2M49B

Structural insights into human s100b and basic fibroblast growth factor (fgf2) interaction
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 2
publication title Structural insights into the interaction of human S100B and basic fibroblast growth factor (FGF2): Effects on FGFR1 receptor signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/metal binding protein
total genus 26
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m49B00
4ZCVA 2D8NA 2LVIA 1QX5B 4PE0A 1UHIA 3PALA 1K90D 1PULA 4CPVA 4PHMA 2JQ6A 4HSZA 1CM1A 3VRRA 3I5IB 1CB1A 1WLMA 2Y1NA 1ZMZA 1R6PA 1SR6C 2KI6D 1XK4A 4M2PA 1IJ5A 5HLVA 1BU3A 1PVBA 1MXEA 3FIAA 1F54A 4GFTA 1EH2A 1J7PA 1ZUZA 5CSNA 2JTTA 3DF0B 1K96A 1XFUO 2NZ0A 1S6IA 4JPZB 1S5GY 1N0YA 2FOTA 2KYFA 2OS8C 3VRPA 2QACA 4USLA 1DGVA 2EC6B 1QX7A 1NUBA 3WNXB 4PDZA 3A4UB 1KQMC 1OZOA 1XYDA 4ORAB 2KFHA 4N1FA 3CR2A 4PHNA 1YUSA 2BE6A 1KSOA 5I2LA 3VRNA 1NWDA 1LXFC 1RK9A 1TNQA 2Q4UA 1BR1B 2EHBA 4MVFA 4DRWA 1F70A 1UHHA 3CLNA 2L98A 3O4YA 3TS5C 1B4CA 4PE1A 3RM1A 1IH0A 1KWOC 1AJ5A 3O2PA 2LVKA 4C0KA 1J7RA 2JXLA 1KK8B 1CDPA 1LA3A 3C1VA 4MZJA 4PHKA 2KYCA 1RFJA 1NX2A 1LINA 5CSJA 4YGDB 1RWYA 3IQQA 1YURA 4ORBB 4IL1A 2M1UA 1TN4A 3A8RA 2WOSA 1CFPA 2WCBA 3DD4A 3HCMA 3I5HB 1RTP1 1DJWA 2DOQA 2M49B 4MZLA 2KAXA 3BUOB 5F6TA 4YRUA 3TDUA 1L2OB 1ZOTB 5AANA 4DIRA 5KTYA 3ICBA 1J7QA 1LKJA 1H4BA 2Q91A 1RROA 2BL0B 1AVSA 2ZFDA 2AMIA 1B8CA 2WORA 3QRXA 2KBMA 1SL9A 2JOJA 5FYXA 4PE4A 1JFKA 1XFWO 2NXQA 2LHLA 3EK8A 3GOFA 2G2BA 3LK0A 2MLEC 3PN7C 3K21A 1CDMA 1QLSA 1UWOA 1QLKA 1BLQA 1EL4A 1SCMB 1CKKA 1IJ6A 2F2PA 4FQOA 5BPJA 5DKRA 3WXAA 4GNKB 4A4CA 2NCOA 2HF5A 2HETA 2ZN8A 1EG3A 1XFXO 1FF1A 1KFUL 4OR9B 3GK2A 1PRWA 4UPGA 3I5GB 1KQVA 3DF0A 3KEVA 3AKAA 1N2DA 1OMDA 3NXAA 1KK7Y 1A2XA 1IRJA 3NSOA 4MN0A 5JJGA 2BE4A 1NX0A 1QV1A 1SYMA 2FCDA 4ZCUA 1B7TZ 4AOMA 2LVVA 1TNWA 2K7DA 5ER5A 1A03A 3M0WA 1ODBA 1QTXA 4DCKA 2KAVA 3JTDB 5HKYA 4YGBB 2CCMA 1NX3A 1TRFA 1M46A 1SL7A 2V53A 2B1UA 3KHEA 2KGBC 2R2IA 4N1GA 2EGDA 2JWWA 1KFXL 3FWBA 4GAOA 2JULA 1Y0VH 1DT7B 3EK7A 3PFVA 1DTLA 5AEQA 1M31A 1S1EA 4MRXA 1YTZC 5AXIA 5CSIA 1MQ1A 2KI6C 4FTGA 1YX7A 1OMVA 2MRDA 2ZRTA 1K93D 1CMFA 1NX1A 2LMUA 2OTGB 4QJ4B 1SY9A 1H8BA 1MF8B 1IWQA 3CGAA 3SIAA 2JZIA 1EG4A 2LP3A 2KFFA 3ZNIA 2I7AA 4PHJA 4OCIA 1OOJA 1FPWA 1SL8A 4I5NB 1UHNA 3I5FC 2SASA 2CBLA 2ZNEA 5B8IB 4CFQA 3TDZA 1QS7A 1V1GA 1ZACA 2M7NA 3BOWB 2F8PA 1C07A 3AAKA 4DS7A 3KF9A 1YUUA 2MHHA 1M45A 2SCPA 1A4PA 2LAPA 2JNXA 2KSPA 3RLZA 4OKHA 2GV5A 2M3WA 2M1KB 2L0PA 4M2OA 4ETOA 1QVIY 1YUTA 3EKJA 5CSFA 1CDNA 3NSIA 1NSHA 1HT9A 2BBNA 2PSRA 2KHNA 1BG1A 2FCEA 3TZ1A 2LHIA 1YR5A 3TUYC 1K8UA 1DJZA 1XO5A 2KFGA 1JWDA 5DKQA 1XFYO 3JVTC 1JBAA 4AQJA 1MXLC 1Y1UA 2RGIA 2JRFA 1WLZA 4I5JA 4MEWA 3CTNA 1LVCD 1RJVA 1VRKA 1TTXA 2KI4C 1TIZA 1IKUA 1BOCA 1QXPA 2K7BA 1JSAA 2LCPA 2CXJA 1CFFA 1FI6A 2ZN9A 3SIBA 1CFDA 5G08A 5D7FA 4GUKA 1WDCB 2PMYA 3IQOA 1FW4A 1SW8A 1KSMA 4E68A 2BCBA 4F0ZB 1DF0A 3OHMB 2HQWA 4QJ5B 4NDDA 1SPYA 2WC8A 1QASA 1NCXA 1PSRA 1G4YR 1SRAA 1U5IB 2I18A 3AAJA 1C7WA 1F55A 1E8AA 1IGVA 1A75B 2MLFC 1AJ4A 1QIWA 3I5IC 4OVNF 4XJKA 5KU1A 2VRGA 3BUXB 2I94A 3BUMB 2KGRA 4U8DA 1OZSA 1G33A 2IS9A 1BF5A 4PALA 1TOPA 3DVEA 3HX4A 3VGOA 1DGUA 1W7IB 2KNEA 2I2RE 1S6CA 1UP5A 4YGAA 2E6WA 2O5GA 2LANA 2LP2A 4NDBA 1W7JB 3O6BA 4P2YB 2EC6C 1S3PA 2LC5A 1SKTA 2LVJA 3DVJA 1CMGA 1C7VA 1TCOB 4ICBA 3GK4X 5I2OA 1XFVO 1F4QA 3FS7A 3EVUA 3D0YB 1B7TY 2F2OA 2FJUB 1IG5A 4MLWA 3CR4X 2O60A 1L7ZA 5TNCA 2HQ8A 2NLNA 1TNXA 3LCPC 2LLTA 2M0RA 3F45A 1M63B 1Y1XA 1SNLA 2BCXA 1SR6B 1GJYA 4I5LB 2BKHB 1MR8A 1KK8C 4M2QA 3BUNB 1Y1AA 1F71A 1GGWA 1YVHA 3VRQA 3OP0A 1WDCC 4D1EA 1K95A 2H61C 1B8RA 1EJ3A 1OMRA 5IBWA 2MJWB 2L50A 3SG6A 2OS8B 4MBEA 3I5HC 1XA5A 3E3RA 1NCZA 1K94A 1ALVA 2LNKA 4L9MA 4TNCA 3BUWB 1WY9A 1EXRA 1L2OC 1KQMB 3SG7A 2G9BA 3KPXA 5PALA 2BL0C 1J55A 1K9UA 3DVKA 3BXKA 1X02A 2MBXA 1YRTB 2H61A 2JT3A 4MSPA 2F33A 2M29A 1DMOA 1IQ5A 2JT8A 1JF2A 1N65A 5CPVA 2ZNDA 2PASA 3ZWHA 1FBVA 3TS5B 5AFPA 4GPLB 3H4SE 4DUQA 1KWOB 1SCVA 5J3XA 1SCMC 3LL8B 2E30A 1BR4B 1J7OA 1WRZA 3EVRA 3OB1B 4QJ3B 1ALWA 1BMOA 1S6JA 2TN4A 1DJXA 1KFUS 1ZFSA 1JUOA 3I5GC 1NPQA 2KQYA 2P6BB 2CTNA 4NDCA 2M97A 1YRUB 2LLSA 2K2AA 3WHUB 4BY5A 2K0JA 1MWNA 3KO0A 2BECA 2COLB 4R1EA 1B8LA 1Q80A 5GQQC 2WNDA 1F4OA 2JT0A 2KAYA 3PSRA 4I5KA 1KCYA 3JTDC 1DJHA 3D0YA 1R2UA 1J1EA 2AUCA 1KFXS 2PRUA 2WCFA 2JU0A 1WRLA 3PN7B 1PK0D 1UHJA 1B9AA 1XVJA 2KQ6A 3SG2A 1AHRA 3DVMA 2KOTA 4GGNA 2K7OA 5KSZA 1JFJA 2K8MB 3FWCA 3SJSA 1PVAA 1TNPA 2BBMA 4JWQA 2CNPA 2LM5A 2OTGC 1S5GZ 1XFZO 2ZKMX 2HPSA 1QVIZ 4OV2A 3VROA 4MRYA 4YI8A 4C0JA 4A4BA 1SK6D 1YVLA 2LMTA 2LMVA 2LV7A 4CIDA 3PM8A 3EKHA 4CLNA 1AUIB 2H2KA 4YI9A 1YX8A 2F3ZA 2M8UA 3PLFB 2LLUA 1QJTA 1D1OA 3WHTB 5AERA 2LUXA 1F8HA 1JF0A 1CM4A 4NQGA 1B47A 2L4HA 3EVVA 4HRGA 2M7LA 5I2QA 1UURA 2NCPA 5D69A 1SMGA 2M9GA 1OSAA 2KBIA 1DJGA 1G8IA 2K61A 2OPOA 1CFCA 1UHKA 2JC2A 1MUXA 3GK1A 3SG3A 4GBAA 2Y1MA 4GGFC 3IF7A 1WRKA 4N5XA 3OX6A 1NCYA 3O78A 3BOWA 4JQ0D 1JC2A 2PVBA 1NYAA 2GGMA 3OX5A 1HQVA 1DJIA 1FI5A 3D10A 5HYDA 2ZRSA 1M39A 1QATA 4MZKA 1IQ3A 2F3YA 1OQPA 1CNPA 3AKBA 5ER4X 3NSLA 2JTZA 1CDLA 3SG5A 2Y4QA 4GGFA 1UUSA 1K9PA 3OB2B 4C0LA 1DVIA 1NP8A 4HREE 1PSBA 2BKIB 3MSEB 3I5FB 1QV0A 1BT6A 1BJFA 3TDIA 5JOLA 3SG4A 4AQIA 4YGEB 1J1DA 1GQMA 4P5OE 3CZTX 2MAZA 2K7CA 2JNFA 4CFRA 2MA2A 3PATA 1CLBA 3EK4A 1QX2A 4Q04A 4YGCB 1NIWA 1LA0A 2QPTA 5I8NA 1RECA 1CLLA 2L4IA 5HLOA 2LE9B 1OE9B 3LK1A 2L51A 4YBHB 1PALA 3CS1A 4XYNA 1DJYA 2GGZA 1KK7Z 1S36A 1QIVA 2ISDA 1V1FA 2JPTA 3TUYB 3CR5X 1TCFA 5HKZA 1AK8A 3LLEA 1AP4A 5DKNA 2LUCA 3JVTB 3NSKA 1S26D 1BODA 2JXCA 3BYAA 3BQ3A 1CLMA 1K9KA 1DF0B 2K2FA 4WQ3A 1U5IA 4PCWA 1Y6WA 2A4JA 2Y5IA 1K2HA 2BCAA 2CT9A 1A75A 4HRHA 2L5XB 2AAOA 2KI4B 4BY4A 2WCEA 2PALA 2L2EA 3CWGA 4WQ2A 4WRIA 2KDHA 1B1GA 4XJKB 1GGZA 5HKWA 1CTRA 1XK4C 1A29A 4PE7A 1MHOA 5K89A 4ORCB 1SBJA
