3DVKA

Crystal structure of ca2+/cam-cav2.3 iq domain complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
143
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 50
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvkA00
1ZMZA 2KQ6A 5AERA 2KYCA 1UWOA 1W7JB 3TDIA 2F8PA 3CWGA 1TRFA 4ZCUA 2KGBC 2OS8C 1DJHA 3O78A 2WC8A 2TN4A 2PRUA 1SY9A 2P6BB 1BOCA 2JXCA 2Q91A 4NDCA 4PHMA 1RROA 3PATA 3PLFB 1W7IB 1KCYA 4GBAA 1SMGA 2M97A 3D0YA 4C0LA 1CDNA 1SCMB 1QASA 1LXFC 2QPTA 1G4YR 2M7NA 4OVNF 2H61C 2BBMA 1DVIA 2JC2A 1U5IA 5D7FA 4NDBA 1K95A 3LK1A 2K7DA 1FBVA 3CGAA 4PE1A 3TS5C 3OX5A 1AUIB 1F4OA 3QRXA 3EKJA 4TNCA 3CR2A 2LHLA 1Y6WA 4GUKA 2I18A 2KBIA 4YI8A 4GGFA 2JWWA 1WDCB 4I5NB 1CB1A 1BLQA 1C07A 5FYXA 4QJ5B 3D0YB 3BUMB 4DUQA 2L50A 3DD4A 1F71A 1WLMA 2WORA 1U5IB 2LLUA 3E3RA 4XYNA 1TNWA 1JBAA 1DJYA 3D10A 3O6BA 2PVBA 4N5XA 2WCFA 2L98A 1B8LA 3I5FB 4OV2A 2JTZA 1RK9A 2L5XB 3HX4A 1CDLA 1IGVA 1SL8A 3NSIA 1GJYA 1KSOA 5AFPA 3A8RA 1DJXA 1S5GZ 1B7TY 1YURA 1YR5A 2LUXA 2V53A 2KSPA 1CFFA 1IKUA 1S3PA 2VRGA 3TS5B 1ODBA 3PN7B 2BCAA 3EK4A 1A2XA 3SIAA 4OR9B 2EC6B 3I5HC 3VRPA 5KSZA 1KQVA 3EK8A 1TTXA 1MR8A 3CZTX 1SNLA 2FCEA 4JPZB 1IJ6A 1L2OC 2JNFA 1YRTB 2COLB 2O5GA 2M7LA 4YGDB 4YBHB 3OB1B 1KQMC 1C7WA 1LA0A 1OMVA 2M9GA 3SIBA 5AXIA 2AUCA 1CLBA 1Y1XA 1XFUO 1X02A 1YUSA 1K9UA 3HCMA 3TZ1A 1FI6A 1S6CA 1S6JA 1BJFA 2JXLA 4YI9A 1CFCA 4GFTA 1QIVA 1QS7A 1QX2A 2WNDA 4PDZA 1DMOA 5JJGA 4MRYA 1KWOC 2KI4B 1IQ5A 3LCPC 3SG5A 4MEWA 2OPOA 4A4CA 5GQQC 2JU0A 1TNXA 2JT8A 3LLEA 1EXRA 1J7RA 1QTXA 1PULA 1SCVA 2LCPA 2M49B 1QX5B 5HLOA 1DT7B 4YGEB 4I5JA 4Q04A 1SL9A 2F3YA 3IQQA 1DJGA 2KYFA 1N0YA 3WHTB 2F2OA 1SCMC 1TNQA 1CKKA 3CR5X 2NCOA 2L51A 1RECA 1V1GA 1K2HA 4USLA 1CDPA 1DJZA 1A03A 1KQMB 2LLSA 1YUUA 1DJWA 2LVKA 2HQ8A 3SG2A 2NXQA 3DVKA 1SL7A 3VRRA 4PHKA 1EJ3A 2MBXA 3FIAA 4YGBB 1XK4C 1Y0VH 1ALVA 1SBJA 2FCDA 3VROA 1S5GY 2CTNA 1EL4A 4AQJA 3NSOA 2LP3A 4HREE 1OOJA 4A4BA 1B7TZ 1WDCC 4OKHA 3DVEA 2MJWB 2I7AA 1G33A 1JF2A 1WLZA 2LM5A 3GOFA 3TDZA 1E8AA 3MSEB 2EHBA 1MXLC 2KFGA 2L2EA 3OP0A 1AJ5A 1F55A 5DKRA 4M2QA 1FI5A 3TDUA 1XK4A 1KSMA 1M63B 1N65A 1XFWO 3NSKA 3F45A 4ETOA 3PALA 1BR1B 5I8NA 1OMDA 1V1FA 4C0JA 3I5FC 2LV7A 3KPXA 1JFJA 4ORCB 1NP8A 2KBMA 1S26D 1OE9B 2PMYA 5CSIA 1RTP1 5JOLA 4JWQA 4MVFA 2BBNA 1WRZA 1SR6C 2AAOA 2BE4A 2ZN8A 1DGVA 4L9MA 1CNPA 3PN7C 2ISDA 2MA2A 1WRKA 5HKYA 2KI6D 2BKIB 2LHIA 3SG3A 2EC6C 1DF0A 1BMOA 2K2FA 1B8RA 1J55A 1JF0A 3NXAA 2HETA 4BY5A 4HRHA 2K2AA 3EK7A 4DS7A 2GGZA 3ICBA 2M8UA 1K9PA 3O4YA 2LAPA 2HQWA 1TCFA 1BF5A 1UHIA 1ALWA 4C0KA 2BKHB 2ZN9A 4ORBB 2Y5IA 3CTNA 2QACA 4MZJA 1GQMA 2ZFDA 1RWYA 1QATA 1PK0D 2MLEC 3BQ3A 3NSLA 1F8HA 1JSAA 1Y1AA 1SYMA 1XFYO 3GK2A 5CSFA 3WNXB 1DF0B 1XVJA 3BUXB 2KFHA 4PHNA 1G8IA 1HT9A 2KI4C 1S36A 1LKJA 1A29A 4AOMA 2L0PA 5I2OA 2BCBA 2Y1NA 1K8UA 1J7OA 1SR6B 2JZIA 2KNEA 4R1EA 4OCIA 3ZWHA 1IG5A 3VRNA 3DVJA 4GGFC 1NCYA 2JULA 4MBEA 2M3WA 1M45A 1PALA 2LE9B 3EKHA 3JVTB 4DRWA 1XO5A 4CIDA 1MF8B 1MHOA 1QLKA 1CM4A 3BOWA 1JC2A 4GPLB 1BU3A 1IRJA 4DCKA 5TNCA 1NYAA 5CPVA 1Q80A 1UURA 5PALA 1NX3A 2CBLA 5KU1A 1B1GA 1CMGA 1F70A 2ZRSA 1LINA 2K7CA 1ZFSA 3EVRA 1KK8B 1TOPA 1QX7A 2K8MB 1UHJA 4FQOA 1NIWA 2MHHA 3PSRA 4U8DA 1CTRA 2F2PA 5HKWA 5ER5A 1AVSA 1YVLA 3CR4X 1YUTA 2JOJA 2LUCA 3OB2B 4N1GA 1JUOA 3BOWB 1LA3A 3GK1A 2E30A 3IQOA 1CFPA 1SRAA 3I5GC 4GAOA 4CFRA 1Y1UA 1AK8A 1IH0A 2BL0B 2CCMA 2KFFA 2LC5A 3KF9A 1S6IA 4WQ3A 4AQIA 1QJTA 2I94A 4NDDA 2M29A 1GGZA 1M46A 2O60A 3IF7A 2WCBA 3H4SE 3EVVA 1XFXO 1EG3A 2L4HA 5BPJA 2SCPA 1KFUL 2LMUA 5HLVA 1KFXL 1CM1A 1UHNA 4IL1A 1XA5A 2KAXA 1DJIA 4ORAB 1PSBA 2E6WA 2GGMA 2ZKMX 4FTGA 4WRIA 2K7OA 3BUWB 4QJ3B 1NX2A 1SK6D 1YVHA 2LVVA 1OZOA 2KI6C 2KHNA 2FOTA 1RFJA 5I2QA 1BR4B 2JQ6A 2KAYA 3RLZA 4BY4A 2JRFA 2ZNDA 2ZRTA 4I5KA 1QV0A 1XYDA 4MZLA 1VRKA 1UHKA 3WXAA 2Y1MA 3TUYB 3I5GB 3C1VA 3BYAA 2FJUB 2HF5A 3I5IB 4HRGA 3DF0B 3LL8B 2PASA 4E68A 3SJSA 1CLMA 1BT6A 1MXEA 3AKBA 5IBWA 1DTLA 3PFVA 1UP5A 2LANA 2RGIA 3GK4X 1KFXS 3FS7A 1BG1A 1KK7Z 1NX1A 2B1UA 4PCWA 2MRDA 1OMRA 3RM1A 2R2IA 4YGAA 2D8NA 5CSNA 4PE4A 1K94A 2NCPA 3JTDB 1IQ3A 1PVAA 1ZUZA 2M0RA 1ZOTB 2F33A 5D69A 5B8IB 2G9BA 3VGOA 4P2YB 2KGRA 2GV5A 5DKNA 5G08A 1WY9A 1AHRA 1A75A 1AJ4A 2KAVA 1JWDA 4NQGA 1K93D 1ZACA 2OTGB 1LVCD 2JTTA 1QXPA 2LMTA 3JVTC 1YTZC 1PSRA 4XJKA 4MZKA 1C7VA 5HYDA 1TNPA 2WOSA 1H4BA 2CNPA 1R2UA 1J1DA 3SG4A 1GGWA 3AKAA 1B47A 3DVMA 4DIRA 4I5LB 4MLWA 2Q4UA 1KK8C 5AANA 1A4PA 1A75B 3O2PA 1MQ1A 4MN0A 1IWQA 1SW8A 3CS1A 2BE6A 3AAJA 2AMIA 2JT3A 3EVUA 1MWNA 4XJKB 3VRQA 1EH2A 1WRLA 2NZ0A 2H61A 3PM8A 1RJVA 1IJ5A 2KOTA 2BL0C 1J7QA 3FWCA 3OHMB 1K9KA 2OS8B 3M0WA 2CT9A 1R6PA 1J1EA 1QLSA 4PALA 2LLTA 1PVBA 2LVJA 1YX7A 3ZNIA 2CXJA 3KHEA 1BODA 1YX8A 4YRUA 1AP4A 4P5OE 5J3XA 2BCXA 1QIWA 2DOQA 2KDHA 2EGDA 1CMFA 1NCZA 1OZSA 1H8BA 1KK7Y 2M1UA 2HPSA 5HKZA 1DGUA 2Y4QA 1QVIZ 2K7BA 4JQ0D 1B4CA 5CSJA 2NLNA 1J7PA 4ICBA 4CPVA 1B8CA 1FF1A 4WQ2A 1NSHA 5ER4X 3AAKA 1TCOB 1OSAA 1S1EA 1QV1A 1JFKA 3KO0A 4M2PA 1N2DA 2WCEA 4CLNA 3TUYC 4HSZA 3SG6A 2BECA 1K90D 2MLFC 2I2RE 2PALA 3I5IC 1NCXA 4PHJA 1TN4A 2G2BA 2K0JA 1F54A 2JPTA 2LVIA 3OX6A 1XFZO 1CLLA 5F6TA 2M1KB 4ZCVA 5KTYA 3A4UB 4GNKB 1SKTA 4CFQA 3JTDC 3FWBA 4D1EA 2A4JA 3BUOB 3WHUB 1CDMA 3DF0A 2LP2A 4PE7A 5DKQA 1HQVA 4F0ZB 1D1OA 5K89A 2LMVA 1PRWA 2F3ZA 1UHHA 1K96A 4GGNA 1SPYA 1CFDA 2LNKA 2KQYA 2IS9A 1L7ZA 1NPQA 2K61A 3BUNB 2OTGC 2SASA 1EG4A 1YRUB 2ZNEA 3I5HB 3K21A 3SG7A 3LK0A 2H2KA 1XFVO 4UPGA 1NWDA 1B9AA 1FW4A 1L2OB 2JT0A 5I2LA 1M39A 1OQPA 4M2OA 4QJ4B 1M31A 1TIZA 3CLNA 1NX0A 1NUBA 3BXKA 2JNXA 3KEVA 2MAZA 1F4QA 2PSRA 1KFUS 4YGCB 5AEQA 2L4IA 4MRXA 1QVIY 1UUSA 1FPWA 4MSPA 4N1FA 4PE0A 1MUXA 1KWOB
