3DVKA

Crystal structure of ca2+/cam-cav2.3 iq domain complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
143
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Calmodulin
total genus 50
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvkA00
1NWDA 4JPZB 1U5IA 4P2YB 1S6JA 3PFVA 1F55A 2NXQA 2KAXA 3EVRA 3BYAA 3I5FB 1NSHA 1JC2A 1CFDA 2K7BA 1RTP1 1SK6D 4DCKA 2CBLA 4OKHA 2E30A 2KFHA 1YRUB 4GAOA 4M2QA 1BOCA 2G9BA 1TIZA 2M0RA 1J7QA 3OX6A 1V1GA 1QS7A 2JTTA 4M2OA 3SG2A 3O4YA 4AQIA 2BL0C 1A75B 2KI6D 2LVJA 3CLNA 3NSKA 2BBMA 2E6WA 2JPTA 5CSJA 4UPGA 4WQ3A 3DVMA 1JFKA 1ZMZA 2P6BB 5B8IB 4ORCB 1CMGA 2ZN8A 3BUXB 3DF0B 1DVIA 2LHLA 2OPOA 1AP4A 1CFPA 4HSZA 4PHNA 2BKHB 3DF0A 4DRWA 3OHMB 1MUXA 2JOJA 1NIWA 2L0PA 2Y1NA 4R1EA 1DF0B 1HT9A 2M7LA 2AAOA 1CDMA 1M31A 1C7VA 1IQ5A 2K7DA 2FCEA 5AFPA 2Y5IA 3D10A 4I5KA 2MAZA 3VRPA 1KWOB 4YGCB 1YURA 1TNPA 5I2OA 1KQMB 3TDUA 4D1EA 1ALWA 3EVVA 2LM5A 2Y1MA 2JTZA 3AKAA 1ZOTB 1SL8A 4YGDB 3EKJA 1TCFA 1YUTA 1VRKA 2TN4A 1QXPA 1K95A 2LVKA 1IWQA 2L4IA 1DT7B 2BCBA 5K89A 1IG5A 1QLSA 2JNFA 2M9GA 3AKBA 3CZTX 3EK8A 3PALA 1UHKA 5AERA 3NSOA 2BE6A 2GV5A 3O6BA 1UP5A 1RFJA 1RJVA 2IS9A 2PMYA 2LMVA 2KQ6A 1A75A 2KAVA 1ZUZA 2JT3A 2LNKA 1OMRA 2WCEA 5TNCA 2F3YA 1MHOA 1M63B 2K8MB 2KYCA 5HKZA 5HKYA 1FPWA 2O5GA 1SNLA 3O2PA 3OB1B 4ORBB 1C7WA 1SR6B 1GQMA 2MLFC 1PSBA 3DD4A 3PLFB 1W7JB 1RECA 5KTYA 1CLBA 1LINA 2M49B 3NSIA 1QVIZ 3GOFA 2WC8A 2JZIA 4PDZA 1WRKA 4GBAA 2K2AA 1AK8A 3NSLA 1CTRA 3LK0A 3K21A 2KI6C 4MRYA 3KHEA 1XVJA 4YRUA 5JOLA 4NDCA 1CMFA 1F54A 2B1UA 1NCXA 1YRTB 1TRFA 1B47A 2L51A 1K9UA 3KPXA 3BUOB 4PHJA 1CM4A 1OOJA 1OSAA 3BQ3A 2CT9A 1U5IB 1XO5A 2KSPA 1CFCA 3LK1A 2KBMA 3WXAA 1CM1A 1KK7Z 1WRZA 1R6PA 1GGWA 1OE9B 1SKTA 1YTZC 3A4UB 1DJIA 1PULA 1Q80A 1S5GY 4I5JA 2AMIA 2AUCA 4I5LB 3KF9A 1KFUL 2ZKMX 3SG5A 1LVCD 1TOPA 1QATA 2JWWA 2KFFA 3VRRA 3I5FC 3D0YB 1QLKA 1N2DA 1NX2A 1EJ3A 3VRQA 5D69A 2F3ZA 1D1OA 4ORAB 1M46A 5I2LA 3DVEA 1UHIA 2HQWA 4CPVA 4OV2A 1JBAA 2LLUA 2M8UA 1M45A 2Q4UA 4MEWA 1UUSA 1WDCC 4GGNA 3CS1A 3JTDB 3EKHA 2BKIB 1B7TY 3PSRA 3EVUA 1RK9A 1DJZA 1SRAA 1QV0A 1NX3A 2ZFDA 3I5IB 5CPVA 1JSAA 2F2OA 1BU3A 2NLNA 2LANA 4F0ZB 2ZNEA 3HX4A 4DIRA 2LLSA 4PE4A 3VGOA 1PALA 4XYNA 2BECA 2LLTA 2EC6C 2CNPA 3OP0A 1A03A 3SIAA 2FOTA 1WDCB 1IKUA 4OCIA 2LVIA 1MF8B 2KYFA 4ZCVA 1A2XA 3RLZA 1X02A 1K94A 2L98A 1J7PA 2Y4QA 4C0KA 2M1UA 2CTNA 4GGFC 2CXJA 1BR4B 2FJUB 1XK4C 3GK1A 1JF0A 1G4YR 1KFXL 1A29A 4JWQA 3WNXB 3DVJA 3IQQA 4YI9A 2COLB 4QJ4B 1MR8A 2EGDA 2GGZA 3BOWB 1Y1UA 4A4CA 5DKNA 3ZWHA 5I2QA 5FYXA 1OZOA 1S5GZ 5CSIA 3SG4A 1QX2A 1K90D 2I2RE 1ALVA 2A4JA 1FF1A 3GK4X 2R2IA 1J7OA 5HYDA 3CR5X 4BY5A 3FIAA 3FWCA 4GUKA 4WRIA 2WNDA 4PCWA 5J3XA 1JWDA 3BUNB 1CFFA 2JXCA 1DMOA 4NDBA 2OTGB 3IQOA 4FQOA 5I8NA 1G8IA 3EK4A 1H4BA 4L9MA 2LC5A 2MRDA 2ZRTA 2JRFA 4M2PA 1KFUS 1QASA 3TDZA 2L5XB 1IGVA 3WHUB 1UHHA 2FCDA 4XJKA 1CNPA 3GK2A 2JC2A 2OTGC 1KQVA 1EG4A 2LVVA 2WCFA 1WLZA 2ZNDA 1ODBA 2F8PA 1DJGA 2LMUA 1SBJA 1S6IA 1OMDA 1XFUO 3VRNA 1XYDA 1DJWA 4HRGA 2L2EA 4ZCUA 1B9AA 2KGRA 2LUXA 1UHNA 4U8DA 4USLA 1PVAA 2OS8C 2PVBA 1XFXO 2GGMA 1S6CA 1B8RA 4HRHA 4NDDA 1FI5A 5HLVA 3WHTB 1UURA 4GPLB 1BT6A 2SASA 1KQMC 1SYMA 1LA3A 2QACA 3RM1A 4OR9B 1GJYA 4C0LA 1LA0A 1UHJA 1KSOA 4N1FA 4YGEB 4FTGA 1WY9A 1M39A 2I18A 1SCVA 2L4HA 1FW4A 2MA2A 1LKJA 1V1FA 1ZACA 2MLEC 3TZ1A 2V53A 3A8RA 4JQ0D 3I5GC 1KWOC 2HQ8A 3SIBA 2WORA 1IRJA 2HF5A 2EC6B 3TDIA 3LLEA 4QJ5B 4N1GA 2RGIA 2LCPA 1UWOA 1EG3A 2HETA 4N5XA 2I94A 2KNEA 1BMOA 1YR5A 2ZN9A 4CIDA 3BXKA 3C1VA 1L2OB 1R2UA 4AQJA 1SCMC 3PN7C 1JF2A 1B1GA 1J1DA 1XFZO 3IF7A 1SW8A 4MLWA 2LP2A 1NPQA 1WRLA 1BJFA 2H61C 3OX5A 1TNQA 1Y0VH 4YGBB 2KHNA 3I5HC 2MHHA 4MZLA 5CSFA 1MXLC 2JULA 3ZNIA 1Y1XA 3TS5C 1N65A 1B8CA 5ER4X 1IH0A 2LUCA 2VRGA 2KBIA 5AXIA 2NZ0A 5G08A 1N0YA 1QIWA 2KQYA 1EXRA 1YUUA 2LE9B 3JVTB 5IBWA 1EH2A 1OMVA 3I5HB 3NXAA 2DOQA 1TNXA 4MZKA 4MSPA 2O60A 1QVIY 2K7CA 1F4QA 1S26D 1CDPA 1PRWA 2KOTA 4ICBA 2M1KB 4YBHB 2BCAA 2NCOA 1PVBA 3TUYB 1J7RA 2JQ6A 4XJKB 1LXFC 3FWBA 2WOSA 1QX7A 2WCBA 5DKRA 1SL9A 3JTDC 3VROA 1KFXS 4GGFA 1E8AA 1G33A 1SL7A 3KO0A 2BE4A 2JT0A 5GQQC 1KK7Y 1YVLA 4MZJA 4ETOA 1C07A 2LMTA 4DS7A 1K9PA 4MRXA 5AANA 2H2KA 2JU0A 2G2BA 3JVTC 2K2FA 3H4SE 1FBVA 1NCZA 2BCXA 1K96A 1YX8A 2SCPA 1QJTA 2EHBA 1NYAA 1IQ3A 1EL4A 1DGUA 2M7NA 3LL8B 1QTXA 1BR1B 1PK0D 1TN4A 2KDHA 4TNCA 1OZSA 2KI4C 5JJGA 2K61A 2I7AA 3BUMB 4C0JA 1DJHA 1SY9A 1KCYA 3AAKA 1S3PA 3SG6A 2F33A 1TNWA 3D0YA 1JFJA 1XA5A 1YVHA 3SG7A 4MN0A 2OS8B 2JT8A 1SCMB 3PN7B 1K9KA 5HKWA 2CCMA 2HPSA 4A4BA 1KK8B 1GGZA 2QPTA 1BODA 2PSRA 4MBEA 3SG3A 2KAYA 5DKQA 5CSNA 2PASA 1QIVA 1IJ5A 1MXEA 2D8NA 2F2PA 4I5NB 3CR2A 5D7FA 1SR6C 1CDNA 1J1EA 1QX5B 1S36A 3AAJA 4OVNF 1AJ4A 3I5GB 1PSRA 1DJYA 1OQPA 1J55A 1RWYA 4DUQA 1WLMA 1NP8A 1F70A 3PATA 3LCPC 1F71A 3BOWA 5BPJA 4BY4A 1K2HA 4Q04A 1DGVA 1CKKA 3CTNA 4WQ2A 1YX7A 3F45A 2NCPA 2PALA 1K93D 2KGBC 2M29A 1XFVO 4PALA 1B7TZ 1CB1A 2PRUA 3BUWB 4P5OE 1DTLA 3CWGA 2ZRSA 1KSMA 4QJ3B 4YI8A 3KEVA 4CFQA 1AJ5A 1XFYO 3FS7A 1L7ZA 3EK7A 1KK8C 3MSEB 4GFTA 3CGAA 1TTXA 5AEQA 4PHKA 2KI4B 1NX1A 4CLNA 1Y1AA 1AHRA 1F8HA 5ER5A 4PE0A 1JUOA 1NX0A 2LAPA 5KSZA 1H8BA 3PM8A 1XK4A 3DVKA 2K0JA 4NQGA 3TS5B 1AVSA 1MQ1A 2K7OA 1IJ6A 3M0WA 3E3RA 3QRXA 4HREE 1RROA 1HQVA 2JNXA 1BF5A 1S1EA 3CR4X 1BG1A 1ZFSA 2M3WA 3O78A 4MVFA 1QV1A 4IL1A 1CLLA 5HLOA 1Y6WA 1K8UA 5F6TA 1A4PA 1MWNA 2LP3A 1L2OC 1FI6A 4GNKB 1F4OA 2H61A 1SPYA 4PE1A 4AOMA 1BLQA 1DJXA 1B8LA 2KFGA 3ICBA 1NCYA 2BBNA 3OB2B 1SMGA 1YUSA 2L50A 3HCMA 4YGAA 2MJWB 2MBXA 1AUIB 4E68A 1XFWO 1B4CA 1DF0A 3SJSA 2BL0B 3I5IC 4PHMA 5PALA 1NUBA 4PE7A 1TCOB 2LHIA 4CFRA 2Q91A 5KU1A 2JXLA 2LV7A 1CLMA 3TUYC 2ISDA 2M97A 1W7IB 1CDLA
