A;  3NSL A;  1S1E A;  3OP0 A;  1RWY A;  1UWO A;  3CGA A;  3GK1 A;  2K8M B;  1A03 A;  5HKY A;  3PAL A;  5AAN A;  2RGI A;  5CSF A;  3NSI A;  3SG7 A;  3D73 A;  1UHK A;  3R1O A;  2WC6 A;  3E3R A;  4PHN A;  1QXP A;  1SR6 C;  4Q04 A;  1OSA A;  1NYA A;  1YVL A;  1EXR A;  2F8P A;  2LE9 B;  2LUX A;  3VRP A;  2L5Y A;  5F6T A;  2M49 B;  1QVI Z;  4MVF A;  2JXL A;  1CDN A;  2ZRS A;  3S0E A;  1YVH A;  1Y1X A;  4NDC A;  3CS1 A;  1REC A;  2ZFD A;  1WLM A;  1LVC D;  2MRD A;  1GQM A;  2WCM A;  3PM2 A;  2M9G A;  2M3W A;  4C0L A;  4YGD B;  1DEL A;  1XVJ A;  2L51 A;  1DJH A;  3EVR A;  1C7V A;  5K89 A;  1SY9 A;  2JNF A;  3BQ3 A;  3SJS A;  1TNP A;  2JNX A;  2KDH A;  1XFU O;  1E8A A;  2BCA A;  1YRT B;  2MBX A;  1BG1 A;  4L9M A;  1C07 A;  1CDP A;  1KK7 Y;  3FWC A;  2KFH A;  3L4A A;  2WCL A;  1SW8 A;  1JWD A;  2LVJ A;  1FW4 A;  1DMO A;  3D76 A;  3EK7 A;  3I5H B;  2KI4 B;  1IH0 A;  1SPY A;  1OOG A;  1R2U A;  1TNX A;  2JU0 A;  3DF0 B;  5GQQ C;  1B8R A;  2PYQ A;  1YUT A;  5ER5 A;  2OS8 B;  3JTD B;  3CZT X;  2F3Z A;  5FI2 A;  5BPJ A;  4C0K A;  1CDM A;  2KYC A;  1K90 D;  1Z4H A;  2G9B A;  1YTZ C;  1QS7 A;  4F7F A;  1KWO B;  2KSP A;  2LMV A;  3RM1 A;  1QLK A;  3H4S E;  4PHJ A;  1TUZ A;  2F3Y A;  1A75 B;  2ZRT A;  1IQ5 A;  4CFR A;  2LV7 A;  1N0Y A;  4CLN A;  3L4L A;  1OOF A;  1SK6 D;  2LVI A;  2BEC A;  4GGF A;  4PE4 A;  2M7N A;  3FE8 A;  4A4C A;  3VRN A;  3CLN A;  3S0A A;  1TNQ A;  1HT9 A;  1WDC C;  2JTT A;  2ZKM X;  3CYZ A;  4JWQ A;  1IJ5 A;  2QEH A;  4N1G A;  4NDD A;  5AEQ A;  3I5F B;  1NP8 A;  3SG4 A;  1CFD A;  1MF8 B;  1B8C A;  3I5I C;  1KFX L;  1QX5 B;  3B6X A;  1AP4 A;  2WCE A;  2M1U A;  3TDI A;  4MEW A;  1YUR A;  3CDN A;  1UHH A;  2P70 A;  2R2I A;  1LA3 A;  3PN7 B;  3V2L A;  1IQ3 A;  1K95 A;  1MQ1 A;  1Z2C B;  3VGO A;  2KLD A;  4DRW A;  1MHO A;  2LHI A;  3IQQ A;  2Y1M A;  3BUX B;  3I5H C;  2KI4 C;  2BCB A;  4JPZ B;  2HQW A;  1F55 A;  2I7A A;  4PE1 A;  5DIC A;  2CXJ A;  4MN0 A;  3CWG A;  1DJW A;  2OS8 C;  3JTD C;  1RJV A;  2WCF A;  4I5N B;  2CTN A;  1BMO A;  1ZOT B;  5CSN A;  1OOH A;  3N7H A;  1KWO C;  2P6B B;  2K7C A;  3FE9 A;  3EKJ A;  1MWN A;  3QME A;  2E6W A;  1JC2 A;  3O78 A;  2F33 A;  1KK8 B;  1QJT A;  4FTG A;  1RFJ A;  2JT0 A;  2F2P A;  4ORA B;  1TIZ A;  1NX3 A;  1ZFS A;  1KSM A;  