chains in the Genus database with same CATH superfamily
1ZMZA 2KQ6A 1XFRA 5AERA 2KYCA 1UWOA 1W7JB 3TDIA 2F8PA 1DELA 3CWGA 1TRFA 1P28A 3NGVA 2KGBC 2OS8C 2WCJA 1DJHA 3O78A 2WC8A 2TN4A 2PRUA 1SY9A 2P6BB 1BOCA 3DXLA 3UNWA 3S0EA 2JXCA 2Q91A 2WC6A 3R1VA 4NDCA 5DICA 4PHMA 1RROA 3PATA 3D75A 1W7IB 3PLFB 1KCYA 4GBAA 1SMGA 2M97A 3D0YA 4C0LA 1CDNA 1SCMB 1QASA 1LXFC 2QPTA 1G4YR 2M7NA 4OVNF 1LS8A 2H61C 2BBMA 1DVIA 2JC2A 1U5IA 5D7FA 4NDBA 1K95A 3LK1A 2K7DA 1FBVA 3CGAA 3BFHA 4PE1A 3TS5C 3OX5A 1AUIB 1F4OA 3QRXA 3EKJA 4TNCA 3CR2A 2LHLA 1Y6WA 4GUKA 1C3YA 2I18A 2KBIA 4YI8A 4GGFA 2JWWA 1WDCB 4I5NB 1CB1A 1BLQA 3FE9A 1C07A 5FYXA 4QJ5B 3D0YB 3BUMB 2QDIA 4DUQA 2L50A 3DD4A 1F71A 1WLMA 2WORA 1U5IB 2QEBA 2LLUA 3E3RA 4XYNA 1TNWA 1JBAA 1DJYA 3D10A 3O6BA 3PJIA 2PVBA 4N5XA 2WCFA 2L98A 1B8LA 3I5FB 4OV2A 2JTZA 1RK9A 2L5XB 3HX4A 1CDLA 1IGVA 1SL8A 3NSIA 1GJYA 1KSOA 5AFPA 5HL1A 3A8RA 1DJXA 1S5GZ 1B7TY 1YURA 1YR5A 2LUXA 2V53A 2KSPA 1CFFA 1IKUA 1S3PA 2VRGA 3TS5B 3D78A 1ODBA 3PN7B 2BCAA 3EK4A 1A2XA 3SIAA 4OR9B 2KPHA 2EC6B 3I5HC 3VRPA 5KSZA 1KQVA 3EK8A 3Q8IA 1TTXA 1MR8A 3CZTX 1SNLA 2FCEA 4JPZB 1IJ6A 1L2OC 3FE8A 2JNFA 1YRTB 2COLB 2O5GA 2M7LA 1T14A 3OBVA 2KLEA 2BNXA 4YGDB 4YBHB 3OB1B 1KQMC 4FQTA 1C7WA 1LA0A 1OMVA 2M9GA 3SIBA 5AXIA 2WCHA 2AUCA 1CLBA 1Y1XA 1XFUO 1X02A 1YUSA 1K9UA 3HCMA 3TZ1A 1FI6A 1S6CA 1S6JA 1BJFA 2JXLA 4YI9A 1CFCA 4GFTA 1QIVA 1QS7A 1QX2A 2WNDA 4PDZA 3B87A 1DMOA 3DYEA 3RZSA 5JJGA 4MRYA 1KWOC 2KI4B 1IQ5A 3LCPC 3SG5A 4MEWA 2OPOA 4A4CA 5GQQC 2JU0A 1TNXA 2JT8A 3LLEA 1EXRA 4INWA 1J7RA 5FI2A 1QTXA 1PULA 1SCVA 2LCPA 2M49B 1QX5B 4IJ7A 5HLOA 1DT7B 4YGEB 4I5JA 4Q04A 1SL9A 2F3YA 3IQQA 1DJGA 2KYFA 1N0YA 3WHTB 5I94A 2F2OA 1SCMC 1TNQA 1CKKA 3CR5X 3D76A 2NCOA 2L51A 1RECA 1V1GA 1K2HA 4USLA 1CDPA 1DJZA 3L47A 3S0GA 1A03A 1KQMB 2LLSA 1YUUA 1DJWA 2LVKA 2HQ8A 3SG2A 2NXQA 3DVKA 1SL7A 3VRRA 4PHKA 1EJ3A 2MBXA 3FIAA 4YGBB 1XK4C 1Y0VH 1ALVA 1SBJA 2FCDA 3VROA 1S5GY 2CTNA 1EL4A 4AQJA 3NSOA 2LP3A 4HREE 1OOJA 3S0DA 1B7TZ 4A4BA 1WDCC 4OKHA 1W9ZA 2MJWB 3DVEA 2I7AA 1G33A 1JF2A 1WLZA 2LM5A 3GOFA 2WCKA 3TDZA 1E8AA 3MSEB 2EHBA 1MXLC 2KFGA 2L2EA 3OP0A 1AJ5A 1F55A 5DKRA 4M2QA 1FI5A 3TDUA 1XK4A 1KSMA 1M63B 1N65A 1XFWO 3NSKA 3F45A 4ZCUA 4ETOA 3PALA 1BR1B 5I8NA 1OMDA 1V1FA 4C0JA 3I5FC 3OGNA 2LV7A 3KPXA 1JFJA 4ORCB 1NP8A 2KBMA 1S26D 1OE9B 3UO9A 2PMYA 5CSIA 1RTP1 5FI7A 5JOLA 4JWQA 1DQEA 4MVFA 2JPOA 1SSEB 2BBNA 1WRZA 1SR6C 2AAOA 2BE4A 2QEOA 2ZN8A 1DGVA 4L9MA 1CNPA 3PN7C 2ISDA 3FE6A 2MA2A 1WRKA 1TWOA 1GM0A 5HKYA 2KI6D 2BKIB 2LHIA 3SG3A 2EC6C 1DF0A 1BMOA 2K2FA 1B8RA 1J55A 1JF0A 3NXAA 2HETA 3CZ2A 3PM2A 2ERBA 4BY5A 4HRHA 2K2AA 3EK7A 2P71A 4DS7A 2GGZA 3ICBA 2M8UA 1K9PA 3O4YA 2LAPA 3IVTA 2HQWA 1TCFA 1BF5A 1UHIA 1ALWA 3D74A 4C0KA 3CABA 2BKHB 2ZN9A 4ORBB 3R1PA 2Y5IA 3CTNA 2QACA 4MZJA 1GQMA 2ZFDA 1RWYA 1QATA 1PK0D 2MLEC 1Z2CB 3BQ3A 3NSLA 1F8HA 1JSAA 1Y1AA 1SYMA 1OOFA 1XFYO 3SS4A 3GK2A 5CSFA 1TUJA 2YGUA 1DF0B 3WNXB 1XVJA 3BUXB 2KFHA 4PHNA 1G8IA 1HT9A 2KI4C 1S36A 1LKJA 3CYZA 1A29A 4AOMA 2L0PA 5I2OA 2BCBA 2Y1NA 1K8UA 3V2LA 3R1OA 1J7OA 1SR6B 2JZIA 2KLDA 2KNEA 1C3ZA 4OCIA 4R1EA 3ZWHA 1IG5A 3VRNA 3DVJA 3B6XA 4GGFC 1NCYA 2JULA 4MBEA 2M3WA 1M45A 1PALA 2LE9B 3EKHA 3JVTB 4JD9A 4DRWA 1XO5A 4CIDA 1MF8B 1MHOA 1QLKA 1CM4A 3BOWA 1JC2A 4GPLB 1BU3A 1OOIX 1IRJA 2QEHA 4DCKA 5TNCA 1NYAA 1TUZA 5CPVA 1Q80A 1UURA 5PALA 1NX3A 2CBLA 5KU1A 1B1GA 1CMGA 1F70A 2ZRSA 1LINA 2K7CA 1ZFSA 3EVRA 1KK8B 1TOPA 1QX7A 2K8MB 1UHJA 4FQOA 1NIWA 2MHHA 3PSRA 4JKTA 3S0AA 4U8DA 2FJYA 1CTRA 2F2PA 5HKWA 5ER5A 1AVSA 1DEKA 1YVLA 3CR4X 1YUTA 2JOJA 2LUCA 3OB2B 4N1GA 1JUOA 3BOWB 1LA3A 3GK1A 2E30A 3IQOA 3DY9A 1CFPA 1SRAA 3I5GC 3NHTA 4GAOA 4CFRA 1Y1UA 1AK8A 1IH0A 2BL0B 2CCMA 2KFFA 2LC5A 3KF9A 1S6IA 4WQ3A 1Z4HA 4AQIA 1QJTA 2I94A 4NDDA 2M29A 1GGZA 1M46A 2O60A 3IF7A 2BAPA 2WCBA 3H4SE 3EVVA 1XFXO 1EG3A 2L4HA 2PYQA 3EG5B 5BPJA 2SCPA 1KFUL 2LMUA 5HLVA 1KFXL 1CM1A 1UHNA 4IL1A 1XA5A 2KAXA 1DJIA 4ORAB 1PSBA 3L4AA 1QWVA 2E6WA 2GGMA 2K60A 2ZKMX 4FTGA 4WRIA 3S0BA 2K7OA 3BUWB 4QJ3B 1NX2A 1SK6D 1YVHA 2LVVA 3K1EA 1OZOA 2KI6C 2KHNA 2FOTA 1RFJA 3BFAA 5I2QA 1BR4B 2JQ6A 2KAYA 3RLZA 4BY4A 2JRFA 2ZNDA 2ZRTA 4I5KA 1QV0A 1XYDA 4MZLA 1VRKA 1UHKA 2H8VA 2Y1MA 3WXAA 3TUYB 3I5GB 3B86A 3C1VA 3BYAA 2FJUB 2HF5A 3I5IB 4HRGA 3DF0B 3LL8B 2PASA 4E68A 3SJSA 1CLMA 1BT6A 1MXEA 3AKBA 5IBWA 1DTLA 3PFVA 1UP5A 2LANA 2RGIA 3GK4X 1KFXS 3FS7A 1BG1A 1KK7Z 1NX1A 2B1UA 4PCWA 2MRDA 1OMRA 3RM1A 2R2IA 3DZTA 4YGAA 2D8NA 5CSNA 3BJHA 4PE4A 3CZ1A 1K94A 2NCPA 3JTDB 1IQ3A 1PVAA 1ZUZA 1OOGA 1ZOTB 2M0RA 2F33A 5D69A 5FI6A 5B8IB 2G9BA 3VGOA 4P2YB 2KGRA 2GV5A 5DKNA 5G08A 1WY9A 1AHRA 1A75A 1AJ4A 2KAVA 2WC5A 1JWDA 4NQGA 1K93D 1ZACA 2OTGB 1LVCD 2JTTA 1QXPA 2LMTA 3QMEA 3JVTC 3R72A 1YTZC 3D73A 1PSRA 4XJKA 4MZKA 1C7VA 5HYDA 1TNPA 2WOSA 4KYNA 2CNPA 1R2UA 1J1DA 1H4BA 2QEVA 1OW4A 3SG4A 3SS5A 1GGWA 3AKAA 1B47A 3DVMA 3SS3A 4DIRA 4I5LB 4MLWA 5D3OA 2Q4UA 1KK8C 5AANA 1A4PA 1A75B 3O2PA 1MQ1A 4MN0A 1IWQA 1SW8A 3CS1A 2BE6A 3AAJA 2AMIA 2JT3A 3EVUA 1MWNA 4XJKB 3VRQA 1EH2A 1WRLA 2NZ0A 2H61A 3PM8A 1IIOA 1RJVA 1IJ5A 1OOHA 2KOTA 2BL0C 1J7QA 3FWCA 3OHMB 1K9KA 1ORGA 2OS8B 3M0WA 2CT9A 1R6PA 1J1EA 1QLSA 