chains in the Genus database with same CATH superfamily
1NWDA 3BFAA 2H8VA 4JPZB 1U5IA 3B88A 1S6JA 4P2YB 3PFVA 1F55A 2NXQA 2KAXA 1C3ZA 3EVRA 3O4XA 3BYAA 3I5FB 1NSHA 3S0BA 1JC2A 1CFDA 2K7BA 1RTP1 1SK6D 4DCKA 2CBLA 4OKHA 2E30A 2KFHA 1YRUB 4GAOA 4M2QA 1BOCA 2G9BA 1TIZA 2M0RA 1J7QA 3OX6A 1V1GA 1QS7A 2JTTA 4M2OA 3SG2A 3O4YA 4AQIA 2BL0C 1A75B 2KI6D 2KLDA 2LVJA 3CLNA 3NSKA 2BBMA 2E6WA 2JPTA 5CSJA 4UPGA 3FE9A 3SS4A 2K60A 4WQ3A 3DVMA 1JFKA 1ZMZA 3CABA 1LS8A 2P6BB 5B8IB 4ORCB 1CMGA 2ZN8A 3BUXB 3DF0B 1DVIA 2LHLA 3S0FA 2OPOA 1AP4A 1CFPA 4HSZA 4PHNA 2BKHB 3DF0A 4DRWA 3OHMB 1MUXA 2JOJA 1NIWA 3FE8A 2L0PA 2Y1NA 5DICA 4R1EA 1DF0B 1HT9A 2M7LA 2AAOA 1CDMA 1M31A 3NHIA 1C7VA 1IQ5A 2K7DA 2FCEA 5AFPA 2Y5IA 3D10A 4I5KA 2MAZA 3VRPA 1KWOB 4YGCB 1YURA 1TNPA 5I2OA 1OOIX 1KQMB 1TWOA 3TDUA 4D1EA 1ALWA 3EVVA 2LM5A 3CZ1A 2Y1MA 2JTZA 3AKAA 1ZOTB 1SL8A 4YGDB 3EKJA 1TCFA 1YUTA 3Q8IA 1VRKA 2TN4A 1QXPA 1K95A 2LVKA 1IWQA 2L4IA 2PYQA 1DT7B 1OOGA 2BCBA 5K89A 1IG5A 3CZ2A 1QLSA 2JNFA 2M9GA 3AKBA 3CZTX 3EK8A 3DY9A 1UHKA 2WC5A 3PALA 1QWVA 3NSOA 5FI7A 5AERA 2BE6A 2GV5A 3D75A 1UP5A 1RFJA 3O6BA 1RJVA 5HL1A 2IS9A 2PMYA 2LMVA 2KQ6A 3DXLA 1A75A 2KAVA 1ZUZA 2JT3A 2LNKA 1OMRA 4JD9A 2WCEA 5TNCA 2L5YA 2F3YA 1MHOA 1M63B 2K8MB 2KYCA 5HKZA 5HKYA 1FPWA 2O5GA 1SNLA 3O2PA 3OB1B 4ORBB 1C7WA 1SR6B 1GQMA 2MLFC 1PSBA 3DD4A 3PLFB 1W7JB 1XFRA 1RECA 5KTYA 1DC1A 3DZTA 1CLBA 1LINA 2M49B 3NSIA 1QVIZ 3GOFA 2WC8A 2JZIA 4PDZA 1WRKA 4GBAA 2K2AA 2WCKA 1AK8A 3NSLA 1CTRA 3LK0A 3K21A 4IJ7A 2KI6C 4MRYA 3KHEA 1XVJA 4YRUA 3OBVA 5JOLA 4NDCA 1CMFA 2BNXA 1F54A 2B1UA 1NCXA 1YRTB 1TRFA 1B47A 2L51A 1K9UA 3KPXA 3BUOB 4PHJA 1CM4A 1OOJA 3PM2A 1OSAA 3D78A 3BQ3A 2CT9A 1U5IB 3D74A 1XO5A 2KSPA 3PJIA 1CFCA 3LK1A 2KBMA 3WXAA 1CM1A 1KK7Z 1WRZA 1R6PA 1GGWA 1OE9B 1SKTA 1YTZC 3A4UB 2WCLA 1DJIA 1PULA 1Q80A 1S5GY 4I5JA 2AMIA 2AUCA 4I5LB 3KF9A 1KFUL 2ZKMX 3SG5A 1LVCD 1TOPA 1QATA 2JWWA 2KFFA 3VRRA 3I5FC 3D0YB 1QLKA 1N2DA 1NX2A 1EJ3A 3VRQA 5D69A 2F3ZA 1D1OA 2FJYA 4ORAB 1M46A 5I2LA 3DVEA 1UHIA 2HQWA 4CPVA 4OV2A 1JBAA 2LLUA 1T14A 2M8UA 1M45A 2Q4UA 4MEWA 1UUSA 1WDCC 4GGNA 3CS1A 3JTDB 3EKHA 2BKIB 1B7TY 3PSRA 3EVUA 1RK9A 1DJZA 1SRAA 1QV0A 1NX3A 2ZFDA 3I5IB 5CPVA 1JSAA 2F2OA 1OOHA 1BU3A 2NLNA 2LANA 4F0ZB 2QEOA 2ZNEA 1OW4A 2KPHA 3HX4A 4DIRA 2LLSA 3NHTA 4PE4A 3VGOA 1C3YA 1PALA 4XYNA 2BECA 2LLTA 2EC6C 2CNPA 3OP0A 3UO9A 1A03A 3SIAA 2FOTA 1WDCB 1IKUA 3CYZA 4OCIA 2LVIA 4OZDA 1MF8B 2KYFA 4ZCVA 1A2XA 3RLZA 1X02A 1K94A 2L98A 1J7PA 2Y4QA 3B87A 3R1PA 4C0KA 2M1UA 2CTNA 4GGFC 2CXJA 1BR4B 2FJUB 1XK4C 3GK1A 3S0EA 1JF0A 1G4YR 1KFXL 4KYNA 3SS5A 1A29A 2QDIA 1TUZA 4JWQA 3WNXB 3DVJA 3IQQA 4YI9A 1IIOA 4INWA 2COLB 4QJ4B 1MR8A 2EGDA 2GGZA 3BOWB 1Y1UA 4A4CA 5DKNA 3ZWHA 5I2QA 5FYXA 1OZOA 1S5GZ 5CSIA 3SG4A 1QX2A 1K90D 2I2RE 1ALVA 2A4JA 1FF1A 3GK4X 2R2IA 1J7OA 5HYDA 3CR5X 4BY5A 3FIAA 3FWCA 4GUKA 4WRIA 2WNDA 4PCWA 5FI2A 5J3XA 1JWDA 3BUNB 1CFFA 2JXCA 1DMOA 4NDBA 2BAPA 2OTGB 3D76A 3IQOA 4FQOA 5I8NA 1G8IA 3EK4A 1H4BA 4L9MA 2LC5A 2MRDA 2ZRTA 2JRFA 4M2PA 1KFUS 1W9ZA 1QASA 3TDZA 2JPOA 2L5XB 1IGVA 3WHUB 1UHHA 2FCDA 4XJKA 2ERBA 3R1OA 1CNPA 3GK2A 2JC2A 2OTGC 1KQVA 1EG4A 2LVVA 2WCFA 1WLZA 1TUJA 4INXA 2ZNDA 2WCHA 3S0DA 1ODBA 2F8PA 1DJGA 2LMUA 1SBJA 1S6IA 1OMDA 1XFUO 3VRNA 1XYDA 1DJWA 4HRGA 2L2EA 4ZCUA 1B9AA 2KGRA 2LUXA 1UHNA 4U8DA 4USLA 1PVAA 2OS8C 2PVBA 1XFXO 2GGMA 1S6CA 1B8RA 4HRHA 4NDDA 1FI5A 3FE6A 5HLVA 3WHTB 1UURA 3L4AA 1BT6A 4GPLB 3VB1A 2PQLA 2SASA 1KQMC 1SYMA 1LA3A 2QACA 3RM1A 4OR9B 1GJYA 4C0LA 1LA0A 1UHJA 1KSOA 4N1FA 2QEVA 4YGEB 4FTGA 2WCJA 1WY9A 1M39A 2I18A 3BJHA 1SCVA 2L4HA 1FW4A 2MA2A 3D77A 1LKJA 1V1FA 1ZACA 2MLEC 3TZ1A 2V53A 3A8RA 4JQ0D 3I5GC 1KWOC 2HQ8A 3SIBA 2WORA 1IRJA 2HF5A 2EC6B 3TDIA 3LLEA 4QJ5B 3R1VA 4N1GA 2RGIA 2WCMA 2LCPA 1GM0A 1UWOA 1EG3A 2HETA 4N5XA 2I94A 2KNEA 1BMOA 1YR5A 3CDNA 2ZN9A 4CIDA 3BXKA 3C1VA 1L2OB 1R2UA 4AQJA 1SCMC 3PN7C 1JF2A 1B1GA 1J1DA 1XFZO 3IF7A 1SW8A 4MLWA 4JKTA 2LP2A 1NPQA 1SSEB 1WRLA 1BJFA 2H61C 3OX5A 5FI6A 1TNQA 1Y0VH 4YGBB 2KHNA 3I5HC 2MHHA 4MZLA 5CSFA 1MXLC 2JULA 3ZNIA 1Y1XA 3TS5C 1N65A 1B8CA 1ORGA 5ER4X 1IH0A 2LUCA 2VRGA 2KBIA 3B6XA 4YGAA 5AXIA 2P71A 2NZ0A 5G08A 1N0YA 1QIWA 2KQYA 1EXRA 1YUUA 2LE9B 3JVTB 5IBWA 1EH2A 1OMVA 3I5HB 3NXAA 2DOQA 1TNXA 4MZKA 4MSPA 2O60A 3RZSA 1QVIY 2K7CA 1F4QA 1S26D 1CDPA 1PRWA 2KOTA 2QEBA 2M1KB 3BFHA 4ICBA 4YBHB 2BCAA 2NCOA 1PVBA 3TUYB 1J7RA 2JQ6A 4XJKB 3L4LA 1LXFC 3FWBA 3OGNA 2WOSA 1QX7A 2WCBA 5DKRA 1SL9A 3JTDC 3VROA 1KFXS 4GGFA 1E8AA 1G33A 3BFBA 5D3OA 1SL7A 3KO0A 2BE4A 2JT0A 2P70A 1KK7Y 1YVLA 4MZJA 5GQQC 4ETOA 1C07A 3B7AA 2LMTA 4DS7A 1K9PA 4MRXA 5AANA 2H2KA 2JU0A 2G2BA 3NGVA 3JVTC 1Z2CB 2K2FA 3H4SE 1FBVA 1NCZA 2BCXA 1K96A 1YX8A 2SCPA 1QJTA 2EHBA 1NYAA 3IVTA 1IQ3A 1EL4A 1DGUA 2M7NA 3LL8B 1QTXA 1BR1B 1PK0D 1TN4A 2KDHA 4TNCA 1OZSA 2KI4C 5JJGA 2K61A 2I7AA 3BUMB 4C0JA 1DJHA 1SY9A 1KCYA 5I94A 3AAKA 1S3PA 3SG6A 2F33A 1TNWA 3D0YA 1JFJA 1XA5A 1YVHA 3SG7A 1P28A 4MN0A 3S0AA 2OS8B 2JT8A 1SCMB 3PN7B 1DEKA 3B86A 1K9KA 5HKWA 2GTEA 2CCMA 5EL2A 2HPSA 4A4BA 1KK8B 1GGZA 2QPTA 1BODA 2PSRA 4MBEA 3SG3A 2KAYA 5DKQA 5CSNA 2PASA 1QIVA 1IJ5A 1MXEA 2D8NA 2F2PA 3R72A 