chains in the Genus database with same CATH superfamily
4ZCVA 5FI6A 2D8NA 2LVIA 1QX5B 4PE0A 1UHIA 3PALA 1K90D 1PULA 4CPVA 4PHMA 2JQ6A 4HSZA 1CM1A 3VRRA 3I5IB 1CB1A 1WLMA 2Y1NA 1ZMZA 1R6PA 1SR6C 2KI6D 1XK4A 4M2PA 1IJ5A 5HLVA 1BU3A 1PVBA 1MXEA 3FIAA 1F54A 2QEOA 4GFTA 1J7PA 1EH2A 3CDNA 2PYQA 1ZUZA 5CSNA 2JTTA 3DF0B 1K96A 1XFUO 2NZ0A 3S0AA 1S6IA 4JPZB 1S5GY 1N0YA 2FOTA 2KYFA 2OS8C 3VRPA 2QACA 4USLA 1DGVA 2EC6B 1QX7A 1NUBA 3WNXB 3B87A 4PDZA 3A4UB 1KQMC 1OZOA 1XYDA 4ORAB 2KFHA 4N1FA 3CR2A 4PHNA 1YUSA 2BE6A 1KSOA 5I2LA 3VRNA 1NWDA 1LXFC 1RK9A 1TNQA 2Q4UA 1BR1B 2EHBA 4MVFA 4DRWA 1F70A 1UHHA 3CLNA 2L98A 3O4YA 3TS5C 3B7AA 5HL1A 1B4CA 4PE1A 3RM1A 1IH0A 1KWOC 3FE6A 1AJ5A 3O2PA 2LVKA 4C0KA 4INXA 1OW4A 1J7RA 2JXLA 1KK8B 1CDPA 1LA3A 3C1VA 4MZJA 4PHKA 2KYCA 1RFJA 1NX2A 2P70A 1LINA 5CSJA 2BNXA 2WCHA 3SS4A 4YGDB 1TWOA 3B86A 3DZTA 1RWYA 4OZDA 3IQQA 1YURA 4ORBB 4IL1A 1C3ZA 2M1UA 1TN4A 3A8RA 2WOSA 1CFPA 2WCBA 3DD4A 3HCMA 3O4XA 3I5HB 1RTP1 1DJWA 2DOQA 2M49B 4MZLA 2KAXA 3BUOB 5F6TA 4YRUA 3TDUA 1L2OB 1ZOTB 5AANA 4DIRA 3NHTA 3ICBA 1DQEA 5KTYA 1LKJA 1J7QA 1H4BA 2Q91A 1RROA 2BL0B 5EL2A 1AVSA 2ZFDA 2AMIA 1B8CA 2WORA 3FE8A 3QRXA 2KBMA 1SL9A 2JOJA 5FYXA 4PE4A 1JFKA 1XFWO 2NXQA 2LHLA 3EK8A 1OOFA 2G2BA 3GOFA 3LK0A 2MLEC 3PN7C 3K21A 1CDMA 1QLSA 1UWOA 1QLKA 1BLQA 3FE9A 1EL4A 1SCMB 1CKKA 1IJ6A 2F2PA 4FQOA 3CABA 5DKRA 3WXAA 5BPJA 4GNKB 4A4CA 2NCOA 2HF5A 2HETA 2ZN8A 1EG3A 1XFXO 1FF1A 1TUJA 1KFUL 3N7HA 4OR9B 3GK2A 1PRWA 4UPGA 3I5GB 1KQVA 3D76A 3DF0A 3KEVA 3AKAA 1N2DA 1OMDA 3NXAA 1KK7Y 1A2XA 2YGUA 3UO9A 1IRJA 3NSOA 4MN0A 5JJGA 2BE4A 1NX0A 1QV1A 1SYMA 3DXLA 2FCDA 4ZCUA 1B7TZ 4AOMA 2LVVA 1OOHA 1TNWA 2K7DA 3CZ0A 5ER5A 1A03A 3M0WA 1ODBA 1QTXA 4DCKA 2KAVA 1Z4HA 3JTDB 4YGBB 2CCMA 1NX3A 5HKYA 1TRFA 1M46A 1SL7A 2V53A 2WCLA 1SSEB 2B1UA 3KHEA 3S0DA 2KGBC 2R2IA 4N1GA 2EGDA 2JWWA 1KFXL 3FWBA 4GAOA 2JULA 1Y0VH 3D74A 3EK7A 3PFVA 5DICA 1DT7B 1DTLA 5AEQA 1M31A 1S1EA 4MRXA 1YTZC 5AXIA 5CSIA 1MQ1A 2KI6C 4FTGA 1YX7A 1OMVA 2MRDA 2ZRTA 1K93D 1CMFA 1NX1A 2LMUA 2OTGB 3BJHA 4QJ4B 3Q8IA 1SY9A 1H8BA 5I94A 1MF8B 3QMEA 3BFHA 1IWQA 3CGAA 3SIAA 2JZIA 1EG4A 2LP3A 2KFFA 3ZNIA 2I7AA 4PHJA 4OCIA 1OOJA 3R72A 3R1VA 1FPWA 1SL8A 4I5NB 1UHNA 3I5FC 2SASA 2CBLA 2ZNEA 5B8IB 4CFQA 3TDZA 1QS7A 1V1GA 1ZACA 2M7NA 3BOWB 3B6XA 1OOGA 2F8PA 1C07A 3AAKA 4DS7A 3KF9A 1YUUA 2MHHA 1M45A 2SCPA 1A4PA 3SS3A 2LAPA 2JNXA 2QEHA 2KSPA 3UNWA 3RLZA 4OKHA 2GV5A 2M3WA 2M1KB 2L0PA 4M2OA 4ETOA 1QVIY 1YUTA 3EKJA 5CSFA 2P71A 1CDNA 3NSIA 1NSHA 1HT9A 2BBNA 2PSRA 2KHNA 3R1OA 1DC1A 1BG1A 2FCEA 3TZ1A 2LHIA 1YR5A 3TUYC 1K8UA 1DJZA 1XO5A 2KFGA 1QWVA 5DKQA 1XFYO 3JVTC 1JBAA 1JWDA 4AQJA 1MXLC 1Y1UA 2GTEA 2RGIA 2JRFA 4FQTA 1WLZA 1Z2CB 4I5JA 4MEWA 3CTNA 1LVCD 1RJVA 1VRKA 1TTXA 2KI4C 1TIZA 1IKUA 1BOCA 1QXPA 2K7BA 1W9ZA 2LCPA 1JSAA 2CXJA 1CFFA 1FI6A 2ZN9A 1T14A 1CFDA 5G08A 3SIBA 3S0FA 2JPOA 5D7FA 4GUKA 1WDCB 2PMYA 3IQOA 1FW4A 1SW8A 1KSMA 4E68A 2BCBA 4F0ZB 1DF0A 2H8VA 3OHMB 2HQWA 2BAPA 4QJ5B 4NDDA 1SPYA 2WC8A 1QASA 1NCXA 1PSRA 1G4YR 1SRAA 1U5IB 2I18A 3AAJA 1C7WA 1DEKA 1F55A 1E8AA 1IGVA 1A75B 2MLFC 1AJ4A 2QEVA 1OOIX 1QIWA 3I5IC 4OVNF 4XJKA 5KU1A 2VRGA 3BUXB 2I94A 3BUMB 3R1PA 3RZSA 2KGRA 2WC6A 3CZ2A 4U8DA 1OZSA 1G33A 2IS9A 1BF5A 4PALA 1TOPA 3DVEA 3HX4A 3VGOA 1DGUA 3B88A 1W7IB 2KNEA 2I2RE 1S6CA 1UP5A 3PJIA 4YGAA 3SS5A 2E6WA 2O5GA 2LANA 2LP2A 4NDBA 1W7JB 3O6BA 3OGNA 4P2YB 2EC6C 1S3PA 2LC5A 1SKTA 2LVJA 3DVJA 1CMGA 1C7VA 1TCOB 4ICBA 3GK4X 5I2OA 1XFVO 3DYEA 1F4QA 3FS7A 3EVUA 3D0YB 1B7TY 2F2OA 2FJUB 1IG5A 4MLWA 3CR4X 3OBVA 2O60A 1L7ZA 1ORGA 5TNCA 1TUZA 2HQ8A 3D78A 2NLNA 1TNXA 3LCPC 2LLTA 3PM2A 2M0RA 3F45A 1M63B 1Y1XA 1SNLA 1XFRA 2BCXA 1SR6B 1GJYA 2KLDA 2BKHB 4I5LB 1MR8A 1KK8C 4M2QA 3BUNB 1Y1AA 1F71A 2ERBA 1GGWA 1YVHA 3VRQA 2QDIA 3OP0A 1P28A 1WDCC 4D1EA 1K95A 2H61C 1B8RA 1IIOA 1EJ3A 1OMRA 5IBWA 2MJWB 2L50A 3SG6A 2OS8B 2WCJA 4MBEA 3I5HC 1XA5A 3E3RA 1NCZA 1K94A 1ALVA 2LNKA 4L9MA 4TNCA 3BUWB 1WY9A 1EXRA 2L2CA 1L2OC 1KQMB 3SG7A 2G9BA 3KPXA 2PQLA 5PALA 1J55A 1K9UA 2BL0C 3DVKA 3BXKA 1X02A 2MBXA 3D73A 1YRTB 2H61A 2JT3A 4MSPA 2F33A 2M29A 3K1EA 4F7FA 1DMOA 1IQ5A 2JT8A 1JF2A 1N65A 5CPVA 2ZNDA 5FI2A 2PASA 3ZWHA 1FBVA 3TS5B 5AFPA 4GPLB 3H4SE 4INWA 1KWOB 4DUQA 3EG5B 1SCVA 2FJYA 5J3XA 2KPHA 1SCMC 3LL8B 2E30A 1BR4B 1J7OA 1WRZA 3EVRA 3OB1B 4QJ3B 1GM0A 3NGVA 1ALWA 1BMOA 1S6JA 2TN4A 1DJXA 1KFUS 1ZFSA 1JUOA 3D75A 1NPQA 3I5GC 2KQYA 2P6BB 3S0GA 2CTNA 4NDCA 2M97A 1YRUB 2LLSA 2K2AA 4KYNA 3WHUB 2K0JA 4BY5A 1MWNA 3KO0A 2BECA 2COLB 4R1EA 1B8LA 1Q80A 5GQQC 5K89A 3VB1A 2WNDA 1F4OA 3L47A 2JT0A 2KAYA 3PSRA 4I5KA 1KCYA 3JTDC 1DJHA 3S0EA 3D0YA 1R2UA 1J1EA 2AUCA 4JD9A 1KFXS 2PRUA 2WCFA 2JU0A 1WRLA 3PN7B 1PK0D 1UHJA 4JKTA 1B9AA 1XVJA 2KQ6A 3SG2A 1AHRA 3DVMA 2KOTA 4GGNA 5D3OA 2K7OA 5KSZA 1JFJA 2K8MB 3FWCA 3SJSA 1PVAA 1TNPA 2BBMA 4JWQA 2CNPA 2LM5A 2OTGC 3DY9A 1S5GZ 1XFZO 2ZKMX 2HPSA 1QVIZ 4OV2A 3VROA 4MRYA 3BFBA 2QEBA 4YI8A 1SK6D 1YVLA 2LMTA 2LMVA 2LV7A 4A4BA 4C0JA 4CIDA 3PM8A 3V2LA 3EKHA 