4F7FA 4PALA 2LLTA 1PVBA 2LVJA 1YX7A 3ZNIA 2CXJA 3KHEA 1BODA 1YX8A 2WCMA 4YRUA 1AP4A 4P5OE 5J3XA 2BCXA 1QIWA 5EL2A 3CDNA 2DOQA 2KDHA 2EGDA 1CMFA 1NCZA 1OZSA 1H8BA 1KK7Y 2M1UA 2HPSA 5HKZA 1DGUA 2Y4QA 4INXA 1QVIZ 2K7BA 4JQ0D 1B4CA 5CSJA 2NLNA 1J7PA 4ICBA 4CPVA 1B8CA 1FF1A 3NHIA 4WQ2A 1NSHA 5ER4X 3CZ0A 3VB1A 3AAKA 1TCOB 1OSAA 1S1EA 1QV1A 1JFKA 3KO0A 4M2PA 1N2DA 2WCEA 4CLNA 3TUYC 4HSZA 3SG6A 2BECA 1K90D 2MLFC 2I2RE 2PALA 2PQLA 3BFBA 3I5IC 1NCXA 4PHJA 3S0FA 1TN4A 2G2BA 2K0JA 1F54A 2JPTA 2LVIA 3N7HA 3B7AA 3OX6A 1XFZO 2WCLA 1CLLA 5F6TA 2M1KB 4ZCVA 3B88A 5KTYA 3A4UB 4GNKB 1SKTA 4CFQA 3JTDC 3FWBA 4D1EA 2A4JA 2P70A 3BUOB 3WHUB 1CDMA 3DF0A 2LP2A 4PE7A 5DKQA 1HQVA 4F0ZB 3D77A 1D1OA 5K89A 2LMVA 1PRWA 2F3ZA 1UHHA 1K96A 4GGNA 1SPYA 1CFDA 2LNKA 2KQYA 2IS9A 3O4XA 1L7ZA 1NPQA 1DC1A 2K61A 3BUNB 2OTGC 2SASA 1EG4A 1YRUB 2ZNEA 3I5HB 3K21A 3SG7A 3LK0A 2H2KA 1XFVO 2L2CA 4UPGA 1NWDA 1B9AA 1FW4A 1L2OB 2JT0A 5I2LA 1M39A 1OQPA 4M2OA 4QJ4B 1M31A 1TIZA 3CLNA 1NX0A 1NUBA 3BXKA 2GTEA 2JNXA 3KEVA 2L5YA 2MAZA 1F4QA 2PSRA 1KFUS 4YGCB 5AEQA 2L4IA 4MRXA 1QVIY 1UUSA 4PT1A 1FPWA 4OZDA 4MSPA 4N1FA 4PE0A 1MUXA 1KWOB 3L4LA
chains in the Genus database with same CATH topology
1ZMZA 2KQ6A 5AERA 2KYCA 1UWOA 1W7JB 3TDIA 2F8PA 3CWGA 1TRFA 4ZCUA 2KGBC 2OS8C 1DJHA 3O78A 2WC8A 2TN4A 2PRUA 1SY9A 2P6BB 1BOCA 2JXCA 2Q91A 4NDCA 4PHMA 1RROA 3PATA 3PLFB 1W7IB 1KCYA 4GBAA 1SMGA 2M97A 3D0YA 4C0LA 1CDNA 1SCMB 1QASA 1LXFC 2QPTA 1G4YR 2M7NA 4OVNF 2H61C 2BBMA 1DVIA 2JC2A 1U5IA 5D7FA 4NDBA 1K95A 3LK1A 2K7DA 1FBVA 3CGAA 4PE1A 3TS5C 3OX5A 1AUIB 1F4OA 3QRXA 3EKJA 4TNCA 3CR2A 2LHLA 1Y6WA 4GUKA 2I18A 2KBIA 4YI8A 4GGFA 2JWWA 1WDCB 4I5NB 1CB1A 1BLQA 1C07A 5FYXA 4QJ5B 3D0YB 3BUMB 4DUQA 2L50A 3DD4A 1F71A 1WLMA 2WORA 1U5IB 2LLUA 3E3RA 4XYNA 1TNWA 1JBAA 1DJYA 3D10A 3O6BA 2PVBA 4N5XA 2WCFA 2L98A 1B8LA 3I5FB 4OV2A 2JTZA 1RK9A 2L5XB 3HX4A 1CDLA 1IGVA 1SL8A 3NSIA 1GJYA 1KSOA 5AFPA 3A8RA 1DJXA 1S5GZ 1B7TY 1YURA 1YR5A 2LUXA 2V53A 2KSPA 1CFFA 1IKUA 1S3PA 2VRGA 3TS5B 1ODBA 3PN7B 2BCAA 3EK4A 1A2XA 3SIAA 4OR9B 2EC6B 3I5HC 3VRPA 5KSZA 1KQVA 3EK8A 1TTXA 1MR8A 3CZTX 1SNLA 2FCEA 4JPZB 1IJ6A 1L2OC 2JNFA 1YRTB 2COLB 2O5GA 2M7LA 4YGDB 4YBHB 3OB1B 1KQMC 1C7WA 1LA0A 1OMVA 2M9GA 3SIBA 5AXIA 2AUCA 1CLBA 1Y1XA 1XFUO 1X02A 1YUSA 1K9UA 3HCMA 3TZ1A 1FI6A 1S6CA 1S6JA 1BJFA 2JXLA 4YI9A 1CFCA 4GFTA 1QIVA 1QS7A 1QX2A 2WNDA 4PDZA 1DMOA 5JJGA 4MRYA 1KWOC 2KI4B 1IQ5A 3LCPC 3SG5A 4MEWA 2OPOA 4A4CA 5GQQC 2JU0A 1TNXA 2JT8A 3LLEA 1EXRA 1J7RA 1QTXA 1PULA 1SCVA 2LCPA 2M49B 1QX5B 5HLOA 1DT7B 4YGEB 4I5JA 4Q04A 1SL9A 2F3YA 3IQQA 1DJGA 2KYFA 1N0YA 3WHTB 2F2OA 1SCMC 1TNQA 1CKKA 3CR5X 2NCOA 2L51A 1RECA 1V1GA 1K2HA 4USLA 1CDPA 1DJZA 1A03A 1KQMB 2LLSA 1YUUA 1DJWA 2LVKA 2HQ8A 3SG2A 2NXQA 3DVKA 1SL7A 3VRRA 4PHKA 1EJ3A 2MBXA 3FIAA 4YGBB 1XK4C 1Y0VH 1ALVA 1SBJA 2FCDA 3VROA 1S5GY 2CTNA 1EL4A 4AQJA 3NSOA 2LP3A 4HREE 1OOJA 4A4BA 1B7TZ 1WDCC 4OKHA 3DVEA 2MJWB 2I7AA 1G33A 1JF2A 1WLZA 2LM5A 3GOFA 3TDZA 1E8AA 3MSEB 2EHBA 1MXLC 2KFGA 2L2EA 3OP0A 1AJ5A 1F55A 5DKRA 4M2QA 1FI5A 3TDUA 1XK4A 1KSMA 1M63B 1N65A 1XFWO 3NSKA 3F45A 4ETOA 3PALA 1BR1B 5I8NA 1OMDA 1V1FA 4C0JA 3I5FC 2LV7A 3KPXA 1JFJA 4ORCB 1NP8A 2KBMA 1S26D 1OE9B 2PMYA 5CSIA 1RTP1 5JOLA 4JWQA 4MVFA 2BBNA 1WRZA 1SR6C 2AAOA 2BE4A 2ZN8A 1DGVA 4L9MA 1CNPA 3PN7C 2ISDA 2MA2A 1WRKA 5HKYA 2KI6D 2BKIB 2LHIA 3SG3A 2EC6C 1DF0A 1BMOA 2K2FA 1B8RA 1J55A 1JF0A 3NXAA 2HETA 4BY5A 4HRHA 2K2AA 3EK7A 4DS7A 2GGZA 3ICBA 2M8UA 1K9PA 3O4YA 2LAPA 2HQWA 1TCFA 1BF5A 1UHIA 1ALWA 4C0KA 2BKHB 2ZN9A 4ORBB 2Y5IA 3CTNA 2QACA 4MZJA 1GQMA 2ZFDA 1RWYA 1QATA 1PK0D 2MLEC 3BQ3A 3NSLA 1F8HA 1JSAA 1Y1AA 1SYMA 1XFYO 3GK2A 5CSFA 3WNXB 1DF0B 1XVJA 3BUXB 2KFHA 4PHNA 1G8IA 1HT9A 2KI4C 1S36A 1LKJA 1A29A 4AOMA 2L0PA 5I2OA 2BCBA 2Y1NA 1K8UA 1J7OA 1SR6B 2JZIA 2KNEA 4R1EA 4OCIA 3ZWHA 1IG5A 3VRNA 3DVJA 4GGFC 1NCYA 2JULA 4MBEA 2M3WA 1M45A 1PALA 2LE9B 3EKHA 3JVTB 4DRWA 1XO5A 4CIDA 1MF8B 1MHOA 1QLKA 1CM4A 3BOWA 1JC2A 4GPLB 1BU3A 1IRJA 4DCKA 5TNCA 1NYAA 5CPVA 1Q80A 1UURA 5PALA 1NX3A 2CBLA 5KU1A 1B1GA 1CMGA 1F70A 2ZRSA 1LINA 2K7CA 1ZFSA 3EVRA 1KK8B 1TOPA 1QX7A 2K8MB 1UHJA 4FQOA 1NIWA 2MHHA 3PSRA 4U8DA 1CTRA 2F2PA 5HKWA 5ER5A 1AVSA 1YVLA 3CR4X 1YUTA 2JOJA 2LUCA 3OB2B 4N1GA 1JUOA 3BOWB 1LA3A 3GK1A 2E30A 3IQOA 1CFPA 1SRAA 3I5GC 4GAOA 4CFRA 1Y1UA 1AK8A 1IH0A 2BL0B 2CCMA 2KFFA 2LC5A 3KF9A 1S6IA 4WQ3A 4AQIA 1QJTA 2I94A 4NDDA 2M29A 1GGZA 1M46A 2O60A 3IF7A 2WCBA 3H4SE 3EVVA 1XFXO 1EG3A 2L4HA 5BPJA 2SCPA 1KFUL 2LMUA 5HLVA 1KFXL 1CM1A 1UHNA 4IL1A 1XA5A 2KAXA 1DJIA 4ORAB 1PSBA 2E6WA 2GGMA 2ZKMX 4FTGA 4WRIA 2K7OA 3BUWB 4QJ3B 1NX2A 1SK6D 1YVHA 2LVVA 1OZOA 2KI6C 2KHNA 2FOTA 1RFJA 5I2QA 1BR4B 2JQ6A 2KAYA 3RLZA 4BY4A 2JRFA 2ZNDA 2ZRTA 4I5KA 1QV0A 1XYDA 4MZLA 1VRKA 1UHKA 3WXAA 2Y1MA 3TUYB 3I5GB 3C1VA 3BYAA 2FJUB 2HF5A 3I5IB 4HRGA 3DF0B 3LL8B 2PASA 4E68A 3SJSA 1CLMA 1BT6A 1MXEA 3AKBA 5IBWA 1DTLA 3PFVA 1UP5A 2LANA 2RGIA 3GK4X 1KFXS 3FS7A 1BG1A 1KK7Z 1NX1A 2B1UA 4PCWA 2MRDA 1OMRA 3RM1A 2R2IA 4YGAA 2D8NA 5CSNA 4PE4A 1K94A 2NCPA 3JTDB 1IQ3A 1PVAA 1ZUZA 2M0RA 1ZOTB 2F33A 5D69A 5B8IB 2G9BA 3VGOA 4P2YB 2KGRA 2GV5A 5DKNA 5G08A 1WY9A 1AHRA 1A75A 1AJ4A 2KAVA 1JWDA 4NQGA 1K93D 1ZACA 2OTGB 1LVCD 2JTTA 1QXPA 2LMTA 3JVTC 1YTZC 1PSRA 4XJKA 4MZKA 1C7VA 5HYDA 1TNPA 2WOSA 1H4BA 2CNPA 1R2UA 1J1DA 3SG4A 1GGWA 3AKAA 1B47A 3DVMA 4DIRA 4I5LB 4MLWA 2Q4UA 1KK8C 5AANA 1A4PA 1A75B 3O2PA 