3CR2A 4I5NB 5D7FA 1SR6C 1CDNA 2L2CA 1J1EA 1QX5B 2QEHA 1S36A 3AAJA 4OVNF 1AJ4A 3I5GB 1PSRA 3K1EA 3EG5B 1DJYA 1OQPA 1J55A 1RWYA 4DUQA 1WLMA 1NP8A 1F70A 3PATA 3LCPC 1F71A 3BOWA 5BPJA 4BY4A 1K2HA 4Q04A 1DGVA 1CKKA 3CTNA 4WQ2A 1YX7A 3F45A 2NCPA 2PALA 1K93D 2KGBC 2M29A 1XFVO 4PALA 1B7TZ 1CB1A 2PRUA 3BUWB 4P5OE 1DTLA 3CWGA 2ZRSA 1KSMA 2WC6A 4FQTA 4QJ3B 4YI8A 3KEVA 4CFQA 1AJ5A 1XFYO 3FS7A 1L7ZA 3EK7A 1KK8C 3CZ0A 3MSEB 4GFTA 2KLEA 1TTXA 3CGAA 5AEQA 4PHKA 2KI4B 1DQEA 1NX1A 4CLNA 1Y1AA 1AHRA 3SS3A 3DYEA 1F8HA 5ER5A 4PE0A 1JUOA 1NX0A 2LAPA 5KSZA 1H8BA 3D73A 3PM8A 1XK4A 3DVKA 2K0JA 1DELA 3UNWA 4NQGA 3TS5B 1AVSA 1MQ1A 2K7OA 1IJ6A 3M0WA 3E3RA 3QRXA 4HREE 1RROA 1HQVA 2JNXA 1BF5A 1S1EA 3CR4X 1BG1A 3L47A 1ZFSA 2M3WA 3O78A 4MVFA 1QV1A 4IL1A 1CLLA 5HLOA 1OOFA 1Y6WA 1K8UA 5F6TA 2YGUA 1A4PA 1MWNA 2LP3A 1L2OC 1FI6A 4GNKB 1F4OA 2H61A 1SPYA 4PE1A 4AOMA 1BLQA 1DJXA 3S0GA 1B8LA 2KFGA 3ICBA 1NCYA 2BBNA 3OB2B 1SMGA 1YUSA 2L50A 3HCMA 4PT1A 2MJWB 2MBXA 1AUIB 4E68A 1XFWO 1B4CA 1DF0A 3SJSA 2BL0B 3I5IC 4PHMA 5PALA 1NUBA 1Z4HA 4F7FA 4PE7A 1TCOB 2LHIA 4CFRA 2Q91A 3V2LA 5KU1A 2JXLA 2LV7A 1CLMA 3QMEA 3TUYC 2ISDA 2M97A 1W7IB 3N7HA 1CDLA
chains in the Genus database with same CATH topology
1NWDA 4JPZB 1U5IA 4P2YB 1S6JA 3PFVA 1F55A 2NXQA 2KAXA 3EVRA 3BYAA 3I5FB 1NSHA 1JC2A 1CFDA 2K7BA 1RTP1 1SK6D 4DCKA 2CBLA 4OKHA 2E30A 2KFHA 1YRUB 4GAOA 4M2QA 1BOCA 2G9BA 1TIZA 2M0RA 1J7QA 3OX6A 1V1GA 1QS7A 2JTTA 4M2OA 3SG2A 3O4YA 4AQIA 2BL0C 1A75B 2KI6D 2LVJA 3CLNA 3NSKA 2BBMA 2E6WA 2JPTA 5CSJA 4UPGA 4WQ3A 3DVMA 1JFKA 1ZMZA 2P6BB 5B8IB 4ORCB 1CMGA 2ZN8A 3BUXB 3DF0B 1DVIA 2LHLA 2OPOA 1AP4A 1CFPA 4HSZA 4PHNA 2BKHB 3DF0A 4DRWA 3OHMB 1MUXA 2JOJA 1NIWA 2L0PA 2Y1NA 4R1EA 1DF0B 1HT9A 2M7LA 2AAOA 1CDMA 1M31A 1C7VA 1IQ5A 2K7DA 2FCEA 5AFPA 2Y5IA 3D10A 4I5KA 2MAZA 3VRPA 1KWOB 4YGCB 1YURA 1TNPA 5I2OA 1KQMB 3TDUA 4D1EA 1ALWA 3EVVA 2LM5A 2Y1MA 2JTZA 3AKAA 1ZOTB 1SL8A 4YGDB 3EKJA 1TCFA 1YUTA 1VRKA 2TN4A 1QXPA 1K95A 2LVKA 1IWQA 2L4IA 1DT7B 2BCBA 5K89A 1IG5A 1QLSA 2JNFA 2M9GA 3AKBA 3CZTX 3EK8A 3PALA 1UHKA 5AERA 3NSOA 2BE6A 2GV5A 3O6BA 1UP5A 1RFJA 1RJVA 2IS9A 2PMYA 2LMVA 2KQ6A 1A75A 2KAVA 1ZUZA 2JT3A 2LNKA 1OMRA 2WCEA 5TNCA 2F3YA 1MHOA 1M63B 2K8MB 2KYCA 5HKZA 5HKYA 1FPWA 2O5GA 1SNLA 3O2PA 3OB1B 4ORBB 1C7WA 1SR6B 1GQMA 2MLFC 1PSBA 3DD4A 3PLFB 1W7JB 1RECA 5KTYA 1CLBA 1LINA 2M49B 3NSIA 1QVIZ 3GOFA 2WC8A 2JZIA 4PDZA 1WRKA 4GBAA 2K2AA 1AK8A 3NSLA 1CTRA 3LK0A 3K21A 2KI6C 4MRYA 3KHEA 1XVJA 4YRUA 5JOLA 4NDCA 1CMFA 1F54A 2B1UA 1NCXA 1YRTB 1TRFA 1B47A 2L51A 1K9UA 3KPXA 3BUOB 4PHJA 1CM4A 1OOJA 1OSAA 3BQ3A 2CT9A 1U5IB 1XO5A 2KSPA 1CFCA 3LK1A 2KBMA 3WXAA 1CM1A 1KK7Z 1WRZA 1R6PA 1GGWA 1OE9B 1SKTA 1YTZC 3A4UB 1DJIA 1PULA 1Q80A 1S5GY 4I5JA 2AMIA 2AUCA 4I5LB 3KF9A 1KFUL 2ZKMX 3SG5A 1LVCD 1TOPA 1QATA 2JWWA 2KFFA 3VRRA 3I5FC 3D0YB 1QLKA 1N2DA 1NX2A 1EJ3A 3VRQA 5D69A 2F3ZA 1D1OA 4ORAB 1M46A 5I2LA 3DVEA 1UHIA 2HQWA 4CPVA 4OV2A 1JBAA 2LLUA 2M8UA 1M45A 2Q4UA 4MEWA 1UUSA 1WDCC 4GGNA 3CS1A 3JTDB 3EKHA 2BKIB 1B7TY 3PSRA 3EVUA 1RK9A 1DJZA 1SRAA 1QV0A 1NX3A 2ZFDA 3I5IB 5CPVA 1JSAA 2F2OA 1BU3A 2NLNA 2LANA 4F0ZB 2ZNEA 3HX4A 4DIRA 2LLSA 4PE4A 3VGOA 1PALA 4XYNA 2BECA 2LLTA 2EC6C 2CNPA 3OP0A 1A03A 3SIAA 2FOTA 1WDCB 1IKUA 4OCIA 2LVIA 1MF8B 2KYFA 4ZCVA 1A2XA 3RLZA 1X02A 1K94A 2L98A 1J7PA 2Y4QA 4C0KA 2M1UA 2CTNA 4GGFC 2CXJA 1BR4B 2FJUB 1XK4C 3GK1A 1JF0A 1G4YR 1KFXL 1A29A 4JWQA 3WNXB 3DVJA 3IQQA 4YI9A 2COLB 4QJ4B 1MR8A 2EGDA 2GGZA 3BOWB 1Y1UA 4A4CA 5DKNA 3ZWHA 5I2QA 5FYXA 1OZOA 1S5GZ 5CSIA 3SG4A 1QX2A 1K90D 2I2RE 1ALVA 2A4JA 1FF1A 3GK4X 2R2IA 1J7OA 5HYDA 3CR5X 4BY5A 3FIAA 3FWCA 4GUKA 4WRIA 2WNDA 4PCWA 5J3XA 1JWDA 3BUNB 1CFFA 2JXCA 1DMOA 4NDBA 2OTGB 3IQOA 4FQOA 5I8NA 1G8IA 3EK4A 1H4BA 4L9MA 2LC5A 2MRDA 2ZRTA 2JRFA 4M2PA 1KFUS 1QASA 3TDZA 2L5XB 1IGVA 3WHUB 1UHHA 2FCDA 4XJKA 1CNPA 3GK2A 2JC2A 2OTGC 1KQVA 1EG4A 2LVVA 2WCFA 1WLZA 2ZNDA 1ODBA 2F8PA 1DJGA 2LMUA 1SBJA 1S6IA 1OMDA 1XFUO 3VRNA 1XYDA 1DJWA 4HRGA 2L2EA 4ZCUA 1B9AA 2KGRA 2LUXA 1UHNA 4U8DA 4USLA 1PVAA 2OS8C 2PVBA 1XFXO 2GGMA 1S6CA 1B8RA 4HRHA 4NDDA 1FI5A 5HLVA 3WHTB 1UURA 4GPLB 1BT6A 2SASA 1KQMC 1SYMA 1LA3A 2QACA 3RM1A 4OR9B 1GJYA 4C0LA 1LA0A 1UHJA 1KSOA 4N1FA 4YGEB 4FTGA 1WY9A 1M39A 2I18A 1SCVA 2L4HA 1FW4A 2MA2A 1LKJA 1V1FA 1ZACA 2MLEC 3TZ1A 2V53A 3A8RA 4JQ0D 3I5GC 1KWOC 2HQ8A 3SIBA 2WORA 1IRJA 2HF5A 2EC6B 3TDIA 3LLEA 4QJ5B 4N1GA 2RGIA 2LCPA 1UWOA 1EG3A 2HETA 4N5XA 2I94A 2KNEA 1BMOA 1YR5A 2ZN9A 4CIDA 3BXKA 3C1VA 1L2OB 1R2UA 4AQJA 1SCMC 3PN7C 1JF2A 1B1GA 1J1DA 1XFZO 3IF7A 1SW8A 4MLWA 2LP2A 1NPQA 1WRLA 1BJFA 2H61C 3OX5A 1TNQA 1Y0VH 4YGBB 2KHNA 3I5HC 2MHHA 4MZLA 5CSFA 1MXLC 2JULA 3ZNIA 1Y1XA 3TS5C 1N65A 1B8CA 5ER4X 1IH0A 2LUCA 2VRGA 2KBIA 5AXIA 2NZ0A 5G08A 1N0YA 1QIWA 2KQYA 1EXRA 1YUUA 2LE9B 3JVTB 5IBWA 1EH2A 1OMVA 3I5HB 3NXAA 2DOQA 1TNXA 4MZKA 4MSPA 2O60A 1QVIY 2K7CA 1F4QA 1S26D 1CDPA 1PRWA 2KOTA 4ICBA 2M1KB 4YBHB 2BCAA 2NCOA 1PVBA 3TUYB 1J7RA 2JQ6A 4XJKB 1LXFC 3FWBA 2WOSA 1QX7A 2WCBA 5DKRA 1SL9A 3JTDC 3VROA 1KFXS 4GGFA 1E8AA 1G33A 1SL7A 3KO0A 2BE4A 2JT0A 5GQQC 1KK7Y 1YVLA 4MZJA 4ETOA 1C07A 2LMTA 4DS7A 1K9PA 4MRXA 5AANA 2H2KA 2JU0A 2G2BA 3JVTC 2K2FA 3H4SE 1FBVA 1NCZA 2BCXA 1K96A 1YX8A 2SCPA 1QJTA 2EHBA 1NYAA 1IQ3A 1EL4A 1DGUA 2M7NA 3LL8B 1QTXA 1BR1B 1PK0D 1TN4A 2KDHA 4TNCA 1OZSA 2KI4C 5JJGA 2K61A 2I7AA 3BUMB 4C0JA 1DJHA 1SY9A 1KCYA 3AAKA 1S3PA 3SG6A 2F33A 1TNWA 3D0YA 