1KK7 Z;  2WCK A;  1DQE A;  2O5G A;  3OGN A;  2I18 A;  3OB2 B;  4KYN A;  3HX4 A;  1XYD A;  3BOW A;  1DT7 B;  4XJK A;  3CTN A;  3I5F C;  1AJ5 A;  3A4U B;  1SSE B;  2PAS A;  1SNL A;  4FQT A;  5G08 A;  2QPT A;  2Y5I A;  1DJI A;  3CR2 A;  4NQG A;  3TZ1 A;  2PSR A;  3CZ1 A;  1OE9 B;  3PN7 C;  3RZS A;  1G8I A;  3BFA A;  1IGV A;  4QJ3 B;  5CPV A;  2LUC A;  1KSO A;  3OX5 A;  1B8L A;  4ZCU A;  1DJG A;  1K9K A;  3SG3 A;  3VRO A;  1KQM C;  5JOL A;  1BOD A;  3PSR A;  2NZ0 A;  3NHI A;  1J1D A;  1CB1 A;  1XFX O;  1CLM A;  1K9P A;  3BJH A;  5DKR A;  1B9A A;  2JXC A;  1HQV A;  2JTZ A;  2PAL A;  3O4X A;  1IJ6 A;  1SL7 A;  1BR1 B;  3DD4 A;  3EVU A;  1NCY A;  4E68 A;  1PSR A;  1KK8 C;  1FI5 A;  2PQL A;  2KHN A;  3EKH A;  4JKT A;  1Q80 A;  4U8D A;  4DS7 A;  2MLF C;  4XYN A;  1ZUZ A;  1BLQ A;  3TUY C;  2EC6 B;  5HLV A;  1GJY A;  1F71 A;  1DGU A;  1JUO A;  1CTR A;  1TRF A;  3LK0 A;  1KQV A;  5IBW A;  5D69 A;  1M46 A;  2EHB A;  2BBM A;  2FCD A;  5I2Q A;  1Y1U A;  2BE6 A;  3CR4 X;  1ZMZ A;  1PAL A;  1CFC A;  1H8B A;  2V53 A;  3PAT A;  3VB1 A;  3BFH A;  2TN4 A;  1CNP A;  4WQ2 A;  1QX2 A;  3KHE A;  1CFF A;  4N1F A;  2NXQ A;  2LLS A;  2B1U A;  3BXK A;  1AK8 A;  4GAO A;  1GGZ A;  4YI8 A;  4M2O A;  3EK4 A;  4ICB A;  2AAO A;  1WDC B;  1JSA A;  3SS3 A;  1XFR A;  2QAC A;  1C3Z A;  2Y4Q A;  4I5L B;  1JFK A;  4ETO A;  1FF1 A;  3I5I B;  2KAV A;  3DF0 A;  1TCO B;  2BCX A;  4R1E A;  1V1F A;  2JRF A;  4WQ3 A;  3WXA A;  2I2R E;  3SG5 A;  1OMD A;  1XFV O;  4JD9 A;  1YRU B;  1GM0 A;  3C1V A;  2EC6 C;  2MAZ A;  2WOR A;  3NSK A;  1A75 A;  1XK4 C;  2OTG B;  4N5X A;  1W7J B;  4F0Z B;  3PLF B;  2LP3 A;  3NSO A;  2JPT A;  3ZNI A;  2JT8 A;  4PCW A;  1QTX A;  1NPQ A;  3DVK A;  2O60 A;  5B8I B;  2HPS A;  2YGU A;  3AAJ A;  1OZS A;  2GTE A;  3K21 A;  4FQO A;  1S26 D;  1UHJ A;  3WHT B;  2KI6 D;  2JOJ A;  2M29 A;  3OHM B;  2VRG A;  3TDU A;  5FYX A;  5I94 A;  1A4P A;  1LXF C;  1JF2 A;  3F45 A;  1UHI A;  4PHK A;  4DCK A;  2LAN A;  2HQ8 A;  2FCE A;  2GGZ A;  2KFG A;  4DUQ A;  2LCP A;  1CFP A;  1S6I A;  5DKQ A;  4YBH B;  2KBI A;  3OBV A;  5I2L A;  4OVN F;  1B7T Y;  3KO0 A;  3OB1 B;  5AER A;  3JVT B;  1WRK A;  1IG5 A;  3BFB A;  4TNC A;  1PK0 D;  1J1E A;  1XFY O;  4OZD A;  1F54 A;  1K2H A;  1TNW A;  1OW4 A;  1NCZ A;  1M31 