1MQ1A 4MN0A 1IWQA 1SW8A 3CS1A 2BE6A 3AAJA 2AMIA 2JT3A 3EVUA 1MWNA 4XJKB 3VRQA 1EH2A 1WRLA 2NZ0A 2H61A 3PM8A 1RJVA 1IJ5A 2KOTA 2BL0C 1J7QA 3FWCA 3OHMB 1K9KA 2OS8B 3M0WA 2CT9A 1R6PA 1J1EA 1QLSA 4PALA 2LLTA 1PVBA 2LVJA 1YX7A 3ZNIA 2CXJA 3KHEA 1BODA 1YX8A 4YRUA 1AP4A 4P5OE 5J3XA 2BCXA 1QIWA 2DOQA 2KDHA 2EGDA 1CMFA 1NCZA 1OZSA 1H8BA 1KK7Y 2M1UA 2HPSA 5HKZA 1DGUA 2Y4QA 1QVIZ 2K7BA 4JQ0D 1B4CA 5CSJA 2NLNA 1J7PA 4ICBA 4CPVA 1B8CA 1FF1A 4WQ2A 1NSHA 5ER4X 3AAKA 1TCOB 1OSAA 1S1EA 1QV1A 1JFKA 3KO0A 4M2PA 1N2DA 2WCEA 4CLNA 3TUYC 4HSZA 3SG6A 2BECA 1K90D 2MLFC 2I2RE 2PALA 3I5IC 1NCXA 4PHJA 1TN4A 2G2BA 2K0JA 1F54A 2JPTA 2LVIA 3OX6A 1XFZO 1CLLA 5F6TA 2M1KB 4ZCVA 5KTYA 3A4UB 4GNKB 1SKTA 4CFQA 3JTDC 3FWBA 4D1EA 2A4JA 3BUOB 3WHUB 1CDMA 3DF0A 2LP2A 4PE7A 5DKQA 1HQVA 4F0ZB 1D1OA 5K89A 2LMVA 1PRWA 2F3ZA 1UHHA 1K96A 4GGNA 1SPYA 1CFDA 2LNKA 2KQYA 2IS9A 1L7ZA 1NPQA 2K61A 3BUNB 2OTGC 2SASA 1EG4A 1YRUB 2ZNEA 3I5HB 3K21A 3SG7A 3LK0A 2H2KA 1XFVO 4UPGA 1NWDA 1B9AA 1FW4A 1L2OB 2JT0A 5I2LA 1M39A 1OQPA 4M2OA 4QJ4B 1M31A 1TIZA 3CLNA 1NX0A 1NUBA 3BXKA 2JNXA 3KEVA 2MAZA 1F4QA 2PSRA 1KFUS 4YGCB 5AEQA 2L4IA 4MRXA 1QVIY 1UUSA 1FPWA 4MSPA 4N1FA 4PE0A 1MUXA 1KWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMZ A;  2KQ6 A;  5AER A;  2KYC A;  1UWO A;  1W7J B;  3TDI A;  2F8P A;  3CWG A;  1TRF A;  4ZCU A;  2KGB C;  2OS8 C;  1DJH A;  3O78 A;  2WC8 A;  2TN4 A;  2PRU A;  1SY9 A;  2P6B B;  1BOC A;  2JXC A;  2Q91 A;  4NDC A;  4PHM A;  1RRO A;  3PAT A;  3PLF B;  1W7I B;  1KCY A;  4GBA A;  1SMG A;  2M97 A;  3D0Y A;  4C0L A;  1CDN A;  1SCM B;  1QAS A;  1LXF C;  2QPT A;  1G4Y R;  2M7N A;  4OVN F;  2H61 C;  2BBM A;  1DVI A;  2JC2 A;  1U5I A;  5D7F A;  4NDB A;  1K95 A;  3LK1 A;  2K7D A;  1FBV A;  3CGA A;  4PE1 A;  3TS5 C;  3OX5 A;  1AUI B;  1F4O A;  3QRX A;  3EKJ A;  4TNC A;  3CR2 A;  2LHL A;  1Y6W A;  4GUK A;  2I18 A;  2KBI A;  4YI8 A;  4GGF A;  2JWW A;  1WDC B;  4I5N B;  1CB1 A;  1BLQ A;  1C07 A;  5FYX A;  4QJ5 B;  3D0Y B;  3BUM B;  4DUQ A;  2L50 A;  3DD4 A;  1F71 A;  1WLM A;  2WOR A;  1U5I B;  2LLU A;  3E3R A;  4XYN A;  1TNW A;  1JBA A;  1DJY A;  3D10 A;  3O6B A;  2PVB A;  4N5X A;  2WCF A;  2L98 A;  1B8L A;  3I5F B;  4OV2 A;  2JTZ A;  1RK9 A;  2L5X B;  3HX4 A;  1CDL A;  1IGV A;  1SL8 A;  3NSI A;  1GJY A;  1KSO A;  5AFP A;  3A8R A;  1DJX A;  1S5G Z;  1B7T Y;  1YUR A;  1YR5 A;  2LUX A;  2V53 A;  2KSP A;  1CFF A;  1IKU A;  1S3P A;  2VRG A;  3TS5 B;  1ODB A;  3PN7 B;  2BCA A;  3EK4 A;  1A2X A;  3SIA A;  4OR9 B;  2EC6 B;  3I5H C;  3VRP A;  5KSZ A;  1KQV A;  3EK8 A;  1TTX A;  1MR8 A;  3CZT X;  1SNL A;  2FCE A;  4JPZ B;  1IJ6 A;  1L2O C;  2JNF A;  1YRT B;  2COL B;  2O5G A;  2M7L A;  4YGD B;  4YBH B;  3OB1 B;  1KQM C;  1C7W A;  1LA0 A;  1OMV A;  2M9G A;  3SIB A;  5AXI A;  2AUC A;  1CLB A;  1Y1X A;  1XFU O;  1X02 A;  1YUS A;  1K9U A;  3HCM A;  3TZ1 A;  1FI6 A;  1S6C A;  1S6J A;  1BJF A;  2JXL A;  4YI9 A;  1CFC A;  4GFT A;  1QIV A;  1QS7 A;  1QX2 A;  2WND A;  4PDZ A;  1DMO A;  5JJG A;  4MRY A;  1KWO C;  2KI4 B;  1IQ5 A;  3LCP C;  3SG5 A;  4MEW A;  2OPO A;  4A4C A;  5GQQ C;  2JU0 A;  1TNX A;  2JT8 A;  3LLE A;  1EXR A;  1J7R A;  1QTX A;  1PUL A;  1SCV A;  2LCP A;  2M49 B;  1QX5 B;  5HLO A;  1DT7 B;  4YGE B;  4I5J A;  4Q04 A;  1SL9 A;  2F3Y A;  3IQQ A;  1DJG A;  2KYF A;  1N0Y A;  3WHT B;  2F2O A;  1SCM C;  1TNQ A;  1CKK A;  3CR5 X;  2NCO A;  2L51 A;  1REC A;  1V1G A;  1K2H A;  4USL A;  1CDP A;  1DJZ A;  1A03 A;  1KQM B;  2LLS A;  1YUU A;  1DJW A;  2LVK A;  2HQ8 A;  3SG2 A;  2NXQ A;  3DVK A;  1SL7 A;  3VRR A;  4PHK A;  1EJ3 A;  2MBX A;  3FIA A;  4YGB B;  1XK4 C;  1Y0V H;  1ALV A;  1SBJ A;  2FCD A;  3VRO A;  1S5G Y;  2CTN A;  1EL4 A;  4AQJ A;  3NSO A;  2LP3 A;  4HRE E;  1OOJ A;  4A4B A;  1B7T Z;  1WDC C;  4OKH A;  3DVE A;  2MJW B;  2I7A A;  1G33 A;  1JF2 A;  1WLZ A;  2LM5 A;  3GOF A;  3TDZ A;  1E8A A;  3MSE B;  2EHB A;  1MXL C;  2KFG A;  2L2E A;  3OP0 A;  1AJ5 A;  1F55 A;  5DKR A;  4M2Q A;  1FI5 A;  3TDU A;  1XK4 A;  1KSM A;  1M63 B;  1N65 A;  1XFW O;  3NSK A;  3F45 A;  4ETO A;  3PAL A;  1BR1 B;  5I8N A;  1OMD A;  1V1F A;  4C0J A;  3I5F C;  2LV7 A;  3KPX A;  1JFJ A;  4ORC B;  1NP8 A;  2KBM A;  1S26 D;  1OE9 B;  2PMY A;  5CSI A;  1RTP 1;  5JOL A;  4JWQ A;  4MVF A;  2BBN A;  1WRZ A;  1SR6 C;  2AAO A;  2BE4 A;  2ZN8 A;  1DGV A;  4L9M A;  1CNP A;  3PN7 C;  2ISD A;  2MA2 A;  1WRK A;  5HKY A;  2KI6 D;  2BKI B;  2LHI A;  3SG3 A;  2EC6 C;  1DF0 A;  1BMO A;  2K2F A;  1B8R A;  1J55 A;  1JF0 A;  3NXA A;  2HET A;  4BY5 A;  4HRH A;  2K2A A;  3EK7 A;  4DS7 A;  2GGZ A;  3ICB A;  2M8U A;  1K9P A;  3O4Y A;  2LAP A;  2HQW A;  1TCF A;  1BF5 A;  1UHI A;  1ALW A;  4C0K A;  2BKH B;  2ZN9 A;  4ORB B;  2Y5I A;  3CTN A;  2QAC A;  4MZJ A;  1GQM A;  2ZFD A;  1RWY A;  1QAT A;  1PK0 D;  2MLE C;  3BQ3 A;  3NSL A;  1F8H A;  1JSA A;  1Y1A A;  1SYM A;  1XFY O;  3GK2 A;  5CSF A;  3WNX B;  1DF0 B;  1XVJ A;  3BUX B;  2KFH A;  4PHN A;  1G8I A;  1HT9 A;  2KI4 C;  1S36 A;  1LKJ A;  1A29 A;  4AOM A;  2L0P A;  5I2O A;  2BCB A;  2Y1N A;  1K8U A;  1J7O A;  1SR6 B;  2JZI A;  2KNE A;  4R1E A;  4OCI A;  3ZWH A;  1IG5 A;  3VRN A;  3DVJ A;  4GGF C;  1NCY A;  2JUL A;  4MBE A;  2M3W A;  1M45 A;  1PAL A;  2LE9 B;  3EKH A;  3JVT B;  4DRW A;  1XO5 A;  4CID A;  1MF8 B;  1MHO A;  1QLK A;  1CM4 A;  3BOW A;  1JC2 A;  4GPL