3L4LA 1AUIB 4CLNA 2H2KA 3D77A 4YI9A 1YX8A 2F3ZA 2M8UA 3PLFB 2LLUA 1QJTA 1D1OA 3WHTB 2L5YA 2LUXA 5AERA 1JF0A 1F8HA 1CM4A 4NQGA 1B47A 2L4HA 3EVVA 4HRGA 2M7LA 5I2QA 1UURA 2NCPA 5D69A 1SMGA 2M9GA 1OSAA 2KBIA 1DJGA 1G8IA 2K61A 2OPOA 1CFCA 1UHKA 2JC2A 1MUXA 3GK1A 3SG3A 4GBAA 2Y1MA 4GGFC 3IF7A 1WRKA 4N5XA 3OX6A 1NCYA 3O78A 3BOWA 4JQ0D 1JC2A 2PVBA 1NYAA 2GGMA 3OX5A 1HQVA 1DELA 1DJIA 1FI5A 3D10A 3CYZA 5HYDA 2ZRSA 1M39A 1QATA 4MZKA 1IQ3A 3NHIA 2F3YA 1OQPA 1CNPA 3AKBA 5ER4X 3NSLA 4IJ7A 2JTZA 1CDLA 3L4AA 3SG5A 1C3YA 2Y4QA 4GGFA 1UUSA 1K9PA 3OB2B 4C0LA 1DVIA 1NP8A 2WCMA 4HREE 1PSBA 2BKIB 3MSEB 3S0BA 3I5FB 1QV0A 1BT6A 2KLEA 1BJFA 3TDIA 5JOLA 3SG4A 4AQIA 4YGEB 1J1DA 5FI7A 1GQMA 4P5OE 3CZTX 2MAZA 2K7CA 2JNFA 4CFRA 3IVTA 2MA2A 3PATA 1CLBA 3EK4A 1QX2A 4Q04A 4YGCB 1NIWA 1LA0A 2QPTA 2WCKA 5I8NA 1RECA 1CLLA 2L4IA 5HLOA 3CZ1A 2LE9B 1OE9B 3LK1A 2L51A 4YBHB 1PALA 3CS1A 4XYNA 1DJYA 2GGZA 1KK7Z 1S36A 1QIVA 3BFAA 2ISDA 1V1FA 2K60A 2JPTA 3TUYB 3CR5X 1TCFA 5HKZA 1AK8A 3LLEA 1AP4A 5DKNA 2LUCA 3JVTB 3NSKA 1S26D 1BODA 2JXCA 3BYAA 3BQ3A 1CLMA 1K9KA 1DF0B 2K2FA 4WQ3A 1U5IA 4PCWA 1Y6WA 2A4JA 2Y5IA 1K2HA 2BCAA 2CT9A 1A75A 4HRHA 2L5XB 2AAOA 2KI4B 4BY4A 2WCEA 2PALA 2L2EA 3CWGA 4WQ2A 4WRIA 2KDHA 1LS8A 2WC5A 1B1GA 4XJKB 1GGZA 5HKWA 1CTRA 1XK4C 1A29A 4PE7A 1MHOA 4PT1A 4ORCB 1SBJA
chains in the Genus database with same CATH topology
4ZCVA 2D8NA 2LVIA 1QX5B 4PE0A 1UHIA 3PALA 1K90D 1PULA 4CPVA 4PHMA 2JQ6A 4HSZA 1CM1A 3VRRA 3I5IB 1CB1A 1WLMA 2Y1NA 1ZMZA 1R6PA 1SR6C 2KI6D 1XK4A 4M2PA 1IJ5A 5HLVA 1BU3A 1PVBA 1MXEA 3FIAA 1F54A 4GFTA 1EH2A 1J7PA 1ZUZA 5CSNA 2JTTA 3DF0B 1K96A 1XFUO 2NZ0A 1S6IA 4JPZB 1S5GY 1N0YA 2FOTA 2KYFA 2OS8C 3VRPA 2QACA 4USLA 1DGVA 2EC6B 1QX7A 1NUBA 3WNXB 4PDZA 3A4UB 1KQMC 1OZOA 1XYDA 4ORAB 2KFHA 4N1FA 3CR2A 4PHNA 1YUSA 2BE6A 1KSOA 5I2LA 3VRNA 1NWDA 1LXFC 1RK9A 1TNQA 2Q4UA 1BR1B 2EHBA 4MVFA 4DRWA 1F70A 1UHHA 3CLNA 2L98A 3O4YA 3TS5C 1B4CA 4PE1A 3RM1A 1IH0A 1KWOC 1AJ5A 3O2PA 2LVKA 4C0KA 1J7RA 2JXLA 1KK8B 1CDPA 1LA3A 3C1VA 4MZJA 4PHKA 2KYCA 1RFJA 1NX2A 1LINA 5CSJA 4YGDB 1RWYA 3IQQA 1YURA 4ORBB 4IL1A 2M1UA 1TN4A 3A8RA 2WOSA 1CFPA 2WCBA 3DD4A 3HCMA 3I5HB 1RTP1 1DJWA 2DOQA 2M49B 4MZLA 2KAXA 3BUOB 5F6TA 4YRUA 3TDUA 1L2OB 1ZOTB 5AANA 4DIRA 5KTYA 3ICBA 1J7QA 1LKJA 1H4BA 2Q91A 1RROA 2BL0B 1AVSA 2ZFDA 2AMIA 1B8CA 2WORA 3QRXA 2KBMA 1SL9A 2JOJA 5FYXA 4PE4A 1JFKA 1XFWO 2NXQA 2LHLA 3EK8A 3GOFA 2G2BA 3LK0A 2MLEC 3PN7C 3K21A 1CDMA 1QLSA 1UWOA 1QLKA 1BLQA 1EL4A 1SCMB 1CKKA 1IJ6A 2F2PA 4FQOA 5BPJA 5DKRA 3WXAA 4GNKB 4A4CA 2NCOA 2HF5A 2HETA 2ZN8A 1EG3A 1XFXO 1FF1A 1KFUL 4OR9B 3GK2A 1PRWA 4UPGA 3I5GB 1KQVA 3DF0A 3KEVA 3AKAA 1N2DA 1OMDA 3NXAA 1KK7Y 1A2XA 1IRJA 3NSOA 4MN0A 5JJGA 2BE4A 1NX0A 1QV1A 1SYMA 2FCDA 4ZCUA 1B7TZ 4AOMA 2LVVA 1TNWA 2K7DA 5ER5A 1A03A 3M0WA 1ODBA 1QTXA 4DCKA 2KAVA 3JTDB 5HKYA 4YGBB 2CCMA 1NX3A 1TRFA 1M46A 1SL7A 2V53A 2B1UA 3KHEA 2KGBC 2R2IA 4N1GA 2EGDA 2JWWA 1KFXL 3FWBA 4GAOA 2JULA 1Y0VH 1DT7B 3EK7A 3PFVA 1DTLA 5AEQA 1M31A 1S1EA 4MRXA 1YTZC 5AXIA 5CSIA 1MQ1A 2KI6C 4FTGA 1YX7A 1OMVA 2MRDA 2ZRTA 1K93D 1CMFA 1NX1A 2LMUA 2OTGB 4QJ4B 1SY9A 1H8BA 1MF8B 1IWQA 3CGAA 3SIAA 2JZIA 1EG4A 2LP3A 2KFFA 3ZNIA 2I7AA 4PHJA 4OCIA 1OOJA 1FPWA 1SL8A 4I5NB 1UHNA 3I5FC 2SASA 2CBLA 2ZNEA 5B8IB 4CFQA 3TDZA 1QS7A 1V1GA 1ZACA 2M7NA 3BOWB 2F8PA 1C07A 3AAKA 4DS7A 3KF9A 1YUUA 2MHHA 1M45A 2SCPA 1A4PA 2LAPA 2JNXA 2KSPA 3RLZA 4OKHA 2GV5A 2M3WA 2M1KB 2L0PA 4M2OA 4ETOA 1QVIY 1YUTA 3EKJA 5CSFA 1CDNA 3NSIA 1NSHA 1HT9A 2BBNA 2PSRA 2KHNA 1BG1A 2FCEA 3TZ1A 2LHIA 1YR5A 3TUYC 1K8UA 1DJZA 1XO5A 2KFGA 1JWDA 5DKQA 1XFYO 3JVTC 1JBAA 4AQJA 1MXLC 1Y1UA 2RGIA 2JRFA 1WLZA 4I5JA 4MEWA 3CTNA 1LVCD 1RJVA 1VRKA 1TTXA 2KI4C 1TIZA 1IKUA 1BOCA 1QXPA 2K7BA 1JSAA 2LCPA 2CXJA 1CFFA 1FI6A 2ZN9A 3SIBA 1CFDA 5G08A 5D7FA 4GUKA 1WDCB 2PMYA 3IQOA 1FW4A 1SW8A 1KSMA 4E68A 2BCBA 4F0ZB 1DF0A 3OHMB 2HQWA 4QJ5B 4NDDA 1SPYA 2WC8A 1QASA 1NCXA 1PSRA 1G4YR 1SRAA 1U5IB 2I18A 3AAJA 1C7WA 1F55A 1E8AA 1IGVA 1A75B 2MLFC 1AJ4A 1QIWA 3I5IC 4OVNF 4XJKA 5KU1A 2VRGA 3BUXB 2I94A 3BUMB 2KGRA 4U8DA 1OZSA 1G33A 2IS9A 1BF5A 4PALA 1TOPA 3DVEA 3HX4A 3VGOA 1DGUA 1W7IB 2KNEA 2I2RE 1S6CA 1UP5A 4YGAA 2E6WA 2O5GA 2LANA 2LP2A 4NDBA 1W7JB 3O6BA 4P2YB 2EC6C 1S3PA 2LC5A 1SKTA 2LVJA 3DVJA 1CMGA 1C7VA 1TCOB 4ICBA 3GK4X 5I2OA 1XFVO 1F4QA 3FS7A 3EVUA 3D0YB 1B7TY 2F2OA 2FJUB 1IG5A 4MLWA 3CR4X 2O60A 1L7ZA 5TNCA 2HQ8A 2NLNA 1TNXA 3LCPC 2LLTA 2M0RA 3F45A 1M63B 1Y1XA 1SNLA 2BCXA 1SR6B 1GJYA 4I5LB 2BKHB 1MR8A 1KK8C 4M2QA 3BUNB 1Y1AA 1F71A 1GGWA 1YVHA 3VRQA 3OP0A 1WDCC 4D1EA 1K95A 2H61C 1B8RA 1EJ3A 1OMRA 5IBWA 2MJWB 2L50A 3SG6A 2OS8B 4MBEA 3I5HC 1XA5A 3E3RA 1NCZA 1K94A 1ALVA 2LNKA 4L9MA 4TNCA 3BUWB 1WY9A 1EXRA 1L2OC 1KQMB 3SG7A 2G9BA 3KPXA 5PALA 2BL0C 1J55A 1K9UA 3DVKA 3BXKA 1X02A 2MBXA 1YRTB 2H61A 2JT3A 4MSPA 2F33A 2M29A 1DMOA 1IQ5A 2JT8A 1JF2A 1N65A 5CPVA 2ZNDA 2PASA 3ZWHA 1FBVA 3TS5B 5AFPA 4GPLB 3H4SE 4DUQA 1KWOB 1SCVA 5J3XA 1SCMC 3LL8B 2E30A 1BR4B 1J7OA 1WRZA 3EVRA 3OB1B 4QJ3B 1ALWA 1BMOA 1S6JA 2TN4A 1DJXA 1KFUS 1ZFSA 1JUOA 3I5GC 1NPQA 2KQYA 2P6BB 2CTNA 4NDCA 2M97A 1YRUB 2LLSA 2K2AA 3WHUB 4BY5A 2K0JA 1MWNA 3KO0A 2BECA 2COLB 4R1EA 1B8LA 1Q80A 5GQQC 2WNDA 1F4OA 2JT0A 2KAYA 3PSRA 4I5KA 1KCYA 3JTDC 1DJHA 3D0YA 1R2UA 1J1EA 2AUCA 1KFXS 2PRUA 2WCFA 2JU0A 1WRLA 3PN7B 1PK0D 1UHJA 1B9AA 1XVJA 2KQ6A 3SG2A 1AHRA 3DVMA 2KOTA 4GGNA 2K7OA 5KSZA 1JFJA 2K8MB 3FWCA 3SJSA 1PVAA 1TNPA 2BBMA 