1JFJA 1XA5A 1YVHA 3SG7A 4MN0A 2OS8B 2JT8A 1SCMB 3PN7B 1K9KA 5HKWA 2CCMA 2HPSA 4A4BA 1KK8B 1GGZA 2QPTA 1BODA 2PSRA 4MBEA 3SG3A 2KAYA 5DKQA 5CSNA 2PASA 1QIVA 1IJ5A 1MXEA 2D8NA 2F2PA 4I5NB 3CR2A 5D7FA 1SR6C 1CDNA 1J1EA 1QX5B 1S36A 3AAJA 4OVNF 1AJ4A 3I5GB 1PSRA 1DJYA 1OQPA 1J55A 1RWYA 4DUQA 1WLMA 1NP8A 1F70A 3PATA 3LCPC 1F71A 3BOWA 5BPJA 4BY4A 1K2HA 4Q04A 1DGVA 1CKKA 3CTNA 4WQ2A 1YX7A 3F45A 2NCPA 2PALA 1K93D 2KGBC 2M29A 1XFVO 4PALA 1B7TZ 1CB1A 2PRUA 3BUWB 4P5OE 1DTLA 3CWGA 2ZRSA 1KSMA 4QJ3B 4YI8A 3KEVA 4CFQA 1AJ5A 1XFYO 3FS7A 1L7ZA 3EK7A 1KK8C 3MSEB 4GFTA 3CGAA 1TTXA 5AEQA 4PHKA 2KI4B 1NX1A 4CLNA 1Y1AA 1AHRA 1F8HA 5ER5A 4PE0A 1JUOA 1NX0A 2LAPA 5KSZA 1H8BA 3PM8A 1XK4A 3DVKA 2K0JA 4NQGA 3TS5B 1AVSA 1MQ1A 2K7OA 1IJ6A 3M0WA 3E3RA 3QRXA 4HREE 1RROA 1HQVA 2JNXA 1BF5A 1S1EA 3CR4X 1BG1A 1ZFSA 2M3WA 3O78A 4MVFA 1QV1A 4IL1A 1CLLA 5HLOA 1Y6WA 1K8UA 5F6TA 1A4PA 1MWNA 2LP3A 1L2OC 1FI6A 4GNKB 1F4OA 2H61A 1SPYA 4PE1A 4AOMA 1BLQA 1DJXA 1B8LA 2KFGA 3ICBA 1NCYA 2BBNA 3OB2B 1SMGA 1YUSA 2L50A 3HCMA 4YGAA 2MJWB 2MBXA 1AUIB 4E68A 1XFWO 1B4CA 1DF0A 3SJSA 2BL0B 3I5IC 4PHMA 5PALA 1NUBA 4PE7A 1TCOB 2LHIA 4CFRA 2Q91A 5KU1A 2JXLA 2LV7A 1CLMA 3TUYC 2ISDA 2M97A 1W7IB 1CDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWD A;  4JPZ B;  1U5I A;  4P2Y B;  1S6J A;  3PFV A;  1F55 A;  2NXQ A;  2KAX A;  3EVR A;  3BYA A;  3I5F B;  1NSH A;  1JC2 A;  1CFD A;  2K7B A;  1RTP 1;  1SK6 D;  4DCK A;  2CBL A;  4OKH A;  2E30 A;  2KFH A;  1YRU B;  4GAO A;  4M2Q A;  1BOC A;  2G9B A;  1TIZ A;  2M0R A;  1J7Q A;  3OX6 A;  1V1G A;  1QS7 A;  2JTT A;  4M2O A;  3SG2 A;  3O4Y A;  4AQI A;  2BL0 C;  1A75 B;  2KI6 D;  2LVJ A;  3CLN A;  3NSK A;  2BBM A;  2E6W A;  2JPT A;  5CSJ A;  4UPG A;  4WQ3 A;  3DVM A;  1JFK A;  1ZMZ A;  2P6B B;  5B8I B;  4ORC B;  1CMG A;  2ZN8 A;  3BUX B;  3DF0 B;  1DVI A;  2LHL A;  2OPO A;  1AP4 A;  1CFP A;  4HSZ A;  4PHN A;  2BKH B;  3DF0 A;  4DRW A;  3OHM B;  1MUX A;  2JOJ A;  1NIW A;  2L0P A;  2Y1N A;  4R1E A;  1DF0 B;  1HT9 A;  2M7L A;  2AAO A;  1CDM A;  1M31 A;  1C7V A;  1IQ5 A;  2K7D A;  2FCE A;  5AFP A;  2Y5I A;  3D10 A;  4I5K A;  2MAZ A;  3VRP A;  1KWO B;  4YGC B;  1YUR A;  1TNP A;  5I2O A;  1KQM B;  3TDU A;  4D1E A;  1ALW A;  3EVV A;  2LM5 A;  2Y1M A;  2JTZ A;  3AKA A;  1ZOT B;  1SL8 A;  4YGD B;  3EKJ A;  1TCF A;  1YUT A;  1VRK A;  2TN4 A;  1QXP A;  1K95 A;  2LVK A;  1IWQ A;  2L4I A;  1DT7 B;  2BCB A;  5K89 A;  1IG5 A;  1QLS A;  2JNF A;  2M9G A;  3AKB A;  3CZT X;  3EK8 A;  3PAL A;  1UHK A;  5AER A;  3NSO A;  2BE6 A;  2GV5 A;  3O6B A;  1UP5 A;  1RFJ A;  1RJV A;  2IS9 A;  2PMY A;  2LMV A;  2KQ6 A;  1A75 A;  2KAV A;  1ZUZ A;  2JT3 A;  2LNK A;  1OMR A;  2WCE A;  5TNC A;  2F3Y A;  1MHO A;  1M63 B;  2K8M B;  2KYC A;  5HKZ A;  5HKY A;  1FPW A;  2O5G A;  1SNL A;  3O2P A;  3OB1 B;  4ORB B;  1C7W A;  1SR6 B;  1GQM A;  2MLF C;  1PSB A;  3DD4 A;  3PLF B;  1W7J B;  1REC A;  5KTY A;  1CLB A;  1LIN A;  2M49 B;  3NSI A;  1QVI Z;  3GOF A;  2WC8 A;  2JZI A;  4PDZ A;  1WRK A;  4GBA A;  2K2A A;  1AK8 A;  3NSL A;  1CTR A;  3LK0 A;  3K21 A;  2KI6 C;  4MRY A;  3KHE A;  1XVJ A;  4YRU A;  5JOL A;  4NDC A;  1CMF A;  1F54 A;  2B1U A;  1NCX A;  1YRT B;  1TRF A;  1B47 A;  2L51 A;  1K9U A;  3KPX A;  3BUO B;  4PHJ A;  1CM4 A;  1OOJ A;  1OSA A;  3BQ3 A;  2CT9 A;  1U5I B;  1XO5 A;  2KSP A;  1CFC A;  3LK1 A;  2KBM A;  3WXA A;  1CM1 A;  1KK7 Z;  1WRZ A;  1R6P A;  1GGW A;  1OE9 B;  1SKT A;  1YTZ C;  3A4U B;  1DJI A;  1PUL A;  1Q80 A;  1S5G Y;  4I5J A;  2AMI A;  2AUC A;  4I5L B;  3KF9 A;  1KFU L;  2ZKM X;  3SG5 A;  1LVC D;  1TOP A;  1QAT A;  2JWW A;  2KFF A;  3VRR A;  3I5F C;  3D0Y B;  1QLK A;  1N2D A;  1NX2 A;  1EJ3 A;  3VRQ A;  5D69 A;  2F3Z A;  1D1O A;  4ORA B;  1M46 A;  5I2L A;  3DVE A;  1UHI A;  2HQW A;  4CPV A;  4OV2 A;  1JBA A;  2LLU A;  2M8U A;  1M45 A;  2Q4U A;  4MEW A;  1UUS A;  1WDC C;  4GGN A;  3CS1 A;  3JTD B;  3EKH A;  2BKI B;  1B7T Y;  3PSR A;  3EVU A;  1RK9 A;  1DJZ A;  1SRA A;  1QV0 A;  1NX3 A;  2ZFD A;  3I5I B;  5CPV A;  1JSA A;  2F2O A;  1BU3 A;  2NLN A;  2LAN A;  4F0Z B;  2ZNE A;  3HX4 A;  4DIR A;  2LLS A;  4PE4 A;  3VGO A;  1PAL A;  4XYN A;  2BEC A;  2LLT A;  2EC6 C;  2CNP A;  3OP0 A;  1A03 A;  3SIA A;  2FOT A;  1WDC B;  1IKU A;  4OCI A;  2LVI A;  1MF8 B;  2KYF A;  4ZCV A;  1A2X A;  3RLZ A;  1X02 A;  1K94 A;  2L98 A;  1J7P A;  2Y4Q A;  4C0K A;  2M1U A;  2CTN A;  4GGF C;  2CXJ A;  1BR4 B;  2FJU B;  1XK4 C;  3GK1 A;  1JF0 A;  1G4Y R;  1KFX L;  1A29 A;  4JWQ A;  3WNX B;  3DVJ A;  3IQQ A;  4YI9 A;  2COL B;  4QJ4 B;  1MR8 A;  2EGD A;  2GGZ A;  3BOW B;  1Y1U A;  4A4C A;  5DKN A;  3ZWH A;  5I2Q A;  5FYX A;  1OZO A;  1S5G Z;  5CSI A;  3SG4 A;  1QX2 A;  1K90 D;  2I2R E;  1ALV A;  2A4J A;  1FF1 A;  3GK4 X;  2R2I A;  1J7O A;  5HYD A;  3CR5 X;  4BY5 A;  3FIA A;  3FWC A;  4GUK A;  4WRI A;  2WND A;  4PCW A;  5J3X A;  1JWD A;  3BUN B;  1CFF A;  2JXC A;  1DMO A;  4NDB A;  2OTG B;  3IQO A;  4FQO A;  5I8N A;  1G8I A;  3EK4 A;  1H4B A;  4L9M A;  2LC5 A;  2MRD A;  2ZRT A;  2JRF A;  4M2P A;  1KFU S;  1QAS A;  3TDZ A;  2L5X B;  1IGV A;  3WHU B;  1UHH A;  2FCD A;  4XJK A;  1CNP A;  3GK2 A;  2JC2 A;  2OTG C;  1KQV A;  1EG4 A;  2LVV A;  2WCF A;  1WLZ A;  2ZND A;  1ODB A;  2F8P A;  1DJG A;  2LMU A;  1SBJ A;  1S6I A;  1OMD A;  1XFU O;  3VRN A;  1XYD A;  1DJW A;  4HRG A;  2L2E A;  4ZCU