2M49B

Structural insights into human s100b and basic fibroblast growth factor (fgf2) interaction
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 2
publication title Structural insights into the interaction of human S100B and basic fibroblast growth factor (FGF2): Effects on FGFR1 receptor signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/metal binding protein
total genus 26
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m49B00
2MAZA 3OB1B 1LKJA 4BY5A 1IGVA 1B1GA 4MZJA 1SMGA 1GJYA 5CSIA 2F2PA 2K0JA 3PALA 1QLKA 2CTNA 2BCBA 1M31A 3JVTC 4MBEA 2K7CA 5HKYA 2KBMA 1QATA 4ZCUA 1B9AA 1SCMB 1RFJA 1KCYA 4GPLB 1IQ5A 1OZSA 3AKAA 3TUYB 2F3ZA 2LMUA 5AFPA 2JTTA 2M9GA 4XJKA 1YVLA 2LHLA 3TZ1A 2KI4B 1JUOA 2OTGC 2PVBA 2BKIB 1CM1A 1SYMA 5AANA 3VRQA 2EC6C 1JF2A 4F0ZB 2EGDA 1PVAA 1MF8B 1X02A 2LV7A 3TDZA 1OZOA 5I8NA 1Y1AA 2K2AA 1ZFSA 2KNEA 2L4IA 2LCPA 3DVKA 3CS1A 2KFFA 2JZIA 2L4HA 2GV5A 2MJWB 4PHMA 1KWOB 2AAOA 1SPYA 1QXPA 1G33A 1QV1A 2BECA 3TS5C 1IG5A 2L98A 1XFVO 1OSAA 2NCPA 1B8LA 2IS9A 4NQGA 4ORAB 2P6BB 3AAKA 3NSKA 4CLNA 1RJVA 3CR5X 5I2QA 1J1EA 3PATA 1K8UA 2KGBC 1QASA 1F55A 2F8PA 1AJ4A 1B7TZ 1LA0A 1UWOA 3O6BA 1D1OA 1MUXA 1TOPA 2JT8A 1KQMC 1XFWO 1FPWA 2BE4A 1V1GA 2D8NA 3D10A 1OMVA 1CDNA 2JULA 1K94A 2K7BA 1SL8A 1YURA 4MLWA 5CSFA 4GAOA 3KEVA 1A75A 1B4CA 4TNCA 2M1KB 4YI8A 2BL0C 3I5GB 3GOFA 1UHNA 2KAVA 4GFTA 1CMFA 4NDBA 3I5HC 4WRIA 2I7AA 5CSJA 1ALVA 1K9KA 1XFUO 3DF0A 2PALA 1S5GZ 1PALA 1EJ3A 3KF9A 4FTGA 3VRPA 2Y4QA 1KQVA 1ZOTB 1KFXS 2E6WA 5HLVA 5AEQA 4YRUA 1WDCB 1K95A 2JU0A 2LP2A 1J7OA 4MEWA 1DJXA 1PULA 3EVUA 2A4JA 2K7DA 2R2IA 1W7IB 1BODA 4WQ2A 4MZLA 3SG3A 3KHEA 1BR4B 3D0YA 1BOCA 1TNQA 1TNXA 1MXLC 1KK7Y 1K9PA 2L51A 2OS8B 3EK8A 1TCFA 4M2PA 1A2XA 1DJIA 1QIVA 1WLMA 1HQVA 1JBAA 1QJTA 2E30A 2F3YA 1BT6A 2ZKMX 3VRNA 3WHTB 3ICBA 1BF5A 3VGOA 1IRJA 1MR8A 2M7NA 1S3PA 2MRDA 2MLFC 1L7ZA 1MQ1A 1SR6B 2KI6D 1QVIY 2H2KA 2KFGA 3WHUB 1C7WA 4JWQA 1R2UA 1XVJA 1UHJA 3BQ3A 1B8CA 1F4OA 2I2RE 1JWDA 1TN4A 4PALA 5KU1A 1ZUZA 4YGBB 4XYNA 2HF5A 4ETOA 2HPSA 1CB1A 1DJGA 4C0JA 2VRGA 1NPQA 1UURA 2JC2A 1FF1A 2ZNEA 1NYAA 1IJ6A 2EHBA 2KDHA 2LMTA 1SY9A 4DUQA 1XK4C 1FBVA 3SG4A 3ZWHA 2MBXA 1Y0VH 2JXCA 1M63B 2CT9A 2ZN8A 3BUXB 2JT3A 5B8IB 1SRAA 1WRZA 2K8MB 1SCMC 5D7FA 3KO0A 3TUYC 1KSOA 3K21A 3EVVA 3SG5A 5HYDA 1DJHA 1S6CA 2LANA 1NX1A 1NWDA 4P5OE 4A4BA 1IWQA 1U5IB 1TCOB 5KTYA 1F54A 2KI4C 3NSOA 3LK1A 2FCEA 2BE6A 2KYFA 2H61C 1NIWA 3IQOA 2HETA 4I5JA 1B8RA 2CBLA 1R6PA 3FWBA 1DGVA 2LMVA 1WRLA 2G9BA 4PE1A 1F71A 1JC2A 3OX6A 5F6TA 1YX8A 2JXLA 1KWOC 1AP4A 3EKJA 1LXFC 1QV0A 5GQQC 2KOTA 2KBIA 1BJFA 4U8DA 2SASA 1ZMZA 1LINA 3HCMA 1BU3A 2Q4UA 3OP0A 3LL8B 1NUBA 2JNXA 1M45A 2FCDA 4AOMA 1SNLA 2COLB 2LNKA 2KQ6A 5CPVA 4WQ3A 1TTXA 1DGUA 1SK6D 1DF0A 4PCWA 4N1GA 3JTDB 2JPTA 1AUIB 3BUOB 1DVIA 2Y1NA 3BOWB 1CFFA 3FWCA 4UPGA 3ZNIA 4AQJA 2LC5A 1B7TY 1SKTA 3CWGA 3KPXA 1NP8A 1EG4A 1FW4A 2M29A 2M49B 3C1VA 1A03A 1JSAA 3CTNA 1GGZA 1CTRA 3GK4X 4NDDA 4MSPA 1AVSA 2LHIA 1N2DA 5ER4X 1WRKA 2KI6C 3F45A 2O5GA 1LA3A 4QJ5B 2JTZA 1IQ3A 3I5GC 1MHOA 1BLQA 1AK8A 2WC8A 4PE0A 5I2OA 3I5FB 4DIRA 2K2FA 1XK4A 1CDPA 2KQYA 2WCEA 2B1UA 2F33A 2QACA 2LVIA 3OB2B 1GQMA 5DKQA 1OE9B 1NX0A 1S5GY 1WDCC 2AMIA 1JF0A 1HT9A 1CFDA 1J7RA 4QJ4B 2KYCA 3E3RA 1XO5A 4GUKA 2LVJA 4YGEB 3RM1A 4P2YB 1OOJA 1MXEA 1JFKA 4OVNF 4FQOA 1F4QA 3OX5A 1G8IA 3PFVA 3PM8A 1C7VA 4IL1A 5JOLA 4CFRA 1PRWA 1CLLA 2OS8C 2H61A 4HRGA 1CLMA 1XFYO 4I5NB 3BUNB 4XJKB 3I5HB 4USLA 4QJ3B 2G2BA 1KSMA 2AUCA 5K89A 1PVBA 2KAYA 4GGNA 1KK8B 4GNKB 1CNPA 1SR6C 2BBNA 2CXJA 4MRYA 1F8HA 1OMRA 3O4YA 1WLZA 1YR5A 4C0KA 4JPZB 4DRWA 4CFQA 2KAXA 2WOSA 2LP3A 3FIAA 4OV2A 1CFCA 1K9UA 2LVKA 4MZKA 1CM4A 1UP5A 4NDCA 5DKNA 2KGRA 3VROA 3SG7A 3DD4A 1JFJA 4GBAA 2I94A 1K90D 1M46A 2CNPA 3EK7A 4YGAA 2M1UA 2ZFDA 2CCMA 2LLSA 1B47A 1NCYA 2BCAA 3CLNA 2MA2A 1Y6WA 1NCZA 2LUXA 1RWYA 4L9MA 2LM5A 1L2OB 1ODBA 4C0LA 3PLFB 1RK9A 3PN7B 2RGIA 4R1EA 3BUMB 2ZRTA 1XFZO 1UUSA 1YRTB 1J7QA 3I5IB 3DVMA 3EK4A 4YBHB 2M3WA 2Y5IA 2NLNA 2SCPA 1DJZA 2PASA 1A75B 2LLTA 4PE7A 1RTP1 1N65A 1J7PA 1KFXL 1FI6A 2K7OA 2ZRSA 5ER5A 5TNCA 1Y1UA 1SW8A 2JNFA 1TNWA 1EL4A 1IKUA 1PSRA 3DF0B 3A8RA 1A4PA 5KSZA 1LVCD 4Q04A 1CFPA 2M7LA 2L2EA 4PHNA 1DMOA 1IH0A 4ZCVA 2F2OA 1SL9A 3JVTB 3SIAA 1CKKA 4GGFC 1GGWA 1M39A 2NCOA 4D1EA 1G4YR 2PMYA 1WY9A 2ZNDA 2JOJA 3WNXB 1V1FA 2KFHA 3D0YB 5HLOA 1KFUS 1SCVA 3NXAA 3H4SE 1EG3A 2OTGB 2GGMA 3JTDC 3TDUA 4PHKA 1AJ5A 3WXAA 2BCXA 2EC6B 1NX2A 3DVEA 1TRFA 1NX3A 1BMOA 1UHHA 5HKZA 2O60A 2ISDA 2KSPA 1YVHA 3EVRA 2V53A 4I5KA 1XYDA 4MRXA 4DCKA 1S6JA 4YI9A 1CMGA 3M0WA 4E68A 2NXQA 1PSBA 1UHKA 3TS5B 2M8UA 3FS7A 5JJGA 4BY4A 2DOQA 3HX4A 4N5XA 3GK1A 3A4UB 4OKHA 3I5FC 4A4CA 5D69A 3CR4X 4MVFA 3SJSA 3CR2A 4PE4A 2L0PA 2HQWA 3TDIA 4HRHA 1XA5A 3O2PA 2PRUA 1YUUA 3GK2A 1YTZC 1DTLA 1DT7B 2WCFA 3CZTX 2LE9B 1W7JB 1SL7A 3NSIA 1KQMB 1PK0D 4ORBB 2MLEC 1QX2A 1N0YA 2ZN9A 5BPJA 3LLEA 1CLBA 1K96A 3OHMB 4YGDB 1H4BA 2JWWA 2NZ0A 3BXKA 1U5IA 4M2QA 3IQQA 1E8AA 1S36A 2M0RA 1MWNA 2MHHA 3PSRA 4ORCB 4I5LB 4AQIA 1CDLA 3RLZA 1YUTA 1Q80A 1QX7A 3VRRA 1J1DA 2Y1MA 2WCBA 2K61A 2BL0B 2LAPA 4JQ0D 4YGCB 5IBWA 1CDMA 3LK0A 1OQPA 3BYAA 2BKHB 3NSLA 3CGAA 2WORA 1KK8C 1EXRA 1TNPA 2GGZA 3AAJA 1YRUB 3QRXA 2HQ8A 1C07A 1QX5B 5J3XA 4ICBA 1J55A 1ZACA 4GGFA 3MSEB 4PDZA 2BBMA 4HREE 5G08A 4CIDA 1KFUL 1XFXO 2LUCA 2Q91A 2WNDA 5CSNA 3LCPC 2M97A 1KK7Z 3O78A 4CPVA 1TIZA 1QS7A 3SIBA 3BUWB 4M2OA 1S6IA 3DVJA 1OMDA 1YUSA 5DKRA 1ALWA 2L5XB 1IJ5A 4HSZA 3BOWA 1RROA 1NCXA 1NSHA 1QTXA 2FOTA 1VRKA 5HKWA 1Y1XA 2JT0A 5PALA 2FJUB 4PHJA 2PSRA 2JRFA 1DJWA 1EH2A 1DF0B 1QVIZ 1RECA 4MN0A 3SG6A 1QIWA 2I18A 3AKBA 3IF7A 1H8BA 1L2OC 2KHNA 2QPTA 5AERA 1S26D 4OR9B 1UHIA 1YX7A 1BG1A 1A29A 3PN7C 2L50A 1DJYA 4DS7A 5I2LA 1FI5A 5FYXA 2OPOA 1F70A 3I5IC 2JQ6A 5AXIA 1AHRA 1QLSA 1S1EA 1SBJA 3EKHA 3SG2A 4OCIA 2TN4A 1K2HA 2LVVA 1BR1B 1K93D 4N1FA 2LLUA