B;  1BU3 A;  1IRJ A;  4DCK A;  5TNC A;  1NYA A;  5CPV A;  1Q80 A;  1UUR A;  5PAL A;  1NX3 A;  2CBL A;  5KU1 A;  1B1G A;  1CMG A;  1F70 A;  2ZRS A;  1LIN A;  2K7C A;  1ZFS A;  3EVR A;  1KK8 B;  1TOP A;  1QX7 A;  2K8M B;  1UHJ A;  4FQO A;  1NIW A;  2MHH A;  3PSR A;  4U8D A;  1CTR A;  2F2P A;  5HKW A;  5ER5 A;  1AVS A;  1YVL A;  3CR4 X;  1YUT A;  2JOJ A;  2LUC A;  3OB2 B;  4N1G A;  1JUO A;  3BOW B;  1LA3 A;  3GK1 A;  2E30 A;  3IQO A;  1CFP A;  1SRA A;  3I5G C;  4GAO A;  4CFR A;  1Y1U A;  1AK8 A;  1IH0 A;  2BL0 B;  2CCM A;  2KFF A;  2LC5 A;  3KF9 A;  1S6I A;  4WQ3 A;  4AQI A;  1QJT A;  2I94 A;  4NDD A;  2M29 A;  1GGZ A;  1M46 A;  2O60 A;  3IF7 A;  2WCB A;  3H4S E;  3EVV A;  1XFX O;  1EG3 A;  2L4H A;  5BPJ A;  2SCP A;  1KFU L;  2LMU A;  5HLV A;  1KFX L;  1CM1 A;  1UHN A;  4IL1 A;  1XA5 A;  2KAX A;  1DJI A;  4ORA B;  1PSB A;  2E6W A;  2GGM A;  2ZKM X;  4FTG A;  4WRI A;  2K7O A;  3BUW B;  4QJ3 B;  1NX2 A;  1SK6 D;  1YVH A;  2LVV A;  1OZO A;  2KI6 C;  2KHN A;  2FOT A;  1RFJ A;  5I2Q A;  1BR4 B;  2JQ6 A;  2KAY A;  3RLZ A;  4BY4 A;  2JRF A;  2ZND A;  2ZRT A;  4I5K A;  1QV0 A;  1XYD A;  4MZL A;  1VRK A;  1UHK A;  3WXA A;  2Y1M A;  3TUY B;  3I5G B;  3C1V A;  3BYA A;  2FJU B;  2HF5 A;  3I5I B;  4HRG A;  3DF0 B;  3LL8 B;  2PAS A;  4E68 A;  3SJS A;  1CLM A;  1BT6 A;  1MXE A;  3AKB A;  5IBW A;  1DTL A;  3PFV A;  1UP5 A;  2LAN A;  2RGI A;  3GK4 X;  1KFX S;  3FS7 A;  1BG1 A;  1KK7 Z;  1NX1 A;  2B1U A;  4PCW A;  2MRD A;  1OMR A;  3RM1 A;  2R2I A;  4YGA A;  2D8N A;  5CSN A;  4PE4 A;  1K94 A;  2NCP A;  3JTD B;  1IQ3 A;  1PVA A;  1ZUZ A;  2M0R A;  1ZOT B;  2F33 A;  5D69 A;  5B8I B;  2G9B A;  3VGO A;  4P2Y B;  2KGR A;  2GV5 A;  5DKN A;  5G08 A;  1WY9 A;  1AHR A;  1A75 A;  1AJ4 A;  2KAV A;  1JWD A;  4NQG A;  1K93 D;  1ZAC A;  2OTG B;  1LVC D;  2JTT A;  1QXP A;  2LMT A;  3JVT C;  1YTZ C;  1PSR A;  4XJK A;  4MZK A;  1C7V A;  5HYD A;  1TNP A;  2WOS A;  1H4B A;  2CNP A;  1R2U A;  1J1D A;  3SG4 A;  1GGW A;  3AKA A;  1B47 A;  3DVM A;  4DIR A;  4I5L B;  4MLW A;  2Q4U A;  1KK8 C;  5AAN A;  1A4P A;  1A75 B;  3O2P A;  1MQ1 A;  4MN0 A;  1IWQ A;  1SW8 A;  3CS1 A;  2BE6 A;  3AAJ A;  2AMI A;  2JT3 A;  3EVU A;  1MWN A;  4XJK B;  3VRQ A;  1EH2 A;  1WRL A;  2NZ0 A;  2H61 A;  3PM8 A;  1RJV A;  1IJ5 A;  2KOT A;  2BL0 C;  1J7Q A;  3FWC A;  3OHM B;  1K9K A;  2OS8 B;  3M0W A;  2CT9 A;  1R6P A;  1J1E A;  1QLS A;  4PAL A;  2LLT A;  1PVB A;  2LVJ A;  1YX7 A;  3ZNI A;  2CXJ A;  3KHE A;  1BOD A;  1YX8 A;  4YRU A;  1AP4 A;  4P5O E;  5J3X A;  2BCX A;  1QIW A;  2DOQ A;  2KDH A;  2EGD A;  1CMF A;  1NCZ A;  1OZS A;  1H8B A;  1KK7 Y;  2M1U A;  2HPS A;  5HKZ A;  1DGU A;  2Y4Q A;  1QVI Z;  2K7B A;  4JQ0 D;  1B4C A;  5CSJ A;  2NLN A;  1J7P A;  4ICB A;  4CPV A;  1B8C A;  1FF1 A;  4WQ2 A;  1NSH A;  5ER4 X;  3AAK A;  1TCO B;  1OSA A;  1S1E A;  1QV1 A;  1JFK A;  3KO0 A;  4M2P A;  1N2D A;  2WCE A;  4CLN A;  3TUY C;  4HSZ A;  3SG6 A;  2BEC A;  1K90 D;  2MLF C;  2I2R E;  2PAL A;  3I5I C;  1NCX A;  4PHJ A;  1TN4 A;  2G2B A;  2K0J A;  1F54 A;  2JPT A;  2LVI A;  3OX6 A;  1XFZ O;  1CLL A;  5F6T A;  2M1K B;  4ZCV A;  5KTY A;  3A4U B;  4GNK B;  1SKT A;  4CFQ A;  3JTD C;  3FWB A;  4D1E A;  2A4J A;  3BUO B;  3WHU B;  1CDM A;  3DF0 A;  2LP2 A;  4PE7 A;  5DKQ A;  1HQV A;  4F0Z B;  1D1O A;  5K89 A;  2LMV A;  1PRW A;  2F3Z A;  1UHH A;  1K96 A;  4GGN A;  1SPY A;  1CFD A;  2LNK A;  2KQY A;  2IS9 A;  1L7Z A;  1NPQ A;  2K61 A;  3BUN B;  2OTG C;  2SAS A;  1EG4 A;  1YRU B;  2ZNE A;  3I5H B;  3K21 A;  3SG7 A;  3LK0 A;  2H2K A;  1XFV O;  4UPG A;  1NWD A;  1B9A A;  1FW4 A;  1L2O B;  2JT0 A;  5I2L A;  1M39 A;  1OQP A;  4M2O A;  4QJ4 B;  1M31 A;  1TIZ A;  3CLN A;  1NX0 A;  1NUB A;  3BXK A;  2JNX A;  3KEV A;  2MAZ A;  1F4Q A;  2PSR A;  1KFU S;  4YGC B;  5AEQ A;  2L4I A;  4MRX A;  1QVI Y;  1UUS A;  1FPW A;  4MSP A;  4N1F A;  4PE0 A;  1MUX A;  1KWO B; 
#chains in the Genus database with same CATH topology
 1ZMZ A;  2KQ6 A;  1XFR A;  5AER A;  2KYC A;  1UWO A;  1W7J B;  3TDI A;  2F8P A;  1DEL A;  3CWG A;  1TRF A;  1P28 A;  3NGV A;  2KGB C;  2OS8 C;  2WCJ A;  1DJH A;  3O78 A;  2WC8 A;  2TN4 A;  2PRU A;  1SY9 A;  2P6B B;  1BOC A;  3DXL A;  3UNW A;  3S0E A;  2JXC A;  2Q91 A;  2WC6 A;  3R1V A;  4NDC A;  5DIC A;  4PHM A;  1RRO A;  3PAT A;  3D75 A;  1W7I B;  3PLF B;  1KCY A;  4GBA A;  1SMG A;  2M97 A;  3D0Y A;  4C0L A;  1CDN A;  1SCM B;  1QAS A;  1LXF C;  2QPT A;  1G4Y R;  2M7N A;  4OVN F;  1LS8 A;  2H61 C;  2BBM A;  1DVI A;  2JC2 A;  1U5I A;  5D7F A;  4NDB A;  1K95 A;  3LK1 A;  2K7D A;  1FBV A;  3CGA A;  3BFH A;  4PE1 A;  3TS5 C;  3OX5 A;  1AUI B;  1F4O A;  3QRX A;  3EKJ A;  4TNC A;  3CR2 A;  2LHL A;  1Y6W A;  4GUK A;  1C3Y A;  2I18 A;  2KBI A;  4YI8 A;  4GGF A;  2JWW A;  1WDC B;  4I5N B;  1CB1 A;  1BLQ A;  3FE9 A;  1C07 A;  5FYX A;  4QJ5 B;  3D0Y B;  3BUM B;  2QDI A;  4DUQ A;  2L50 A;  3DD4 A;  1F71 A;  1WLM A;  2WOR A;  1U5I B;  2QEB A;  2LLU A;  3E3R A;  4XYN A;  1TNW A;  1JBA A;  1DJY A;  3D10 A;  3O6B A;  3PJI A;  2PVB A;  4N5X A;  2WCF A;  2L98 A;  1B8L A;  3I5F B;  4OV2 A;  2JTZ A;  1RK9 A;  2L5X B;  3HX4 A;  1CDL A;  1IGV A;  1SL8 A;  3NSI A;  1GJY A;  1KSO A;  5AFP A;  5HL1 A;  3A8R A;  1DJX A;  1S5G Z;  1B7T Y;  1YUR A;  1YR5 A;  2LUX A;  2V53 A;  2KSP A;  1CFF A;  1IKU A;  1S3P A;  2VRG A;  