A;  3GOF A;  2OTG C;  1BJF A;  1KQM B;  2WOS A;  1PUL A;  1M45 A;  3RLZ A;  3WHU B;  2QEV A;  3UO9 A;  3DVJ A;  4GPL B;  1OOI X;  2NCO A;  1C7W A;  4GBA A;  3DVM A;  2WC8 A;  5ER4 X;  3CZ0 A;  1YX7 A;  5KU1 A;  4QJ4 B;  4PAL A;  4GFT A;  1LIN A;  4YGE B;  3PFV A;  3B7A A;  4P5O E;  4UPG A;  1GGW A;  2MHH A;  2CT9 A;  5D3O A;  1DVI A;  3LK1 A;  3TUY B;  2L98 A;  3DY9 A;  4MRX A;  2FJU B;  2K7D A;  4MZL A;  3FE6 A;  4PDZ A;  1N65 A;  3L47 A;  3FIA A;  1NX0 A;  1YUU A;  4AOM A;  4MLW A;  4CID A;  2HF5 A;  1TOP A;  1C3Y A;  5AFP A;  2WC5 A;  3M0W A;  1DGV A;  1TN4 A;  1EH2 A;  1F8H A;  1LS8 A;  1UUR A;  3JVT C;  3MSE B;  2Q91 A;  1BOC A;  1MR8 A;  4OCI A;  3TS5 B;  1SMG A;  3QRX A;  1NX1 A;  5AXI A;  1EG4 A;  2LNK A;  2JZI A;  2D8N A;  2LC5 A;  2K2A A;  2KOT A;  1LA0 A;  4WRI A;  2BE4 A;  2LMU A;  2FJY A;  3FWB A;  3AKA A;  3D74 A;  2KBM A;  2Y1N A;  1J7Q A;  2LVK A;  1JFJ A;  2Q4U A;  3A8R A;  3D77 A;  2JWW A;  1QWV A;  2K2F A;  3I5G B;  3KPX A;  2ZND A;  3S0D A;  2LLU A;  2KYF A;  1MUX A;  2LM5 A;  1IKU A;  3VRR A;  1XK4 A;  3KF9 A;  4YGC B; 
#chains in the Genus database with same CATH homology
 3PM8 A;  1K94 A;  1F70 A;  1S36 A;  2LAP A;  1B7T Z;  2H61 A;  1S6C A;  3BUM B;  3D10 A;  2L4I A;  3AKB A;  1CKK A;  4HRE E;  1SKT A;  5I2O A;  1SRA A;  2G2B A;  1S5G Z;  1G33 A;  4HRH A;  1A2X A;  2WCB A;  4GGN A;  1SL8 A;  4M2P A;  4AQI A;  2KAY A;  1J7P A;  5TNC A;  3TS5 C;  1EL4 A;  2CCM A;  1B1G A;  1YR5 A;  2KQY A;  3O2P A;  2COL B;  3EK8 A;  4GUK A;  1KFX S;  3WNX B;  1ALV A;  1M63 B;  4PE0 A;  4I5J A;  1H4B A;  2SCP A;  1AVS A;  5HKW A;  1XA5 A;  2K0J A;  3I5G C;  1EJ3 A;  1PVB A;  1EG3 A;  2I94 A;  2CNP A;  2KFF A;  4YGA A;  1K93 D;  3BUN B;  1OZO A;  1CMG A;  3O4Y A;  1ALW A;  2MJW B;  1IRJ A;  4D1E A;  1MXE A;  1SCM C;  1YX8 A;  3LLE A;  4NDB A;  1DMO A;  4USL A;  1FPW A;  1WRZ A;  1L2O C;  2AUC A;  3FS7 A;  3KEV A;  3VRQ A;  5HKZ A;  5KSZ A;  3CR5 X;  3HCM A;  2CBL A;  2L0P A;  2F2O A;  1QIW A;  2EGD A;  2GGM A;  1KFU L;  1OOJ A;  2M8U A;  1RK9 A;  3BUO B;  4GNK B;  1Y0V H;  4MZK A;  4BY4 A;  1QV1 A;  1VRK A;  1U5I A;  2H61 C;  4P2Y B;  2KQ6 A;  2PRU A;  3IQO A;  4IL1 A;  1NWD A;  1QV0 A;  1DJZ A;  2KAX A;  2BL0 B;  2OPO A;  3BUW B;  3ZWH A;  4OR9 B;  5HYD A;  