chains in the Genus database with same CATH superfamily
2MAZA 3OB1B 1LKJA 4BY5A 1IGVA 1B1GA 2P71A 4MZJA 1SMGA 1GJYA 5CSIA 2F2PA 4AOMA 2K0JA 3PALA 4OZDA 1QLKA 2CTNA 2BCBA 3VB1A 1M31A 3JVTC 4MBEA 2K7CA 5HKYA 2KBMA 1QATA 4ZCUA 1B9AA 1SCMB 1RFJA 1KCYA 4GPLB 1IQ5A 1OZSA 3AKAA 3TUYB 2F3ZA 2L2CA 2LMUA 5AFPA 2JTTA 2M9GA 4XJKA 1YVLA 2LHLA 3TZ1A 2WC5A 2KI4B 1JUOA 2OTGC 2PVBA 2BKIB 1CM1A 1SYMA 5AANA 3VRQA 2EC6C 1JF2A 4F0ZB 2EGDA 1PVAA 2JPOA 1MF8B 1X02A 2LV7A 3TDZA 1OZOA 5I8NA 1Y1AA 2BNXA 2K2AA 1ZFSA 2KNEA 2L4IA 2LCPA 3DVKA 3CS1A 2KFFA 2JZIA 2L4HA 2GV5A 2MJWB 4PHMA 1KWOB 2AAOA 1SPYA 1QXPA 1G33A 1QV1A 2BECA 3TS5C 1IG5A 2L98A 1XFVO 1OSAA 2NCPA 1B8LA 2IS9A 4NQGA 2L5YA 3SS5A 4ORAB 2P6BB 3AAKA 3NSKA 1LS8A 4CLNA 1RJVA 3CR5X 5I2QA 1J1EA 3PATA 1K8UA 2KGBC 1QASA 1F55A 2F8PA 1AJ4A 1B7TZ 1LA0A 1UWOA 3O6BA 1D1OA 1MUXA 1TOPA 2JT8A 1KQMC 1XFWO 1FPWA 3R1VA 3CABA 2BAPA 2BE4A 2QEBA 1V1GA 2D8NA 1P28A 3D10A 1OMVA 1CDNA 2JULA 1K94A 2K7BA 1SL8A 3UNWA 1YURA 4MLWA 5CSFA 1OOHA 4GAOA 4IJ7A 2H8VA 3KEVA 1A75A 1B4CA 2WCMA 4TNCA 2M1KB 4YI8A 2BL0C 3D77A 3I5GB 3GOFA 3NHIA 1UHNA 2KAVA 3EG5B 4GFTA 1CMFA 4NDBA 3I5HC 4WRIA 2I7AA 5CSJA 1ALVA 1K9KA 1XFUO 3DF0A 2PALA 4JD9A 1S5GZ 1PALA 1EJ3A 3KF9A 4FTGA 3VRPA 2Y4QA 1KQVA 3K1EA 1ZOTB 1KFXS 2E6WA 5HLVA 5AEQA 4YRUA 5I94A 2QEHA 1WDCB 1K95A 2JU0A 2LP2A 4INXA 4MEWA 1J7OA 1DJXA 1PULA 3R1PA 3EVUA 3CDNA 2A4JA 2ERBA 2K7DA 2R2IA 1W7IB 1BODA 5EL2A 4WQ2A 4MZLA 3SG3A 3KHEA 1BR4B 3D0YA 3L47A 1BOCA 1TNQA 1TNXA 1MXLC 1KK7Y 1K9PA 2L51A 2OS8B 3EK8A 1TCFA 4M2PA 1A2XA 1DJIA 1QIVA 1WLMA 1HQVA 1JBAA 1QJTA 2E30A 2F3YA 1DEKA 1BT6A 2QEVA 2ZKMX 3VRNA 3WHTB 3ICBA 3S0FA 1TUZA 3VGOA 1BF5A 1IRJA 1MR8A 2M7NA 1S3PA 2KLEA 4F7FA 2MRDA 2QEOA 3CZ2A 2MLFC 1L7ZA 1MQ1A 2PYQA 1SR6B 1Z2CB 1QVIY 2H2KA 2KI6D 2KFGA 3WHUB 1C7WA 3FE6A 4JWQA 1R2UA 1XVJA 1UHJA 3BQ3A 1B8CA 2K60A 1F4OA 2I2RE 1JWDA 1TN4A 3BFAA 4PALA 5KU1A 1ZUZA 4YGBB 4XYNA 2HF5A 4ETOA 3D78A 2HPSA 3OBVA 1CB1A 1DJGA 4C0JA 2VRGA 1NPQA 1UURA 2JC2A 3NGVA 1FF1A 2ZNEA 1NYAA 1IJ6A 2EHBA 2KDHA 2KLDA 3SS3A 2LMTA 1SY9A 4DUQA 1XK4C 2QDIA 1FBVA 2FJYA 3BFHA 3SG4A 3ZWHA 2MBXA 1Y0VH 2JXCA 3B86A 1M63B 2CT9A 2ZN8A 3BUXB 2JT3A 5B8IB 1SRAA 1WRZA 2K8MB 1SCMC 3D75A 5D7FA 3KO0A 3TUYC 1KSOA 3K21A 3EVVA 3SG5A 5HYDA 1DJHA 1S6CA 2LANA 1NX1A 1NWDA 4P5OE 4A4BA 1IWQA 1U5IB 1TCOB 5KTYA 1F54A 2KI4C 3NSOA 3LK1A 2FCEA 2BE6A 2KYFA 2H61C 3B87A 1NIWA 3IQOA 2HETA 4I5JA 3QMEA 5HL1A 1B8RA 2CBLA 1R6PA 3FWBA 1DGVA 3N7HA 2LMVA 1WRLA 2G9BA 3V2LA 4PE1A 1C3ZA 5DICA 1F71A 1JC2A 3OX6A 5F6TA 1YX8A 2JXLA 1KWOC 1AP4A 3EKJA 1LXFC 1QV0A 5GQQC 2KOTA 2KBIA 1BJFA 4U8DA 2SASA 1ZMZA 3S0GA 1LINA 1W9ZA 1BU3A 3HCMA 2Q4UA 3SS4A 3OP0A 3L4LA 3LL8B 1NUBA 2JNXA 1M45A 2FCDA 4PT1A 1SNLA 2COLB 2LNKA 2KQ6A 5CPVA 1T14A 4WQ3A 1TTXA 1DGUA 1SK6D 1DF0A 4PCWA 4N1GA 3JTDB 2JPTA 1AUIB 3BUOB 1DVIA 2Y1NA 3BOWB 3R72A 1CFFA 3FWCA 4UPGA 3ZNIA 4AQJA 2LC5A 1B7TY 1SKTA 3CWGA 3KPXA 1NP8A 1EG4A 1FW4A 2M29A 2M49B 3C1VA 1DC1A 1A03A 1JSAA 3CTNA 1GGZA 1CTRA 3GK4X 4NDDA 4MSPA 3S0EA 1AVSA 2LHIA 1N2DA 5ER4X 1WRKA 2KI6C 3F45A 2O5GA 1LA3A 4QJ5B 2JTZA 1IQ3A 3I5GC 1MHOA 1BLQA 1AK8A 2WC8A 4PE0A 5I2OA 1SSEB 3I5FB 3L4AA 4DIRA 2K2FA 1XK4A 1CDPA 2KQYA 2WCEA 2B1UA 2F33A 2QACA 2LVIA 3OB2B 1GQMA 5DKQA 1OE9B 1NX0A 1S5GY 1WDCC 3NHTA 2AMIA 1JF0A 1HT9A 4FQTA 1CFDA 1J7RA 4QJ4B 2KYCA 3E3RA 1XO5A 4GUKA 2LVJA 4YGEB 3RM1A 4P2YB 1OOJA 5FI6A 1MXEA 1JFKA 4OVNF 4FQOA 3B7AA 1F4QA 3OX5A 1G8IA 3PFVA 3PM8A 1C7VA 4IL1A 5JOLA 4CFRA 1PRWA 1CLLA 1QWVA 4JKTA 2OS8C 2H61A 4HRGA 1CLMA 1GM0A 1XFYO 4I5NB 3BUNB 4XJKB 3I5HB 4USLA 4QJ3B 2G2BA 1KSMA 2AUCA 5K89A 1PVBA 1OOFA 2KAYA 3OGNA 4GGNA 1KK8B 4GNKB 1CNPA 3BFBA 1SR6C 1OW4A 1OOIX 2BBNA 2CXJA 3CZ0A 4MRYA 1F8HA 1OMRA 3O4YA 1WLZA 1YR5A 4C0KA 4JPZB 5FI2A 4DRWA 4CFQA 2KAXA 2WOSA 2LP3A 3FIAA 4OV2A 1CFCA 1K9UA 2LVKA 2WC6A 3CZ1A 1CM4A 1UP5A 4MZKA 4NDCA 5DKNA 2KGRA 1OOGA 3VROA 3SG7A 2KPHA 3DD4A 1JFJA 3D74A 4GBAA 1TUJA 2I94A 1K90D 1M46A 2CNPA 3EK7A 2WCHA 4YGAA 2M1UA 2ZFDA 2CCMA 2LLSA 1B47A 1NCYA 2BCAA 3CLNA 2MA2A 1Y6WA 1NCZA 2LUXA 1RWYA 4L9MA 2LM5A 1L2OB 1ODBA 4C0LA 3PLFB 1RK9A 4INWA 3PN7B 2RGIA 4R1EA 3BUMB 2ZRTA 1XFZO 1UUSA 1YRTB 1J7QA 1TWOA 3I5IB 3DVMA 3EK4A 4YBHB 2M3WA 2Y5IA 3S0AA 2NLNA 2SCPA 1DJZA 2PASA 1A75B 2LLTA 3DYEA 4PE7A 1RTP1 3D76A 1N65A 1J7PA 1KFXL 1FI6A 2K7OA 2ZRSA 5ER5A 5TNCA 1Y1UA 1SW8A 3B6XA 2JNFA 2WCJA 2YGUA 1TNWA 1EL4A 1IKUA 1PSRA 3DF0B 3A8RA 1A4PA 5KSZA 1LVCD 4Q04A 1CFPA 2M7LA 2L2EA 1Z4HA 4PHNA 1DMOA 1IH0A 4ZCVA 2F2OA 1SL9A 3JVTB 3SIAA 1CKKA 4GGFC 1GGWA 1M39A 2NCOA 4D1EA 1G4YR 2PMYA 1WY9A 2ZNDA 2JOJA 3WNXB 3UO9A 1V1FA 2KFHA 3D0YB 5HLOA 1KFUS 1SCVA 5D3OA 3NXAA 3H4SE 1C3YA 1EG3A 2OTGB 3BJHA 2GGMA 3JTDC 3TDUA 4PHKA 1AJ5A 3WXAA 2BCXA 2EC6B 1NX2A 3DVEA 3FE8A 1TRFA 1NX3A 1BMOA 1UHHA 2PQLA 5HKZA 2O60A 2ISDA 1DQEA 2KSPA 1YVHA 3EVRA 2V53A 4I5KA 1XYDA 4MRXA 4DCKA 1S6JA 4YI9A 1CMGA 3M0WA 4E68A 2NXQA 1PSBA 1UHKA 4KYNA 2M8UA 3FS7A 3TS5B 5JJGA 4BY4A 2DOQA 3HX4A 3PM2A 3GK1A 3A4UB 4N5XA 4OKHA 3O4XA 