2M49B

Structural insights into human s100b and basic fibroblast growth factor (fgf2) interaction
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
91
structure length
91
Chain Sequence
b'SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 2
publication title Structural insights into the interaction of human S100B and basic fibroblast growth factor (FGF2): Effects on FGFR1 receptor signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/metal binding protein
total genus 26
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m49B00
4AQIA 1TNQA 3KO0A 4NDDA 5KTYA 1R2UA 1XFVO 1BF5A 2CBLA 2NXQA 3CTNA 3DVJA 1AP4A 4OVNF 3D0YB 1KSOA 1FF1A 1TNXA 2JULA 1QS7A 2A4JA 2HF5A 4DIRA 1G33A 2F3YA 1JC2A 1IH0A 1YTZC 5KU1A 2LVVA 1PK0D 1TCOB 1CMGA 1KWOB 3BOWA 2L2EA 4BY5A 2GGMA 4QJ4B 1RTP1 1QJTA 3TZ1A 2EC6C 3MSEB 2NCPA 1GJYA 2F2OA 2JNXA 4A4CA 1DJGA 1CTRA 1UHJA 2B1UA 2KBMA 1OZOA 2M0RA 2PVBA 2WC8A 2FCEA 5I8NA 1B8CA 2JQ6A 1HT9A 1M63B 1NYAA 2DOQA 2JT3A 3NSIA 1RJVA 1BLQA 2BE6A 2KFGA 2M29A 3A8RA 1L7ZA 2F33A 4A4BA 1OSAA 2PRUA 5HLVA 2BL0B 1W7IB 1ZMZA 4IL1A 4PALA 2LMTA 4HRGA 4YGAA 4Q04A 1S5GY 1XFWO 1ZACA 1QIVA 2ZNDA 3EKHA 4WRIA 3TUYB 1FPWA 1SKTA 4E68A 3PN7C 1BG1A 1YUTA 3OB1B 1A75A 2FJUB 3EKJA 1M31A 1DTLA 1UHKA 4D1EA 4GNKB 4L9MA 3KEVA 1CDNA 2IS9A 5CSJA 1EG4A 4N1FA 2KI4B 2LHLA 2BKHB 5DKRA 3D0YA 2CTNA 1KCYA 1S36A 3HCMA 4TNCA 4CPVA 1L2OB 1GGWA 3AKAA 3PLFB 4I5JA 5I2LA 2KYCA 1Y6WA 4M2PA 4HREE 1MHOA 3OX6A 3KF9A 4NDCA 1EG3A 3BUMB 3BUOB 4JQ0D 2ISDA 1TIZA 1MWNA 1QASA 3O78A 5PALA 2AMIA 5CSNA 5FYXA 3VGOA 2PSRA 3PM8A 2MJWB 2E6WA 3NSOA 3GOFA 1OOJA 1KFXS 3AKBA 3OB2B 3FIAA 1QVIZ 2OPOA 4WQ2A 5CPVA 3TS5B 1S6CA 2MLEC 1YUUA 1XFUO 2KQ6A 1N2DA 1CM1A 1M45A 2M3WA 2M49B 2PASA 2K8MB 4PHJA 4C0LA 2QPTA 1S6IA 2K7OA 1MR8A 1DMOA 3PFVA 4CLNA 2PMYA 1YX7A 4JWQA 4NQGA 1J1DA 2L4HA 1GGZA 4MLWA 1CM4A 1NCXA 2KAVA 3BOWB 2MAZA 2MRDA 3AAJA 4CFRA 2VRGA 1SR6B 1CFPA 1K94A 4P5OE 2JU0A 3DF0B 2OS8C 2K7DA 2KDHA 1BJFA 5D7FA 1KQMC 1XFXO 4MZLA 3OP0A 4GPLB 2WCBA 4PCWA 3O6BA 3IF7A 1NX0A 1WDCC 1PALA 3FWCA 1V1FA 2CNPA 2JC2A 3NXAA 1NWDA 2QACA 3O2PA 1K93D 3SIAA 2K61A 2RGIA 1DF0A 1ALVA 1U5IB 2JTTA 3EK8A 2M97A 4GGNA 3RLZA 1WLMA 4BY4A 1A75B 3ZNIA 3LCPC 2LC5A 2NLNA 2Q4UA 3DVKA 3CR5X 1UWOA 1M39A 4ICBA 4YI9A 2E30A 5GQQC 1QVIY 2L51A 1XA5A 1BU3A 4YGEB 3ICBA 2ZKMX 1MXLC 2JXCA 3NSKA 1CLMA 4ORAB 5DKNA 2Y1MA 3RM1A 3QRXA 2Y4QA 4FTGA 4QJ3B 2JTZA 1YRUB 2BBMA 1S26D 4GUKA 1JF2A 1D1OA 2LMVA 1IQ5A 1QV0A 4DCKA 2JWWA 3BXKA 4GBAA 1XK4C 2JZIA 3CWGA 3DF0A 2K7CA 5I2OA 1LA3A 3CR2A 1JBAA 3LK0A 1PSRA 4MVFA 2OTGC 3DVMA 1TTXA 1UURA 3I5GB 1XFYO 4PE1A 2PALA 2MHHA 1OQPA 3I5FB 1LKJA 2KNEA 2R2IA 2O60A 1TRFA 2K2FA 3JVTC 1NUBA 4I5NB 1K2HA 3I5IB 2KQYA 1NX3A 2M9GA 1WLZA 1F55A 1B7TZ 1IWQA 1IGVA 1IG5A 1PVBA 1AJ4A 1X02A 3CS1A 4N1GA 4PE0A 2MBXA 2H61A 1U5IA 1DJXA 2KBIA 4OR9B 5J3XA 4F0ZB 1DJWA 3OHMB 1J7RA 1PSBA 3JTDC 1RFJA 2EHBA 2LLUA 3VRNA 4CFQA 1DVIA 1BR4B 2M7NA 1DGVA 3EVUA 1JF0A 3SG5A 