1CM4 A;  1U5I B;  1CLB A;  2BBN A;  2SAS A;  1NUB A;  1DJY A;  1SYM A;  1JBA A;  1B47 A;  2FOT A;  2DOQ A;  4YRU A;  1RTP 1;  1CMF A;  2KNE A;  2M97 A;  1G4Y R;  1DF0 A;  1NSH A;  3LL8 B;  2LMT A;  3DVE A;  1A29 A;  2MA2 A;  1PVA A;  1FI6 A;  1TCF A;  3AAK A;  4YGB B;  1AJ4 A;  4JQ0 D;  2KI6 C;  1QAT A;  1B4C A;  1XFW O;  1PSB A;  1BU3 A;  1OQP A;  2ZNE A;  2BKI B;  1DF0 B;  2M1K B;  4ORC B;  1S5G Y;  2PMY A;  4CPV A;  2NCP A;  1K8U A;  4MSP A;  2LLT A;  1TTX A;  2JUL A;  3GK4 X;  1NCX A;  2L5X B;  1KCY A;  4C0J A;  1ODB A;  1R6P A;  4OV2 A;  1WY9 A;  4CFQ A;  1IWQ A;  2M0R A;  3SG6 A;  5KTY A;  3OX6 A;  1QAS A;  4MZJ A;  1BF5 A;  2JT3 A;  2L50 A;  1L7Z A;  2L4H A;  4M2Q A;  1BR4 B;  2BL0 C;  3SIA A;  1NX2 A;  1AHR A;  4ORB B;  1WRL A;  4A4B A;  1UUS A;  2ISD A;  1UP5 A;  1BT6 A;  2HET A;  1J55 A;  2GV5 A;  3GK2 A;  1K9U A;  2PVB A;  5DKN A;  2ZN9 A;  1QX7 A;  1CLL A;  1F4O A;  1MXL C;  1DJX A;  4AQJ A;  2L2E A;  4QJ5 B;  2H2K A;  2JC2 A;  1J7O A;  5HLO A;  1X02 A;  5D7F A;  3TDZ A;  1ZAC A;  2BKH B;  1S6J A;  1K96 A;  1S3P A;  4HRG A;  1YUS A;  3D0Y A;  4MBE A;  2LP2 A;  4DIR A;  1FBV A;  1SCV A;  2K61 A;  1PRW A;  1QVI Y;  1F4Q A;  1V1G A;  4I5K A;  1Y1A A;  1N2D A;  4HSZ A;  1OMR A;  1SBJ A;  2NLN A;  3NXA A;  3BYA A;  3O6B A;  5J3X A;  1CM1 A;  1WLZ A;  3D0Y B;  1QLS A;  5I8N A;  3LCP C;  1SL9 A;  1AUI B;  5PAL A;  1J7R A;  2IS9 A;  2MLE C;  4PE7 A;  1QIV A;  1OMV A;  3EVV A;  4GGF C;  1XFZ O;  1KFU S;  1SCM B;  1SR6 B;  2JQ6 A;  4OKH A;  1L2O B;  1W7I B;  2A4J A;  2WND A;  3BOW B;  4XJK B;  5CSI A;  1M39 A;  2LHL A;  1CDL A;  1JF0 A;  5JJG A;  4ZCV A;  2K7O A;  1DTL A;  4BY5 A;  1Y6W A;  1RRO A;  2ZN8 A;  2AMI A;  5CSJ A;  1NIW A;  2E30 A;  1LKJ A;  2M7L A;  1XO5 A;  2KGR A;  3SIB A;  4YI9 A;  4PHM A;  2KGB C;  1UHN A;  4MRY A;  1D1O A;  2LVV A;  3SG2 A;  2K7B A;  3IF7 A;  3ICB A;  3NSL A;  1S1E A;  3OP0 A;  1RWY A;  1UWO A;  3CGA A;  3GK1 A;  2K8M B;  1A03 A;  5HKY A;  3PAL A;  5AAN A;  2RGI A;  5CSF A;  3NSI A;  3SG7 A;  1UHK A;  3E3R A;  4PHN A;  1QXP A;  1SR6 C;  4Q04 A;  1OSA A;  1NYA A;  1YVL A;  1EXR A;  2F8P A;  2LE9 B;  2LUX A;  3VRP A;  5F6T A;  2M49 B;  1QVI Z;  4MVF A;  2JXL A;  1CDN A;  2ZRS A;  1YVH A;  1Y1X A;  4NDC A;  3CS1 A;  1REC A;  2ZFD