3I5FC 3S0BA 4A4CA 5D69A 3CR4X 3IVTA 4MVFA 3SJSA 3CR2A 4PE4A 2L0PA 2HQWA 3TDIA 4HRHA 1XA5A 3O2PA 2PRUA 1YUUA 3GK2A 1YTZC 1DTLA 1DT7B 2WCFA 3CZTX 2LE9B 1W7JB 1SL7A 3DXLA 1KQMB 1PK0D 3NSIA 4ORBB 2MLEC 1QX2A 1N0YA 2ZN9A 5BPJA 2GTEA 3LLEA 1CLBA 1K96A 3OHMB 4YGDB 1H4BA 2JWWA 2NZ0A 3BXKA 1U5IA 4M2QA 3IQQA 1E8AA 1S36A 2M0RA 1MWNA 2MHHA 3PSRA 4ORCB 3S0DA 4I5LB 4AQIA 1CDLA 3RLZA 1YUTA 1Q80A 1QX7A 3VRRA 1J1DA 2Y1MA 2WCBA 2K61A 2BL0B 2LAPA 4JQ0D 4YGCB 5IBWA 1CDMA 3LK0A 1OQPA 3BYAA 2BKHB 3NSLA 3CYZA 3CGAA 2WORA 3RZSA 1KK8C 1EXRA 1TNPA 2GGZA 3AAJA 1YRUB 3QRXA 2HQ8A 1C07A 3DZTA 1QX5B 5J3XA 4ICBA 2WCKA 3DY9A 1J55A 1ZACA 4GGFA 3MSEB 4PDZA 2BBMA 4HREE 5G08A 4CIDA 1ORGA 1KFUL 1XFXO 2LUCA 2Q91A 2WNDA 5CSNA 3LCPC 2M97A 5FI7A 1KK7Z 3O78A 4CPVA 1TIZA 1QS7A 3SIBA 3BUWB 4M2OA 1S6IA 3DVJA 1OMDA 1YUSA 5DKRA 1ALWA 2L5XB 1IJ5A 4HSZA 3BOWA 1RROA 3Q8IA 1NCXA 1NSHA 1QTXA 2FOTA 1VRKA 5HKWA 1Y1XA 2JT0A 2P70A 2FJUB 5PALA 4PHJA 2PSRA 2JRFA 1DJWA 1EH2A 1DF0B 1QVIZ 1RECA 3D73A 4MN0A 3SG6A 1QIWA 3FE9A 2I18A 3AKBA 3IF7A 1H8BA 1L2OC 2KHNA 2QPTA 1IIOA 5AERA 1S26D 4OR9B 1UHIA 1YX7A 1DELA 3B88A 1BG1A 1A29A 3PN7C 2L50A 1DJYA 2WCLA 4DS7A 5I2LA 1FI5A 5FYXA 2OPOA 1F70A 3I5IC 2JQ6A 5AXIA 3PJIA 1AHRA 1QLSA 1XFRA 1S1EA 1SBJA 3EKHA 3SG2A 4OCIA 3R1OA 2TN4A 1K2HA 2LVVA 1BR1B 1K93D 4N1FA 2LLUA
chains in the Genus database with same CATH topology
2MAZA 3OB1B 1LKJA 4BY5A 1IGVA 1B1GA 4MZJA 1SMGA 1GJYA 5CSIA 2F2PA 2K0JA 3PALA 1QLKA 2CTNA 2BCBA 1M31A 3JVTC 4MBEA 2K7CA 5HKYA 2KBMA 1QATA 4ZCUA 1B9AA 1SCMB 1RFJA 1KCYA 4GPLB 1IQ5A 1OZSA 3AKAA 3TUYB 2F3ZA 2LMUA 5AFPA 2JTTA 2M9GA 4XJKA 1YVLA 2LHLA 3TZ1A 2KI4B 1JUOA 2OTGC 2PVBA 2BKIB 1CM1A 1SYMA 5AANA 3VRQA 2EC6C 1JF2A 4F0ZB 2EGDA 1PVAA 1MF8B 1X02A 2LV7A 3TDZA 1OZOA 5I8NA 1Y1AA 2K2AA 1ZFSA 2KNEA 2L4IA 2LCPA 3DVKA 3CS1A 2KFFA 2JZIA 2L4HA 2GV5A 2MJWB 4PHMA 1KWOB 2AAOA 1SPYA 1QXPA 1G33A 1QV1A 2BECA 3TS5C 1IG5A 2L98A 1XFVO 1OSAA 2NCPA 1B8LA 2IS9A 4NQGA 4ORAB 2P6BB 3AAKA 3NSKA 4CLNA 1RJVA 3CR5X 5I2QA 1J1EA 3PATA 1K8UA 2KGBC 1QASA 1F55A 2F8PA 1AJ4A 1B7TZ 1LA0A 1UWOA 3O6BA 1D1OA 1MUXA 1TOPA 2JT8A 1KQMC 1XFWO 1FPWA 2BE4A 1V1GA 2D8NA 3D10A 1OMVA 1CDNA 2JULA 1K94A 2K7BA 1SL8A 1YURA 4MLWA 5CSFA 4GAOA 3KEVA 1A75A 1B4CA 4TNCA 2M1KB 4YI8A 2BL0C 3I5GB 3GOFA 1UHNA 2KAVA 4GFTA 1CMFA 4NDBA 3I5HC 4WRIA 2I7AA 5CSJA 1ALVA 1K9KA 1XFUO 3DF0A 2PALA 1S5GZ 1PALA 1EJ3A 3KF9A 4FTGA 3VRPA 2Y4QA 1KQVA 1ZOTB 1KFXS 2E6WA 5HLVA 5AEQA 4YRUA 1WDCB 1K95A 2JU0A 2LP2A 1J7OA 4MEWA 1DJXA 1PULA 3EVUA 2A4JA 2K7DA 2R2IA 1W7IB 1BODA 4WQ2A 4MZLA 3SG3A 3KHEA 1BR4B 3D0YA 1BOCA 1TNQA 1TNXA 1MXLC 1KK7Y 1K9PA 2L51A 2OS8B 3EK8A 1TCFA 4M2PA 1A2XA 1DJIA 1QIVA 1WLMA 1HQVA 1JBAA 1QJTA 2E30A 2F3YA 1BT6A 2ZKMX 3VRNA 3WHTB 3ICBA 1BF5A 3VGOA 1IRJA 1MR8A 2M7NA 1S3PA 2MRDA 2MLFC 1L7ZA 1MQ1A 1SR6B 2KI6D 1QVIY 2H2KA 2KFGA 3WHUB 1C7WA 4JWQA 1R2UA 1XVJA 1UHJA 3BQ3A 1B8CA 1F4OA 2I2RE 1JWDA 1TN4A 4PALA 5KU1A 1ZUZA 4YGBB 4XYNA 2HF5A 4ETOA 2HPSA 1CB1A 1DJGA 4C0JA 2VRGA 1NPQA 1UURA 2JC2A 1FF1A 2ZNEA 1NYAA 1IJ6A 2EHBA 2KDHA 2LMTA 1SY9A 4DUQA 1XK4C 1FBVA 3SG4A 3ZWHA 2MBXA 1Y0VH 2JXCA 1M63B 2CT9A 2ZN8A 3BUXB 2JT3A 5B8IB 1SRAA 1WRZA 2K8MB 1SCMC 5D7FA 3KO0A 3TUYC 1KSOA 3K21A 3EVVA 3SG5A 5HYDA 1DJHA 1S6CA 2LANA 1NX1A 1NWDA 4P5OE 4A4BA 1IWQA 1U5IB 1TCOB 5KTYA 1F54A 2KI4C 3NSOA 3LK1A 2FCEA 2BE6A 2KYFA 2H61C 1NIWA 3IQOA 2HETA 4I5JA 1B8RA 2CBLA 1R6PA 3FWBA 1DGVA 2LMVA 1WRLA 2G9BA 4PE1A 1F71A 1JC2A 3OX6A 5F6TA 1YX8A 2JXLA 1KWOC 1AP4A 3EKJA 1LXFC 1QV0A 5GQQC 2KOTA 2KBIA 1BJFA 4U8DA 2SASA 1ZMZA 1LINA 3HCMA 1BU3A 2Q4UA 3OP0A 3LL8B 1NUBA 2JNXA 1M45A 2FCDA 4AOMA 1SNLA 2COLB 2LNKA 2KQ6A 5CPVA 4WQ3A 1TTXA 1DGUA 1SK6D 1DF0A 4PCWA 4N1GA 3JTDB 2JPTA 1AUIB 3BUOB 1DVIA 2Y1NA 3BOWB 1CFFA 3FWCA 4UPGA 3ZNIA 4AQJA 2LC5A 1B7TY 1SKTA 3CWGA 3KPXA 1NP8A 1EG4A 1FW4A 2M29A 2M49B 3C1VA 1A03A 1JSAA 3CTNA 1GGZA 1CTRA 3GK4X 4NDDA 4MSPA 1AVSA 2LHIA 1N2DA 5ER4X 1WRKA 2KI6C 3F45A 2O5GA 1LA3A 4QJ5B 2JTZA 1IQ3A 3I5GC 1MHOA 1BLQA 1AK8A 2WC8A 4PE0A 5I2OA 3I5FB 4DIRA 2K2FA 1XK4A 1CDPA 2KQYA 2WCEA 2B1UA 2F33A 2QACA 2LVIA 3OB2B 1GQMA 5DKQA 1OE9B 1NX0A 1S5GY 1WDCC 2AMIA 1JF0A 1HT9A 1CFDA 1J7RA 4QJ4B 2KYCA 3E3RA 1XO5A 4GUKA 2LVJA 4YGEB 3RM1A 4P2YB 1OOJA 1MXEA 1JFKA 4OVNF 4FQOA 1F4QA 3OX5A 1G8IA 3PFVA 3PM8A 1C7VA 4IL1A 5JOLA 4CFRA 1PRWA 1CLLA 2OS8C 2H61A 4HRGA 1CLMA 1XFYO 4I5NB 3BUNB 4XJKB 3I5HB 4USLA 4QJ3B 2G2BA 1KSMA 2AUCA 5K89A 1PVBA 2KAYA 4GGNA 1KK8B 4GNKB 1CNPA 1SR6C 2BBNA 2CXJA 4MRYA 1F8HA 1OMRA 3O4YA 1WLZA 1YR5A 4C0KA 4JPZB 4DRWA 4CFQA 2KAXA 2WOSA 2LP3A 3FIAA 4OV2A 1CFCA 1K9UA 2LVKA 4MZKA 1CM4A 1UP5A 4NDCA 5DKNA 2KGRA 3VROA 3SG7A 3DD4A 1JFJA 4GBAA 2I94A 1K90D 1M46A 2CNPA 3EK7A 4YGAA 2M1UA 2ZFDA 2CCMA 2LLSA 1B47A 1NCYA 2BCAA 3CLNA 2MA2A 1Y6WA 1NCZA 2LUXA 1RWYA 4L9MA 2LM5A 1L2OB 1ODBA 4C0LA 3PLFB 1RK9A 3PN7B 2RGIA 4R1EA 3BUMB 2ZRTA 1XFZO 1UUSA 1YRTB 1J7QA 3I5IB 3DVMA 3EK4A 4YBHB 2M3WA 2Y5IA 2NLNA 2SCPA 1DJZA 2PASA 1A75B 2LLTA 4PE7A 1RTP1 1N65A 1J7PA 1KFXL 1FI6A 2K7OA 2ZRSA 5ER5A 5TNCA 1Y1UA 1SW8A 2JNFA 1TNWA 1EL4A 1IKUA 1PSRA 3DF0B 3A8RA 1A4PA 5KSZA 1LVCD 4Q04A 1CFPA 2M7LA 2L2EA 4PHNA 1DMOA 1IH0A 4ZCVA 2F2OA 1SL9A 3JVTB 3SIAA 1CKKA 4GGFC 1GGWA 1M39A 2NCOA 4D1EA 1G4YR 2PMYA 1WY9A 2ZNDA 2JOJA 3WNXB 1V1FA 2KFHA 3D0YB 5HLOA 1KFUS 1SCVA 3NXAA 3H4SE 1EG3A 2OTGB 2GGMA 3JTDC 3TDUA 4PHKA 1AJ5A 3WXAA 2BCXA 2EC6B 1NX2A 3DVEA 1TRFA 1NX3A 1BMOA 1UHHA 5HKZA 2O60A 2ISDA 2KSPA 