1JFKA 1CDLA 2AAOA 1RECA 1JSAA 2KFFA 5I2QA 1KWOC 1YX8A 4AOMA 2BKIB 2HQ8A 1MXEA 2MLFC 1GQMA 1MUXA 3I5HB 4NDBA 1SBJA 3CZTX 2BCXA 1CFFA 3TDUA 1R6PA 2ZNEA 1KQVA 3TDIA 1AHRA 1KK8B 3O4YA 3FS7A 5HKYA 3F45A 2I2RE 4OCIA 2WOSA 1K9PA 2BL0C 3A4UB 1YURA 1OE9B 4M2QA 2BECA 3D10A 2M7LA 2LP2A 2CT9A 3TUYC 1VRKA 2HQWA 3BYAA 3WHUB 1CNPA 1DF0B 1K90D 3C1VA 4OV2A 2BCBA 2WCEA 2GGZA 5HKZA 1N65A 1QX2A 4XYNA 1DJHA 1SW8A 1B7TY 2Y1NA 1Y1UA 3AAKA 4MEWA 1JWDA 4GGFC 3WHTB 2BBNA 3HX4A 3ZWHA 5B8IB 1SK6D 4P2YB 2KI4C 1S1EA 3NSLA 1IJ5A 1K95A 1QXPA 2F3ZA 3PATA 1BMOA 4QJ5B 2I18A 3LK1A 1TNWA 1L2OC 3GK4X 2KHNA 2LMUA 2M8UA 3PSRA 4YRUA 3E3RA 4AQJA 4YGBB 1K9KA 4MSPA 1SCMB 1J55A 5HYDA 2Q91A 5JJGA 2LLTA 3IQQA 1CB1A 1W7JB 2EGDA 1IJ6A 3VRRA 1CFDA 1F4QA 4PE7A 3SJSA 4CIDA 1KFUL 1UHHA 4YBHB 2LUXA 1FI5A 1UP5A 1SMGA 3IQOA 4PHNA 1SYMA 2LM5A 1AJ5A 1XVJA 2KOTA 1WRLA 1FBVA 2KFHA 4GAOA 1QX5B 3TS5C 2JNFA 1AVSA 1PRWA 1EL4A 1IRJA 2F8PA 2KAXA 4DS7A 5AFPA 1F71A 1FW4A 1ODBA 2ZN9A 5KSZA 1K96A 2P6BB 2LP3A 2L98A 2EC6B 1SL8A 3BUXB 2LUCA 4XJKA 1CDMA 1JFJA 4MBEA 5BPJA 1F4OA 4I5KA 1J7QA 1S3PA 2KGBC 2NZ0A 5CSFA 5ER5A 1XFZO 1HQVA 1B8LA 1SL7A 1SR6C 3EVVA 4OKHA 2F2PA 4ORBB 1SL9A 1QATA 5HLOA 3PALA 1C7VA 4UPGA 2COLB 1CLLA 3EK4A 1RK9A 2L0PA 4DUQA 1Y0VH 2K2AA 1BODA 3WNXB 1DJIA 2WORA 3FWBA 1NP8A 3CR4X 1TOPA 5G08A 1E8AA 3PN7B 3KHEA 3SG7A 2KAYA 1ZUZA 3JTDB 1PULA 3VROA 2M1UA 1F8HA 1K8UA 2NCOA 4PDZA 2V53A 2H61C 2I7AA 3BUWB 1B47A 2HETA 4YGCB 1UHIA 1YR5A 2KSPA 1NPQA 3CLNA 3VRQA 3EVRA 3SG4A 3TDZA 4U8DA 4MRXA 3H4SE 5AERA 2JT0A 1QV1A 1Y1AA 2L50A 1A03A 1YVLA 2WCFA 3LL8B 1UUSA 1TN4A 2WNDA 5HKWA 1CDPA 3WXAA 1CKKA 1QTXA 2AUCA 1IKUA 1S6JA 1XK4A 1J7PA 2TN4A 2ZN8A 3BQ3A 1DGUA 1QIWA 1H8BA 1NCYA 1SNLA 1KK7Y 1NX1A 1RROA 2Y5IA 4ZCVA 2JT8A 5AXIA 1YRTB 4ORCB 1WRKA 1LVCD 3KPXA 1F54A 4ETOA 1NX2A 1CLBA 1OMDA 1JUOA 5CSIA 1MF8B 1RWYA 3I5GC 1J1EA 2L4IA 3LLEA 4MZJA 1BOCA 1XO5A 2KI6D 2GV5A 1LXFC 2H2KA 1WRZA 1AUIB 1EH2A 4PE4A 3I5FC 1NIWA 2MA2A 4WQ3A 1NCZA 1A4PA 1LINA 2SASA 1B1GA 3I5IC 2FCDA 1SCVA 1FI6A 5TNCA 3CGAA 1TNPA 2M1KB 4I5LB 3GK1A 4M2OA 1BT6A 1AK8A 1Y1XA 1IQ3A 2G2BA 2K7BA 2LANA 3SG2A 5F6TA 1C07A 4JPZB 1B9AA 1ZFSA 1LA0A 2BE4A 2JOJA 2LHIA 4MRYA 2SCPA 4XJKB 1CFCA 2LE9B 2OS8B 1KFUS 4HRHA 5DKQA 2CXJA 2D8NA 1J7OA 2LVIA 4GFTA 2BCAA 1KQMB 1B4CA 1QLKA 2ZRTA 1V1GA 1DJZA 1MQ1A 5ER4X 2KI6C 1NSHA 1OMRA 4N5XA 1QX7A 5K89A 3I5HC 2LVJA 5JOLA 2LAPA 4USLA 2LLSA 5IBWA 1WDCB 1SY9A 5D69A 4PHKA 4C0JA 1KSMA 1UHNA 1KK8C 2O5GA 1DJYA 1A2XA 1ZOTB 4ZCUA 1YVHA 4PHMA 1CMFA 2JRFA 2JPTA 2FOTA 4YI8A 3EK7A 2K0JA 3BUNB 2LV7A 1BR1B 4MZKA 2CCMA 5AEQA 4GGFA 2ZRSA 3K21A 2JXLA 1WY9A 1G8IA 2HPSA 1H4BA 1SPYA 2LCPA 4DRWA 1XYDA 4FQOA 3SG3A 1EXRA 1TCFA 2I94A 3GK2A 1F70A 3VRPA 2LVKA 2L5XB 1K9UA 1OMVA 1EJ3A 1KFXL 4C0KA 1SRAA 3DD4A 3DVEA 1KK7Z 1N0YA 2KGRA 1ALWA 1G4YR 4R1EA 2G9BA 4MN0A 2LNKA 1Q80A 1S5GZ 1PVAA 3OX5A 1DT7B 3M0WA 2OTGB 3SIBA 1SCMC 1M46A 1B8RA 5AANA 3JVTB 1QLSA 4HSZA 1C7WA 1YUSA 1A29A 4YGDB 2ZFDA 3SG6A 2KYFA 1OZSA