3TS5 B;  3D78 A;  1ODB A;  3PN7 B;  2BCA A;  3EK4 A;  1A2X A;  3SIA A;  4OR9 B;  2KPH A;  2EC6 B;  3I5H C;  3VRP A;  5KSZ A;  1KQV A;  3EK8 A;  3Q8I A;  1TTX A;  1MR8 A;  3CZT X;  1SNL A;  2FCE A;  4JPZ B;  1IJ6 A;  1L2O C;  3FE8 A;  2JNF A;  1YRT B;  2COL B;  2O5G A;  2M7L A;  1T14 A;  3OBV A;  2KLE A;  2BNX A;  4YGD B;  4YBH B;  3OB1 B;  1KQM C;  4FQT A;  1C7W A;  1LA0 A;  1OMV A;  2M9G A;  3SIB A;  5AXI A;  2WCH A;  2AUC A;  1CLB A;  1Y1X A;  1XFU O;  1X02 A;  1YUS A;  1K9U A;  3HCM A;  3TZ1 A;  1FI6 A;  1S6C A;  1S6J A;  1BJF A;  2JXL A;  4YI9 A;  1CFC A;  4GFT A;  1QIV A;  1QS7 A;  1QX2 A;  2WND A;  4PDZ A;  3B87 A;  1DMO A;  3DYE A;  3RZS A;  5JJG A;  4MRY A;  1KWO C;  2KI4 B;  1IQ5 A;  3LCP C;  3SG5 A;  4MEW A;  2OPO A;  4A4C A;  5GQQ C;  2JU0 A;  1TNX A;  2JT8 A;  3LLE A;  1EXR A;  4INW A;  1J7R A;  5FI2 A;  1QTX A;  1PUL A;  1SCV A;  2LCP A;  2M49 B;  1QX5 B;  4IJ7 A;  5HLO A;  1DT7 B;  4YGE B;  4I5J A;  4Q04 A;  1SL9 A;  2F3Y A;  3IQQ A;  1DJG A;  2KYF A;  1N0Y A;  3WHT B;  5I94 A;  2F2O A;  1SCM C;  1TNQ A;  1CKK A;  3CR5 X;  3D76 A;  2NCO A;  2L51 A;  1REC A;  1V1G A;  1K2H A;  4USL A;  1CDP A;  1DJZ A;  3L47 A;  3S0G A;  1A03 A;  1KQM B;  2LLS A;  1YUU A;  1DJW A;  2LVK A;  2HQ8 A;  3SG2 A;  2NXQ A;  3DVK A;  1SL7 A;  3VRR A;  4PHK A;  1EJ3 A;  2MBX A;  3FIA A;  4YGB B;  1XK4 C;  1Y0V H;  1ALV A;  1SBJ A;  2FCD A;  3VRO A;  1S5G Y;  2CTN A;  1EL4 A;  4AQJ A;  3NSO A;  2LP3 A;  4HRE E;  1OOJ A;  3S0D A;  1B7T Z;  4A4B A;  1WDC C;  4OKH A;  1W9Z A;  2MJW B;  3DVE A;  2I7A A;  1G33 A;  1JF2 A;  1WLZ A;  2LM5 A;  3GOF A;  2WCK A;  3TDZ A;  1E8A A;  3MSE B;  2EHB A;  1MXL C;  2KFG A;  2L2E A;  3OP0 A;  1AJ5 A;  1F55 A;  5DKR A;  4M2Q A;  1FI5 A;  3TDU A;  1XK4 A;  1KSM A;  1M63 B;  1N65 A;  1XFW O;  3NSK A;  3F45 A;  4ZCU A;  4ETO A;  3PAL A;  1BR1 B;  5I8N A;  1OMD A;  1V1F A;  4C0J A;  3I5F C;  3OGN A;  2LV7 A;  3KPX A;  1JFJ A;  4ORC B;  1NP8 A;  2KBM A;  1S26 D;  1OE9 B;  3UO9 A;  2PMY A;  5CSI A;  1RTP 1;  5FI7 A;  5JOL A;  4JWQ A;  1DQE A;  4MVF A;  2JPO A;  1SSE B;  2BBN A;  1WRZ A;  1SR6 C;  2AAO A;  2BE4 A;  2QEO A;  2ZN8 A;  1DGV A;  4L9M A;  1CNP A;  3PN7 C;  2ISD A;  3FE6 A;  2MA2 A;  1WRK A;  1TWO A;  1GM0 A;  5HKY A;  2KI6 D;  2BKI B;  2LHI A;  3SG3 A;  2EC6 C;  1DF0 A;  1BMO A;  2K2F A;  1B8R A;  1J55 A;  1JF0 A;  3NXA A;  2HET A;  3CZ2 A;  3PM2 A;  2ERB A;  4BY5 A;  4HRH A;  2K2A A;  3EK7 A;  2P71 A;  4DS7 A;  2GGZ A;  3ICB A;  2M8U A;  1K9P A;  3O4Y A;  2LAP A;  3IVT A;  2HQW A;  1TCF A;  1BF5 A;  1UHI A;  1ALW A;  3D74 A;  4C0K A;  3CAB A;  2BKH B;  2ZN9 A;  4ORB B;  3R1P A;  2Y5I A;  3CTN A;  2QAC A;  4MZJ A;  1GQM A;  2ZFD A;  1RWY A;  1QAT A;  1PK0 D;  2MLE C;  1Z2C B;  3BQ3 A;  3NSL A;  1F8H A;  1JSA A;  1Y1A A;  1SYM A;  1OOF A;  1XFY O;  3SS4 A;  3GK2 A;  5CSF A;  1TUJ A;  2YGU A;  1DF0 B;  3WNX B;  1XVJ A;  3BUX B;  2KFH A;  4PHN A;  1G8I A;  1HT9 A;  2KI4 C;  1S36 A;  1LKJ A;  3CYZ A;  1A29 A;  4AOM A;  2L0P A;  5I2O A;  2BCB A;  2Y1N A;  1K8U A;  3V2L A;  3R1O A;  1J7O A;  1SR6 B;  2JZI A;  2KLD A;  2KNE A;  1C3Z A;  4OCI A;  4R1E A;  3ZWH A;  1IG5 A;  3VRN A;  3DVJ A;  3B6X A;  4GGF C;  1NCY A;  2JUL A;  4MBE A;  2M3W A;  1M45 A;  1PAL A;  2LE9 B;  3EKH A;  3JVT B;  4JD9 A;  4DRW A;  1XO5 A;  4CID A;  1MF8 B;  1MHO A;  1QLK A;  1CM4 A;  3BOW A;  1JC2 A;  4GPL B;  1BU3 A;  1OOI X;  1IRJ A;  2QEH A;  4DCK A;  5TNC A;  1NYA A;  1TUZ A;  5CPV A;  1Q80 A;  1UUR A;  5PAL A;  1NX3 A;  2CBL A;  5KU1 A;  1B1G A;  1CMG A;  1F70 A;  2ZRS A;  1LIN A;  2K7C A;  1ZFS A;  3EVR A;  1KK8 B;  1TOP A;  1QX7 A;  2K8M B;  1UHJ A;  4FQO A;  1NIW A;  2MHH A;  3PSR A;  4JKT A;  3S0A A;  4U8D A;  2FJY A;  1CTR A;  2F2P A;  5HKW A;  5ER5 A;  1AVS A;  1DEK A;  1YVL A;  3CR4 X;  1YUT A;  2JOJ A;  2LUC A;  3OB2 B;  4N1G A;  1JUO A;  3BOW B;  1LA3 A;  3GK1 A;  2E30 A;  3IQO A;  3DY9 A;  1CFP A;  1SRA A;  3I5G C;  3NHT A;  4GAO A;  4CFR A;  1Y1U A;  1AK8 A;  1IH0 A;  2BL0 B;  2CCM A;  2KFF A;  2LC5 A;  3KF9 A;  1S6I A;  4WQ3 A;  1Z4H A;  4AQI A;  1QJT A;  2I94 A;  4NDD A;  2M29 A;  1GGZ A;  1M46 A;  2O60 A;  3IF7 A;  2BAP A;  2WCB A;  3H4S E;  3EVV A;  1XFX O;  1EG3 A;  2L4H A;  2PYQ A;  3EG5 B;  5BPJ A;  2SCP A;  1KFU L;  2LMU A;  5HLV A;  1KFX L;  1CM1 A;  1UHN A;  4IL1 A;  1XA5 A;  2KAX A;  1DJI A;  4ORA B;  1PSB A;  3L4A A;  1QWV A;  2E6W A;  2GGM A;  2K60 A;  2ZKM X;  4FTG A;  4WRI A;  3S0B A;  2K7O A;  3BUW B;  4QJ3 B;  1NX2 A;  1SK6 D;  1YVH A;  2LVV A;  3K1E A;  1OZO A;  2KI6 C;  2KHN A;  2FOT A;  1RFJ A;  3BFA A;  5I2Q A;  1BR4 B;  2JQ6 A;  2KAY A;  3RLZ A;  4BY4 A;  2JRF A;  2ZND A;  2ZRT A;  4I5K A;  1QV0 A;  1XYD A;  4MZL A;  1VRK A;  1UHK A;  2H8V A;  2Y1M A;  3WXA A;  3TUY B;  3I5G B;  3B86 A;  3C1V A;  3BYA A;  2FJU B;  2HF5 A;  3I5I B;  4HRG A;  3DF0 B;  3LL8 B;  2PAS A;  4E68 A;  3SJS A;  1CLM A;  1BT6 A;  1MXE A;  3AKB A;  5IBW A;  1DTL A;  3PFV A;  1UP5 A;  2LAN A;  2RGI A;  3GK4 X;  1KFX S;  3FS7 A;  1BG1 A;  1KK7 Z;  1NX1 A;  2B1U A;  4PCW A;  2MRD A;  1OMR A;  3RM1 A;  2R2I A;  3DZT A;  4YGA A;  2D8N A;  5CSN A;  3BJH A;  4PE4 A;  3CZ1 A;  1K94 A;  2NCP A;  3JTD B;  1IQ3 A;  1PVA A;  1ZUZ A;  1OOG A;  1ZOT B;  2M0R A;  2F33 A;  5D69 A;  5FI6 A;  5B8I B;  2G9B A;  3VGO A;  4P2Y B;  