1YVHA 3EVRA 2V53A 4I5KA 1XYDA 4MRXA 4DCKA 1S6JA 4YI9A 1CMGA 3M0WA 4E68A 2NXQA 1PSBA 1UHKA 3TS5B 2M8UA 3FS7A 5JJGA 4BY4A 2DOQA 3HX4A 4N5XA 3GK1A 3A4UB 4OKHA 3I5FC 4A4CA 5D69A 3CR4X 4MVFA 3SJSA 3CR2A 4PE4A 2L0PA 2HQWA 3TDIA 4HRHA 1XA5A 3O2PA 2PRUA 1YUUA 3GK2A 1YTZC 1DTLA 1DT7B 2WCFA 3CZTX 2LE9B 1W7JB 1SL7A 3NSIA 1KQMB 1PK0D 4ORBB 2MLEC 1QX2A 1N0YA 2ZN9A 5BPJA 3LLEA 1CLBA 1K96A 3OHMB 4YGDB 1H4BA 2JWWA 2NZ0A 3BXKA 1U5IA 4M2QA 3IQQA 1E8AA 1S36A 2M0RA 1MWNA 2MHHA 3PSRA 4ORCB 4I5LB 4AQIA 1CDLA 3RLZA 1YUTA 1Q80A 1QX7A 3VRRA 1J1DA 2Y1MA 2WCBA 2K61A 2BL0B 2LAPA 4JQ0D 4YGCB 5IBWA 1CDMA 3LK0A 1OQPA 3BYAA 2BKHB 3NSLA 3CGAA 2WORA 1KK8C 1EXRA 1TNPA 2GGZA 3AAJA 1YRUB 3QRXA 2HQ8A 1C07A 1QX5B 5J3XA 4ICBA 1J55A 1ZACA 4GGFA 3MSEB 4PDZA 2BBMA 4HREE 5G08A 4CIDA 1KFUL 1XFXO 2LUCA 2Q91A 2WNDA 5CSNA 3LCPC 2M97A 1KK7Z 3O78A 4CPVA 1TIZA 1QS7A 3SIBA 3BUWB 4M2OA 1S6IA 3DVJA 1OMDA 1YUSA 5DKRA 1ALWA 2L5XB 1IJ5A 4HSZA 3BOWA 1RROA 1NCXA 1NSHA 1QTXA 2FOTA 1VRKA 5HKWA 1Y1XA 2JT0A 5PALA 2FJUB 4PHJA 2PSRA 2JRFA 1DJWA 1EH2A 1DF0B 1QVIZ 1RECA 4MN0A 3SG6A 1QIWA 2I18A 3AKBA 3IF7A 1H8BA 1L2OC 2KHNA 2QPTA 5AERA 1S26D 4OR9B 1UHIA 1YX7A 1BG1A 1A29A 3PN7C 2L50A 1DJYA 4DS7A 5I2LA 1FI5A 5FYXA 2OPOA 1F70A 3I5IC 2JQ6A 5AXIA 1AHRA 1QLSA 1S1EA 1SBJA 3EKHA 3SG2A 4OCIA 2TN4A 1K2HA 2LVVA 1BR1B 1K93D 4N1FA 2LLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAZ A;  3OB1 B;  1LKJ A;  4BY5 A;  1IGV A;  1B1G A;  4MZJ A;  1SMG A;  1GJY A;  5CSI A;  2F2P A;  2K0J A;  3PAL A;  1QLK A;  2CTN A;  2BCB A;  1M31 A;  3JVT C;  4MBE A;  2K7C A;  5HKY A;  2KBM A;  1QAT A;  4ZCU A;  1B9A A;  1SCM B;  1RFJ A;  1KCY A;  4GPL B;  1IQ5 A;  1OZS A;  3AKA A;  3TUY B;  2F3Z A;  2LMU A;  5AFP A;  2JTT A;  2M9G A;  4XJK A;  1YVL A;  2LHL A;  3TZ1 A;  2KI4 B;  1JUO A;  2OTG C;  2PVB A;  2BKI B;  1CM1 A;  1SYM A;  5AAN A;  3VRQ A;  2EC6 C;  1JF2 A;  4F0Z B;  2EGD A;  1PVA A;  1MF8 B;  1X02 A;  2LV7 A;  3TDZ A;  1OZO A;  5I8N A;  1Y1A A;  2K2A A;  1ZFS A;  2KNE A;  2L4I A;  2LCP A;  3DVK A;  3CS1 A;  2KFF A;  2JZI A;  2L4H A;  2GV5 A;  2MJW B;  4PHM A;  1KWO B;  2AAO A;  1SPY A;  1QXP A;  1G33 A;  1QV1 A;  2BEC A;  3TS5 C;  1IG5 A;  2L98 A;  1XFV O;  1OSA A;  2NCP A;  1B8L A;  2IS9 A;  4NQG A;  4ORA B;  2P6B B;  3AAK A;  3NSK A;  4CLN A;  1RJV A;  3CR5 X;  5I2Q A;  1J1E A;  3PAT A;  1K8U A;  2KGB C;  1QAS A;  1F55 A;  2F8P A;  1AJ4 A;  1B7T Z;  1LA0 A;  1UWO A;  3O6B A;  1D1O A;  1MUX A;  1TOP A;  2JT8 A;  1KQM C;  1XFW O;  1FPW A;  2BE4 A;  1V1G A;  2D8N A;  3D10 A;  1OMV A;  1CDN A;  2JUL A;  1K94 A;  2K7B A;  1SL8 A;  1YUR A;  4MLW A;  5CSF A;  4GAO A;  3KEV A;  1A75 A;  1B4C A;  4TNC A;  2M1K B;  4YI8 A;  2BL0 C;  3I5G B;  3GOF A;  1UHN A;  2KAV A;  4GFT A;  1CMF A;  4NDB A;  3I5H C;  4WRI A;  2I7A A;  5CSJ A;  1ALV A;  1K9K A;  1XFU O;  3DF0 A;  2PAL A;  1S5G Z;  1PAL A;  1EJ3 A;  3KF9 A;  4FTG A;  3VRP A;  2Y4Q A;  1KQV A;  1ZOT B;  1KFX S;  2E6W A;  5HLV A;  5AEQ A;  4YRU A;  1WDC B;  1K95 A;  2JU0 A;  2LP2 A;  1J7O A;  4MEW A;  1DJX A;  1PUL A;  3EVU A;  2A4J A;  2K7D A;  2R2I A;  1W7I B;  1BOD A;  4WQ2 A;  4MZL A;  3SG3 A;  3KHE A;  1BR4 B;  3D0Y A;  1BOC A;  1TNQ A;  1TNX A;  1MXL C;  1KK7 Y;  1K9P A;  2L51 A;  2OS8 B;  3EK8 A;  1TCF A;  4M2P A;  1A2X A;  1DJI A;  1QIV A;  1WLM A;  1HQV A;  1JBA A;  1QJT A;  2E30 A;  2F3Y A;  1BT6 A;  2ZKM X;  3VRN A;  3WHT B;  3ICB A;  1BF5 A;  3VGO A;  1IRJ A;  1MR8 A;  2M7N A;  1S3P A;  2MRD A;  2MLF C;  1L7Z A;  1MQ1 A;  1SR6 B;  2KI6 D;  1QVI Y;  2H2K A;  2KFG A;  3WHU B;  1C7W A;  4JWQ A;  1R2U A;  1XVJ A;  1UHJ A;  3BQ3 A;  1B8C A;  1F4O A;  2I2R E;  1JWD A;  1TN4 A;  4PAL A;  5KU1 A;  1ZUZ A;  4YGB B;  4XYN A;  2HF5 A;  4ETO A;  2HPS A;  1CB1 A;  1DJG A;  4C0J A;  2VRG A;  1NPQ A;  1UUR A;  2JC2 A;  1FF1 A;  2ZNE A;  1NYA A;  1IJ6 A;  2EHB A;  2KDH A;  2LMT A;  1SY9 A;  4DUQ A;  1XK4 C;  1FBV A;  3SG4 A;  3ZWH A;  2MBX A;  1Y0V H;  2JXC A;  1M63 B;  2CT9 A;  2ZN8 A;  3BUX B;  2JT3 A;  5B8I B;  1SRA A;  1WRZ A;  2K8M B;  1SCM C;  5D7F A;  3KO0 A;  3TUY C;  1KSO A;  3K21 A;  3EVV A;  3SG5 A;  5HYD A;  1DJH A;  1S6C A;  2LAN A;  1NX1 A;  1NWD A;  4P5O E;  4A4B A;  1IWQ A;  1U5I B;  1TCO B;  5KTY A;  1F54 A;  2KI4 C;  3NSO A;  3LK1 A;  2FCE A;  2BE6 A;  2KYF A;  2H61 C;  1NIW A;  3IQO A;  2HET A;  4I5J A;  1B8R A;  2CBL A;  1R6P A;  3FWB A;  1DGV A;  2LMV A;  1WRL A;  2G9B A;  4PE1 A;  1F71 A;  1JC2 A;  3OX6 A;  5F6T A;  1YX8 A;  2JXL A;  1KWO C;  1AP4 A;  3EKJ A;  1LXF C;  1QV0 A;  5GQQ C;  2KOT A;  2KBI A;  1BJF A;  4U8D A;  2SAS A;  1ZMZ A;  1LIN A;  3HCM A;  1BU3 A;  2Q4U A;  3OP0 A;  3LL8 B;  1NUB A;  2JNX A;  1M45 A;  2FCD A;  4AOM A;  1SNL A;  2COL B;  2LNK A;  2KQ6 A;  5CPV A;  4WQ3 A;  1TTX A;  1DGU A;  1SK6 D;  1DF0 A;  4PCW A;  4N1G A;  3JTD B;  2JPT A;  1AUI B;  3BUO B;  1DVI A;  2Y1N A;  3BOW B;  1CFF A;  3FWC A;  4UPG A;  3ZNI A;  4AQJ A;  2LC5 A;  1B7T Y;  1SKT A;  3CWG A;  3KPX A;  1NP8 A;  1EG4 A;  1FW4 A;  2M29 A;  2M49 B;  3C1V A;  1A03 A;  1JSA A;  3CTN A;  1GGZ A;  1CTR A;  3GK4 X;  4NDD A;  4MSP A;  1AVS A;  2LHI A;  1N2D A;  5ER4 X;  1WRK A;  2KI6 C;  3F45 A;  2O5G A;  1LA3 A;  4QJ5 B;  2JTZ A;  1IQ3 A;  3I5G C;  1MHO A;  1BLQ A;  1AK8 A;  2WC8 A;  4PE0 A;  5I2O A;  3I5F B;  4DIR A;  2K2F A;  1XK4 A;  1CDP A;  2KQY A;  2WCE A;  2B1U A;  2F33 