chains in the Genus database with same CATH superfamily
4AQIA 1TNQA 3RZSA 3KO0A 4NDDA 5KTYA 1R2UA 1XFVO 1BF5A 1TWOA 2CBLA 2H8VA 5FI7A 2NXQA 3CTNA 3DVJA 1AP4A 4OVNF 3QMEA 3D0YB 1KSOA 3BFBA 1FF1A 1DEKA 1TNXA 2JULA 1QS7A 2A4JA 2HF5A 4DIRA 1G33A 2F3YA 1JC2A 1IH0A 1YTZC 5KU1A 2LVVA 1PK0D 1TCOB 1CMGA 1KWOB 3BOWA 3DY9A 2L2EA 4BY5A 2GGMA 4QJ4B 1RTP1 1QJTA 3TZ1A 2EC6C 3MSEB 4FQTA 2NCPA 1GJYA 2F2OA 2JNXA 4A4CA 1DJGA 1CTRA 1UHJA 2B1UA 2KBMA 1OZOA 2M0RA 2PVBA 2WC8A 2FCEA 3D76A 5I8NA 1B8CA 2JQ6A 1HT9A 1M63B 1NYAA 2DOQA 2JT3A 3NSIA 1RJVA 1BLQA 2BE6A 2KFGA 2M29A 3A8RA 1L7ZA 2F33A 4A4BA 1OSAA 2K60A 2PRUA 3D74A 5HLVA 2BL0B 1W7IB 1ZMZA 4IL1A 4PALA 2LMTA 4HRGA 2WCLA 4YGAA 4Q04A 1S5GY 1XFWO 1ZACA 1QIVA 2ZNDA 3EKHA 4WRIA 3TUYB 1FPWA 3SS4A 1SKTA 4E68A 3PN7C 1BG1A 1YUTA 3D78A 3OB1B 1A75A 2FJUB 3EKJA 1M31A 1DTLA 1UHKA 4D1EA 4GNKB 4L9MA 3KEVA 1CDNA 2IS9A 2WCHA 2WCKA 1EG4A 4JD9A 5CSJA 4N1FA 2KI4B 2LHLA 2BKHB 5DKRA 3D0YA 2CTNA 3D77A 4PT1A 1KCYA 1S36A 3HCMA 4TNCA 4CPVA 1L2OB 1GGWA 3AKAA 2KLDA 3PLFB 4I5JA 5I2LA 2KYCA 1Y6WA 4M2PA 4HREE 1MHOA 3OX6A 3KF9A 4NDCA 1EG3A 3BUMB 3FE6A 3BUOB 4JQ0D 2ISDA 1TIZA 1MWNA 1QASA 3O78A 4KYNA 5PALA 2AMIA 3K1EA 5CSNA 5FYXA 3VGOA 2PSRA 3PM8A 2MJWB 3EG5B 2E6WA 3B88A 3GOFA 3NSOA 3NGVA 3L4AA 1OOJA 1KFXS 3AKBA 3OB2B 3FIAA 1QVIZ 2OPOA 4WQ2A 2P71A 5CPVA 3DYEA 3TS5B 1S6CA 1TUZA 2MLEC 1YUUA 1XFUO 3B87A 2KQ6A 1N2DA 1CM1A 1M45A 2M3WA 3D73A 2M49B 2PASA 2K8MB 4PHJA 4C0LA 2QPTA 3CZ2A 1S6IA 2K7OA 1MR8A 3R72A 1DMOA 1OOFA 3PFVA 4CLNA 2PMYA 1YX7A 4JWQA 4NQGA 1J1DA 2L4HA 1GGZA 4MLWA 1CM4A 1NCXA 2KAVA 3BOWB 2MAZA 3CZ0A 3NHTA 3SS3A 2MRDA 2WCJA 3AAJA 4CFRA 2VRGA 1SR6B 1CFPA 1K94A 4P5OE 2JU0A 3DF0B 2OS8C 2K7DA 3NHIA 2KDHA 1BJFA 5D7FA 1KQMC 1XFXO 4MZLA 3OP0A 4GPLB 2WCBA 4PCWA 3O6BA 4F7FA 3IF7A 1NX0A 1WDCC 1PALA 2KLEA 4IJ7A 3FWCA 1V1FA 2CNPA 2JC2A 3NXAA 1NWDA 2QACA 1DQEA 3O2PA 1K93D 3SIAA 2P70A 2K61A 2RGIA 1DF0A 1ALVA 1U5IB 2JTTA 3EK8A 2M97A 4GGNA 3RLZA 1WLMA 4BY4A 5DICA 1A75B 3ZNIA 3LCPC 2LC5A 2NLNA 2Q4UA 4INWA 3DVKA 2BNXA 2PQLA 1UWOA 3CR5X 1M39A 4ICBA 4YI9A 2E30A 5GQQC 1QVIY 2L51A 1XA5A 1BU3A 4YGEB 5D3OA 3ICBA 2ZKMX 1MXLC 2JXCA 3NSKA 1CLMA 4ORAB 5DKNA 2Y1MA 3UNWA 3RM1A 3QRXA 2Y4QA 4FTGA 4QJ3B 2JTZA 3L4LA 1YRUB 2BBMA 1S26D 4GUKA 1JF2A 1D1OA 2LMVA 1IQ5A 1QV0A 2KPHA 4DCKA 2JWWA 3BXKA 4GBAA 1XK4C 3B86A 2JZIA 3CWGA 3CZ1A 3DF0A 1OOGA 2K7CA 5I2OA 3S0BA 1LA3A 2L5YA 3CR2A 1JBAA 3LK0A 1PSRA 4MVFA 2OTGC 3DVMA 1TTXA 1UURA 3I5GB 1XFYO 4PE1A 2PALA 2MHHA 1OQPA 3I5FB 1LKJA 2KNEA 2R2IA 2O60A 1TRFA 2K2FA 3JVTC 1NUBA 4I5NB 1K2HA 3I5IB 2KQYA 1NX3A 2M9GA 1WLZA 1F55A 1B7TZ 1IWQA 1IGVA 1IG5A 1PVBA 1AJ4A 1X02A 2ERBA 2JPOA 3CS1A 3S0EA 4N1GA 1Z2CB 4PE0A 2MBXA 2H61A 1U5IA 1DJXA 2KBIA 4OR9B 3CDNA 5J3XA 4F0ZB 1DJWA 3OHMB 3UO9A 1J7RA 1PSBA 3JTDC 1RFJA 2EHBA 2LLUA 3VRNA 4CFQA 1DVIA 1BR4B 2M7NA 1DGVA 3EVUA 1JF0A 3SG5A 1JFKA 1CDLA 1OOIX 1RECA 2AAOA 1JSAA 2KFFA 5I2QA 1KWOC 1YX8A 4AOMA 2BKIB 3S0GA 2HQ8A 1MXEA 2MLFC 