A;  1WLM A;  1LVC D;  2MRD A;  1GQM A;  4C0L A;  2M9G A;  2M3W A;  4YGD B;  1XVJ A;  2L51 A;  1DJH A;  3EVR A;  1C7V A;  5K89 A;  1SY9 A;  2JNF A;  3BQ3 A;  3SJS A;  1TNP A;  2JNX A;  2KDH A;  1XFU O;  1E8A A;  2BCA A;  1YRT B;  2MBX A;  1BG1 A;  4L9M A;  1C07 A;  1CDP A;  1KK7 Y;  3FWC A;  2KFH A;  1SW8 A;  1JWD A;  2LVJ A;  1FW4 A;  3EK7 A;  3I5H B;  2KI4 B;  1IH0 A;  1SPY A;  1R2U A;  1TNX A;  2JU0 A;  3DF0 B;  5GQQ C;  1B8R A;  1YUT A;  5ER5 A;  2OS8 B;  3JTD B;  3CZT X;  2F3Z A;  5BPJ A;  4C0K A;  1CDM A;  2KYC A;  1K90 D;  2G9B A;  1YTZ C;  1QS7 A;  1KWO B;  2KSP A;  2LMV A;  3RM1 A;  1QLK A;  3H4S E;  4PHJ A;  2F3Y A;  1A75 B;  2ZRT A;  1IQ5 A;  4CFR A;  2LV7 A;  1N0Y A;  4CLN A;  1SK6 D;  2LVI A;  2BEC A;  4GGF A;  4PE4 A;  2M7N A;  4A4C A;  3VRN A;  3CLN A;  1TNQ A;  1HT9 A;  1WDC C;  2JTT A;  2ZKM X;  4JWQ A;  1IJ5 A;  4N1G A;  4NDD A;  5AEQ A;  3I5F B;  1NP8 A;  3SG4 A;  1CFD A;  1MF8 B;  1B8C A;  3I5I C;  1KFX L;  1QX5 B;  1AP4 A;  2WCE A;  2M1U A;  3TDI A;  4MEW A;  1YUR A;  1UHH A;  2R2I A;  1LA3 A;  3PN7 B;  1IQ3 A;  1K95 A;  1MQ1 A;  3VGO A;  4DRW A;  1MHO A;  2LHI A;  3IQQ A;  2Y1M A;  3BUX B;  3I5H C;  2KI4 C;  2BCB A;  4JPZ B;  2HQW A;  1F55 A;  2I7A A;  4PE1 A;  2CXJ A;  4MN0 A;  3CWG A;  1DJW A;  2OS8 C;  3JTD C;  1RJV A;  2WCF A;  4I5N B;  2CTN A;  1BMO A;  1ZOT B;  5CSN A;  1KWO C;  2P6B B;  2K7C A;  3EKJ A;  1MWN A;  2E6W A;  1JC2 A;  3O78 A;  2F33 A;  1KK8 B;  1QJT A;  4FTG A;  1RFJ A;  2JT0 A;  2F2P A;  4ORA B;  1TIZ A;  1NX3 A;  1ZFS A;  1KSM A;  1KK7 Z;  2O5G A;  2I18 A;  3OB2 B;  3HX4 A;  1XYD A;  3BOW A;  1DT7 B;  4XJK A;  3CTN A;  3I5F C;  1AJ5 A;  3A4U B;  2PAS A;  1SNL A;  5G08 A;  2QPT A;  2Y5I A;  1DJI A;  3CR2 A;  4NQG A;  3TZ1 A;  2PSR A;  1OE9 B;  3PN7 C;  1G8I A;  1IGV A;  4QJ3 B;  5CPV A;  2LUC A;  1KSO A;  3OX5 A;  1B8L A;  4ZCU A;  1DJG A;  1K9K A;  3SG3 A;  3VRO A;  1KQM C;  5JOL A;  1BOD A;  3PSR A;  2NZ0 A;  1CB1 A;  1J1D A;  1XFX O;  1CLM A;  1K9P A;  5DKR A;  1B9A A;  2JXC A;  1HQV A;  2JTZ A;  2PAL A;  1IJ6 A;  1SL7 A;  1BR1 B;  3DD4 A;  3EVU A;  1NCY A;  4E68 A;  1PSR A;  1KK8 C;  1FI5 A;  2KHN A;  3EKH A;  4U8D A;  1Q80 A;  4DS7 A;  2MLF C;  4XYN A;  1ZUZ A;  1BLQ A;  3TUY C;  2EC6 B;  5HLV A;  1GJY A;  1F71 A;  