A;  2QAC A;  2LVI A;  3OB2 B;  1GQM A;  5DKQ A;  1OE9 B;  1NX0 A;  1S5G Y;  1WDC C;  2AMI A;  1JF0 A;  1HT9 A;  1CFD A;  1J7R A;  4QJ4 B;  2KYC A;  3E3R A;  1XO5 A;  4GUK A;  2LVJ A;  4YGE B;  3RM1 A;  4P2Y B;  1OOJ A;  1MXE A;  1JFK A;  4OVN F;  4FQO A;  1F4Q A;  3OX5 A;  1G8I A;  3PFV A;  3PM8 A;  1C7V A;  4IL1 A;  5JOL A;  4CFR A;  1PRW A;  1CLL A;  2OS8 C;  2H61 A;  4HRG A;  1CLM A;  1XFY O;  4I5N B;  3BUN B;  4XJK B;  3I5H B;  4USL A;  4QJ3 B;  2G2B A;  1KSM A;  2AUC A;  5K89 A;  1PVB A;  2KAY A;  4GGN A;  1KK8 B;  4GNK B;  1CNP A;  1SR6 C;  2BBN A;  2CXJ A;  4MRY A;  1F8H A;  1OMR A;  3O4Y A;  1WLZ A;  1YR5 A;  4C0K A;  4JPZ B;  4DRW A;  4CFQ A;  2KAX A;  2WOS A;  2LP3 A;  3FIA A;  4OV2 A;  1CFC A;  1K9U A;  2LVK A;  4MZK A;  1CM4 A;  1UP5 A;  4NDC A;  5DKN A;  2KGR A;  3VRO A;  3SG7 A;  3DD4 A;  1JFJ A;  4GBA A;  2I94 A;  1K90 D;  1M46 A;  2CNP A;  3EK7 A;  4YGA A;  2M1U A;  2ZFD A;  2CCM A;  2LLS A;  1B47 A;  1NCY A;  2BCA A;  3CLN A;  2MA2 A;  1Y6W A;  1NCZ A;  2LUX A;  1RWY A;  4L9M A;  2LM5 A;  1L2O B;  1ODB A;  4C0L A;  3PLF B;  1RK9 A;  3PN7 B;  2RGI A;  4R1E A;  3BUM B;  2ZRT A;  1XFZ O;  1UUS A;  1YRT B;  1J7Q A;  3I5I B;  3DVM A;  3EK4 A;  4YBH B;  2M3W A;  2Y5I A;  2NLN A;  2SCP A;  1DJZ A;  2PAS A;  1A75 B;  2LLT A;  4PE7 A;  1RTP 1;  1N65 A;  1J7P A;  1KFX L;  1FI6 A;  2K7O A;  2ZRS A;  5ER5 A;  5TNC A;  1Y1U A;  1SW8 A;  2JNF A;  1TNW A;  1EL4 A;  1IKU A;  1PSR A;  3DF0 B;  3A8R A;  1A4P A;  5KSZ A;  1LVC D;  4Q04 A;  1CFP A;  2M7L A;  2L2E A;  4PHN A;  1DMO A;  1IH0 A;  4ZCV A;  2F2O A;  1SL9 A;  3JVT B;  3SIA A;  1CKK A;  4GGF C;  1GGW A;  1M39 A;  2NCO A;  4D1E A;  1G4Y R;  2PMY A;  1WY9 A;  2ZND A;  2JOJ A;  3WNX B;  1V1F A;  2KFH A;  3D0Y B;  5HLO A;  1KFU S;  1SCV A;  3NXA A;  3H4S E;  1EG3 A;  2OTG B;  2GGM A;  3JTD C;  3TDU A;  4PHK A;  1AJ5 A;  3WXA A;  2BCX A;  2EC6 B;  1NX2 A;  3DVE A;  1TRF A;  1NX3 A;  1BMO A;  1UHH A;  5HKZ A;  2O60 A;  2ISD A;  2KSP A;  1YVH A;  3EVR A;  2V53 A;  4I5K A;  1XYD A;  4MRX A;  4DCK A;  1S6J A;  4YI9 A;  1CMG A;  3M0W A;  4E68 A;  2NXQ A;  1PSB A;  1UHK A;  3TS5 B;  2M8U A;  3FS7 A;  5JJG A;  4BY4 A;  2DOQ A;  3HX4 A;  4N5X A;  3GK1 A;  3A4U B;  4OKH A;  3I5F C;  4A4C A;  5D69 A;  3CR4 X;  4MVF A;  3SJS A;  3CR2 A;  4PE4 A;  2L0P A;  2HQW A;  3TDI A;  4HRH A;  1XA5 A;  3O2P A;  2PRU A;  1YUU A;  3GK2 A;  1YTZ C;  1DTL A;  1DT7 B;  2WCF A;  3CZT X;  2LE9 B;  1W7J B;  1SL7 A;  3NSI A;  1KQM B;  1PK0 D;  4ORB B;  2MLE C;  1QX2 A;  1N0Y A;  2ZN9 A;  5BPJ A;  3LLE A;  1CLB A;  1K96 A;  3OHM B;  4YGD B;  1H4B A;  2JWW A;  2NZ0 A;  3BXK A;  1U5I A;  4M2Q A;  3IQQ A;  1E8A A;  1S36 A;  2M0R A;  1MWN A;  2MHH A;  3PSR A;  4ORC B;  4I5L B;  4AQI A;  1CDL A;  3RLZ A;  1YUT A;  1Q80 A;  1QX7 A;  3VRR A;  1J1D A;  2Y1M A;  2WCB A;  2K61 A;  2BL0 B;  2LAP A;  4JQ0 D;  4YGC B;  5IBW A;  1CDM A;  3LK0 A;  1OQP A;  3BYA A;  2BKH B;  3NSL A;  3CGA A;  2WOR A;  1KK8 C;  1EXR A;  1TNP A;  2GGZ A;  3AAJ A;  1YRU B;  3QRX A;  2HQ8 A;  1C07 A;  1QX5 B;  5J3X A;  4ICB A;  1J55 A;  1ZAC A;  4GGF A;  3MSE B;  4PDZ A;  2BBM A;  4HRE E;  5G08 A;  4CID A;  1KFU L;  1XFX O;  2LUC A;  2Q91 A;  2WND A;  5CSN A;  3LCP C;  2M97 A;  1KK7 Z;  3O78 A;  4CPV A;  1TIZ A;  1QS7 A;  3SIB A;  3BUW B;  4M2O A;  1S6I A;  3DVJ A;  1OMD A;  1YUS A;  5DKR A;  1ALW A;  2L5X B;  1IJ5 A;  4HSZ A;  3BOW A;  1RRO A;  1NCX A;  1NSH A;  1QTX A;  2FOT A;  1VRK A;  5HKW A;  1Y1X A;  2JT0 A;  5PAL A;  2FJU B;  4PHJ A;  2PSR A;  2JRF A;  1DJW A;  1EH2 A;  1DF0 B;  1QVI Z;  1REC A;  4MN0 A;  3SG6 A;  1QIW A;  2I18 A;  3AKB A;  3IF7 A;  1H8B A;  1L2O C;  2KHN A;  2QPT A;  5AER A;  1S26 D;  4OR9 B;  1UHI A;  1YX7 A;  1BG1 A;  1A29 A;  3PN7 C;  2L50 A;  1DJY A;  4DS7 A;  5I2L A;  1FI5 A;  5FYX A;  2OPO A;  1F70 A;  3I5I C;  2JQ6 A;  5AXI A;  1AHR A;  1QLS A;  1S1E A;  1SBJ A;  3EKH A;  3SG2 A;  4OCI A;  2TN4 A;  1K2H A;  2LVV A;  1BR1 B;  1K93 D;  4N1F A;  2LLU A; 
#chains in the Genus database with same CATH topology
 2MAZ A;  3OB1 B;  1LKJ A;  4BY5 A;  1IGV A;  1B1G A;  2P71 A;  4MZJ A;  1SMG A;  1GJY A;  5CSI A;  2F2P A;  4AOM A;  2K0J A;  3PAL A;  4OZD A;  1QLK A;  2CTN A;  2BCB A;  3VB1 A;  1M31 A;  3JVT C;  4MBE A;  2K7C A;  5HKY A;  2KBM A;  1QAT A;  4ZCU A;  1B9A A;  1SCM B;  1RFJ A;  1KCY A;  4GPL B;  1IQ5 A;  1OZS A;  3AKA A;  3TUY B;  2F3Z A;  2L2C A;  2LMU A;  5AFP A;  2JTT A;  2M9G A;  4XJK A;  1YVL A;  2LHL A;  3TZ1 A;  2WC5 A;  2KI4 B;  1JUO A;  2OTG C;  2PVB A;  2BKI B;  1CM1 A;  1SYM A;  5AAN A;  3VRQ A;  2EC6 C;  1JF2 A;  4F0Z B;  2EGD A;  1PVA A;  2JPO A;  1MF8 B;  1X02 A;  2LV7 A;  3TDZ A;  1OZO A;  5I8N A;  1Y1A A;  2BNX A;  2K2A A;  1ZFS A;  2KNE A;  2L4I A;  2LCP A;  3DVK A;  3CS1 A;  2KFF A;  2JZI A;  2L4H A;  2GV5 A;  2MJW B;  4PHM A;  1KWO B;  2AAO A;  1SPY A;  1QXP A;  1G33 A;  1QV1 A;  2BEC A;  3TS5 C;  1IG5 A;  2L98 A;  1XFV O;  1OSA A;  2NCP A;  1B8L A;  2IS9 A;  4NQG A;  2L5Y A;  3SS5 A;  4ORA B;  2P6B B;  3AAK A;  3NSK A;  1LS8 A;  4CLN A;  1RJV A;  3CR5 X;  5I2Q A;  1J1E A;  3PAT A;  1K8U A;  2KGB C;  1QAS A;  1F55 A;  2F8P A;  1AJ4 A;  1B7T Z;  1LA0 A;  1UWO A;  3O6B A;  1D1O A;  1MUX A;  1TOP A;  2JT8 A;  1KQM C;  1XFW O;  1FPW A;  3R1V A;  3CAB A;  2BAP A;  2BE4 A;  2QEB A;  1V1G A;  2D8N A;  