4JWQA 2CNPA 2LM5A 2OTGC 1S5GZ 1XFZO 2ZKMX 2HPSA 1QVIZ 4OV2A 3VROA 4MRYA 4YI8A 4C0JA 4A4BA 1SK6D 1YVLA 2LMTA 2LMVA 2LV7A 4CIDA 3PM8A 3EKHA 4CLNA 1AUIB 2H2KA 4YI9A 1YX8A 2F3ZA 2M8UA 3PLFB 2LLUA 1QJTA 1D1OA 3WHTB 5AERA 2LUXA 1F8HA 1JF0A 1CM4A 4NQGA 1B47A 2L4HA 3EVVA 4HRGA 2M7LA 5I2QA 1UURA 2NCPA 5D69A 1SMGA 2M9GA 1OSAA 2KBIA 1DJGA 1G8IA 2K61A 2OPOA 1CFCA 1UHKA 2JC2A 1MUXA 3GK1A 3SG3A 4GBAA 2Y1MA 4GGFC 3IF7A 1WRKA 4N5XA 3OX6A 1NCYA 3O78A 3BOWA 4JQ0D 1JC2A 2PVBA 1NYAA 2GGMA 3OX5A 1HQVA 1DJIA 1FI5A 3D10A 5HYDA 2ZRSA 1M39A 1QATA 4MZKA 1IQ3A 2F3YA 1OQPA 1CNPA 3AKBA 5ER4X 3NSLA 2JTZA 1CDLA 3SG5A 2Y4QA 4GGFA 1UUSA 1K9PA 3OB2B 4C0LA 1DVIA 1NP8A 4HREE 1PSBA 2BKIB 3MSEB 3I5FB 1QV0A 1BT6A 1BJFA 3TDIA 5JOLA 3SG4A 4AQIA 4YGEB 1J1DA 1GQMA 4P5OE 3CZTX 2MAZA 2K7CA 2JNFA 4CFRA 2MA2A 3PATA 1CLBA 3EK4A 1QX2A 4Q04A 4YGCB 1NIWA 1LA0A 2QPTA 5I8NA 1RECA 1CLLA 2L4IA 5HLOA 2LE9B 1OE9B 3LK1A 2L51A 4YBHB 1PALA 3CS1A 4XYNA 1DJYA 2GGZA 1KK7Z 1S36A 1QIVA 2ISDA 1V1FA 2JPTA 3TUYB 3CR5X 1TCFA 5HKZA 1AK8A 3LLEA 1AP4A 5DKNA 2LUCA 3JVTB 3NSKA 1S26D 1BODA 2JXCA 3BYAA 3BQ3A 1CLMA 1K9KA 1DF0B 2K2FA 4WQ3A 1U5IA 4PCWA 1Y6WA 2A4JA 2Y5IA 1K2HA 2BCAA 2CT9A 1A75A 4HRHA 2L5XB 2AAOA 2KI4B 4BY4A 2WCEA 2PALA 2L2EA 3CWGA 4WQ2A 4WRIA 2KDHA 1B1GA 4XJKB 1GGZA 5HKWA 1CTRA 1XK4C 1A29A 4PE7A 1MHOA 5K89A 4ORCB 1SBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCV A;  2D8N A;  2LVI A;  1QX5 B;  4PE0 A;  1UHI A;  3PAL A;  1K90 D;  1PUL A;  4CPV A;  4PHM A;  2JQ6 A;  4HSZ A;  1CM1 A;  3VRR A;  3I5I B;  1CB1 A;  1WLM A;  2Y1N A;  1ZMZ A;  1R6P A;  1SR6 C;  2KI6 D;  1XK4 A;  4M2P A;  1IJ5 A;  5HLV A;  1BU3 A;  1PVB A;  1MXE A;  3FIA A;  1F54 A;  4GFT A;  1EH2 A;  1J7P A;  1ZUZ A;  5CSN A;  2JTT A;  3DF0 B;  1K96 A;  1XFU O;  2NZ0 A;  1S6I A;  4JPZ B;  1S5G Y;  1N0Y A;  2FOT A;  2KYF A;  2OS8 C;  3VRP A;  2QAC A;  4USL A;  1DGV A;  2EC6 B;  1QX7 A;  1NUB A;  3WNX B;  4PDZ A;  3A4U B;  1KQM C;  1OZO A;  1XYD A;  4ORA B;  2KFH A;  4N1F A;  3CR2 A;  4PHN A;  1YUS A;  2BE6 A;  1KSO A;  5I2L A;  3VRN A;  1NWD A;  1LXF C;  1RK9 A;  1TNQ A;  2Q4U A;  1BR1 B;  2EHB A;  4MVF A;  4DRW A;  1F70 A;  1UHH A;  3CLN A;  2L98 A;  3O4Y A;  3TS5 C;  1B4C A;  4PE1 A;  3RM1 A;  1IH0 A;  1KWO C;  1AJ5 A;  3O2P A;  2LVK A;  4C0K A;  1J7R A;  2JXL A;  1KK8 B;  1CDP A;  1LA3 A;  3C1V A;  4MZJ A;  4PHK A;  2KYC A;  1RFJ A;  1NX2 A;  1LIN A;  5CSJ A;  4YGD B;  1RWY A;  3IQQ A;  1YUR A;  4ORB B;  4IL1 A;  2M1U A;  1TN4 A;  3A8R A;  2WOS A;  1CFP A;  2WCB A;  3DD4 A;  3HCM A;  3I5H B;  1RTP 1;  1DJW A;  2DOQ A;  2M49 B;  4MZL A;  2KAX A;  3BUO B;  5F6T A;  4YRU A;  3TDU A;  1L2O B;  1ZOT B;  5AAN A;  4DIR A;  5KTY A;  3ICB A;  1J7Q A;  1LKJ A;  1H4B A;  2Q91 A;  1RRO A;  2BL0 B;  1AVS A;  2ZFD A;  2AMI A;  1B8C A;  2WOR A;  3QRX A;  2KBM A;  1SL9 A;  2JOJ A;  5FYX A;  4PE4 A;  1JFK A;  1XFW O;  2NXQ A;  2LHL A;  3EK8 A;  3GOF A;  2G2B A;  3LK0 A;  2MLE C;  3PN7 C;  3K21 A;  1CDM A;  1QLS A;  1UWO A;  1QLK A;  1BLQ A;  1EL4 A;  1SCM B;  1CKK A;  1IJ6 A;  2F2P A;  4FQO A;  5BPJ A;  5DKR A;  3WXA A;  4GNK B;  4A4C A;  2NCO A;  2HF5 A;  2HET A;  2ZN8 A;  1EG3 A;  1XFX O;  1FF1 A;  1KFU L;  4OR9 B;  3GK2 A;  1PRW A;  4UPG A;  3I5G B;  1KQV A;  3DF0 A;  3KEV A;  3AKA A;  1N2D A;  1OMD A;  3NXA A;  1KK7 Y;  1A2X A;  1IRJ A;  3NSO A;  4MN0 A;  5JJG A;  2BE4 A;  1NX0 A;  1QV1 A;  1SYM A;  2FCD A;  4ZCU A;  1B7T Z;  4AOM A;  2LVV A;  1TNW A;  2K7D A;  5ER5 A;  1A03 A;  3M0W A;  1ODB A;  1QTX A;  4DCK A;  2KAV A;  3JTD B;  5HKY A;  4YGB B;  2CCM A;  1NX3 A;  1TRF A;  1M46 A;  1SL7 A;  2V53 A;  2B1U A;  3KHE A;  2KGB C;  2R2I A;  4N1G A;  2EGD A;  2JWW A;  1KFX L;  3FWB A;  4GAO A;  2JUL A;  1Y0V H;  1DT7 B;  3EK7 A;  3PFV A;  1DTL A;  5AEQ A;  1M31 A;  1S1E A;  4MRX A;  1YTZ C;  5AXI A;  5CSI A;  1MQ1 A;  2KI6 C;  4FTG A;  1YX7 A;  1OMV A;  2MRD A;  2ZRT A;  1K93 D;  1CMF A;  1NX1 A;  2LMU A;  2OTG B;  4QJ4 B;  1SY9 A;  1H8B A;  1MF8 B;  1IWQ A;  3CGA A;  3SIA A;  2JZI A;  1EG4 A;  2LP3 A;  2KFF A;  3ZNI A;  2I7A A;  4PHJ A;  4OCI A;  1OOJ A;  1FPW A;  1SL8 A;  4I5N B;  1UHN A;  3I5F C;  2SAS A;  2CBL A;  2ZNE A;  5B8I B;  4CFQ A;  3TDZ A;  1QS7 A;  1V1G A;  1ZAC A;  2M7N A;  3BOW B;  2F8P A;  1C07 A;  3AAK A;  4DS7 A;  3KF9 A;  1YUU A;  2MHH A;  1M45 A;  2SCP A;  1A4P A;  2LAP A;  2JNX A;  2KSP A;  3RLZ A;  4OKH A;  2GV5 A;  2M3W A;  2M1K B;  2L0P A;  4M2O A;  4ETO A;  1QVI Y;  1YUT A;  3EKJ A;  5CSF A;  1CDN A;  3NSI A;  1NSH A;  1HT9 A;  2BBN A;  2PSR A;  2KHN A;  1BG1 A;  2FCE A;  3TZ1 A;  2LHI A;  1YR5 A;  3TUY C;  1K8U A;  1DJZ A;  1XO5 A;  2KFG A;  1JWD A;  5DKQ A;  1XFY O;  3JVT C;  1JBA A;  4AQJ A;  1MXL C;  1Y1U A;  2RGI A;  2JRF A;  1WLZ A;  4I5J A;  4MEW A;  3CTN A;  1LVC D;  1RJV A;  1VRK A;  1TTX A;  2KI4 C;  1TIZ A;  1IKU A;  1BOC A;  1QXP A;  2K7B A;  1JSA A;  2LCP A;  2CXJ A;  1CFF A;  1FI6 A;  2ZN9 A;  3SIB A;  1CFD A;  5G08 A;  5D7F A;  4GUK A;  1WDC B;  2PMY A;  3IQO A;  1FW4 A;  1SW8 A;  1KSM A;  4E68 A;  2BCB A;  4F0Z B;  1DF0 A;  3OHM B;  2HQW A;  4QJ5 B;  4NDD A;  1SPY A;  2WC8 A;  1QAS A;  1NCX A;  1PSR A;  1G4Y R;  1SRA A;  1U5I B;  2I18 A;  3AAJ A;  1C7W A;  1F55 A;  1E8A A;  1IGV A;  1A75 B;  2MLF C;  1AJ4 A;  1QIW A;  3I5I C;  4OVN F;  4XJK A;  5KU1 A;  2VRG A;  3BUX B;  2I94 A;  3BUM B;  2KGR A;  4U8D