1GQMA 1MUXA 3I5HB 4NDBA 1SBJA 3CZTX 5HL1A 1IIOA 2BCXA 1CFFA 3TDUA 2BAPA 1R6PA 2ZNEA 1KQVA 3TDIA 3R1PA 1AHRA 1KK8B 3O4YA 3FS7A 5HKYA 3F45A 2I2RE 4OCIA 3S0AA 3V2LA 2WOSA 1K9PA 2BL0C 3A4UB 3PJIA 1YURA 1OE9B 4M2QA 2BECA 3D10A 2M7LA 2LP2A 2CT9A 3TUYC 1VRKA 2HQWA 3BYAA 3WHUB 1CNPA 1DF0B 1K90D 3C1VA 2YGUA 4OV2A 3PM2A 3SS5A 2GTEA 2BCBA 2WCEA 2GGZA 5HKZA 3DXLA 1N65A 1QX2A 4XYNA 1DJHA 1SW8A 1B7TY 2Y1NA 1Y1UA 3AAKA 4MEWA 1JWDA 4GGFC 3WHTB 2BBNA 3HX4A 5EL2A 3ZWHA 5B8IB 1SK6D 4P2YB 2KI4C 1S1EA 3NSLA 1IJ5A 1K95A 1QXPA 2F3ZA 3PATA 1BMOA 3S0FA 4QJ5B 2I18A 3LK1A 1TNWA 1L2OC 3GK4X 2KHNA 2LMUA 2M8UA 2WC5A 3PSRA 3E3RA 4YRUA 3Q8IA 4YGBB 1K9KA 4AQJA 5I94A 2L2CA 1SCMB 4MSPA 1J55A 5HYDA 2Q91A 5JJGA 2LLTA 3IQQA 1CB1A 1W7JB 2EGDA 1IJ6A 3VRRA 1CFDA 1SSEB 4INXA 1F4QA 4PE7A 3SJSA 2QEOA 1C3ZA 4CIDA 1KFUL 1UHHA 4YBHB 2LUXA 1FI5A 1UP5A 1SMGA 3IQOA 4PHNA 1SYMA 2LM5A 1AJ5A 1XVJA 2KOTA 1WRLA 1FBVA 2KFHA 4GAOA 1QX5B 3TS5C 2JNFA 3D75A 1AVSA 1PRWA 1EL4A 2QEBA 1IRJA 2F8PA 2KAXA 4DS7A 5AFPA 1F71A 1FW4A 1ODBA 2ZN9A 5KSZA 3OBVA 1K96A 2P6BB 2LP3A 2L98A 2EC6B 1SL8A 3BUXB 2LUCA 1QWVA 4XJKA 1CDMA 5FI6A 1JFJA 4MBEA 1TUJA 5BPJA 1F4OA 4I5KA 1J7QA 1S3PA 2KGBC 2NZ0A 5CSFA 5ER5A 1XFZO 1HQVA 1B8LA 1SL7A 2QDIA 1SR6C 3EVVA 4OKHA 2F2PA 2QEHA 4ORBB 1SL9A 1QATA 5HLOA 3PALA 1C7VA 4OZDA 4UPGA 2COLB 1CLLA 3EK4A 1RK9A 2L0PA 4DUQA 1Y0VH 2K2AA 1BODA 3L47A 3WNXB 1DJIA 3BFAA 2WORA 3FWBA 1NP8A 3CR4X 1TOPA 5G08A 1E8AA 3PN7B 3KHEA 3SG7A 2KAYA 1ZUZA 3JTDB 3B7AA 1PULA 3N7HA 3VROA 2M1UA 1F8HA 1K8UA 2NCOA 3FE8A 4PDZA 2V53A 2H61C 2I7AA 3BUWB 1B47A 2HETA 4YGCB 1UHIA 1YR5A 2KSPA 1NPQA 3CLNA 3VRQA 3EVRA 3SG4A 3TDZA 4U8DA 4MRXA 3H4SE 5AERA 1GM0A 2JT0A 1QV1A 1Y1AA 2L50A 1A03A 1YVLA 2WCFA 3LL8B 1UUSA 1TN4A 2WNDA 3CYZA 5HKWA 3S0DA 1CDPA 3WXAA 1CKKA 1P28A 3R1OA 1QTXA 2AUCA 1IKUA 1S6JA 1XK4A 1J7PA 2TN4A 2ZN8A 3BQ3A 1DGUA 3CABA 1QIWA 3B6XA 1H8BA 3OGNA 1NCYA 1SNLA 1KK7Y 1NX1A 1RROA 2Y5IA 4ZCVA 2JT8A 5AXIA 1YRTB 4ORCB 1WRKA 3IVTA 1LVCD 3KPXA 1F54A 1XFRA 4ETOA 1NX2A 1CLBA 1OMDA 1JUOA 5CSIA 1MF8B 1RWYA 1C3YA 3BFHA 3I5GC 1J1EA 4JKTA 2L4IA 3LLEA 4MZJA 1BOCA 1XO5A 2KI6D 2GV5A 1LXFC 2H2KA 1WRZA 1AUIB 1EH2A 4PE4A 3I5FC 1NIWA 2MA2A 4WQ3A 1NCZA 1A4PA 1LINA 2SASA 1B1GA 3I5IC 2FCDA 1SCVA 1FI6A 5TNCA 3CGAA 1TNPA 1T14A 2M1KB 2PYQA 4I5LB 3GK1A 4M2OA 1BT6A 1AK8A 1W9ZA 1Y1XA 1IQ3A 2G2BA 2K7BA 2LANA 3SG2A 5F6TA 1C07A 4JPZB 1B9AA 1ZFSA 1LA0A 5FI2A 2BE4A 2JOJA 2LHIA 4MRYA 2SCPA 4XJKB 1CFCA 1DELA 2LE9B 2OS8B 1KFUS 4HRHA 5DKQA 2CXJA 2D8NA 1Z4HA 1J7OA 2LVIA 4GFTA 2BCAA 1KQMB 1B4CA 1QLKA 2ZRTA 3DZTA 1V1GA 1DJZA 3VB1A 1MQ1A 5ER4X 2KI6C 1NSHA 1OMRA 4N5XA 1QX7A 5K89A 3I5HC 2LVJA 5JOLA 2LAPA 2WC6A 2LLSA 4USLA 1WDCB 5IBWA 1SY9A 5D69A 4PHKA 4C0JA 1KSMA 1UHNA 1KK8C 2O5GA 1DJYA 1A2XA 1ZOTB 4ZCUA 1YVHA 4PHMA 1CMFA 3BJHA 2JRFA 2JPTA 2FOTA 4YI8A 2FJYA 3EK7A 2K0JA 3BUNB 2LV7A 1BR1B 4MZKA 2CCMA 5AEQA 4GGFA 2ZRSA 3K21A 2JXLA 1WY9A 1G8IA 2HPSA 1H4BA 1SPYA 3O4XA 2LCPA 2WCMA 4DRWA 1XYDA 4FQOA 3SG3A 1EXRA 1OW4A 1TCFA 2I94A 3GK2A 1F70A 3VRPA 2LVKA 1OOHA 2L5XB 1K9UA 1OMVA 1EJ3A 1KFXL 1LS8A 4C0KA 1SRAA 3DD4A 3DVEA 1KK7Z 1N0YA 2KGRA 1ALWA 1G4YR 4R1EA 2G9BA 4MN0A 2LNKA 1Q80A 1S5GZ 1PVAA 3OX5A 1DT7B 3M0WA 2OTGB 3SIBA 1SCMC 1M46A 3FE9A 1ORGA 1B8RA 5AANA 3JVTB 1QLSA 1DC1A 2QEVA 3R1VA 4HSZA 1C7WA 1YUSA 1A29A 4YGDB 2ZFDA 3SG6A 2KYFA 1OZSA