1P28 A;  3D10 A;  1OMV A;  1CDN A;  2JUL A;  1K94 A;  2K7B A;  1SL8 A;  3UNW A;  1YUR A;  4MLW A;  5CSF A;  1OOH A;  4GAO A;  4IJ7 A;  2H8V A;  3KEV A;  1A75 A;  1B4C A;  2WCM A;  4TNC A;  2M1K B;  4YI8 A;  2BL0 C;  3D77 A;  3I5G B;  3GOF A;  3NHI A;  1UHN A;  2KAV A;  3EG5 B;  4GFT A;  1CMF A;  4NDB A;  3I5H C;  4WRI A;  2I7A A;  5CSJ A;  1ALV A;  1K9K A;  1XFU O;  3DF0 A;  2PAL A;  4JD9 A;  1S5G Z;  1PAL A;  1EJ3 A;  3KF9 A;  4FTG A;  3VRP A;  2Y4Q A;  1KQV A;  3K1E A;  1ZOT B;  1KFX S;  2E6W A;  5HLV A;  5AEQ A;  4YRU A;  5I94 A;  2QEH A;  1WDC B;  1K95 A;  2JU0 A;  2LP2 A;  4INX A;  4MEW A;  1J7O A;  1DJX A;  1PUL A;  3R1P A;  3EVU A;  3CDN A;  2A4J A;  2ERB A;  2K7D A;  2R2I A;  1W7I B;  1BOD A;  5EL2 A;  4WQ2 A;  4MZL A;  3SG3 A;  3KHE A;  1BR4 B;  3D0Y A;  3L47 A;  1BOC A;  1TNQ A;  1TNX A;  1MXL C;  1KK7 Y;  1K9P A;  2L51 A;  2OS8 B;  3EK8 A;  1TCF A;  4M2P A;  1A2X A;  1DJI A;  1QIV A;  1WLM A;  1HQV A;  1JBA A;  1QJT A;  2E30 A;  2F3Y A;  1DEK A;  1BT6 A;  2QEV A;  2ZKM X;  3VRN A;  3WHT B;  3ICB A;  3S0F A;  1TUZ A;  3VGO A;  1BF5 A;  1IRJ A;  1MR8 A;  2M7N A;  1S3P A;  2KLE A;  4F7F A;  2MRD A;  2QEO A;  3CZ2 A;  2MLF C;  1L7Z A;  1MQ1 A;  2PYQ A;  1SR6 B;  1Z2C B;  1QVI Y;  2H2K A;  2KI6 D;  2KFG A;  3WHU B;  1C7W A;  3FE6 A;  4JWQ A;  1R2U A;  1XVJ A;  1UHJ A;  3BQ3 A;  1B8C A;  2K60 A;  1F4O A;  2I2R E;  1JWD A;  1TN4 A;  3BFA A;  4PAL A;  5KU1 A;  1ZUZ A;  4YGB B;  4XYN A;  2HF5 A;  4ETO A;  3D78 A;  2HPS A;  3OBV A;  1CB1 A;  1DJG A;  4C0J A;  2VRG A;  1NPQ A;  1UUR A;  2JC2 A;  3NGV A;  1FF1 A;  2ZNE A;  1NYA A;  1IJ6 A;  2EHB A;  2KDH A;  2KLD A;  3SS3 A;  2LMT A;  1SY9 A;  4DUQ A;  1XK4 C;  2QDI A;  1FBV A;  2FJY A;  3BFH A;  3SG4 A;  3ZWH A;  2MBX A;  1Y0V H;  2JXC A;  3B86 A;  1M63 B;  2CT9 A;  2ZN8 A;  3BUX B;  2JT3 A;  5B8I B;  1SRA A;  1WRZ A;  2K8M B;  1SCM C;  3D75 A;  5D7F A;  3KO0 A;  3TUY C;  1KSO A;  3K21 A;  3EVV A;  3SG5 A;  5HYD A;  1DJH A;  1S6C A;  2LAN A;  1NX1 A;  1NWD A;  4P5O E;  4A4B A;  1IWQ A;  1U5I B;  1TCO B;  5KTY A;  1F54 A;  2KI4 C;  3NSO A;  3LK1 A;  2FCE A;  2BE6 A;  2KYF A;  2H61 C;  3B87 A;  1NIW A;  3IQO A;  2HET A;  4I5J A;  3QME A;  5HL1 A;  1B8R A;  2CBL A;  1R6P A;  3FWB A;  1DGV A;  3N7H A;  2LMV A;  1WRL A;  2G9B A;  3V2L A;  4PE1 A;  1C3Z A;  5DIC A;  1F71 A;  1JC2 A;  3OX6 A;  5F6T A;  1YX8 A;  2JXL A;  1KWO C;  1AP4 A;  3EKJ A;  1LXF C;  1QV0 A;  5GQQ C;  2KOT A;  2KBI A;  1BJF A;  4U8D A;  2SAS A;  1ZMZ A;  3S0G A;  1LIN A;  1W9Z A;  1BU3 A;  3HCM A;  2Q4U A;  3SS4 A;  3OP0 A;  3L4L A;  3LL8 B;  1NUB A;  2JNX A;  1M45 A;  2FCD A;  4PT1 A;  1SNL A;  2COL B;  2LNK A;  2KQ6 A;  5CPV A;  1T14 A;  4WQ3 A;  1TTX A;  1DGU A;  1SK6 D;  1DF0 A;  4PCW A;  4N1G A;  3JTD B;  2JPT A;  1AUI B;  3BUO B;  1DVI A;  2Y1N A;  3BOW B;  3R72 A;  1CFF A;  3FWC A;  4UPG A;  3ZNI A;  4AQJ A;  2LC5 A;  1B7T Y;  1SKT A;  3CWG A;  3KPX A;  1NP8 A;  1EG4 A;  1FW4 A;  2M29 A;  2M49 B;  3C1V A;  1DC1 A;  1A03 A;  1JSA A;  3CTN A;  1GGZ A;  1CTR A;  3GK4 X;  4NDD A;  4MSP A;  3S0E A;  1AVS A;  2LHI A;  1N2D A;  5ER4 X;  1WRK A;  2KI6 C;  3F45 A;  2O5G A;  1LA3 A;  4QJ5 B;  2JTZ A;  1IQ3 A;  3I5G C;  1MHO A;  1BLQ A;  1AK8 A;  2WC8 A;  4PE0 A;  5I2O A;  1SSE B;  3I5F B;  3L4A A;  4DIR A;  2K2F A;  1XK4 A;  1CDP A;  2KQY A;  2WCE A;  2B1U A;  2F33 A;  2QAC A;  2LVI A;  3OB2 B;  1GQM A;  5DKQ A;  1OE9 B;  1NX0 A;  1S5G Y;  1WDC C;  3NHT A;  2AMI A;  1JF0 A;  1HT9 A;  4FQT A;  1CFD A;  1J7R A;  4QJ4 B;  2KYC A;  3E3R A;  1XO5 A;  4GUK A;  2LVJ A;  4YGE B;  3RM1 A;  4P2Y B;  1OOJ A;  5FI6 A;  1MXE A;  1JFK A;  4OVN F;  4FQO A;  3B7A A;  1F4Q A;  3OX5 A;  1G8I A;  3PFV A;  3PM8 A;  1C7V A;  4IL1 A;  5JOL A;  4CFR A;  1PRW A;  1CLL A;  1QWV A;  4JKT A;  2OS8 C;  2H61 A;  4HRG A;  1CLM A;  1GM0 A;  1XFY O;  4I5N B;  3BUN B;  4XJK B;  3I5H B;  4USL A;  4QJ3 B;  2G2B A;  1KSM A;  2AUC A;  5K89 A;  1PVB A;  1OOF A;  2KAY A;  3OGN A;  4GGN A;  1KK8 B;  4GNK B;  1CNP A;  3BFB A;  1SR6 C;  1OW4 A;  1OOI X;  2BBN A;  2CXJ A;  3CZ0 A;  4MRY A;  1F8H A;  1OMR A;  3O4Y A;  1WLZ A;  1YR5 A;  4C0K A;  4JPZ B;  5FI2 A;  4DRW A;  4CFQ A;  2KAX A;  2WOS A;  2LP3 A;  3FIA A;  4OV2 A;  1CFC A;  1K9U A;  2LVK A;  2WC6 A;  3CZ1 A;  1CM4 A;  1UP5 A;  4MZK A;  4NDC A;  5DKN A;  2KGR A;  1OOG A;  3VRO A;  3SG7 A;  2KPH A;  3DD4 A;  1JFJ A;  3D74 A;  4GBA A;  1TUJ A;  2I94 A;  1K90 D;  1M46 A;  2CNP A;  3EK7 A;  2WCH A;  4YGA A;  2M1U A;  2ZFD A;  2CCM A;  2LLS A;  1B47 A;  1NCY A;  2BCA A;  3CLN A;  2MA2 A;  1Y6W A;  1NCZ A;  2LUX A;  1RWY A;  4L9M A;  2LM5 A;  1L2O B;  1ODB A;  4C0L A;  3PLF B;  1RK9 A;  4INW A;  3PN7 B;  2RGI A;  4R1E A;  3BUM B;  2ZRT A;  1XFZ O;  1UUS A;  1YRT B;  1J7Q A;  1TWO A;  3I5I B;  3DVM A;  3EK4 A;  4YBH B;  2M3W A;  2Y5I A;  3S0A A;  2NLN A;  2SCP A;  1DJZ A;  2PAS A;  1A75 B;  2LLT A;  3DYE A;  4PE7 A;  1RTP 1;  3D76 A;  1N65 A;  1J7P A;  1KFX L;  1FI6 A;  2K7O A;  2ZRS A;  5ER5 A;  5TNC A;  1Y1U A;  1SW8 A;  3B6X A;  2JNF A;  2WCJ A;  2YGU A;  1TNW A;  1EL4 A;  1IKU A;  1PSR A;  3DF0 B;  3A8R A;  1A4P A;  5KSZ A;  1LVC D;  4Q04 A;  1CFP A;  2M7L A;  2L2E A;  1Z4H A;  4PHN A;  1DMO A;  1IH0 A;  4ZCV A;  2F2O A;  1SL9 A;  3JVT B;  3SIA A;  1CKK A;  4GGF C;  1GGW A;  1M39 A;  2NCO A;  4D1E A;  1G4Y R;  