2KGR A;  2GV5 A;  5DKN A;  5G08 A;  1WY9 A;  1AHR A;  1A75 A;  1AJ4 A;  2KAV A;  2WC5 A;  1JWD A;  4NQG A;  1K93 D;  1ZAC A;  2OTG B;  1LVC D;  2JTT A;  1QXP A;  2LMT A;  3QME A;  3JVT C;  3R72 A;  1YTZ C;  3D73 A;  1PSR A;  4XJK A;  4MZK A;  1C7V A;  5HYD A;  1TNP A;  2WOS A;  4KYN A;  2CNP A;  1R2U A;  1J1D A;  1H4B A;  2QEV A;  1OW4 A;  3SG4 A;  3SS5 A;  1GGW A;  3AKA A;  1B47 A;  3DVM A;  3SS3 A;  4DIR A;  4I5L B;  4MLW A;  5D3O A;  2Q4U A;  1KK8 C;  5AAN A;  1A4P A;  1A75 B;  3O2P A;  1MQ1 A;  4MN0 A;  1IWQ A;  1SW8 A;  3CS1 A;  2BE6 A;  3AAJ A;  2AMI A;  2JT3 A;  3EVU A;  1MWN A;  4XJK B;  3VRQ A;  1EH2 A;  1WRL A;  2NZ0 A;  2H61 A;  3PM8 A;  1IIO A;  1RJV A;  1IJ5 A;  1OOH A;  2KOT A;  2BL0 C;  1J7Q A;  3FWC A;  3OHM B;  1K9K A;  1ORG A;  2OS8 B;  3M0W A;  2CT9 A;  1R6P A;  1J1E A;  1QLS A;  4F7F A;  4PAL A;  2LLT A;  1PVB A;  2LVJ A;  1YX7 A;  3ZNI A;  2CXJ A;  3KHE A;  1BOD A;  1YX8 A;  2WCM A;  4YRU A;  1AP4 A;  4P5O E;  5J3X A;  2BCX A;  1QIW A;  5EL2 A;  3CDN A;  2DOQ A;  2KDH A;  2EGD A;  1CMF A;  1NCZ A;  1OZS A;  1H8B A;  1KK7 Y;  2M1U A;  2HPS A;  5HKZ A;  1DGU A;  2Y4Q A;  4INX A;  1QVI Z;  2K7B A;  4JQ0 D;  1B4C A;  5CSJ A;  2NLN A;  1J7P A;  4ICB A;  4CPV A;  1B8C A;  1FF1 A;  3NHI A;  4WQ2 A;  1NSH A;  5ER4 X;  3CZ0 A;  3VB1 A;  3AAK A;  1TCO B;  1OSA A;  1S1E A;  1QV1 A;  1JFK A;  3KO0 A;  4M2P A;  1N2D A;  2WCE A;  4CLN A;  3TUY C;  4HSZ A;  3SG6 A;  2BEC A;  1K90 D;  2MLF C;  2I2R E;  2PAL A;  2PQL A;  3BFB A;  3I5I C;  1NCX A;  4PHJ A;  3S0F A;  1TN4 A;  2G2B A;  2K0J A;  1F54 A;  2JPT A;  2LVI A;  3N7H A;  3B7A A;  3OX6 A;  1XFZ O;  2WCL A;  1CLL A;  5F6T A;  2M1K B;  4ZCV A;  3B88 A;  5KTY A;  3A4U B;  4GNK B;  1SKT A;  4CFQ A;  3JTD C;  3FWB A;  4D1E A;  2A4J A;  2P70 A;  3BUO B;  3WHU B;  1CDM A;  3DF0 A;  2LP2 A;  4PE7 A;  5DKQ A;  1HQV A;  4F0Z B;  3D77 A;  1D1O A;  5K89 A;  2LMV A;  1PRW A;  2F3Z A;  1UHH A;  1K96 A;  4GGN A;  1SPY A;  1CFD A;  2LNK A;  2KQY A;  2IS9 A;  3O4X A;  1L7Z A;  1NPQ A;  1DC1 A;  2K61 A;  3BUN B;  2OTG C;  2SAS A;  1EG4 A;  1YRU B;  2ZNE A;  3I5H B;  3K21 A;  3SG7 A;  3LK0 A;  2H2K A;  1XFV O;  2L2C A;  4UPG A;  1NWD A;  1B9A A;  1FW4 A;  1L2O B;  2JT0 A;  5I2L A;  1M39 A;  1OQP A;  4M2O A;  4QJ4 B;  1M31 A;  1TIZ A;  3CLN A;  1NX0 A;  1NUB A;  3BXK A;  2GTE A;  2JNX A;  3KEV A;  2L5Y A;  2MAZ A;  1F4Q A;  2PSR A;  1KFU S;  4YGC B;  5AEQ A;  2L4I A;  4MRX A;  1QVI Y;  1UUS A;  4PT1 A;  1FPW A;  4OZD A;  4MSP A;  4N1F A;  4PE0 A;  1MUX A;  1KWO B;  3L4L A; 
#chains in the Genus database with same CATH homology
 1ZMZ A;  2KQ6 A;  5AER A;  2KYC A;  1UWO A;  1W7J B;  3TDI A;  2F8P A;  3CWG A;  1TRF A;  4ZCU A;  2KGB C;  2OS8 C;  1DJH A;  3O78 A;  2WC8 A;  2TN4 A;  2PRU A;  1SY9 A;  2P6B B;  1BOC A;  2JXC A;  2Q91 A;  4NDC A;  4PHM A;  1RRO A;  3PAT A;  3PLF B;  1W7I B;  1KCY A;  4GBA A;  1SMG A;  2M97 A;  3D0Y A;  4C0L A;  1CDN A;  1SCM B;  1QAS A;  1LXF C;  2QPT A;  1G4Y R;  2M7N A;  4OVN F;  2H61 C;  2BBM A;  1DVI A;  2JC2 A;  1U5I A;  5D7F A;  4NDB A;  1K95 A;  3LK1 A;  2K7D A;  1FBV A;  3CGA A;  4PE1 A;  3TS5 C;  3OX5 A;  1AUI B;  1F4O A;  3QRX A;  3EKJ A;  4TNC A;  3CR2 A;  2LHL A;  1Y6W A;  4GUK A;  2I18 A;  2KBI A;  4YI8 A;  4GGF A;  2JWW A;  1WDC B;  4I5N B;  1CB1 A;  1BLQ A;  1C07 A;  5FYX A;  4QJ5 B;  3D0Y B;  3BUM B;  4DUQ A;  2L50 A;  3DD4 A;  1F71 A;  1WLM A;  2WOR A;  1U5I B;  2LLU A;  3E3R A;  4XYN A;  1TNW A;  1JBA A;  1DJY A;  3D10 A;  3O6B A;  2PVB A;  4N5X A;  2WCF A;  2L98 A;  1B8L A;  3I5F B;  4OV2 A;  2JTZ A;  1RK9 A;  2L5X B;  3HX4 A;  1CDL A;  1IGV A;  1SL8 A;  3NSI A;  1GJY A;  1KSO A;  5AFP A;  3A8R A;  1DJX A;  1S5G Z;  1B7T Y;  1YUR A;  1YR5 A;  2LUX A;  2V53 A;  2KSP A;  1CFF A;  1IKU A;  1S3P A;  2VRG A;  3TS5 B;  1ODB A;  3PN7 B;  2BCA A;  3EK4 A;  1A2X A;  3SIA A;  4OR9 B;  2EC6 B;  3I5H C;  3VRP A;  5KSZ A;  1KQV A;  3EK8 A;  1TTX A;  1MR8 A;  3CZT X;  1SNL A;  2FCE A;  4JPZ B;  1IJ6 A;  1L2O C;  2JNF A;  1YRT B;  2COL B;  2O5G A;  2M7L A;  4YGD B;  4YBH B;  3OB1 B;  1KQM C;  1C7W A;  1LA0 A;  1OMV A;  2M9G A;  3SIB A;  5AXI A;  2AUC A;  1CLB A;  1Y1X A;  1XFU O;  1X02 A;  1YUS A;  1K9U A;  3HCM A;  3TZ1 A;  1FI6 A;  1S6C A;  1S6J A;  1BJF A;  2JXL A;  4YI9 A;  1CFC A;  4GFT A;  1QIV A;  1QS7 A;  1QX2 A;  2WND A;  4PDZ A;  1DMO A;  5JJG A;  4MRY A;  1KWO C;  2KI4 B;  1IQ5 A;  3LCP C;  3SG5 A;  4MEW A;  2OPO A;  4A4C A;  5GQQ C;  2JU0 A;  1TNX A;  2JT8 A;  3LLE A;  1EXR A;  1J7R A;  1QTX A;  1PUL A;  1SCV A;  2LCP A;  2M49 B;  1QX5 B;  5HLO A;  1DT7 B;  4YGE B;  4I5J A;  4Q04 A;  1SL9 A;  2F3Y A;  3IQQ A;  1DJG A;  2KYF A;  1N0Y A;  3WHT B;  2F2O A;  1SCM C;  1TNQ A;  1CKK A;  3CR5 X;  2NCO A;  2L51 A;  1REC A;  1V1G A;  1K2H A;  4USL A;  1CDP A;  1DJZ A;  1A03 A;  1KQM B;  2LLS A;  1YUU A;  1DJW A;  2LVK A;  2HQ8 A;  3SG2 A;  2NXQ A;  3DVK A;  1SL7 A;  3VRR A;  4PHK A;  1EJ3 A;  2MBX A;  3FIA A;  4YGB B;  1XK4 C;  1Y0V H;  1ALV A;  1SBJ A;  2FCD A;  3VRO A;  1S5G Y;  2CTN A;  1EL4 A;  4AQJ A;  3NSO A;  2LP3 A;  4HRE E;  1OOJ A;  4A4B A;  1B7T Z;  1WDC C;  4OKH A;  3DVE A;  2MJW B;  2I7A A;  1G33 A;  1JF2 A;  1WLZ A;  2LM5 A;  3GOF A;  3TDZ A;  1E8A A;  3MSE B;  2EHB A;  1MXL C;  2KFG A;  2L2E A;  3OP0 A;  1AJ5 A;  1F55 