A;  1B9A A;  2KGR A;  2LUX A;  1UHN A;  4U8D A;  4USL A;  1PVA A;  2OS8 C;  2PVB A;  1XFX O;  2GGM A;  1S6C A;  1B8R A;  4HRH A;  4NDD A;  1FI5 A;  5HLV A;  3WHT B;  1UUR A;  4GPL B;  1BT6 A;  2SAS A;  1KQM C;  1SYM A;  1LA3 A;  2QAC A;  3RM1 A;  4OR9 B;  1GJY A;  4C0L A;  1LA0 A;  1UHJ A;  1KSO A;  4N1F A;  4YGE B;  4FTG A;  1WY9 A;  1M39 A;  2I18 A;  1SCV A;  2L4H A;  1FW4 A;  2MA2 A;  1LKJ A;  1V1F A;  1ZAC A;  2MLE C;  3TZ1 A;  2V53 A;  3A8R A;  4JQ0 D;  3I5G C;  1KWO C;  2HQ8 A;  3SIB A;  2WOR A;  1IRJ A;  2HF5 A;  2EC6 B;  3TDI A;  3LLE A;  4QJ5 B;  4N1G A;  2RGI A;  2LCP A;  1UWO A;  1EG3 A;  2HET A;  4N5X A;  2I94 A;  2KNE A;  1BMO A;  1YR5 A;  2ZN9 A;  4CID A;  3BXK A;  3C1V A;  1L2O B;  1R2U A;  4AQJ A;  1SCM C;  3PN7 C;  1JF2 A;  1B1G A;  1J1D A;  1XFZ O;  3IF7 A;  1SW8 A;  4MLW A;  2LP2 A;  1NPQ A;  1WRL A;  1BJF A;  2H61 C;  3OX5 A;  1TNQ A;  1Y0V H;  4YGB B;  2KHN A;  3I5H C;  2MHH A;  4MZL A;  5CSF A;  1MXL C;  2JUL A;  3ZNI A;  1Y1X A;  3TS5 C;  1N65 A;  1B8C A;  5ER4 X;  1IH0 A;  2LUC A;  2VRG A;  2KBI A;  5AXI A;  2NZ0 A;  5G08 A;  1N0Y A;  1QIW A;  2KQY A;  1EXR A;  1YUU A;  2LE9 B;  3JVT B;  5IBW A;  1EH2 A;  1OMV A;  3I5H B;  3NXA A;  2DOQ A;  1TNX A;  4MZK A;  4MSP A;  2O60 A;  1QVI Y;  2K7C A;  1F4Q A;  1S26 D;  1CDP A;  1PRW A;  2KOT A;  4ICB A;  2M1K B;  4YBH B;  2BCA A;  2NCO A;  1PVB A;  3TUY B;  1J7R A;  2JQ6 A;  4XJK B;  1LXF C;  3FWB A;  2WOS A;  1QX7 A;  2WCB A;  5DKR A;  1SL9 A;  3JTD C;  3VRO A;  1KFX S;  4GGF A;  1E8A A;  1G33 A;  1SL7 A;  3KO0 A;  2BE4 A;  2JT0 A;  5GQQ C;  1KK7 Y;  1YVL A;  4MZJ A;  4ETO A;  1C07 A;  2LMT A;  4DS7 A;  1K9P A;  4MRX A;  5AAN A;  2H2K A;  2JU0 A;  2G2B A;  3JVT C;  2K2F A;  3H4S E;  1FBV A;  1NCZ A;  2BCX A;  1K96 A;  1YX8 A;  2SCP A;  1QJT A;  2EHB A;  1NYA A;  1IQ3 A;  1EL4 A;  1DGU A;  2M7N A;  3LL8 B;  1QTX A;  1BR1 B;  1PK0 D;  1TN4 A;  2KDH A;  4TNC A;  1OZS A;  2KI4 C;  5JJG A;  2K61 A;  2I7A A;  3BUM B;  4C0J A;  1DJH A;  1SY9 A;  1KCY A;  3AAK A;  1S3P A;  3SG6 A;  2F33 A;  1TNW A;  3D0Y A;  1JFJ A;  1XA5 A;  1YVH A;  3SG7 A;  4MN0 A;  2OS8 B;  2JT8 A;  1SCM B;  3PN7 B;  1K9K A;  5HKW A;  2CCM A;  2HPS A;  4A4B A;  1KK8 B;  1GGZ A;  2QPT A;  1BOD A;  2PSR A;  4MBE A;  3SG3 A;  2KAY A;  5DKQ A;  5CSN A;  2PAS A;  1QIV A;  1IJ5 A;  1MXE A;  2D8N A;  2F2P A;  4I5N B;  3CR2 A;  5D7F A;  1SR6 C;  1CDN A;  1J1E A;  1QX5 B;  1S36 A;  3AAJ A;  4OVN F;  1AJ4 A;  3I5G B;  1PSR A;  1DJY A;  1OQP A;  1J55 A;  1RWY A;  4DUQ A;  1WLM A;  1NP8 A;  1F70 A;  3PAT A;  3LCP C;  1F71 A;  3BOW A;  5BPJ A;  4BY4 A;  1K2H A;  4Q04 A;  1DGV A;  1CKK A;  3CTN A;  4WQ2 A;  1YX7 A;  3F45 A;  2NCP A;  2PAL A;  1K93 D;  2KGB C;  2M29 A;  1XFV O;  4PAL A;  1B7T Z;  1CB1 A;  2PRU A;  3BUW B;  4P5O E;  1DTL A;  3CWG A;  2ZRS A;  1KSM A;  4QJ3 B;  4YI8 A;  3KEV A;  4CFQ A;  1AJ5 A;  1XFY O;  3FS7 A;  1L7Z A;  3EK7 A;  1KK8 C;  3MSE B;  4GFT A;  3CGA A;  1TTX A;  5AEQ A;  4PHK A;  2KI4 B;  1NX1 A;  4CLN A;  1Y1A A;  1AHR A;  1F8H A;  5ER5 A;  4PE0 A;  1JUO A;  1NX0 A;  2LAP A;  5KSZ A;  1H8B A;  3PM8 A;  1XK4 A;  3DVK A;  2K0J A;  4NQG A;  3TS5 B;  1AVS A;  1MQ1 A;  2K7O A;  1IJ6 A;  3M0W A;  3E3R A;  3QRX A;  4HRE E;  1RRO A;  1HQV A;  2JNX A;  1BF5 A;  1S1E A;  3CR4 X;  1BG1 A;  1ZFS A;  2M3W A;  3O78 A;  4MVF A;  1QV1 A;  4IL1 A;  1CLL A;  5HLO A;  1Y6W A;  1K8U A;  5F6T A;  1A4P A;  1MWN A;  2LP3 A;  1L2O C;  1FI6 A;  4GNK B;  1F4O A;  2H61 A;  1SPY A;  4PE1 A;  4AOM A;  1BLQ A;  1DJX A;  1B8L A;  2KFG A;  3ICB A;  1NCY A;  2BBN A;  3OB2 B;  1SMG A;  1YUS A;  2L50 A;  3HCM A;  4YGA A;  2MJW B;  2MBX A;  1AUI B;  4E68 A;  1XFW O;  1B4C A;  1DF0 A;  3SJS A;  2BL0 B;  3I5I C;  4PHM A;  5PAL A;  1NUB A;  4PE7 A;  1TCO B;  2LHI A;  4CFR A;  2Q91 A;  5KU1 A;  2JXL A;  2LV7 A;  1CLM A;  3TUY C;  2ISD A;  2M97 A;  1W7I B;  1CDL A; 
#chains in the Genus database with same CATH topology
 1NWD A;  3BFA A;  2H8V A;  4JPZ B;  1U5I A;  3B88 A;  1S6J A;  4P2Y B;  3PFV A;  1F55 A;  2NXQ A;  2KAX A;  1C3Z A;  3EVR A;  3O4X A;  3BYA A;  3I5F B;  1NSH A;  3S0B A;  1JC2 A;  1CFD A;  2K7B A;  1RTP 1;  1SK6 D;  4DCK A;  2CBL A;  4OKH A;  2E30 A;  2KFH A;  1YRU B;  4GAO A;  4M2Q A;  1BOC A;  2G9B A;  1TIZ A;  2M0R A;  1J7Q A;  3OX6 A;  1V1G A;  1QS7 A;  2JTT A;  4M2O A;  3SG2 A;  3O4Y A;  4AQI A;  2BL0 C;  1A75 B;  2KI6 D;  2KLD A;  2LVJ A;  3CLN A;  3NSK A;  2BBM A;  2E6W A;  2JPT A;  5CSJ A;  4UPG A;  3FE9 A;  3SS4 A;  2K60 A;  4WQ3 A;  3DVM A;  1JFK A;  1ZMZ A;  3CAB A;  1LS8 A;  2P6B B;  5B8I B;  4ORC B;  1CMG A;  2ZN8 A;  3BUX B;  3DF0 B;  1DVI A;  2LHL A;  3S0F A;  2OPO A;  1AP4 A;  1CFP A;  4HSZ A;  4PHN A;  2BKH B;  3DF0 A;  4DRW A;  3OHM B;  1MUX A;  2JOJ A;  1NIW A;  3FE8 A;  2L0P A;  2Y1N A;  5DIC A;  4R1E A;  1DF0 B;  1HT9 A;  2M7L A;  2AAO A;  1CDM A;  1M31 A;  3NHI A;  1C7V A;  1IQ5 A;  2K7D A;  2FCE A;  5AFP A;  2Y5I A;  3D10 A;  4I5K A;  2MAZ A;  3VRP A;  1KWO B;  4YGC B;  1YUR A;  1TNP A;  5I2O A;  1OOI X;  1KQM B;  1TWO A;  3TDU A;  4D1E A;  1ALW A;  3EVV A;  2LM5 A;  3CZ1 A;  2Y1M A;  2JTZ A;  3AKA A;  1ZOT B;  1SL8 A;  4YGD B;  3EKJ A;  1TCF A;  1YUT A;  3Q8I A;  1VRK A;  2TN4 A;  1QXP A;  1K95 A;  2LVK A;  1IWQ A;  2L4I A;  2PYQ A;  1DT7 B;  1OOG A;  2BCB A;  5K89 