A;  1OZS A;  1G33 A;  2IS9 A;  1BF5 A;  4PAL A;  1TOP A;  3DVE A;  3HX4 A;  3VGO A;  1DGU A;  1W7I B;  2KNE A;  2I2R E;  1S6C A;  1UP5 A;  4YGA A;  2E6W A;  2O5G A;  2LAN A;  2LP2 A;  4NDB A;  1W7J B;  3O6B A;  4P2Y B;  2EC6 C;  1S3P A;  2LC5 A;  1SKT A;  2LVJ A;  3DVJ A;  1CMG A;  1C7V A;  1TCO B;  4ICB A;  3GK4 X;  5I2O A;  1XFV O;  1F4Q A;  3FS7 A;  3EVU A;  3D0Y B;  1B7T Y;  2F2O A;  2FJU B;  1IG5 A;  4MLW A;  3CR4 X;  2O60 A;  1L7Z A;  5TNC A;  2HQ8 A;  2NLN A;  1TNX A;  3LCP C;  2LLT A;  2M0R A;  3F45 A;  1M63 B;  1Y1X A;  1SNL A;  2BCX A;  1SR6 B;  1GJY A;  4I5L B;  2BKH B;  1MR8 A;  1KK8 C;  4M2Q A;  3BUN B;  1Y1A A;  1F71 A;  1GGW A;  1YVH A;  3VRQ A;  3OP0 A;  1WDC C;  4D1E A;  1K95 A;  2H61 C;  1B8R A;  1EJ3 A;  1OMR A;  5IBW A;  2MJW B;  2L50 A;  3SG6 A;  2OS8 B;  4MBE A;  3I5H C;  1XA5 A;  3E3R A;  1NCZ A;  1K94 A;  1ALV A;  2LNK A;  4L9M A;  4TNC A;  3BUW B;  1WY9 A;  1EXR A;  1L2O C;  1KQM B;  3SG7 A;  2G9B A;  3KPX A;  5PAL A;  2BL0 C;  1J55 A;  1K9U A;  3DVK A;  3BXK A;  1X02 A;  2MBX A;  1YRT B;  2H61 A;  2JT3 A;  4MSP A;  2F33 A;  2M29 A;  1DMO A;  1IQ5 A;  2JT8 A;  1JF2 A;  1N65 A;  5CPV A;  2ZND A;  2PAS A;  3ZWH A;  1FBV A;  3TS5 B;  5AFP A;  4GPL B;  3H4S E;  4DUQ A;  1KWO B;  1SCV A;  5J3X A;  1SCM C;  3LL8 B;  2E30 A;  1BR4 B;  1J7O A;  1WRZ A;  3EVR A;  3OB1 B;  4QJ3 B;  1ALW A;  1BMO A;  1S6J A;  2TN4 A;  1DJX A;  1KFU S;  1ZFS A;  1JUO A;  3I5G C;  1NPQ A;  2KQY A;  2P6B B;  2CTN A;  4NDC A;  2M97 A;  1YRU B;  2LLS A;  2K2A A;  3WHU B;  4BY5 A;  2K0J A;  1MWN A;  3KO0 A;  2BEC A;  2COL B;  4R1E A;  1B8L A;  1Q80 A;  5GQQ C;  2WND A;  1F4O A;  2JT0 A;  2KAY A;  3PSR A;  4I5K A;  1KCY A;  3JTD C;  1DJH A;  3D0Y A;  1R2U A;  1J1E A;  2AUC A;  1KFX S;  2PRU A;  2WCF A;  2JU0 A;  1WRL A;  3PN7 B;  1PK0 D;  1UHJ A;  1B9A A;  1XVJ A;  2KQ6 A;  3SG2 A;  1AHR A;  3DVM A;  2KOT A;  4GGN A;  2K7O A;  5KSZ A;  1JFJ A;  2K8M B;  3FWC A;  3SJS A;  1PVA A;  1TNP A;  2BBM A;  4JWQ A;  2CNP A;  2LM5 A;  2OTG C;  1S5G Z;  1XFZ O;  2ZKM X;  2HPS A;  1QVI Z;  4OV2 A;  3VRO A;  4MRY A;  4YI8 A;  4C0J A;  4A4B A;  1SK6 D;  1YVL A;  2LMT A;  2LMV A;  2LV7 A;  4CID A;  3PM8 A;  3EKH A;  4CLN A;  1AUI B;  2H2K A;  4YI9 A;  1YX8 A;  2F3Z A;  2M8U A;  3PLF B;  2LLU A;  1QJT A;  1D1O A;  3WHT B;  5AER A;  2LUX A;  1F8H A;  1JF0 A;  1CM4 A;  4NQG A;  1B47 A;  2L4H A;  3EVV A;  4HRG A;  2M7L A;  5I2Q A;  1UUR A;  2NCP A;  5D69 A;  1SMG A;  2M9G A;  1OSA A;  2KBI A;  1DJG A;  1G8I A;  2K61 A;  2OPO A;  1CFC A;  1UHK A;  2JC2 A;  1MUX A;  3GK1 A;  3SG3 A;  4GBA A;  2Y1M A;  4GGF C;  3IF7 A;  1WRK A;  4N5X A;  3OX6 A;  1NCY A;  3O78 A;  3BOW A;  4JQ0 D;  1JC2 A;  2PVB A;  1NYA A;  2GGM A;  3OX5 A;  1HQV A;  1DJI A;  1FI5 A;  3D10 A;  5HYD A;  2ZRS A;  1M39 A;  1QAT A;  4MZK A;  1IQ3 A;  2F3Y A;  1OQP A;  1CNP A;  3AKB A;  5ER4 X;  3NSL A;  2JTZ A;  1CDL A;  3SG5 A;  2Y4Q A;  4GGF A;  1UUS A;  1K9P A;  3OB2 B;  4C0L A;  1DVI A;  1NP8 A;  4HRE E;  1PSB A;  2BKI B;  3MSE B;  3I5F B;  1QV0 A;  1BT6 A;  1BJF A;  3TDI A;  5JOL A;  3SG4 A;  4AQI A;  4YGE B;  1J1D A;  1GQM A;  4P5O E;  3CZT X;  2MAZ A;  2K7C A;  2JNF A;  4CFR A;  2MA2 A;  3PAT A;  1CLB A;  3EK4 A;  1QX2 A;  4Q04 A;  4YGC B;  1NIW A;  1LA0 A;  2QPT A;  5I8N A;  1REC A;  1CLL A;  2L4I A;  5HLO A;  2LE9 B;  1OE9 B;  3LK1 A;  2L51 A;  4YBH B;  1PAL A;  3CS1 A;  4XYN A;  1DJY A;  2GGZ A;  1KK7 Z;  1S36 A;  1QIV A;  2ISD A;  1V1F A;  2JPT A;  3TUY B;  3CR5 X;  1TCF A;  5HKZ A;  1AK8 A;  3LLE A;  1AP4 A;  5DKN A;  2LUC A;  3JVT B;  3NSK A;  1S26 D;  1BOD A;  2JXC A;  3BYA A;  3BQ3 A;  1CLM A;  1K9K A;  1DF0 B;  2K2F A;  4WQ3 A;  1U5I A;  4PCW A;  1Y6W A;  2A4J A;  2Y5I A;  1K2H A;  2BCA A;  2CT9 A;  1A75 A;  4HRH A;  2L5X B;  2AAO A;  2KI4 B;  4BY4 A;  2WCE A;  2PAL A;  2L2E A;  3CWG A;  4WQ2 A;  4WRI A;  2KDH A;  1B1G A;  4XJK B;  1GGZ A;  5HKW A;  1CTR A;  1XK4 C;  1A29 A;  4PE7 A;  1MHO A;  5K89 A;  4ORC B;  1SBJ A; 
#chains in the Genus database with same CATH topology
 4ZCV A;  5FI6 A;  2D8N A;  2LVI A;  1QX5 B;  4PE0 A;  1UHI A;  3PAL A;  1K90 D;  1PUL A;  4CPV A;  4PHM A;  2JQ6 A;  4HSZ A;  1CM1 A;  3VRR A;  3I5I B;  1CB1 A;  1WLM A;  2Y1N A;  1ZMZ A;  1R6P A;  1SR6 C;  2KI6 D;  1XK4 A;  4M2P A;  1IJ5 A;  5HLV A;  1BU3 A;  1PVB A;  1MXE A;  3FIA A;  1F54 A;  2QEO A;  4GFT A;  1J7P A;  1EH2 A;  3CDN A;  2PYQ A;  1ZUZ A;  5CSN A;  2JTT A;  3DF0 B;  1K96 A;  1XFU O;  2NZ0 A;  3S0A A;  1S6I A;  4JPZ B;  1S5G Y;  1N0Y A;  2FOT A;  2KYF A;  2OS8 C;  3VRP A;  2QAC A;  4USL A;  1DGV A;  2EC6 B;  1QX7 A;  1NUB A;  3WNX B;  3B87 A;  4PDZ A;  3A4U B;  1KQM C;  1OZO A;  1XYD A;  4ORA B;  2KFH A;  4N1F A;  3CR2 A;  4PHN A;  1YUS A;  2BE6 A;  1KSO A;  5I2L A;  3VRN A;  1NWD A;  1LXF C;  1RK9 A;  1TNQ A;  2Q4U A;  1BR1 B;  2EHB A;  4MVF A;  4DRW A;  1F70 A;  1UHH A;  3CLN A;  2L98 A;  3O4Y A;  3TS5 C;  3B7A A;  5HL1 A;  1B4C A;  4PE1 A;  3RM1 A;  1IH0 A;  1KWO C;  3FE6 A;  1AJ5 A;  3O2P A;  2LVK A;  4C0K A;  4INX A;  1OW4 A;  1J7R A;  2JXL A;  1KK8 B;  1CDP A;  1LA3 A;  3C1V A;  4MZJ A;  4PHK A;  2KYC A;  1RFJ A;  1NX2 A;  2P70 A;  1LIN A;  5CSJ A;  2BNX A;  2WCH A;  3SS4 A;  4YGD B;  1TWO A;  3B86 A;  3DZT A;  1RWY A;  4OZD A;  3IQQ A;  1YUR A;  4ORB B;  4IL1 A;  1C3Z A;  2M1U A;  1TN4 A;  