2PMY A;  1WY9 A;  2ZND A;  2JOJ A;  3WNX B;  3UO9 A;  1V1F A;  2KFH A;  3D0Y B;  5HLO A;  1KFU S;  1SCV A;  5D3O A;  3NXA A;  3H4S E;  1C3Y A;  1EG3 A;  2OTG B;  3BJH A;  2GGM A;  3JTD C;  3TDU A;  4PHK A;  1AJ5 A;  3WXA A;  2BCX A;  2EC6 B;  1NX2 A;  3DVE A;  3FE8 A;  1TRF A;  1NX3 A;  1BMO A;  1UHH A;  2PQL A;  5HKZ A;  2O60 A;  2ISD A;  1DQE A;  2KSP A;  1YVH A;  3EVR A;  2V53 A;  4I5K A;  1XYD A;  4MRX A;  4DCK A;  1S6J A;  4YI9 A;  1CMG A;  3M0W A;  4E68 A;  2NXQ A;  1PSB A;  1UHK A;  4KYN A;  2M8U A;  3FS7 A;  3TS5 B;  5JJG A;  4BY4 A;  2DOQ A;  3HX4 A;  3PM2 A;  3GK1 A;  3A4U B;  4N5X A;  4OKH A;  3O4X A;  3I5F C;  3S0B A;  4A4C A;  5D69 A;  3CR4 X;  3IVT A;  4MVF A;  3SJS A;  3CR2 A;  4PE4 A;  2L0P A;  2HQW A;  3TDI A;  4HRH A;  1XA5 A;  3O2P A;  2PRU A;  1YUU A;  3GK2 A;  1YTZ C;  1DTL A;  1DT7 B;  2WCF A;  3CZT X;  2LE9 B;  1W7J B;  1SL7 A;  3DXL A;  1KQM B;  1PK0 D;  3NSI A;  4ORB B;  2MLE C;  1QX2 A;  1N0Y A;  2ZN9 A;  5BPJ A;  2GTE A;  3LLE A;  1CLB A;  1K96 A;  3OHM B;  4YGD B;  1H4B A;  2JWW A;  2NZ0 A;  3BXK A;  1U5I A;  4M2Q A;  3IQQ A;  1E8A A;  1S36 A;  2M0R A;  1MWN A;  2MHH A;  3PSR A;  4ORC B;  3S0D A;  4I5L B;  4AQI A;  1CDL A;  3RLZ A;  1YUT A;  1Q80 A;  1QX7 A;  3VRR A;  1J1D A;  2Y1M A;  2WCB A;  2K61 A;  2BL0 B;  2LAP A;  4JQ0 D;  4YGC B;  5IBW A;  1CDM A;  3LK0 A;  1OQP A;  3BYA A;  2BKH B;  3NSL A;  3CYZ A;  3CGA A;  2WOR A;  3RZS A;  1KK8 C;  1EXR A;  1TNP A;  2GGZ A;  3AAJ A;  1YRU B;  3QRX A;  2HQ8 A;  1C07 A;  3DZT A;  1QX5 B;  5J3X A;  4ICB A;  2WCK A;  3DY9 A;  1J55 A;  1ZAC A;  4GGF A;  3MSE B;  4PDZ A;  2BBM A;  4HRE E;  5G08 A;  4CID A;  1ORG A;  1KFU L;  1XFX O;  2LUC A;  2Q91 A;  2WND A;  5CSN A;  3LCP C;  2M97 A;  5FI7 A;  1KK7 Z;  3O78 A;  4CPV A;  1TIZ A;  1QS7 A;  3SIB A;  3BUW B;  4M2O A;  1S6I A;  3DVJ A;  1OMD A;  1YUS A;  5DKR A;  1ALW A;  2L5X B;  1IJ5 A;  4HSZ A;  3BOW A;  1RRO A;  3Q8I A;  1NCX A;  1NSH A;  1QTX A;  2FOT A;  1VRK A;  5HKW A;  1Y1X A;  2JT0 A;  2P70 A;  2FJU B;  5PAL A;  4PHJ A;  2PSR A;  2JRF A;  1DJW A;  1EH2 A;  1DF0 B;  1QVI Z;  1REC A;  3D73 A;  4MN0 A;  3SG6 A;  1QIW A;  3FE9 A;  2I18 A;  3AKB A;  3IF7 A;  1H8B A;  1L2O C;  2KHN A;  2QPT A;  1IIO A;  5AER A;  1S26 D;  4OR9 B;  1UHI A;  1YX7 A;  1DEL A;  3B88 A;  1BG1 A;  1A29 A;  3PN7 C;  2L50 A;  1DJY A;  2WCL A;  4DS7 A;  5I2L A;  1FI5 A;  5FYX A;  2OPO A;  1F70 A;  3I5I C;  2JQ6 A;  5AXI A;  3PJI A;  1AHR A;  1QLS A;  1XFR A;  1S1E A;  1SBJ A;  3EKH A;  3SG2 A;  4OCI A;  3R1O A;  2TN4 A;  1K2H A;  2LVV A;  1BR1 B;  1K93 D;  4N1F A;  2LLU A; 
#chains in the Genus database with same CATH homology
 2MAZ A;  3OB1 B;  1LKJ A;  4BY5 A;  1IGV A;  1B1G A;  4MZJ A;  1SMG A;  1GJY A;  5CSI A;  2F2P A;  2K0J A;  3PAL A;  1QLK A;  2CTN A;  2BCB A;  1M31 A;  3JVT C;  4MBE A;  2K7C A;  5HKY A;  2KBM A;  1QAT A;  4ZCU A;  1B9A A;  1SCM B;  1RFJ A;  1KCY A;  4GPL B;  1IQ5 A;  1OZS A;  3AKA A;  3TUY B;  2F3Z A;  2LMU A;  5AFP A;  2JTT A;  2M9G A;  4XJK A;  1YVL A;  2LHL A;  3TZ1 A;  2KI4 B;  1JUO A;  2OTG C;  2PVB A;  2BKI B;  1CM1 A;  1SYM A;  5AAN A;  3VRQ A;  2EC6 C;  1JF2 A;  4F0Z B;  2EGD A;  1PVA A;  1MF8 B;  1X02 A;  2LV7 A;  3TDZ A;  1OZO A;  5I8N A;  1Y1A A;  2K2A A;  1ZFS A;  2KNE A;  2L4I A;  2LCP A;  3DVK A;  3CS1 A;  2KFF A;  2JZI A;  2L4H A;  2GV5 A;  2MJW B;  4PHM A;  1KWO B;  2AAO A;  1SPY A;  1QXP A;  1G33 A;  1QV1 A;  2BEC A;  3TS5 C;  1IG5 A;  2L98 A;  1XFV O;  1OSA A;  2NCP A;  1B8L A;  2IS9 A;  4NQG A;  4ORA B;  2P6B B;  3AAK A;  3NSK A;  4CLN A;  1RJV A;  3CR5 X;  5I2Q A;  1J1E A;  3PAT A;  1K8U A;  2KGB C;  1QAS A;  1F55 A;  2F8P A;  1AJ4 A;  1B7T Z;  1LA0 A;  1UWO A;  3O6B A;  1D1O A;  1MUX A;  1TOP A;  2JT8 A;  1KQM C;  1XFW O;  1FPW A;  2BE4 A;  1V1G A;  2D8N A;  3D10 A;  1OMV A;  1CDN A;  2JUL A;  1K94 A;  2K7B A;  1SL8 A;  1YUR A;  4MLW A;  5CSF A;  4GAO A;  3KEV A;  1A75 A;  1B4C A;  4TNC A;  2M1K B;  4YI8 A;  2BL0 C;  3I5G B;  3GOF A;  1UHN A;  2KAV A;  4GFT A;  1CMF A;  4NDB A;  3I5H C;  4WRI A;  2I7A A;  5CSJ A;  1ALV A;  1K9K A;  1XFU O;  3DF0 A;  2PAL A;  1S5G Z;  1PAL A;  1EJ3 A;  3KF9 A;  4FTG A;  3VRP A;  2Y4Q A;  1KQV A;  1ZOT B;  1KFX S;  2E6W A;  5HLV A;  5AEQ A;  4YRU A;  1WDC B;  1K95 A;  2JU0 A;  2LP2 A;  1J7O A;  4MEW A;  1DJX A;  1PUL A;  3EVU A;  2A4J A;  2K7D A;  2R2I A;  1W7I B;  1BOD A;  4WQ2 A;  4MZL A;  3SG3 A;  3KHE A;  1BR4 B;  3D0Y A;  1BOC A;  1TNQ A;  1TNX A;  1MXL C;  1KK7 Y;  1K9P A;  2L51 A;  2OS8 B;  3EK8 A;  1TCF A;  4M2P A;  1A2X A;  1DJI A;  1QIV A;  1WLM A;  1HQV A;  1JBA A;  1QJT A;  2E30 A;  2F3Y A;  1BT6 A;  2ZKM X;  3VRN A;  3WHT B;  3ICB A;  1BF5 A;  3VGO A;  1IRJ A;  1MR8 A;  2M7N A;  1S3P A;  2MRD A;  2MLF C;  1L7Z A;  1MQ1 A;  1SR6 B;  2KI6 D;  1QVI Y;  2H2K A;  2KFG A;  3WHU B;  1C7W A;  4JWQ A;  1R2U A;  1XVJ A;  1UHJ A;  3BQ3 A;  1B8C A;  1F4O A;  2I2R E;  1JWD A;  1TN4 A;  4PAL A;  5KU1 A;  1ZUZ A;  4YGB B;  4XYN A;  2HF5 A;  4ETO A;  2HPS A;  1CB1 A;  1DJG A;  4C0J A;  2VRG A;  1NPQ A;  1UUR A;  2JC2 A;  1FF1 A;  2ZNE A;  1NYA A;  1IJ6 A;  2EHB A;  2KDH A;  2LMT A;  1SY9 A;  4DUQ A;  1XK4 C;  1FBV A;  3SG4 A;  3ZWH A;  2MBX A;  1Y0V H;  2JXC A;  1M63 B;  2CT9 A;  2ZN8 A;  3BUX B;  2JT3 A;  5B8I B;  1SRA A;  1WRZ A;  2K8M B;  1SCM C;  5D7F A;  3KO0 