A;  1IG5 A;  3CZ2 A;  1QLS A;  2JNF A;  2M9G A;  3AKB A;  3CZT X;  3EK8 A;  3DY9 A;  1UHK A;  2WC5 A;  3PAL A;  1QWV A;  3NSO A;  5FI7 A;  5AER A;  2BE6 A;  2GV5 A;  3D75 A;  1UP5 A;  1RFJ A;  3O6B A;  1RJV A;  5HL1 A;  2IS9 A;  2PMY A;  2LMV A;  2KQ6 A;  3DXL A;  1A75 A;  2KAV A;  1ZUZ A;  2JT3 A;  2LNK A;  1OMR A;  4JD9 A;  2WCE A;  5TNC A;  2L5Y A;  2F3Y A;  1MHO A;  1M63 B;  2K8M B;  2KYC A;  5HKZ A;  5HKY A;  1FPW A;  2O5G A;  1SNL A;  3O2P A;  3OB1 B;  4ORB B;  1C7W A;  1SR6 B;  1GQM A;  2MLF C;  1PSB A;  3DD4 A;  3PLF B;  1W7J B;  1XFR A;  1REC A;  5KTY A;  1DC1 A;  3DZT A;  1CLB A;  1LIN A;  2M49 B;  3NSI A;  1QVI Z;  3GOF A;  2WC8 A;  2JZI A;  4PDZ A;  1WRK A;  4GBA A;  2K2A A;  2WCK A;  1AK8 A;  3NSL A;  1CTR A;  3LK0 A;  3K21 A;  4IJ7 A;  2KI6 C;  4MRY A;  3KHE A;  1XVJ A;  4YRU A;  3OBV A;  5JOL A;  4NDC A;  1CMF A;  2BNX A;  1F54 A;  2B1U A;  1NCX A;  1YRT B;  1TRF A;  1B47 A;  2L51 A;  1K9U A;  3KPX A;  3BUO B;  4PHJ A;  1CM4 A;  1OOJ A;  3PM2 A;  1OSA A;  3D78 A;  3BQ3 A;  2CT9 A;  1U5I B;  3D74 A;  1XO5 A;  2KSP A;  3PJI A;  1CFC A;  3LK1 A;  2KBM A;  3WXA A;  1CM1 A;  1KK7 Z;  1WRZ A;  1R6P A;  1GGW A;  1OE9 B;  1SKT A;  1YTZ C;  3A4U B;  2WCL A;  1DJI A;  1PUL A;  1Q80 A;  1S5G Y;  4I5J A;  2AMI A;  2AUC A;  4I5L B;  3KF9 A;  1KFU L;  2ZKM X;  3SG5 A;  1LVC D;  1TOP A;  1QAT A;  2JWW A;  2KFF A;  3VRR A;  3I5F C;  3D0Y B;  1QLK A;  1N2D A;  1NX2 A;  1EJ3 A;  3VRQ A;  5D69 A;  2F3Z A;  1D1O A;  2FJY A;  4ORA B;  1M46 A;  5I2L A;  3DVE A;  1UHI A;  2HQW A;  4CPV A;  4OV2 A;  1JBA A;  2LLU A;  1T14 A;  2M8U A;  1M45 A;  2Q4U A;  4MEW A;  1UUS A;  1WDC C;  4GGN A;  3CS1 A;  3JTD B;  3EKH A;  2BKI B;  1B7T Y;  3PSR A;  3EVU A;  1RK9 A;  1DJZ A;  1SRA A;  1QV0 A;  1NX3 A;  2ZFD A;  3I5I B;  5CPV A;  1JSA A;  2F2O A;  1OOH A;  1BU3 A;  2NLN A;  2LAN A;  4F0Z B;  2QEO A;  2ZNE A;  1OW4 A;  2KPH A;  3HX4 A;  4DIR A;  2LLS A;  3NHT A;  4PE4 A;  3VGO A;  1C3Y A;  1PAL A;  4XYN A;  2BEC A;  2LLT A;  2EC6 C;  2CNP A;  3OP0 A;  3UO9 A;  1A03 A;  3SIA A;  2FOT A;  1WDC B;  1IKU A;  3CYZ A;  4OCI A;  2LVI A;  4OZD A;  1MF8 B;  2KYF A;  4ZCV A;  1A2X A;  3RLZ A;  1X02 A;  1K94 A;  2L98 A;  1J7P A;  2Y4Q A;  3B87 A;  3R1P A;  4C0K A;  2M1U A;  2CTN A;  4GGF C;  2CXJ A;  1BR4 B;  2FJU B;  1XK4 C;  3GK1 A;  3S0E A;  1JF0 A;  1G4Y R;  1KFX L;  4KYN A;  3SS5 A;  1A29 A;  2QDI A;  1TUZ A;  4JWQ A;  3WNX B;  3DVJ A;  3IQQ A;  4YI9 A;  1IIO A;  4INW A;  2COL B;  4QJ4 B;  1MR8 A;  2EGD A;  2GGZ A;  3BOW B;  1Y1U A;  4A4C A;  5DKN A;  3ZWH A;  5I2Q A;  5FYX A;  1OZO A;  1S5G Z;  5CSI A;  3SG4 A;  1QX2 A;  1K90 D;  2I2R E;  1ALV A;  2A4J A;  1FF1 A;  3GK4 X;  2R2I A;  1J7O A;  5HYD A;  3CR5 X;  4BY5 A;  3FIA A;  3FWC A;  4GUK A;  4WRI A;  2WND A;  4PCW A;  5FI2 A;  5J3X A;  1JWD A;  3BUN B;  1CFF A;  2JXC A;  1DMO A;  4NDB A;  2BAP A;  2OTG B;  3D76 A;  3IQO A;  4FQO A;  5I8N A;  1G8I A;  3EK4 A;  1H4B A;  4L9M A;  2LC5 A;  2MRD A;  2ZRT A;  2JRF A;  4M2P A;  1KFU S;  1W9Z A;  1QAS A;  3TDZ A;  2JPO A;  2L5X B;  1IGV A;  3WHU B;  1UHH A;  2FCD A;  4XJK A;  2ERB A;  3R1O A;  1CNP A;  3GK2 A;  2JC2 A;  2OTG C;  1KQV A;  1EG4 A;  2LVV A;  2WCF A;  1WLZ A;  1TUJ A;  4INX A;  2ZND A;  2WCH A;  3S0D A;  1ODB A;  2F8P A;  1DJG A;  2LMU A;  1SBJ A;  1S6I A;  1OMD A;  1XFU O;  3VRN A;  1XYD A;  1DJW A;  4HRG A;  2L2E A;  4ZCU A;  1B9A A;  2KGR A;  2LUX A;  1UHN A;  4U8D A;  4USL A;  1PVA A;  2OS8 C;  2PVB A;  1XFX O;  2GGM A;  1S6C A;  1B8R A;  4HRH A;  4NDD A;  1FI5 A;  3FE6 A;  5HLV A;  3WHT B;  1UUR A;  3L4A A;  1BT6 A;  4GPL B;  3VB1 A;  2PQL A;  2SAS A;  1KQM C;  1SYM A;  1LA3 A;  2QAC A;  3RM1 A;  4OR9 B;  1GJY A;  4C0L A;  1LA0 A;  1UHJ A;  1KSO A;  4N1F A;  2QEV A;  4YGE B;  4FTG A;  2WCJ A;  1WY9 A;  1M39 A;  2I18 A;  3BJH A;  1SCV A;  2L4H A;  1FW4 A;  2MA2 A;  3D77 A;  1LKJ A;  1V1F A;  1ZAC A;  2MLE C;  3TZ1 A;  2V53 A;  3A8R A;  4JQ0 D;  3I5G C;  1KWO C;  2HQ8 A;  3SIB A;  2WOR A;  1IRJ A;  2HF5 A;  2EC6 B;  3TDI A;  3LLE A;  4QJ5 B;  3R1V A;  4N1G A;  2RGI A;  2WCM A;  2LCP A;  1GM0 A;  1UWO A;  1EG3 A;  2HET A;  4N5X A;  2I94 A;  2KNE A;  1BMO A;  1YR5 A;  3CDN A;  2ZN9 A;  4CID A;  3BXK A;  3C1V A;  1L2O B;  1R2U A;  4AQJ A;  1SCM C;  3PN7 C;  1JF2 A;  1B1G A;  1J1D A;  1XFZ O;  3IF7 A;  1SW8 A;  4MLW A;  4JKT A;  2LP2 A;  1NPQ A;  1SSE B;  1WRL A;  1BJF A;  2H61 C;  3OX5 A;  5FI6 A;  1TNQ A;  1Y0V H;  4YGB B;  2KHN A;  3I5H C;  2MHH A;  4MZL A;  5CSF A;  1MXL C;  2JUL A;  3ZNI A;  1Y1X A;  3TS5 C;  1N65 A;  1B8C A;  1ORG A;  5ER4 X;  1IH0 A;  2LUC A;  2VRG A;  2KBI A;  3B6X A;  4YGA A;  5AXI A;  2P71 A;  2NZ0 A;  5G08 A;  1N0Y A;  1QIW A;  2KQY A;  1EXR A;  1YUU A;  2LE9 B;  3JVT B;  5IBW A;  1EH2 A;  1OMV A;  3I5H B;  3NXA A;  2DOQ A;  1TNX A;  4MZK A;  4MSP A;  2O60 A;  3RZS A;  1QVI Y;  2K7C A;  1F4Q A;  1S26 D;  1CDP A;  1PRW A;  2KOT A;  2QEB A;  2M1K B;  3BFH A;  4ICB A;  4YBH B;  2BCA A;  2NCO A;  1PVB A;  3TUY B;  1J7R A;  2JQ6 A;  4XJK B;  3L4L A;  1LXF C;  3FWB A;  3OGN A;  2WOS A;  1QX7 A;  2WCB A;  5DKR A;  1SL9 A;  3JTD C;  3VRO A;  1KFX S;  4GGF A;  1E8A A;  1G33 A;  3BFB A;  5D3O A;  1SL7 A;  3KO0 A;  2BE4 A;  2JT0 A;  2P70 A;  1KK7 Y;  1YVL A;  4MZJ A;  5GQQ C;  4ETO A;  1C07 A;  3B7A A;  2LMT