3A8R A;  2WOS A;  1CFP A;  2WCB A;  3DD4 A;  3HCM A;  3O4X A;  3I5H B;  1RTP 1;  1DJW A;  2DOQ A;  2M49 B;  4MZL A;  2KAX A;  3BUO B;  5F6T A;  4YRU A;  3TDU A;  1L2O B;  1ZOT B;  5AAN A;  4DIR A;  3NHT A;  3ICB A;  1DQE A;  5KTY A;  1LKJ A;  1J7Q A;  1H4B A;  2Q91 A;  1RRO A;  2BL0 B;  5EL2 A;  1AVS A;  2ZFD A;  2AMI A;  1B8C A;  2WOR A;  3FE8 A;  3QRX A;  2KBM A;  1SL9 A;  2JOJ A;  5FYX A;  4PE4 A;  1JFK A;  1XFW O;  2NXQ A;  2LHL A;  3EK8 A;  1OOF A;  2G2B A;  3GOF A;  3LK0 A;  2MLE C;  3PN7 C;  3K21 A;  1CDM A;  1QLS A;  1UWO A;  1QLK A;  1BLQ A;  3FE9 A;  1EL4 A;  1SCM B;  1CKK A;  1IJ6 A;  2F2P A;  4FQO A;  3CAB A;  5DKR A;  3WXA A;  5BPJ A;  4GNK B;  4A4C A;  2NCO A;  2HF5 A;  2HET A;  2ZN8 A;  1EG3 A;  1XFX O;  1FF1 A;  1TUJ A;  1KFU L;  3N7H A;  4OR9 B;  3GK2 A;  1PRW A;  4UPG A;  3I5G B;  1KQV A;  3D76 A;  3DF0 A;  3KEV A;  3AKA A;  1N2D A;  1OMD A;  3NXA A;  1KK7 Y;  1A2X A;  2YGU A;  3UO9 A;  1IRJ A;  3NSO A;  4MN0 A;  5JJG A;  2BE4 A;  1NX0 A;  1QV1 A;  1SYM A;  3DXL A;  2FCD A;  4ZCU A;  1B7T Z;  4AOM A;  2LVV A;  1OOH A;  1TNW A;  2K7D A;  3CZ0 A;  5ER5 A;  1A03 A;  3M0W A;  1ODB A;  1QTX A;  4DCK A;  2KAV A;  1Z4H A;  3JTD B;  4YGB B;  2CCM A;  1NX3 A;  5HKY A;  1TRF A;  1M46 A;  1SL7 A;  2V53 A;  2WCL A;  1SSE B;  2B1U A;  3KHE A;  3S0D A;  2KGB C;  2R2I A;  4N1G A;  2EGD A;  2JWW A;  1KFX L;  3FWB A;  4GAO A;  2JUL A;  1Y0V H;  3D74 A;  3EK7 A;  3PFV A;  5DIC A;  1DT7 B;  1DTL A;  5AEQ A;  1M31 A;  1S1E A;  4MRX A;  1YTZ C;  5AXI A;  5CSI A;  1MQ1 A;  2KI6 C;  4FTG A;  1YX7 A;  1OMV A;  2MRD A;  2ZRT A;  1K93 D;  1CMF A;  1NX1 A;  2LMU A;  2OTG B;  3BJH A;  4QJ4 B;  3Q8I A;  1SY9 A;  1H8B A;  5I94 A;  1MF8 B;  3QME A;  3BFH A;  1IWQ A;  3CGA A;  3SIA A;  2JZI A;  1EG4 A;  2LP3 A;  2KFF A;  3ZNI A;  2I7A A;  4PHJ A;  4OCI A;  1OOJ A;  3R72 A;  3R1V A;  1FPW A;  1SL8 A;  4I5N B;  1UHN A;  3I5F C;  2SAS A;  2CBL A;  2ZNE A;  5B8I B;  4CFQ A;  3TDZ A;  1QS7 A;  1V1G A;  1ZAC A;  2M7N A;  3BOW B;  3B6X A;  1OOG A;  2F8P A;  1C07 A;  3AAK A;  4DS7 A;  3KF9 A;  1YUU A;  2MHH A;  1M45 A;  2SCP A;  1A4P A;  3SS3 A;  2LAP A;  2JNX A;  2QEH A;  2KSP A;  3UNW A;  3RLZ A;  4OKH A;  2GV5 A;  2M3W A;  2M1K B;  2L0P A;  4M2O A;  4ETO A;  1QVI Y;  1YUT A;  3EKJ A;  5CSF A;  2P71 A;  1CDN A;  3NSI A;  1NSH A;  1HT9 A;  2BBN A;  2PSR A;  2KHN A;  3R1O A;  1DC1 A;  1BG1 A;  2FCE A;  3TZ1 A;  2LHI A;  1YR5 A;  3TUY C;  1K8U A;  1DJZ A;  1XO5 A;  2KFG A;  1QWV A;  5DKQ A;  1XFY O;  3JVT C;  1JBA A;  1JWD A;  4AQJ A;  1MXL C;  1Y1U A;  2GTE A;  2RGI A;  2JRF A;  4FQT A;  1WLZ A;  1Z2C B;  4I5J A;  4MEW A;  3CTN A;  1LVC D;  1RJV A;  1VRK A;  1TTX A;  2KI4 C;  1TIZ A;  1IKU A;  1BOC A;  1QXP A;  2K7B A;  1W9Z A;  2LCP A;  1JSA A;  2CXJ A;  1CFF A;  1FI6 A;  2ZN9 A;  1T14 A;  1CFD A;  5G08 A;  3SIB A;  3S0F A;  2JPO A;  5D7F A;  4GUK A;  1WDC B;  2PMY A;  3IQO A;  1FW4 A;  1SW8 A;  1KSM A;  4E68 A;  2BCB A;  4F0Z B;  1DF0 A;  2H8V A;  3OHM B;  2HQW A;  2BAP A;  4QJ5 B;  4NDD A;  1SPY A;  2WC8 A;  1QAS A;  1NCX A;  1PSR A;  1G4Y R;  1SRA A;  1U5I B;  2I18 A;  3AAJ A;  1C7W A;  1DEK A;  1F55 A;  1E8A A;  1IGV A;  1A75 B;  2MLF C;  1AJ4 A;  2QEV A;  1OOI X;  1QIW A;  3I5I C;  4OVN F;  4XJK A;  5KU1 A;  2VRG A;  3BUX B;  2I94 A;  3BUM B;  3R1P A;  3RZS A;  2KGR A;  2WC6 A;  3CZ2 A;  4U8D A;  1OZS A;  1G33 A;  2IS9 A;  1BF5 A;  4PAL A;  1TOP A;  3DVE A;  3HX4 A;  3VGO A;  1DGU A;  3B88 A;  1W7I B;  2KNE A;  2I2R E;  1S6C A;  1UP5 A;  3PJI A;  4YGA A;  3SS5 A;  2E6W A;  2O5G A;  2LAN A;  2LP2 A;  4NDB A;  1W7J B;  3O6B A;  3OGN A;  4P2Y B;  2EC6 C;  1S3P A;  2LC5 A;  1SKT A;  2LVJ A;  3DVJ A;  1CMG A;  1C7V A;  1TCO B;  4ICB A;  3GK4 X;  5I2O A;  1XFV O;  3DYE A;  1F4Q A;  3FS7 A;  3EVU A;  3D0Y B;  1B7T Y;  2F2O A;  2FJU B;  1IG5 A;  4MLW A;  3CR4 X;  3OBV A;  2O60 A;  1L7Z A;  1ORG A;  5TNC A;  1TUZ A;  2HQ8 A;  3D78 A;  2NLN A;  1TNX A;  3LCP C;  2LLT A;  3PM2 A;  2M0R A;  3F45 A;  1M63 B;  1Y1X A;  1SNL A;  1XFR A;  2BCX A;  1SR6 B;  1GJY A;  2KLD A;  2BKH B;  4I5L B;  1MR8 A;  1KK8 C;  4M2Q A;  3BUN B;  1Y1A A;  1F71 A;  2ERB A;  1GGW A;  1YVH A;  3VRQ A;  2QDI A;  3OP0 A;  1P28 A;  1WDC C;  4D1E A;  1K95 A;  2H61 C;  1B8R A;  1IIO A;  1EJ3 A;  1OMR A;  5IBW A;  2MJW B;  2L50 A;  3SG6 A;  2OS8 B;  2WCJ A;  4MBE A;  3I5H C;  1XA5 A;  3E3R A;  1NCZ A;  1K94 A;  1ALV A;  2LNK A;  4L9M A;  4TNC A;  3BUW B;  1WY9 A;  1EXR A;  2L2C A;  1L2O C;  1KQM B;  3SG7 A;  2G9B A;  3KPX A;  2PQL A;  5PAL A;  1J55 A;  1K9U A;  2BL0 C;  3DVK A;  3BXK A;  1X02 A;  2MBX A;  3D73 A;  1YRT B;  2H61 A;  2JT3 A;  4MSP A;  2F33 A;  2M29 A;  3K1E A;  4F7F A;  1DMO A;  1IQ5 A;  2JT8 A;  1JF2 A;  1N65 A;  5CPV A;  2ZND A;  5FI2 A;  2PAS A;  3ZWH A;  1FBV A;  3TS5 B;  5AFP A;  4GPL B;  3H4S E;  4INW A;  1KWO B;  4DUQ A;  3EG5 B;  1SCV A;  2FJY A;  5J3X A;  2KPH A;  1SCM C;  3LL8 B;  2E30 A;  1BR4 B;  1J7O A;  1WRZ A;  3EVR A;  3OB1 B;  4QJ3 B;  1GM0 A;  3NGV A;  1ALW A;  1BMO A;  1S6J A;  2TN4 A;  1DJX A;  1KFU S;  1ZFS A;  1JUO A;  3D75 A;  1NPQ A;  3I5G C;  2KQY A;  2P6B B;  3S0G A;  2CTN A;  4NDC A;  2M97 A;  1YRU B;  2LLS A;  2K2A A;  4KYN A;  3WHU B;  2K0J A;  4BY5 A;  1MWN A;  3KO0 A;  2BEC A;  2COL B;  4R1E A;  1B8L A;  1Q80 A;  5GQQ C;  5K89 A;  3VB1 A;  2WND A;  