chains in the Genus database with same CATH topology
4AQIA 1TNQA 3KO0A 4NDDA 5KTYA 1R2UA 1XFVO 1BF5A 2CBLA 2NXQA 3CTNA 3DVJA 1AP4A 4OVNF 3D0YB 1KSOA 1FF1A 1TNXA 2JULA 1QS7A 2A4JA 2HF5A 4DIRA 1G33A 2F3YA 1JC2A 1IH0A 1YTZC 5KU1A 2LVVA 1PK0D 1TCOB 1CMGA 1KWOB 3BOWA 2L2EA 4BY5A 2GGMA 4QJ4B 1RTP1 1QJTA 3TZ1A 2EC6C 3MSEB 2NCPA 1GJYA 2F2OA 2JNXA 4A4CA 1DJGA 1CTRA 1UHJA 2B1UA 2KBMA 1OZOA 2M0RA 2PVBA 2WC8A 2FCEA 5I8NA 1B8CA 2JQ6A 1HT9A 1M63B 1NYAA 2DOQA 2JT3A 3NSIA 1RJVA 1BLQA 2BE6A 2KFGA 2M29A 3A8RA 1L7ZA 2F33A 4A4BA 1OSAA 2PRUA 5HLVA 2BL0B 1W7IB 1ZMZA 4IL1A 4PALA 2LMTA 4HRGA 4YGAA 4Q04A 1S5GY 1XFWO 1ZACA 1QIVA 2ZNDA 3EKHA 4WRIA 3TUYB 1FPWA 1SKTA 4E68A 3PN7C 1BG1A 1YUTA 3OB1B 1A75A 2FJUB 3EKJA 1M31A 1DTLA 1UHKA 4D1EA 4GNKB 4L9MA 3KEVA 1CDNA 2IS9A 5CSJA 1EG4A 4N1FA 2KI4B 2LHLA 2BKHB 5DKRA 3D0YA 2CTNA 1KCYA 1S36A 3HCMA 4TNCA 4CPVA 1L2OB 1GGWA 3AKAA 3PLFB 4I5JA 5I2LA 2KYCA 1Y6WA 4M2PA 4HREE 1MHOA 3OX6A 3KF9A 4NDCA 1EG3A 3BUMB 3BUOB 4JQ0D 2ISDA 1TIZA 1MWNA 1QASA 3O78A 5PALA 2AMIA 5CSNA 5FYXA 3VGOA 2PSRA 3PM8A 2MJWB 2E6WA 3NSOA 3GOFA 1OOJA 1KFXS 3AKBA 3OB2B 3FIAA 1QVIZ 2OPOA 4WQ2A 5CPVA 3TS5B 1S6CA 2MLEC 1YUUA 1XFUO 2KQ6A 1N2DA 1CM1A 1M45A 2M3WA 2M49B 2PASA 2K8MB 4PHJA 4C0LA 2QPTA 1S6IA 2K7OA 1MR8A 1DMOA 3PFVA 4CLNA 2PMYA 1YX7A 4JWQA 4NQGA 1J1DA 2L4HA 1GGZA 4MLWA 1CM4A 1NCXA 2KAVA 3BOWB 2MAZA 2MRDA 3AAJA 4CFRA 2VRGA 1SR6B 1CFPA 1K94A 4P5OE 2JU0A 3DF0B 2OS8C 2K7DA 2KDHA 1BJFA 5D7FA 1KQMC 1XFXO 4MZLA 3OP0A 4GPLB 2WCBA 4PCWA 3O6BA 3IF7A 1NX0A 1WDCC 1PALA 3FWCA 1V1FA 2CNPA 2JC2A 3NXAA 1NWDA 2QACA 3O2PA 1K93D 3SIAA 2K61A 2RGIA 1DF0A 1ALVA 1U5IB 2JTTA 3EK8A 2M97A 4GGNA 3RLZA 1WLMA 4BY4A 1A75B 3ZNIA 3LCPC 2LC5A 2NLNA 2Q4UA 3DVKA 3CR5X 1UWOA 1M39A 4ICBA 4YI9A 2E30A 5GQQC 1QVIY 2L51A 1XA5A 1BU3A 4YGEB 3ICBA 2ZKMX 1MXLC 2JXCA 3NSKA 1CLMA 4ORAB 5DKNA 2Y1MA 3RM1A 3QRXA 2Y4QA 4FTGA 4QJ3B 2JTZA 1YRUB 2BBMA 1S26D 4GUKA 1JF2A 1D1OA 2LMVA 1IQ5A 1QV0A 4DCKA 2JWWA 3BXKA 4GBAA 1XK4C 2JZIA 3CWGA 3DF0A 2K7CA 5I2OA 1LA3A 3CR2A 1JBAA 3LK0A 1PSRA 4MVFA 2OTGC 3DVMA 1TTXA 1UURA 3I5GB 1XFYO 4PE1A 2PALA 2MHHA 1OQPA 3I5FB 1LKJA 2KNEA 2R2IA 2O60A 1TRFA 2K2FA 3JVTC 1NUBA 4I5NB 1K2HA 3I5IB 2KQYA 1NX3A 2M9GA 1WLZA 1F55A 1B7TZ 1IWQA 1IGVA 1IG5A 1PVBA 1AJ4A 1X02A 3CS1A 4N1GA 4PE0A 2MBXA 2H61A 1U5IA 1DJXA 2KBIA 4OR9B 5J3XA 4F0ZB 1DJWA 3OHMB 1J7RA 1PSBA 3JTDC 1RFJA 2EHBA 2LLUA 3VRNA 4CFQA 1DVIA 1BR4B 2M7NA 1DGVA 3EVUA 1JF0A 3SG5A 1JFKA 1CDLA 2AAOA 1RECA 1JSAA 2KFFA 5I2QA 1KWOC 1YX8A 4AOMA 2BKIB 2HQ8A 1MXEA 2MLFC 1GQMA 1MUXA 3I5HB 4NDBA 1SBJA 3CZTX 2BCXA 1CFFA 3TDUA 1R6PA 2ZNEA 