A;  4DS7 A;  1K9P A;  4MRX A;  5AAN A;  2H2K A;  2JU0 A;  2G2B A;  3NGV A;  3JVT C;  1Z2C B;  2K2F A;  3H4S E;  1FBV A;  1NCZ A;  2BCX A;  1K96 A;  1YX8 A;  2SCP A;  1QJT A;  2EHB A;  1NYA A;  3IVT A;  1IQ3 A;  1EL4 A;  1DGU A;  2M7N A;  3LL8 B;  1QTX A;  1BR1 B;  1PK0 D;  1TN4 A;  2KDH A;  4TNC A;  1OZS A;  2KI4 C;  5JJG A;  2K61 A;  2I7A A;  3BUM B;  4C0J A;  1DJH A;  1SY9 A;  1KCY A;  5I94 A;  3AAK A;  1S3P A;  3SG6 A;  2F33 A;  1TNW A;  3D0Y A;  1JFJ A;  1XA5 A;  1YVH A;  3SG7 A;  1P28 A;  4MN0 A;  3S0A A;  2OS8 B;  2JT8 A;  1SCM B;  3PN7 B;  1DEK A;  3B86 A;  1K9K A;  5HKW A;  2GTE A;  2CCM A;  5EL2 A;  2HPS A;  4A4B A;  1KK8 B;  1GGZ A;  2QPT A;  1BOD A;  2PSR A;  4MBE A;  3SG3 A;  2KAY A;  5DKQ A;  5CSN A;  2PAS A;  1QIV A;  1IJ5 A;  1MXE A;  2D8N A;  2F2P A;  3R72 A;  3CR2 A;  4I5N B;  5D7F A;  1SR6 C;  1CDN A;  2L2C A;  1J1E A;  1QX5 B;  2QEH A;  1S36 A;  3AAJ A;  4OVN F;  1AJ4 A;  3I5G B;  1PSR A;  3K1E A;  3EG5 B;  1DJY A;  1OQP A;  1J55 A;  1RWY A;  4DUQ A;  1WLM A;  1NP8 A;  1F70 A;  3PAT A;  3LCP C;  1F71 A;  3BOW A;  5BPJ A;  4BY4 A;  1K2H A;  4Q04 A;  1DGV A;  1CKK A;  3CTN A;  4WQ2 A;  1YX7 A;  3F45 A;  2NCP A;  2PAL A;  1K93 D;  2KGB C;  2M29 A;  1XFV O;  4PAL A;  1B7T Z;  1CB1 A;  2PRU A;  3BUW B;  4P5O E;  1DTL A;  3CWG A;  2ZRS A;  1KSM A;  2WC6 A;  4FQT A;  4QJ3 B;  4YI8 A;  3KEV A;  4CFQ A;  1AJ5 A;  1XFY O;  3FS7 A;  1L7Z A;  3EK7 A;  1KK8 C;  3CZ0 A;  3MSE B;  4GFT A;  2KLE A;  1TTX A;  3CGA A;  5AEQ A;  4PHK A;  2KI4 B;  1DQE A;  1NX1 A;  4CLN A;  1Y1A A;  1AHR A;  3SS3 A;  3DYE A;  1F8H A;  5ER5 A;  4PE0 A;  1JUO A;  1NX0 A;  2LAP A;  5KSZ A;  1H8B A;  3D73 A;  3PM8 A;  1XK4 A;  3DVK A;  2K0J A;  1DEL A;  3UNW A;  4NQG A;  3TS5 B;  1AVS A;  1MQ1 A;  2K7O A;  1IJ6 A;  3M0W A;  3E3R A;  3QRX A;  4HRE E;  1RRO A;  1HQV A;  2JNX A;  1BF5 A;  1S1E A;  3CR4 X;  1BG1 A;  3L47 A;  1ZFS A;  2M3W A;  3O78 A;  4MVF A;  1QV1 A;  4IL1 A;  1CLL A;  5HLO A;  1OOF A;  1Y6W A;  1K8U A;  5F6T A;  2YGU A;  1A4P A;  1MWN A;  2LP3 A;  1L2O C;  1FI6 A;  4GNK B;  1F4O A;  2H61 A;  1SPY A;  4PE1 A;  4AOM A;  1BLQ A;  1DJX A;  3S0G A;  1B8L A;  2KFG A;  3ICB A;  1NCY A;  2BBN A;  3OB2 B;  1SMG A;  1YUS A;  2L50 A;  3HCM A;  4PT1 A;  2MJW B;  2MBX A;  1AUI B;  4E68 A;  1XFW O;  1B4C A;  1DF0 A;  3SJS A;  2BL0 B;  3I5I C;  4PHM A;  5PAL A;  1NUB A;  1Z4H A;  4F7F A;  4PE7 A;  1TCO B;  2LHI A;  4CFR A;  2Q91 A;  3V2L A;  5KU1 A;  2JXL A;  2LV7 A;  1CLM A;  3QME A;  3TUY C;  2ISD A;  2M97 A;  1W7I B;  3N7H A;  1CDL A; 
#chains in the Genus database with same CATH homology
 1NWD A;  4JPZ B;  1U5I A;  4P2Y B;  1S6J A;  3PFV A;  1F55 A;  2NXQ A;  2KAX A;  3EVR A;  3BYA A;  3I5F B;  1NSH A;  1JC2 A;  1CFD A;  2K7B A;  1RTP 1;  1SK6 D;  4DCK A;  2CBL A;  4OKH A;  2E30 A;  2KFH A;  1YRU B;  4GAO A;  4M2Q A;  1BOC A;  2G9B A;  1TIZ A;  2M0R A;  1J7Q A;  3OX6 A;  1V1G A;  1QS7 A;  2JTT A;  4M2O A;  3SG2 A;  3O4Y A;  4AQI A;  2BL0 C;  1A75 B;  2KI6 D;  2LVJ A;  3CLN A;  3NSK A;  2BBM A;  2E6W A;  2JPT A;  5CSJ A;  4UPG A;  4WQ3 A;  3DVM A;  1JFK A;  1ZMZ A;  2P6B B;  5B8I B;  4ORC B;  1CMG A;  2ZN8 A;  3BUX B;  3DF0 B;  1DVI A;  2LHL A;  2OPO A;  1AP4 A;  1CFP A;  4HSZ A;  4PHN A;  2BKH B;  3DF0 A;  4DRW A;  3OHM B;  1MUX A;  2JOJ A;  1NIW A;  2L0P A;  2Y1N A;  4R1E A;  1DF0 B;  1HT9 A;  2M7L A;  2AAO A;  1CDM A;  1M31 A;  1C7V A;  1IQ5 A;  2K7D A;  2FCE A;  5AFP A;  2Y5I A;  3D10 A;  4I5K A;  2MAZ A;  3VRP A;  1KWO B;  4YGC B;  1YUR A;  1TNP A;  5I2O A;  1KQM B;  3TDU A;  4D1E A;  1ALW A;  3EVV A;  2LM5 A;  2Y1M A;  2JTZ A;  3AKA A;  1ZOT B;  1SL8 A;  4YGD B;  3EKJ A;  1TCF A;  1YUT A;  1VRK A;  2TN4 A;  1QXP A;  1K95 A;  2LVK A;  1IWQ A;  2L4I A;  1DT7 B;  2BCB A;  5K89 A;  1IG5 A;  1QLS A;  2JNF A;  2M9G A;  3AKB A;  3CZT X;  3EK8 A;  3PAL A;  1UHK A;  5AER A;  3NSO A;  2BE6 A;  2GV5 A;  3O6B A;  1UP5 A;  1RFJ A;  1RJV A;  2IS9 A;  2PMY A;  2LMV A;  2KQ6 A;  1A75 A;  2KAV A;  1ZUZ A;  2JT3 A;  2LNK A;  1OMR A;  2WCE A;  5TNC A;  2F3Y A;  1MHO A;  1M63 B;  2K8M B;  2KYC A;  5HKZ A;  5HKY A;  1FPW A;  2O5G A;  1SNL A;  3O2P A;  3OB1 B;  4ORB B;  1C7W A;  1SR6 B;  1GQM A;  2MLF C;  1PSB A;  3DD4 A;  3PLF B;  1W7J B;  1REC A;  5KTY A;  1CLB A;  1LIN A;  2M49 B;  3NSI A;  1QVI Z;  3GOF A;  2WC8 A;  2JZI A;  4PDZ A;  1WRK A;  4GBA A;  2K2A A;  1AK8 A;  3NSL A;  1CTR A;  3LK0 A;  3K21 A;  2KI6 C;  4MRY A;  3KHE A;  1XVJ A;  4YRU A;  5JOL A;  4NDC A;  1CMF A;  1F54 A;  2B1U A;  1NCX A;  1YRT B;  1TRF A;  1B47 A;  2L51 A;  1K9U A;  3KPX A;  3BUO B;  4PHJ A;  1CM4 A;  1OOJ A;  1OSA A;  3BQ3 A;  2CT9 A;  1U5I B;  1XO5 A;  2KSP A;  1CFC A;  3LK1 A;  2KBM A;  3WXA A;  1CM1 A;  1KK7 Z;  1WRZ A;  1R6P A;  1GGW A;  1OE9 B;  1SKT A;  1YTZ C;  3A4U B;  1DJI A;  1PUL A;  1Q80 A;  1S5G Y;  4I5J A;  2AMI A;  2AUC A;  4I5L B;  3KF9 A;  1KFU L;  2ZKM X;  3SG5 A;  1LVC D;  1TOP A;  1QAT A;  2JWW A;  2KFF A;  3VRR A;  3I5F C;  3D0Y B;  1QLK A;  1N2D A;  1NX2 A;  1EJ3 A;  3VRQ A;  5D69 A;  2F3Z A;  1D1O A;  4ORA B;  1M46 A;  5I2L A;  3DVE A;  1UHI A;  2HQW A;  4CPV A;  4OV2 A;  1JBA A;  2LLU A;  2M8U A;  1M45 A;  2Q4U A;  4MEW A;  1UUS A;  1WDC C;  4GGN A;  3CS1 A;  3JTD B;  3EKH A;  2BKI B;  1B7T Y;  3PSR A;  3EVU A;  1RK9 A;  1DJZ A;  1SRA