A;  5DKR A;  4M2Q A;  1FI5 A;  3TDU A;  1XK4 A;  1KSM A;  1M63 B;  1N65 A;  1XFW O;  3NSK A;  3F45 A;  4ETO A;  3PAL A;  1BR1 B;  5I8N A;  1OMD A;  1V1F A;  4C0J A;  3I5F C;  2LV7 A;  3KPX A;  1JFJ A;  4ORC B;  1NP8 A;  2KBM A;  1S26 D;  1OE9 B;  2PMY A;  5CSI A;  1RTP 1;  5JOL A;  4JWQ A;  4MVF A;  2BBN A;  1WRZ A;  1SR6 C;  2AAO A;  2BE4 A;  2ZN8 A;  1DGV A;  4L9M A;  1CNP A;  3PN7 C;  2ISD A;  2MA2 A;  1WRK A;  5HKY A;  2KI6 D;  2BKI B;  2LHI A;  3SG3 A;  2EC6 C;  1DF0 A;  1BMO A;  2K2F A;  1B8R A;  1J55 A;  1JF0 A;  3NXA A;  2HET A;  4BY5 A;  4HRH A;  2K2A A;  3EK7 A;  4DS7 A;  2GGZ A;  3ICB A;  2M8U A;  1K9P A;  3O4Y A;  2LAP A;  2HQW A;  1TCF A;  1BF5 A;  1UHI A;  1ALW A;  4C0K A;  2BKH B;  2ZN9 A;  4ORB B;  2Y5I A;  3CTN A;  2QAC A;  4MZJ A;  1GQM A;  2ZFD A;  1RWY A;  1QAT A;  1PK0 D;  2MLE C;  3BQ3 A;  3NSL A;  1F8H A;  1JSA A;  1Y1A A;  1SYM A;  1XFY O;  3GK2 A;  5CSF A;  3WNX B;  1DF0 B;  1XVJ A;  3BUX B;  2KFH A;  4PHN A;  1G8I A;  1HT9 A;  2KI4 C;  1S36 A;  1LKJ A;  1A29 A;  4AOM A;  2L0P A;  5I2O A;  2BCB A;  2Y1N A;  1K8U A;  1J7O A;  1SR6 B;  2JZI A;  2KNE A;  4R1E A;  4OCI A;  3ZWH A;  1IG5 A;  3VRN A;  3DVJ A;  4GGF C;  1NCY A;  2JUL A;  4MBE A;  2M3W A;  1M45 A;  1PAL A;  2LE9 B;  3EKH A;  3JVT B;  4DRW A;  1XO5 A;  4CID A;  1MF8 B;  1MHO A;  1QLK A;  1CM4 A;  3BOW A;  1JC2 A;  4GPL B;  1BU3 A;  1IRJ A;  4DCK A;  5TNC A;  1NYA A;  5CPV A;  1Q80 A;  1UUR A;  5PAL A;  1NX3 A;  2CBL A;  5KU1 A;  1B1G A;  1CMG A;  1F70 A;  2ZRS A;  1LIN A;  2K7C A;  1ZFS A;  3EVR A;  1KK8 B;  1TOP A;  1QX7 A;  2K8M B;  1UHJ A;  4FQO A;  1NIW A;  2MHH A;  3PSR A;  4U8D A;  1CTR A;  2F2P A;  5HKW A;  5ER5 A;  1AVS A;  1YVL A;  3CR4 X;  1YUT A;  2JOJ A;  2LUC A;  3OB2 B;  4N1G A;  1JUO A;  3BOW B;  1LA3 A;  3GK1 A;  2E30 A;  3IQO A;  1CFP A;  1SRA A;  3I5G C;  4GAO A;  4CFR A;  1Y1U A;  1AK8 A;  1IH0 A;  2BL0 B;  2CCM A;  2KFF A;  2LC5 A;  3KF9 A;  1S6I A;  4WQ3 A;  4AQI A;  1QJT A;  2I94 A;  4NDD A;  2M29 A;  1GGZ A;  1M46 A;  2O60 A;  3IF7 A;  2WCB A;  3H4S E;  3EVV A;  1XFX O;  1EG3 A;  2L4H A;  5BPJ A;  2SCP A;  1KFU L;  2LMU A;  5HLV A;  1KFX L;  1CM1 A;  1UHN A;  4IL1 A;  1XA5 A;  2KAX A;  1DJI A;  4ORA B;  1PSB A;  2E6W A;  2GGM A;  2ZKM X;  4FTG A;  4WRI A;  2K7O A;  3BUW B;  4QJ3 B;  1NX2 A;  1SK6 D;  1YVH A;  2LVV A;  1OZO A;  2KI6 C;  2KHN A;  2FOT A;  1RFJ A;  5I2Q A;  1BR4 B;  2JQ6 A;  2KAY A;  3RLZ A;  4BY4 A;  2JRF A;  2ZND A;  2ZRT A;  4I5K A;  1QV0 A;  1XYD A;  4MZL A;  1VRK A;  1UHK A;  3WXA A;  2Y1M A;  3TUY B;  3I5G B;  3C1V A;  3BYA A;  2FJU B;  2HF5 A;  3I5I B;  4HRG A;  3DF0 B;  3LL8 B;  2PAS A;  4E68 A;  3SJS A;  1CLM A;  1BT6 A;  1MXE A;  3AKB A;  5IBW A;  1DTL A;  3PFV A;  1UP5 A;  2LAN A;  2RGI A;  3GK4 X;  1KFX S;  3FS7 A;  1BG1 A;  1KK7 Z;  1NX1 A;  2B1U A;  4PCW A;  2MRD A;  1OMR A;  3RM1 A;  2R2I A;  4YGA A;  2D8N A;  5CSN A;  4PE4 A;  1K94 A;  2NCP A;  3JTD B;  1IQ3 A;  1PVA A;  1ZUZ A;  2M0R A;  1ZOT B;  2F33 A;  5D69 A;  5B8I B;  2G9B A;  3VGO A;  4P2Y B;  2KGR A;  2GV5 A;  5DKN A;  5G08 A;  1WY9 A;  1AHR A;  1A75 A;  1AJ4 A;  2KAV A;  1JWD A;  4NQG A;  1K93 D;  1ZAC A;  2OTG B;  1LVC D;  2JTT A;  1QXP A;  2LMT A;  3JVT C;  1YTZ C;  1PSR A;  4XJK A;  4MZK A;  1C7V A;  5HYD A;  1TNP A;  2WOS A;  1H4B A;  2CNP A;  1R2U A;  1J1D A;  3SG4 A;  1GGW A;  3AKA A;  1B47 A;  3DVM A;  4DIR A;  4I5L B;  4MLW A;  2Q4U A;  1KK8 C;  5AAN A;  1A4P A;  1A75 B;  3O2P A;  1MQ1 A;  4MN0 A;  1IWQ A;  1SW8 A;  3CS1 A;  2BE6 A;  3AAJ A;  2AMI A;  2JT3 A;  3EVU A;  1MWN A;  4XJK B;  3VRQ A;  1EH2 A;  1WRL A;  2NZ0 A;  2H61 A;  3PM8 A;  1RJV A;  1IJ5 A;  2KOT A;  2BL0 C;  1J7Q A;  3FWC A;  3OHM B;  1K9K A;  2OS8 B;  3M0W A;  2CT9 A;  1R6P A;  1J1E A;  1QLS A;  4PAL A;  2LLT A;  1PVB A;  2LVJ A;  1YX7 A;  3ZNI A;  2CXJ A;  3KHE A;  1BOD A;  1YX8 A;  4YRU A;  1AP4 A;  4P5O E;  5J3X A;  2BCX A;  1QIW A;  2DOQ A;  2KDH A;  2EGD A;  1CMF A;  1NCZ A;  1OZS A;  1H8B A;  1KK7 Y;  2M1U A;  2HPS A;  5HKZ A;  1DGU A;  2Y4Q A;  1QVI Z;  2K7B A;  4JQ0 D;  1B4C A;  5CSJ A;  2NLN A;  1J7P A;  4ICB A;  4CPV A;  1B8C A;  1FF1 A;  4WQ2 A;  1NSH A;  5ER4 X;  3AAK A;  1TCO B;  1OSA A;  1S1E A;  1QV1 A;  1JFK A;  3KO0 A;  4M2P A;  1N2D A;  2WCE A;  4CLN A;  3TUY C;  4HSZ A;  3SG6 A;  2BEC A;  1K90 D;  2MLF C;  2I2R E;  2PAL A;  3I5I C;  1NCX A;  4PHJ A;  1TN4 A;  2G2B A;  2K0J A;  1F54 A;  2JPT A;  2LVI A;  3OX6 A;  1XFZ O;  1CLL A;  5F6T A;  2M1K B;  4ZCV A;  5KTY A;  3A4U B;  4GNK B;  1SKT A;  4CFQ A;  3JTD C;  3FWB A;  4D1E A;  2A4J A;  3BUO B;  3WHU B;  1CDM A;  3DF0 A;  2LP2 A;  4PE7 A;  5DKQ A;  1HQV A;  4F0Z B;  1D1O A;  5K89 A;  2LMV A;  1PRW A;  2F3Z A;  1UHH A;  1K96 A;  4GGN A;  1SPY A;  1CFD A;  2LNK A;  2KQY A;  2IS9 A;  1L7Z A;  1NPQ A;  2K61 A;  3BUN B;  2OTG C;  2SAS A;  1EG4 A;  1YRU B;  2ZNE A;  3I5H B;  3K21 A;  3SG7 A;  3LK0 A;  2H2K A;  1XFV O;  4UPG A;  1NWD A;  1B9A A;  1FW4 A;  1L2O B;  2JT0 A;  5I2L A;  1M39 A;  1OQP A;  4M2O A;  4QJ4 B;  1M31 A;  1TIZ A;  3CLN A;  1NX0 A;  1NUB A;  3BXK A;  2JNX A;  3KEV A;  2MAZ A;  1F4Q A;  2PSR A;  1KFU S;  4YGC B;  5AEQ A;  2L4I A;  4MRX A;  1QVI Y;  1UUS A;  1FPW A;  4MSP A;  4N1F A;  4PE0 A;  1MUX A;  1KWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...