1KQVA 3TDIA 1AHRA 1KK8B 3O4YA 3FS7A 5HKYA 3F45A 2I2RE 4OCIA 2WOSA 1K9PA 2BL0C 3A4UB 1YURA 1OE9B 4M2QA 2BECA 3D10A 2M7LA 2LP2A 2CT9A 3TUYC 1VRKA 2HQWA 3BYAA 3WHUB 1CNPA 1DF0B 1K90D 3C1VA 4OV2A 2BCBA 2WCEA 2GGZA 5HKZA 1N65A 1QX2A 4XYNA 1DJHA 1SW8A 1B7TY 2Y1NA 1Y1UA 3AAKA 4MEWA 1JWDA 4GGFC 3WHTB 2BBNA 3HX4A 3ZWHA 5B8IB 1SK6D 4P2YB 2KI4C 1S1EA 3NSLA 1IJ5A 1K95A 1QXPA 2F3ZA 3PATA 1BMOA 4QJ5B 2I18A 3LK1A 1TNWA 1L2OC 3GK4X 2KHNA 2LMUA 2M8UA 3PSRA 4YRUA 3E3RA 4AQJA 4YGBB 1K9KA 4MSPA 1SCMB 1J55A 5HYDA 2Q91A 5JJGA 2LLTA 3IQQA 1CB1A 1W7JB 2EGDA 1IJ6A 3VRRA 1CFDA 1F4QA 4PE7A 3SJSA 4CIDA 1KFUL 1UHHA 4YBHB 2LUXA 1FI5A 1UP5A 1SMGA 3IQOA 4PHNA 1SYMA 2LM5A 1AJ5A 1XVJA 2KOTA 1WRLA 1FBVA 2KFHA 4GAOA 1QX5B 3TS5C 2JNFA 1AVSA 1PRWA 1EL4A 1IRJA 2F8PA 2KAXA 4DS7A 5AFPA 1F71A 1FW4A 1ODBA 2ZN9A 5KSZA 1K96A 2P6BB 2LP3A 2L98A 2EC6B 1SL8A 3BUXB 2LUCA 4XJKA 1CDMA 1JFJA 4MBEA 5BPJA 1F4OA 4I5KA 1J7QA 1S3PA 2KGBC 2NZ0A 5CSFA 5ER5A 1XFZO 1HQVA 1B8LA 1SL7A 1SR6C 3EVVA 4OKHA 2F2PA 4ORBB 1SL9A 1QATA 5HLOA 3PALA 1C7VA 4UPGA 2COLB 1CLLA 3EK4A 1RK9A 2L0PA 4DUQA 1Y0VH 2K2AA 1BODA 3WNXB 1DJIA 2WORA 3FWBA 1NP8A 3CR4X 1TOPA 5G08A 1E8AA 3PN7B 3KHEA 3SG7A 2KAYA 1ZUZA 3JTDB 1PULA 3VROA 2M1UA 1F8HA 1K8UA 2NCOA 4PDZA 2V53A 2H61C 2I7AA 3BUWB 1B47A 2HETA 4YGCB 1UHIA 1YR5A 2KSPA 1NPQA 3CLNA 3VRQA 3EVRA 3SG4A 3TDZA 4U8DA 4MRXA 3H4SE 5AERA 2JT0A 1QV1A 1Y1AA 2L50A 1A03A 1YVLA 2WCFA 3LL8B 1UUSA 1TN4A 2WNDA 5HKWA 1CDPA 3WXAA 1CKKA 1QTXA 2AUCA 1IKUA 1S6JA 1XK4A 1J7PA 2TN4A 2ZN8A 3BQ3A 1DGUA 1QIWA 1H8BA 1NCYA 1SNLA 1KK7Y 1NX1A 1RROA 2Y5IA 4ZCVA 2JT8A 5AXIA 1YRTB 4ORCB 1WRKA 1LVCD 3KPXA 1F54A 4ETOA 1NX2A 1CLBA 1OMDA 1JUOA 5CSIA 1MF8B 1RWYA 3I5GC 1J1EA 2L4IA 3LLEA 4MZJA 1BOCA 1XO5A 2KI6D 2GV5A 1LXFC 2H2KA 1WRZA 1AUIB 1EH2A 4PE4A 3I5FC 1NIWA 2MA2A 4WQ3A 1NCZA 1A4PA 1LINA 2SASA 1B1GA 3I5IC 2FCDA 1SCVA 1FI6A 5TNCA 3CGAA 1TNPA 2M1KB 4I5LB 3GK1A 4M2OA 1BT6A 1AK8A 1Y1XA 1IQ3A 2G2BA 2K7BA 2LANA 3SG2A 5F6TA 1C07A 4JPZB 1B9AA 1ZFSA 1LA0A 2BE4A 2JOJA 2LHIA 4MRYA 2SCPA 4XJKB 1CFCA 2LE9B 2OS8B 1KFUS 4HRHA 5DKQA 2CXJA 2D8NA 1J7OA 2LVIA 4GFTA 2BCAA 1KQMB 1B4CA 1QLKA 2ZRTA 1V1GA 1DJZA 1MQ1A 5ER4X 2KI6C 1NSHA 1OMRA 4N5XA 1QX7A 5K89A 3I5HC 2LVJA 5JOLA 2LAPA 4USLA 2LLSA 5IBWA 1WDCB 1SY9A 5D69A 4PHKA 4C0JA 1KSMA 1UHNA 1KK8C 2O5GA 1DJYA 1A2XA 1ZOTB 4ZCUA 1YVHA 4PHMA 1CMFA 2JRFA 2JPTA 2FOTA 4YI8A 3EK7A 2K0JA 3BUNB 2LV7A 1BR1B 4MZKA 2CCMA 5AEQA 4GGFA 2ZRSA 3K21A 2JXLA 1WY9A 1G8IA 2HPSA 1H4BA 1SPYA 2LCPA 4DRWA 1XYDA 4FQOA 3SG3A 1EXRA 1TCFA 2I94A 3GK2A 1F70A 3VRPA 2LVKA 2L5XB 1K9UA 1OMVA 1EJ3A 1KFXL 4C0KA 1SRAA 3DD4A 3DVEA 1KK7Z 1N0YA 2KGRA 1ALWA 1G4YR 4R1EA 2G9BA 4MN0A 2LNKA 1Q80A 1S5GZ 1PVAA 3OX5A 1DT7B 3M0WA 2OTGB 3SIBA 1SCMC 1M46A 1B8RA 5AANA 3JVTB 1QLSA 4HSZA 1C7WA 1YUSA 1A29A 4YGDB 2ZFDA 3SG6A 2KYFA 1OZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQI A;  1TNQ A;  3KO0 A;  4NDD A;  5KTY A;  1R2U A;  1XFV O;  1BF5 A;  2CBL A;  2NXQ A;  