A;  1QV0 A;  1NX3 A;  2ZFD A;  3I5I B;  5CPV A;  1JSA A;  2F2O A;  1BU3 A;  2NLN A;  2LAN A;  4F0Z B;  2ZNE A;  3HX4 A;  4DIR A;  2LLS A;  4PE4 A;  3VGO A;  1PAL A;  4XYN A;  2BEC A;  2LLT A;  2EC6 C;  2CNP A;  3OP0 A;  1A03 A;  3SIA A;  2FOT A;  1WDC B;  1IKU A;  4OCI A;  2LVI A;  1MF8 B;  2KYF A;  4ZCV A;  1A2X A;  3RLZ A;  1X02 A;  1K94 A;  2L98 A;  1J7P A;  2Y4Q A;  4C0K A;  2M1U A;  2CTN A;  4GGF C;  2CXJ A;  1BR4 B;  2FJU B;  1XK4 C;  3GK1 A;  1JF0 A;  1G4Y R;  1KFX L;  1A29 A;  4JWQ A;  3WNX B;  3DVJ A;  3IQQ A;  4YI9 A;  2COL B;  4QJ4 B;  1MR8 A;  2EGD A;  2GGZ A;  3BOW B;  1Y1U A;  4A4C A;  5DKN A;  3ZWH A;  5I2Q A;  5FYX A;  1OZO A;  1S5G Z;  5CSI A;  3SG4 A;  1QX2 A;  1K90 D;  2I2R E;  1ALV A;  2A4J A;  1FF1 A;  3GK4 X;  2R2I A;  1J7O A;  5HYD A;  3CR5 X;  4BY5 A;  3FIA A;  3FWC A;  4GUK A;  4WRI A;  2WND A;  4PCW A;  5J3X A;  1JWD A;  3BUN B;  1CFF A;  2JXC A;  1DMO A;  4NDB A;  2OTG B;  3IQO A;  4FQO A;  5I8N A;  1G8I A;  3EK4 A;  1H4B A;  4L9M A;  2LC5 A;  2MRD A;  2ZRT A;  2JRF A;  4M2P A;  1KFU S;  1QAS A;  3TDZ A;  2L5X B;  1IGV A;  3WHU B;  1UHH A;  2FCD A;  4XJK A;  1CNP A;  3GK2 A;  2JC2 A;  2OTG C;  1KQV A;  1EG4 A;  2LVV A;  2WCF A;  1WLZ A;  2ZND A;  1ODB A;  2F8P A;  1DJG A;  2LMU A;  1SBJ A;  1S6I A;  1OMD A;  1XFU O;  3VRN A;  1XYD A;  1DJW A;  4HRG A;  2L2E A;  4ZCU A;  1B9A A;  2KGR A;  2LUX A;  1UHN A;  4U8D A;  4USL A;  1PVA A;  2OS8 C;  2PVB A;  1XFX O;  2GGM A;  1S6C A;  1B8R A;  4HRH A;  4NDD A;  1FI5 A;  5HLV A;  3WHT B;  1UUR A;  4GPL B;  1BT6 A;  2SAS A;  1KQM C;  1SYM A;  1LA3 A;  2QAC A;  3RM1 A;  4OR9 B;  1GJY A;  4C0L A;  1LA0 A;  1UHJ A;  1KSO A;  4N1F A;  4YGE B;  4FTG A;  1WY9 A;  1M39 A;  2I18 A;  1SCV A;  2L4H A;  1FW4 A;  2MA2 A;  1LKJ A;  1V1F A;  1ZAC A;  2MLE C;  3TZ1 A;  2V53 A;  3A8R A;  4JQ0 D;  3I5G C;  1KWO C;  2HQ8 A;  3SIB A;  2WOR A;  1IRJ A;  2HF5 A;  2EC6 B;  3TDI A;  3LLE A;  4QJ5 B;  4N1G A;  2RGI A;  2LCP A;  1UWO A;  1EG3 A;  2HET A;  4N5X A;  2I94 A;  2KNE A;  1BMO A;  1YR5 A;  2ZN9 A;  4CID A;  3BXK A;  3C1V A;  1L2O B;  1R2U A;  4AQJ A;  1SCM C;  3PN7 C;  1JF2 A;  1B1G A;  1J1D A;  1XFZ O;  3IF7 A;  1SW8 A;  4MLW A;  2LP2 A;  1NPQ A;  1WRL A;  1BJF A;  2H61 C;  3OX5 A;  1TNQ A;  1Y0V H;  4YGB B;  2KHN A;  3I5H C;  2MHH A;  4MZL A;  5CSF A;  1MXL C;  2JUL A;  3ZNI A;  1Y1X A;  3TS5 C;  1N65 A;  1B8C A;  5ER4 X;  1IH0 A;  2LUC A;  2VRG A;  2KBI A;  5AXI A;  2NZ0 A;  5G08 A;  1N0Y A;  1QIW A;  2KQY A;  1EXR A;  1YUU A;  2LE9 B;  3JVT B;  5IBW A;  1EH2 A;  1OMV A;  3I5H B;  3NXA A;  2DOQ A;  1TNX A;  4MZK A;  4MSP A;  2O60 A;  1QVI Y;  2K7C A;  1F4Q A;  1S26 D;  1CDP A;  1PRW A;  2KOT A;  4ICB A;  2M1K B;  4YBH B;  2BCA A;  2NCO A;  1PVB A;  3TUY B;  1J7R A;  2JQ6 A;  4XJK B;  1LXF C;  3FWB A;  2WOS A;  1QX7 A;  2WCB A;  5DKR A;  1SL9 A;  3JTD C;  3VRO A;  1KFX S;  4GGF A;  1E8A A;  1G33 A;  1SL7 A;  3KO0 A;  2BE4 A;  2JT0 A;  5GQQ C;  1KK7 Y;  1YVL A;  4MZJ A;  4ETO A;  1C07 A;  2LMT A;  4DS7 A;  1K9P A;  4MRX A;  5AAN A;  2H2K A;  2JU0 A;  2G2B A;  3JVT C;  2K2F A;  3H4S E;  1FBV A;  1NCZ A;  2BCX A;  1K96 A;  1YX8 A;  2SCP A;  1QJT A;  2EHB A;  1NYA A;  1IQ3 A;  1EL4 A;  1DGU A;  2M7N A;  3LL8 B;  1QTX A;  1BR1 B;  1PK0 D;  1TN4 A;  2KDH A;  4TNC A;  1OZS A;  2KI4 C;  5JJG A;  2K61 A;  2I7A A;  3BUM B;  4C0J A;  1DJH A;  1SY9 A;  1KCY A;  3AAK A;  1S3P A;  3SG6 A;  2F33 A;  1TNW A;  3D0Y A;  1JFJ A;  1XA5 A;  1YVH A;  3SG7 A;  4MN0 A;  2OS8 B;  2JT8 A;  1SCM B;  3PN7 B;  1K9K A;  5HKW A;  2CCM A;  2HPS A;  4A4B A;  1KK8 B;  1GGZ A;  2QPT A;  1BOD A;  2PSR A;  4MBE A;  3SG3 A;  2KAY A;  5DKQ A;  5CSN A;  2PAS A;  1QIV A;  1IJ5 A;  1MXE A;  2D8N A;  2F2P A;  4I5N B;  3CR2 A;  5D7F A;  1SR6 C;  1CDN A;  1J1E A;  1QX5 B;  1S36 A;  3AAJ A;  4OVN F;  1AJ4 A;  3I5G B;  1PSR A;  1DJY A;  1OQP A;  1J55 A;  1RWY A;  4DUQ A;  1WLM A;  1NP8 A;  1F70 A;  3PAT A;  3LCP C;  1F71 A;  3BOW A;  5BPJ A;  4BY4 A;  1K2H A;  4Q04 A;  1DGV A;  1CKK A;  3CTN A;  4WQ2 A;  1YX7 A;  3F45 A;  2NCP A;  2PAL A;  1K93 D;  2KGB C;  2M29 A;  1XFV O;  4PAL A;  1B7T Z;  1CB1 A;  2PRU A;  3BUW B;  4P5O E;  1DTL A;  3CWG A;  2ZRS A;  1KSM A;  4QJ3 B;  4YI8 A;  3KEV A;  4CFQ A;  1AJ5 A;  1XFY O;  3FS7 A;  1L7Z A;  3EK7 A;  1KK8 C;  3MSE B;  4GFT A;  3CGA A;  1TTX A;  5AEQ A;  4PHK A;  2KI4 B;  1NX1 A;  4CLN A;  1Y1A A;  1AHR A;  1F8H A;  5ER5 A;  4PE0 A;  1JUO A;  1NX0 A;  2LAP A;  5KSZ A;  1H8B A;  3PM8 A;  1XK4 A;  3DVK A;  2K0J A;  4NQG A;  3TS5 B;  1AVS A;  1MQ1 A;  2K7O A;  1IJ6 A;  3M0W A;  3E3R A;  3QRX A;  4HRE E;  1RRO A;  1HQV A;  2JNX A;  1BF5 A;  1S1E A;  3CR4 X;  1BG1 A;  1ZFS A;  2M3W A;  3O78 A;  4MVF A;  1QV1 A;  4IL1 A;  1CLL A;  5HLO A;  1Y6W A;  1K8U A;  5F6T A;  1A4P A;  1MWN A;  2LP3 A;  1L2O C;  1FI6 A;  4GNK B;  1F4O A;  2H61 A;  1SPY A;  4PE1 A;  4AOM A;  1BLQ A;  1DJX A;  1B8L A;  2KFG A;  3ICB A;  1NCY A;  2BBN A;  3OB2 B;  1SMG A;  1YUS A;  2L50 A;  3HCM A;  4YGA A;  2MJW B;  2MBX A;  1AUI B;  4E68 A;  1XFW O;  1B4C A;  1DF0 A;  3SJS A;  2BL0 B;  3I5I C;  4PHM A;  5PAL A;  1NUB A;  4PE7 A;  1TCO B;  2LHI A;  4CFR A;  2Q91 A;  5KU1 A;  2JXL A;  2LV7 A;  1CLM A;  3TUY C;  2ISD A;  2M97 A;  1W7I B;  1CDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...