A;  3TUY C;  1KSO A;  3K21 A;  3EVV A;  3SG5 A;  5HYD A;  1DJH A;  1S6C A;  2LAN A;  1NX1 A;  1NWD A;  4P5O E;  4A4B A;  1IWQ A;  1U5I B;  1TCO B;  5KTY A;  1F54 A;  2KI4 C;  3NSO A;  3LK1 A;  2FCE A;  2BE6 A;  2KYF A;  2H61 C;  1NIW A;  3IQO A;  2HET A;  4I5J A;  1B8R A;  2CBL A;  1R6P A;  3FWB A;  1DGV A;  2LMV A;  1WRL A;  2G9B A;  4PE1 A;  1F71 A;  1JC2 A;  3OX6 A;  5F6T A;  1YX8 A;  2JXL A;  1KWO C;  1AP4 A;  3EKJ A;  1LXF C;  1QV0 A;  5GQQ C;  2KOT A;  2KBI A;  1BJF A;  4U8D A;  2SAS A;  1ZMZ A;  1LIN A;  3HCM A;  1BU3 A;  2Q4U A;  3OP0 A;  3LL8 B;  1NUB A;  2JNX A;  1M45 A;  2FCD A;  4AOM A;  1SNL A;  2COL B;  2LNK A;  2KQ6 A;  5CPV A;  4WQ3 A;  1TTX A;  1DGU A;  1SK6 D;  1DF0 A;  4PCW A;  4N1G A;  3JTD B;  2JPT A;  1AUI B;  3BUO B;  1DVI A;  2Y1N A;  3BOW B;  1CFF A;  3FWC A;  4UPG A;  3ZNI A;  4AQJ A;  2LC5 A;  1B7T Y;  1SKT A;  3CWG A;  3KPX A;  1NP8 A;  1EG4 A;  1FW4 A;  2M29 A;  2M49 B;  3C1V A;  1A03 A;  1JSA A;  3CTN A;  1GGZ A;  1CTR A;  3GK4 X;  4NDD A;  4MSP A;  1AVS A;  2LHI A;  1N2D A;  5ER4 X;  1WRK A;  2KI6 C;  3F45 A;  2O5G A;  1LA3 A;  4QJ5 B;  2JTZ A;  1IQ3 A;  3I5G C;  1MHO A;  1BLQ A;  1AK8 A;  2WC8 A;  4PE0 A;  5I2O A;  3I5F B;  4DIR A;  2K2F A;  1XK4 A;  1CDP A;  2KQY A;  2WCE A;  2B1U A;  2F33 A;  2QAC A;  2LVI A;  3OB2 B;  1GQM A;  5DKQ A;  1OE9 B;  1NX0 A;  1S5G Y;  1WDC C;  2AMI A;  1JF0 A;  1HT9 A;  1CFD A;  1J7R A;  4QJ4 B;  2KYC A;  3E3R A;  1XO5 A;  4GUK A;  2LVJ A;  4YGE B;  3RM1 A;  4P2Y B;  1OOJ A;  1MXE A;  1JFK A;  4OVN F;  4FQO A;  1F4Q A;  3OX5 A;  1G8I A;  3PFV A;  3PM8 A;  1C7V A;  4IL1 A;  5JOL A;  4CFR A;  1PRW A;  1CLL A;  2OS8 C;  2H61 A;  4HRG A;  1CLM A;  1XFY O;  4I5N B;  3BUN B;  4XJK B;  3I5H B;  4USL A;  4QJ3 B;  2G2B A;  1KSM A;  2AUC A;  5K89 A;  1PVB A;  2KAY A;  4GGN A;  1KK8 B;  4GNK B;  1CNP A;  1SR6 C;  2BBN A;  2CXJ A;  4MRY A;  1F8H A;  1OMR A;  3O4Y A;  1WLZ A;  1YR5 A;  4C0K A;  4JPZ B;  4DRW A;  4CFQ A;  2KAX A;  2WOS A;  2LP3 A;  3FIA A;  4OV2 A;  1CFC A;  1K9U A;  2LVK A;  4MZK A;  1CM4 A;  1UP5 A;  4NDC A;  5DKN A;  2KGR A;  3VRO A;  3SG7 A;  3DD4 A;  1JFJ A;  4GBA A;  2I94 A;  1K90 D;  1M46 A;  2CNP A;  3EK7 A;  4YGA A;  2M1U A;  2ZFD A;  2CCM A;  2LLS A;  1B47 A;  1NCY A;  2BCA A;  3CLN A;  2MA2 A;  1Y6W A;  1NCZ A;  2LUX A;  1RWY A;  4L9M A;  2LM5 A;  1L2O B;  1ODB A;  4C0L A;  3PLF B;  1RK9 A;  3PN7 B;  2RGI A;  4R1E A;  3BUM B;  2ZRT A;  1XFZ O;  1UUS A;  1YRT B;  1J7Q A;  3I5I B;  3DVM A;  3EK4 A;  4YBH B;  2M3W A;  2Y5I A;  2NLN A;  2SCP A;  1DJZ A;  2PAS A;  1A75 B;  2LLT A;  4PE7 A;  1RTP 1;  1N65 A;  1J7P A;  1KFX L;  1FI6 A;  2K7O A;  2ZRS A;  5ER5 A;  5TNC A;  1Y1U A;  1SW8 A;  2JNF A;  1TNW A;  1EL4 A;  1IKU A;  1PSR A;  3DF0 B;  3A8R A;  1A4P A;  5KSZ A;  1LVC D;  4Q04 A;  1CFP A;  2M7L A;  2L2E A;  4PHN A;  1DMO A;  1IH0 A;  4ZCV A;  2F2O A;  1SL9 A;  3JVT B;  3SIA A;  1CKK A;  4GGF C;  1GGW A;  1M39 A;  2NCO A;  4D1E A;  1G4Y R;  2PMY A;  1WY9 A;  2ZND A;  2JOJ A;  3WNX B;  1V1F A;  2KFH A;  3D0Y B;  5HLO A;  1KFU S;  1SCV A;  3NXA A;  3H4S E;  1EG3 A;  2OTG B;  2GGM A;  3JTD C;  3TDU A;  4PHK A;  1AJ5 A;  3WXA A;  2BCX A;  2EC6 B;  1NX2 A;  3DVE A;  1TRF A;  1NX3 A;  1BMO A;  1UHH A;  5HKZ A;  2O60 A;  2ISD A;  2KSP A;  1YVH A;  3EVR A;  2V53 A;  4I5K A;  1XYD A;  4MRX A;  4DCK A;  1S6J A;  4YI9 A;  1CMG A;  3M0W A;  4E68 A;  2NXQ A;  1PSB A;  1UHK A;  3TS5 B;  2M8U A;  3FS7 A;  5JJG A;  4BY4 A;  2DOQ A;  3HX4 A;  4N5X A;  3GK1 A;  3A4U B;  4OKH A;  3I5F C;  4A4C A;  5D69 A;  3CR4 X;  4MVF A;  3SJS A;  3CR2 A;  4PE4 A;  2L0P A;  2HQW A;  3TDI A;  4HRH A;  1XA5 A;  3O2P A;  2PRU A;  1YUU A;  3GK2 A;  1YTZ C;  1DTL A;  1DT7 B;  2WCF A;  3CZT X;  2LE9 B;  1W7J B;  1SL7 A;  3NSI A;  1KQM B;  1PK0 D;  4ORB B;  2MLE C;  1QX2 A;  1N0Y A;  2ZN9 A;  5BPJ A;  3LLE A;  1CLB A;  1K96 A;  3OHM B;  4YGD B;  1H4B A;  2JWW A;  2NZ0 A;  3BXK A;  1U5I A;  4M2Q A;  3IQQ A;  1E8A A;  1S36 A;  2M0R A;  1MWN A;  2MHH A;  3PSR A;  4ORC B;  4I5L B;  4AQI A;  1CDL A;  3RLZ A;  1YUT A;  1Q80 A;  1QX7 A;  3VRR A;  1J1D A;  2Y1M A;  2WCB A;  2K61 A;  2BL0 B;  2LAP A;  4JQ0 D;  4YGC B;  5IBW A;  1CDM A;  3LK0 A;  1OQP A;  3BYA A;  2BKH B;  3NSL A;  3CGA A;  2WOR A;  1KK8 C;  1EXR A;  1TNP A;  2GGZ A;  3AAJ A;  1YRU B;  3QRX A;  2HQ8 A;  1C07 A;  1QX5 B;  5J3X A;  4ICB A;  1J55 A;  1ZAC A;  4GGF A;  3MSE B;  4PDZ A;  2BBM A;  4HRE E;  5G08 A;  4CID A;  1KFU L;  1XFX O;  2LUC A;  2Q91 A;  2WND A;  5CSN A;  3LCP C;  2M97 A;  1KK7 Z;  3O78 A;  4CPV A;  1TIZ A;  1QS7 A;  3SIB A;  3BUW B;  4M2O A;  1S6I A;  3DVJ A;  1OMD A;  1YUS A;  5DKR A;  1ALW A;  2L5X B;  1IJ5 A;  4HSZ A;  3BOW A;  1RRO A;  1NCX A;  1NSH A;  1QTX A;  2FOT A;  1VRK A;  5HKW A;  1Y1X A;  2JT0 A;  5PAL A;  2FJU B;  4PHJ A;  2PSR A;  2JRF A;  1DJW A;  1EH2 A;  1DF0 B;  1QVI Z;  1REC A;  4MN0 A;  3SG6 A;  1QIW A;  2I18 A;  3AKB A;  3IF7 A;  1H8B A;  1L2O C;  2KHN A;  2QPT A;  5AER A;  1S26 D;  4OR9 B;  1UHI A;  1YX7 A;  1BG1 A;  1A29 A;  3PN7 C;  2L50 A;  1DJY A;  4DS7 A;  5I2L A;  1FI5 A;  5FYX A;  2OPO A;  1F70 A;  3I5I C;  2JQ6 A;  5AXI A;  1AHR A;  1QLS A;  1S1E A;  1SBJ A;  3EKH A;  3SG2 A;  4OCI A;  2TN4 A;  1K2H A;  2LVV A;  1BR1 B;  1K93 D;  4N1F A;  2LLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...