3CTN A;  3DVJ A;  1AP4 A;  4OVN F;  3D0Y B;  1KSO A;  1FF1 A;  1TNX A;  2JUL A;  1QS7 A;  2A4J A;  2HF5 A;  4DIR A;  1G33 A;  2F3Y A;  1JC2 A;  1IH0 A;  1YTZ C;  5KU1 A;  2LVV A;  1PK0 D;  1TCO B;  1CMG A;  1KWO B;  3BOW A;  2L2E A;  4BY5 A;  2GGM A;  4QJ4 B;  1RTP 1;  1QJT A;  3TZ1 A;  2EC6 C;  3MSE B;  2NCP A;  1GJY A;  2F2O A;  2JNX A;  4A4C A;  1DJG A;  1CTR A;  1UHJ A;  2B1U A;  2KBM A;  1OZO A;  2M0R A;  2PVB A;  2WC8 A;  2FCE A;  5I8N A;  1B8C A;  2JQ6 A;  1HT9 A;  1M63 B;  1NYA A;  2DOQ A;  2JT3 A;  3NSI A;  1RJV A;  1BLQ A;  2BE6 A;  2KFG A;  2M29 A;  3A8R A;  1L7Z A;  2F33 A;  4A4B A;  1OSA A;  2PRU A;  5HLV A;  2BL0 B;  1W7I B;  1ZMZ A;  4IL1 A;  4PAL A;  2LMT A;  4HRG A;  4YGA A;  4Q04 A;  1S5G Y;  1XFW O;  1ZAC A;  1QIV A;  2ZND A;  3EKH A;  4WRI A;  3TUY B;  1FPW A;  1SKT A;  4E68 A;  3PN7 C;  1BG1 A;  1YUT A;  3OB1 B;  1A75 A;  2FJU B;  3EKJ A;  1M31 A;  1DTL A;  1UHK A;  4D1E A;  4GNK B;  4L9M A;  3KEV A;  1CDN A;  2IS9 A;  5CSJ A;  1EG4 A;  4N1F A;  2KI4 B;  2LHL A;  2BKH B;  5DKR A;  3D0Y A;  2CTN A;  1KCY A;  1S36 A;  3HCM A;  4TNC A;  4CPV A;  1L2O B;  1GGW A;  3AKA A;  3PLF B;  4I5J A;  5I2L A;  2KYC A;  1Y6W A;  4M2P A;  4HRE E;  1MHO A;  3OX6 A;  3KF9 A;  4NDC A;  1EG3 A;  3BUM B;  3BUO B;  4JQ0 D;  2ISD A;  1TIZ A;  1MWN A;  1QAS A;  3O78 A;  5PAL A;  2AMI A;  5CSN A;  5FYX A;  3VGO A;  2PSR A;  3PM8 A;  2MJW B;  2E6W A;  3NSO A;  3GOF A;  1OOJ A;  1KFX S;  3AKB A;  3OB2 B;  3FIA A;  1QVI Z;  2OPO A;  4WQ2 A;  5CPV A;  3TS5 B;  1S6C A;  2MLE C;  1YUU A;  1XFU O;  2KQ6 A;  1N2D A;  1CM1 A;  1M45 A;  2M3W A;  2M49 B;  2PAS A;  2K8M B;  4PHJ A;  4C0L A;  2QPT A;  1S6I A;  2K7O A;  1MR8 A;  1DMO A;  3PFV A;  4CLN A;  2PMY A;  1YX7 A;  4JWQ A;  4NQG A;  1J1D A;  2L4H A;  1GGZ A;  4MLW A;  1CM4 A;  1NCX A;  2KAV A;  3BOW B;  2MAZ A;  2MRD A;  3AAJ A;  4CFR A;  2VRG A;  1SR6 B;  1CFP A;  1K94 A;  4P5O E;  2JU0 A;  3DF0 B;  2OS8 C;  2K7D A;  2KDH A;  1BJF A;  5D7F A;  1KQM C;  1XFX O;  4MZL A;  3OP0 A;  4GPL B;  2WCB A;  4PCW A;  3O6B A;  3IF7 A;  1NX0 A;  1WDC C;  1PAL A;  3FWC A;  1V1F A;  2CNP A;  2JC2 A;  3NXA A;  1NWD A;  2QAC A;  3O2P A;  1K93 D;  3SIA A;  2K61 A;  2RGI A;  1DF0 A;  1ALV A;  1U5I B;  2JTT A;  3EK8 A;  2M97 A;  4GGN A;  3RLZ A;  1WLM A;  4BY4 A;  1A75 B;  3ZNI A;  3LCP C;  2LC5 A;  2NLN A;  2Q4U A;  3DVK A;  3CR5 X;  1UWO A;  1M39 A;  4ICB A;  4YI9 A;  2E30 A;  5GQQ C;  1QVI Y;  2L51 A;  1XA5 A;  1BU3 A;  4YGE B;  3ICB A;  2ZKM X;  1MXL C;  2JXC A;  3NSK A;  1CLM A;  4ORA B;  5DKN A;  2Y1M A;  3RM1 A;  3QRX A;  2Y4Q A;  4FTG A;  4QJ3 B;  2JTZ A;  1YRU B;  2BBM A;  1S26 D;  4GUK A;  1JF2 A;  1D1O A;  2LMV A;  1IQ5 A;  1QV0 A;  4DCK A;  2JWW A;  3BXK A;  4GBA A;  1XK4 C;  2JZI A;  3CWG A;  3DF0 A;  2K7C A;  5I2O A;  1LA3 A;  3CR2 A;  1JBA A;  3LK0 A;  1PSR A;  4MVF A;  2OTG C;  3DVM A;  1TTX A;  1UUR A;  3I5G B;  1XFY O;  4PE1 A;  