1F4O A;  3L47 A;  2JT0 A;  2KAY A;  3PSR A;  4I5K A;  1KCY A;  3JTD C;  1DJH A;  3S0E A;  3D0Y A;  1R2U A;  1J1E A;  2AUC A;  4JD9 A;  1KFX S;  2PRU A;  2WCF A;  2JU0 A;  1WRL A;  3PN7 B;  1PK0 D;  1UHJ A;  4JKT A;  1B9A A;  1XVJ A;  2KQ6 A;  3SG2 A;  1AHR A;  3DVM A;  2KOT A;  4GGN A;  5D3O A;  2K7O A;  5KSZ A;  1JFJ A;  2K8M B;  3FWC A;  3SJS A;  1PVA A;  1TNP A;  2BBM A;  4JWQ A;  2CNP A;  2LM5 A;  2OTG C;  3DY9 A;  1S5G Z;  1XFZ O;  2ZKM X;  2HPS A;  1QVI Z;  4OV2 A;  3VRO A;  4MRY A;  3BFB A;  2QEB A;  4YI8 A;  1SK6 D;  1YVL A;  2LMT A;  2LMV A;  2LV7 A;  4A4B A;  4C0J A;  4CID A;  3PM8 A;  3V2L A;  3EKH A;  3L4L A;  1AUI B;  4CLN A;  2H2K A;  3D77 A;  4YI9 A;  1YX8 A;  2F3Z A;  2M8U A;  3PLF B;  2LLU A;  1QJT A;  1D1O A;  3WHT B;  2L5Y A;  2LUX A;  5AER A;  1JF0 A;  1F8H A;  1CM4 A;  4NQG A;  1B47 A;  2L4H A;  3EVV A;  4HRG A;  2M7L A;  5I2Q A;  1UUR A;  2NCP A;  5D69 A;  1SMG A;  2M9G A;  1OSA A;  2KBI A;  1DJG A;  1G8I A;  2K61 A;  2OPO A;  1CFC A;  1UHK A;  2JC2 A;  1MUX A;  3GK1 A;  3SG3 A;  4GBA A;  2Y1M A;  4GGF C;  3IF7 A;  1WRK A;  4N5X A;  3OX6 A;  1NCY A;  3O78 A;  3BOW A;  4JQ0 D;  1JC2 A;  2PVB A;  1NYA A;  2GGM A;  3OX5 A;  1HQV A;  1DEL A;  1DJI A;  1FI5 A;  3D10 A;  3CYZ A;  5HYD A;  2ZRS A;  1M39 A;  1QAT A;  4MZK A;  1IQ3 A;  3NHI A;  2F3Y A;  1OQP A;  1CNP A;  3AKB A;  5ER4 X;  3NSL A;  4IJ7 A;  2JTZ A;  1CDL A;  3L4A A;  3SG5 A;  1C3Y A;  2Y4Q A;  4GGF A;  1UUS A;  1K9P A;  3OB2 B;  4C0L A;  1DVI A;  1NP8 A;  2WCM A;  4HRE E;  1PSB A;  2BKI B;  3MSE B;  3S0B A;  3I5F B;  1QV0 A;  1BT6 A;  2KLE A;  1BJF A;  3TDI A;  5JOL A;  3SG4 A;  4AQI A;  4YGE B;  1J1D A;  5FI7 A;  1GQM A;  4P5O E;  3CZT X;  2MAZ A;  2K7C A;  2JNF A;  4CFR A;  3IVT A;  2MA2 A;  3PAT A;  1CLB A;  3EK4 A;  1QX2 A;  4Q04 A;  4YGC B;  1NIW A;  1LA0 A;  2QPT A;  2WCK A;  5I8N A;  1REC A;  1CLL A;  2L4I A;  5HLO A;  3CZ1 A;  2LE9 B;  1OE9 B;  3LK1 A;  2L51 A;  4YBH B;  1PAL A;  3CS1 A;  4XYN A;  1DJY A;  2GGZ A;  1KK7 Z;  1S36 A;  1QIV A;  3BFA A;  2ISD A;  1V1F A;  2K60 A;  2JPT A;  3TUY B;  3CR5 X;  1TCF A;  5HKZ A;  1AK8 A;  3LLE A;  1AP4 A;  5DKN A;  2LUC A;  3JVT B;  3NSK A;  1S26 D;  1BOD A;  2JXC A;  3BYA A;  3BQ3 A;  1CLM A;  1K9K A;  1DF0 B;  2K2F A;  4WQ3 A;  1U5I A;  4PCW A;  1Y6W A;  2A4J A;  2Y5I A;  1K2H A;  2BCA A;  2CT9 A;  1A75 A;  4HRH A;  2L5X B;  2AAO A;  2KI4 B;  4BY4 A;  2WCE A;  2PAL A;  2L2E A;  3CWG A;  4WQ2 A;  4WRI A;  2KDH A;  1LS8 A;  2WC5 A;  1B1G A;  4XJK B;  1GGZ A;  5HKW A;  1CTR A;  1XK4 C;  1A29 A;  4PE7 A;  1MHO A;  4PT1 A;  4ORC B;  1SBJ A; 
#chains in the Genus database with same CATH homology
 4ZCV A;  2D8N A;  2LVI A;  1QX5 B;  4PE0 A;  1UHI A;  3PAL A;  1K90 D;  1PUL A;  4CPV A;  4PHM A;  2JQ6 A;  4HSZ A;  1CM1 A;  3VRR A;  3I5I B;  1CB1 A;  1WLM A;  2Y1N A;  1ZMZ A;  1R6P A;  1SR6 C;  2KI6 D;  1XK4 A;  4M2P A;  1IJ5 A;  5HLV A;  1BU3 A;  1PVB A;  1MXE A;  3FIA A;  1F54 A;  4GFT A;  1EH2 A;  1J7P A;  1ZUZ A;  5CSN A;  2JTT A;  3DF0 B;  1K96 A;  1XFU O;  2NZ0 A;  1S6I A;  4JPZ B;  1S5G Y;  1N0Y A;  2FOT A;  2KYF A;  2OS8 C;  3VRP A;  2QAC A;  4USL A;  1DGV A;  2EC6 B;  1QX7 A;  1NUB A;  3WNX B;  4PDZ A;  3A4U B;  1KQM C;  1OZO A;  1XYD A;  4ORA B;  2KFH A;  4N1F A;  3CR2 A;  4PHN A;  1YUS A;  2BE6 A;  1KSO A;  5I2L A;  3VRN A;  1NWD A;  1LXF C;  1RK9 A;  1TNQ A;  2Q4U A;  1BR1 B;  2EHB A;  4MVF A;  4DRW A;  1F70 A;  1UHH A;  3CLN A;  2L98 A;  3O4Y A;  3TS5 C;  1B4C A;  4PE1 A;  3RM1 A;  1IH0 A;  1KWO C;  1AJ5 A;  3O2P A;  2LVK A;  4C0K A;  1J7R A;  2JXL A;  1KK8 B;  1CDP A;  1LA3 A;  3C1V A;  4MZJ A;  4PHK A;  2KYC A;  1RFJ A;  1NX2 A;  1LIN A;  5CSJ A;  4YGD B;  1RWY A;  3IQQ A;  1YUR A;  4ORB B;  4IL1 A;  2M1U A;  1TN4 A;  3A8R A;  2WOS A;  1CFP A;  2WCB A;  3DD4 A;  3HCM A;  3I5H B;  1RTP 1;  1DJW A;  2DOQ A;  2M49 B;  4MZL A;  2KAX A;  3BUO B;  5F6T A;  4YRU A;  3TDU A;  1L2O B;  1ZOT B;  5AAN A;  4DIR A;  5KTY A;  3ICB A;  1J7Q A;  1LKJ A;  1H4B A;  2Q91 A;  1RRO A;  2BL0 B;  1AVS A;  2ZFD A;  2AMI A;  1B8C A;  2WOR A;  3QRX A;  2KBM A;  1SL9 A;  2JOJ A;  5FYX A;  4PE4 A;  1JFK A;  1XFW O;  2NXQ A;  2LHL A;  3EK8 A;  3GOF A;  2G2B A;  3LK0 A;  2MLE C;  3PN7 C;  3K21 A;  1CDM A;  1QLS A;  1UWO A;  1QLK A;  1BLQ A;  1EL4 A;  1SCM B;  1CKK A;  1IJ6 A;  2F2P A;  4FQO A;  5BPJ A;  5DKR A;  3WXA A;  4GNK B;  4A4C A;  2NCO A;  2HF5 A;  2HET A;  2ZN8 A;  1EG3 A;  1XFX O;  1FF1 A;  1KFU L;  4OR9 B;  3GK2 A;  1PRW A;  4UPG A;  3I5G B;  1KQV A;  3DF0 A;  3KEV A;  3AKA A;  1N2D A;  1OMD A;  3NXA A;  1KK7 Y;  1A2X A;  1IRJ A;  3NSO A;  4MN0 A;  5JJG A;  2BE4 A;  1NX0 A;  1QV1 A;  1SYM A;  2FCD A;  4ZCU A;  1B7T Z;  4AOM A;  2LVV A;  1TNW A;  2K7D A;  5ER5 A;  1A03 A;  3M0W A;  1ODB A;  1QTX A;  4DCK A;  2KAV A;  3JTD B;  5HKY A;  4YGB B;  2CCM A;  1NX3 A;  1TRF A;  1M46 A;  1SL7 A;  2V53 A;  2B1U A;  3KHE A;  2KGB C;  2R2I A;  4N1G A;  2EGD A;  2JWW A;  1KFX L;  3FWB A;  4GAO A;  2JUL A;  1Y0V H;  1DT7 B;  3EK7 A;  3PFV A;  1DTL A;  5AEQ A;  1M31 A;  1S1E A;  4MRX A;  1YTZ C;  5AXI A;  5CSI A;  1MQ1 A;  2KI6 C;  4FTG A;  1YX7 A;  1OMV A;  2MRD A;  2ZRT A;  1K93 D;  1CMF A;  1NX1 A;  2LMU A;  2OTG B;  4QJ4 B;  1SY9 A;  1H8B A;  1MF8 B;  1IWQ A;  3CGA A;  3SIA A;  2JZI A;  1EG4 A;  2LP3 A;  2KFF A;  3ZNI A;  2I7A