1DGU A;  1JUO A;  1CTR A;  1TRF A;  3LK0 A;  1KQV A;  5IBW A;  5D69 A;  1M46 A;  2EHB A;  2BBM A;  2FCD A;  5I2Q A;  1Y1U A;  2BE6 A;  3CR4 X;  1ZMZ A;  1PAL A;  1CFC A;  1H8B A;  2V53 A;  3PAT A;  2TN4 A;  1CNP A;  4WQ2 A;  1QX2 A;  3KHE A;  1CFF A;  4N1F A;  2NXQ A;  2LLS A;  2B1U A;  3BXK A;  1AK8 A;  4GAO A;  1GGZ A;  4YI8 A;  4M2O A;  3EK4 A;  4ICB A;  2AAO A;  1WDC B;  1JSA A;  2QAC A;  2Y4Q A;  4I5L B;  1JFK A;  4ETO A;  1FF1 A;  3I5I B;  2KAV A;  3DF0 A;  1TCO B;  2BCX A;  4R1E A;  1V1F A;  2JRF A;  4WQ3 A;  3WXA A;  2I2R E;  3SG5 A;  1OMD A;  1XFV O;  1YRU B;  3C1V A;  2EC6 C;  2MAZ A;  2WOR A;  3NSK A;  1A75 A;  1XK4 C;  2OTG B;  4N5X A;  1W7J B;  4F0Z B;  3PLF B;  2LP3 A;  3NSO A;  2JPT A;  3ZNI A;  2JT8 A;  4PCW A;  1QTX A;  1NPQ A;  3DVK A;  2O60 A;  5B8I B;  2HPS A;  3AAJ A;  1OZS A;  3K21 A;  4FQO A;  1S26 D;  1UHJ A;  3WHT B;  2KI6 D;  2JOJ A;  2M29 A;  3OHM B;  2VRG A;  3TDU A;  5FYX A;  1A4P A;  1LXF C;  1JF2 A;  3F45 A;  1UHI A;  4PHK A;  4DCK A;  2LAN A;  2HQ8 A;  2FCE A;  2GGZ A;  2KFG A;  4DUQ A;  2LCP A;  1CFP A;  1S6I A;  5DKQ A;  4YBH B;  2KBI A;  5I2L A;  4OVN F;  1B7T Y;  3KO0 A;  3OB1 B;  5AER A;  3JVT B;  1WRK A;  1IG5 A;  4TNC A;  1PK0 D;  1J1E A;  1XFY O;  1F54 A;  1K2H A;  1TNW A;  1NCZ A;  1M31 A;  3GOF A;  2OTG C;  1BJF A;  1KQM B;  2WOS A;  1PUL A;  1M45 A;  3RLZ A;  3WHU B;  3DVJ A;  4GPL B;  4GBA A;  2NCO A;  1C7W A;  3DVM A;  2WC8 A;  5ER4 X;  1YX7 A;  5KU1 A;  4QJ4 B;  4PAL A;  4GFT A;  1LIN A;  4YGE B;  3PFV A;  4P5O E;  4UPG A;  1GGW A;  2MHH A;  2CT9 A;  1DVI A;  3LK1 A;  3TUY B;  2L98 A;  4MRX A;  2FJU B;  2K7D A;  4MZL A;  4PDZ A;  1N65 A;  3FIA A;  1NX0 A;  1YUU A;  4AOM A;  4MLW A;  4CID A;  2HF5 A;  1TOP A;  5AFP A;  3M0W A;  1DGV A;  1TN4 A;  1EH2 A;  1F8H A;  1UUR A;  3JVT C;  3MSE B;  2Q91 A;  1BOC A;  1MR8 A;  4OCI A;  3TS5 B;  1SMG A;  3QRX A;  1NX1 A;  5AXI A;  1EG4 A;  2LNK A;  2JZI A;  2D8N A;  2LC5 A;  2K2A A;  2KOT A;  1LA0 A;  4WRI A;  2BE4 A;  2LMU A;  3FWB A;  3AKA A;  2KBM A;  2Y1N A;  1J7Q A;  2LVK A;  1JFJ A;  2Q4U A;  3A8R A;  2JWW A;  2K2F A;  3I5G B;  3KPX A;  2ZND A;  2LLU A;  2KYF A;  1MUX A;  2LM5 A;  1IKU A;  3VRR A;  1XK4 A;  3KF9 A;  4YGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...