A;  4PHJ A;  4OCI A;  1OOJ A;  1FPW A;  1SL8 A;  4I5N B;  1UHN A;  3I5F C;  2SAS A;  2CBL A;  2ZNE A;  5B8I B;  4CFQ A;  3TDZ A;  1QS7 A;  1V1G A;  1ZAC A;  2M7N A;  3BOW B;  2F8P A;  1C07 A;  3AAK A;  4DS7 A;  3KF9 A;  1YUU A;  2MHH A;  1M45 A;  2SCP A;  1A4P A;  2LAP A;  2JNX A;  2KSP A;  3RLZ A;  4OKH A;  2GV5 A;  2M3W A;  2M1K B;  2L0P A;  4M2O A;  4ETO A;  1QVI Y;  1YUT A;  3EKJ A;  5CSF A;  1CDN A;  3NSI A;  1NSH A;  1HT9 A;  2BBN A;  2PSR A;  2KHN A;  1BG1 A;  2FCE A;  3TZ1 A;  2LHI A;  1YR5 A;  3TUY C;  1K8U A;  1DJZ A;  1XO5 A;  2KFG A;  1JWD A;  5DKQ A;  1XFY O;  3JVT C;  1JBA A;  4AQJ A;  1MXL C;  1Y1U A;  2RGI A;  2JRF A;  1WLZ A;  4I5J A;  4MEW A;  3CTN A;  1LVC D;  1RJV A;  1VRK A;  1TTX A;  2KI4 C;  1TIZ A;  1IKU A;  1BOC A;  1QXP A;  2K7B A;  1JSA A;  2LCP A;  2CXJ A;  1CFF A;  1FI6 A;  2ZN9 A;  3SIB A;  1CFD A;  5G08 A;  5D7F A;  4GUK A;  1WDC B;  2PMY A;  3IQO A;  1FW4 A;  1SW8 A;  1KSM A;  4E68 A;  2BCB A;  4F0Z B;  1DF0 A;  3OHM B;  2HQW A;  4QJ5 B;  4NDD A;  1SPY A;  2WC8 A;  1QAS A;  1NCX A;  1PSR A;  1G4Y R;  1SRA A;  1U5I B;  2I18 A;  3AAJ A;  1C7W A;  1F55 A;  1E8A A;  1IGV A;  1A75 B;  2MLF C;  1AJ4 A;  1QIW A;  3I5I C;  4OVN F;  4XJK A;  5KU1 A;  2VRG A;  3BUX B;  2I94 A;  3BUM B;  2KGR A;  4U8D A;  1OZS A;  1G33 A;  2IS9 A;  1BF5 A;  4PAL A;  1TOP A;  3DVE A;  3HX4 A;  3VGO A;  1DGU A;  1W7I B;  2KNE A;  2I2R E;  1S6C A;  1UP5 A;  4YGA A;  2E6W A;  2O5G A;  2LAN A;  2LP2 A;  4NDB A;  1W7J B;  3O6B A;  4P2Y B;  2EC6 C;  1S3P A;  2LC5 A;  1SKT A;  2LVJ A;  3DVJ A;  1CMG A;  1C7V A;  1TCO B;  4ICB A;  3GK4 X;  5I2O A;  1XFV O;  1F4Q A;  3FS7 A;  3EVU A;  3D0Y B;  1B7T Y;  2F2O A;  2FJU B;  1IG5 A;  4MLW A;  3CR4 X;  2O60 A;  1L7Z A;  5TNC A;  2HQ8 A;  2NLN A;  1TNX A;  3LCP C;  2LLT A;  2M0R A;  3F45 A;  1M63 B;  1Y1X A;  1SNL A;  2BCX A;  1SR6 B;  1GJY A;  4I5L B;  2BKH B;  1MR8 A;  1KK8 C;  4M2Q A;  3BUN B;  1Y1A A;  1F71 A;  1GGW A;  1YVH A;  3VRQ A;  3OP0 A;  1WDC C;  4D1E A;  1K95 A;  2H61 C;  1B8R A;  1EJ3 A;  1OMR A;  5IBW A;  2MJW B;  2L50 A;  3SG6 A;  2OS8 B;  4MBE A;  3I5H C;  1XA5 A;  3E3R A;  1NCZ A;  1K94 A;  1ALV A;  2LNK A;  4L9M A;  4TNC A;  3BUW B;  1WY9 A;  1EXR A;  1L2O C;  1KQM B;  3SG7 A;  2G9B A;  3KPX A;  5PAL A;  2BL0 C;  1J55 A;  1K9U A;  3DVK A;  3BXK A;  1X02 A;  2MBX A;  1YRT B;  2H61 A;  2JT3 A;  4MSP A;  2F33 A;  2M29 A;  1DMO A;  1IQ5 A;  2JT8 A;  1JF2 A;  1N65 A;  5CPV A;  2ZND A;  2PAS A;  3ZWH A;  1FBV A;  3TS5 B;  5AFP A;  4GPL B;  3H4S E;  4DUQ A;  1KWO B;  1SCV A;  5J3X A;  1SCM C;  3LL8 B;  2E30 A;  1BR4 B;  1J7O A;  1WRZ A;  3EVR A;  3OB1 B;  4QJ3 B;  1ALW A;  1BMO A;  1S6J A;  2TN4 A;  1DJX A;  1KFU S;  1ZFS A;  1JUO A;  3I5G C;  1NPQ A;  2KQY A;  2P6B B;  2CTN A;  4NDC A;  2M97 A;  1YRU B;  2LLS A;  2K2A A;  3WHU B;  4BY5 A;  2K0J A;  1MWN A;  3KO0 A;  2BEC A;  2COL B;  4R1E A;  1B8L A;  1Q80 A;  5GQQ C;  2WND A;  1F4O A;  2JT0 A;  2KAY A;  3PSR A;  4I5K A;  1KCY A;  3JTD C;  1DJH A;  3D0Y A;  1R2U A;  1J1E A;  2AUC A;  1KFX S;  2PRU A;  2WCF A;  2JU0 A;  1WRL A;  3PN7 B;  1PK0 D;  1UHJ A;  1B9A A;  1XVJ A;  2KQ6 A;  3SG2 A;  1AHR A;  3DVM A;  2KOT A;  4GGN A;  2K7O A;  5KSZ A;  1JFJ A;  2K8M B;  3FWC A;  3SJS A;  1PVA A;  1TNP A;  2BBM A;  4JWQ A;  2CNP A;  2LM5 A;  2OTG C;  1S5G Z;  1XFZ O;  2ZKM X;  2HPS A;  1QVI Z;  4OV2 A;  3VRO A;  4MRY A;  4YI8 A;  4C0J A;  4A4B A;  1SK6 D;  1YVL A;  2LMT A;  2LMV A;  2LV7 A;  4CID A;  3PM8 A;  3EKH A;  4CLN A;  1AUI B;  2H2K A;  4YI9 A;  1YX8 A;  2F3Z A;  2M8U A;  3PLF B;  2LLU A;  1QJT A;  1D1O A;  3WHT B;  5AER A;  2LUX A;  1F8H A;  1JF0 A;  1CM4 A;  4NQG A;  1B47 A;  2L4H A;  3EVV A;  4HRG A;  2M7L A;  5I2Q A;  1UUR A;  2NCP A;  5D69 A;  1SMG A;  2M9G A;  1OSA A;  2KBI A;  1DJG A;  1G8I A;  2K61 A;  2OPO A;  1CFC A;  1UHK A;  2JC2 A;  1MUX A;  3GK1 A;  3SG3 A;  4GBA A;  2Y1M A;  4GGF C;  3IF7 A;  1WRK A;  4N5X A;  3OX6 A;  1NCY A;  3O78 A;  3BOW A;  4JQ0 D;  1JC2 A;  2PVB A;  1NYA A;  2GGM A;  3OX5 A;  1HQV A;  1DJI A;  1FI5 A;  3D10 A;  5HYD A;  2ZRS A;  1M39 A;  1QAT A;  4MZK A;  1IQ3 A;  2F3Y A;  1OQP A;  1CNP A;  3AKB A;  5ER4 X;  3NSL A;  2JTZ A;  1CDL A;  3SG5 A;  2Y4Q A;  4GGF A;  1UUS A;  1K9P A;  3OB2 B;  4C0L A;  1DVI A;  1NP8 A;  4HRE E;  1PSB A;  2BKI B;  3MSE B;  3I5F B;  1QV0 A;  1BT6 A;  1BJF A;  3TDI A;  5JOL A;  3SG4 A;  4AQI A;  4YGE B;  1J1D A;  1GQM A;  4P5O E;  3CZT X;  2MAZ A;  2K7C A;  2JNF A;  4CFR A;  2MA2 A;  3PAT A;  1CLB A;  3EK4 A;  1QX2 A;  4Q04 A;  4YGC B;  1NIW A;  1LA0 A;  2QPT A;  5I8N A;  1REC A;  1CLL A;  2L4I A;  5HLO A;  2LE9 B;  1OE9 B;  3LK1 A;  2L51 A;  4YBH B;  1PAL A;  3CS1 A;  4XYN A;  1DJY A;  2GGZ A;  1KK7 Z;  1S36 A;  1QIV A;  2ISD A;  1V1F A;  2JPT A;  3TUY B;  3CR5 X;  1TCF A;  5HKZ A;  1AK8 A;  3LLE A;  1AP4 A;  5DKN A;  2LUC A;  3JVT B;  3NSK A;  1S26 D;  1BOD A;  2JXC A;  3BYA A;  3BQ3 A;  1CLM A;  1K9K A;  1DF0 B;  2K2F A;  4WQ3 A;  1U5I A;  4PCW A;  1Y6W A;  2A4J A;  2Y5I A;  1K2H A;  2BCA A;  2CT9 A;  1A75 A;  4HRH A;  2L5X B;  2AAO A;  2KI4 B;  4BY4 A;  2WCE A;  2PAL A;  2L2E A;  3CWG A;  4WQ2 A;  4WRI A;  2KDH A;  1B1G A;  4XJK B;  1GGZ A;  5HKW A;  1CTR A;  1XK4 C;  1A29 A;  4PE7 A;  1MHO A;  5K89 A;  4ORC B;  1SBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...