2PAL A;  2MHH A;  1OQP A;  3I5F B;  1LKJ A;  2KNE A;  2R2I A;  2O60 A;  1TRF A;  2K2F A;  3JVT C;  1NUB A;  4I5N B;  1K2H A;  3I5I B;  2KQY A;  1NX3 A;  2M9G A;  1WLZ A;  1F55 A;  1B7T Z;  1IWQ A;  1IGV A;  1IG5 A;  1PVB A;  1AJ4 A;  1X02 A;  3CS1 A;  4N1G A;  4PE0 A;  2MBX A;  2H61 A;  1U5I A;  1DJX A;  2KBI A;  4OR9 B;  5J3X A;  4F0Z B;  1DJW A;  3OHM B;  1J7R A;  1PSB A;  3JTD C;  1RFJ A;  2EHB A;  2LLU A;  3VRN A;  4CFQ A;  1DVI A;  1BR4 B;  2M7N A;  1DGV A;  3EVU A;  1JF0 A;  3SG5 A;  1JFK A;  1CDL A;  2AAO A;  1REC A;  1JSA A;  2KFF A;  5I2Q A;  1KWO C;  1YX8 A;  4AOM A;  2BKI B;  2HQ8 A;  1MXE A;  2MLF C;  1GQM A;  1MUX A;  3I5H B;  4NDB A;  1SBJ A;  3CZT X;  2BCX A;  1CFF A;  3TDU A;  1R6P A;  2ZNE A;  1KQV A;  3TDI A;  1AHR A;  1KK8 B;  3O4Y A;  3FS7 A;  5HKY A;  3F45 A;  2I2R E;  4OCI A;  2WOS A;  1K9P A;  2BL0 C;  3A4U B;  1YUR A;  1OE9 B;  4M2Q A;  2BEC A;  3D10 A;  2M7L A;  2LP2 A;  2CT9 A;  3TUY C;  1VRK A;  2HQW A;  3BYA A;  3WHU B;  1CNP A;  1DF0 B;  1K90 D;  3C1V A;  4OV2 A;  2BCB A;  2WCE A;  2GGZ A;  5HKZ A;  1N65 A;  1QX2 A;  4XYN A;  1DJH A;  1SW8 A;  1B7T Y;  2Y1N A;  1Y1U A;  3AAK A;  4MEW A;  1JWD A;  4GGF C;  3WHT B;  2BBN A;  3HX4 A;  3ZWH A;  5B8I B;  1SK6 D;  4P2Y B;  2KI4 C;  1S1E A;  3NSL A;  1IJ5 A;  1K95 A;  1QXP A;  2F3Z A;  3PAT A;  1BMO A;  4QJ5 B;  2I18 A;  3LK1 A;  1TNW A;  1L2O C;  3GK4 X;  2KHN A;  2LMU A;  2M8U A;  3PSR A;  4YRU A;  3E3R A;  4AQJ A;  4YGB B;  1K9K A;  4MSP A;  1SCM B;  1J55 A;  5HYD A;  2Q91 A;  5JJG A;  2LLT A;  3IQQ A;  1CB1 A;  1W7J B;  2EGD A;  1IJ6 A;  3VRR A;  1CFD A;  1F4Q A;  4PE7 A;  3SJS A;  4CID A;  1KFU L;  1UHH A;  4YBH B;  2LUX A;  1FI5 A;  1UP5 A;  1SMG A;  3IQO A;  4PHN A;  1SYM A;  2LM5 A;  1AJ5 A;  1XVJ A;  2KOT A;  1WRL A;  1FBV A;  2KFH A;  4GAO A;  1QX5 B;  3TS5 C;  2JNF A;  1AVS A;  1PRW A;  1EL4 A;  1IRJ A;  2F8P A;  2KAX A;  4DS7 A;  5AFP A;  1F71 A;  1FW4 A;  1ODB A;  2ZN9 A;  5KSZ A;  1K96 A;  2P6B B;  2LP3 A;  2L98 A;  2EC6 B;  1SL8 A;  3BUX B;  2LUC A;  4XJK A;  1CDM A;  1JFJ A;  4MBE A;  5BPJ A;  1F4O A;  4I5K A;  1J7Q A;  1S3P A;  2KGB C;  2NZ0 A;  5CSF A;  5ER5 A;  1XFZ O;  1HQV A;  1B8L A;  1SL7 A;  1SR6 C;  3EVV A;  4OKH A;  2F2P A;  4ORB B;  1SL9 A;  1QAT A;  5HLO A;  3PAL A;  1C7V A;  4UPG A;  2COL B;  1CLL A;  3EK4 A;  1RK9 A;  2L0P A;  4DUQ A;  1Y0V H;  2K2A A;  1BOD A;  3WNX B;  1DJI A;  2WOR A;  3FWB A;  1NP8 A;  3CR4 X;  1TOP A;  5G08 A;  1E8A A;  3PN7 B;  3KHE A;  3SG7 A;  2KAY A;  1ZUZ A;  3JTD B;  1PUL A;  3VRO A;  2M1U A;  1F8H A;  1K8U A;  2NCO A;  4PDZ A;  2V53 A;  2H61 C;  2I7A A;  3BUW B;  1B47 A;  2HET A;  4YGC B;  1UHI A;  1YR5 A;  2KSP A;  1NPQ A;  3CLN A;  3VRQ A;  3EVR A;  3SG4 A;  3TDZ A;  4U8D A;  4MRX A;  3H4S E;  5AER A;  2JT0 A;  1QV1 A;  1Y1A A;  2L50 A;  1A03 A;  1YVL A;  2WCF A;  3LL8 B;  1UUS A;  1TN4 A;  2WND A;  5HKW A;  1CDP A;  3WXA A;  1CKK A;  1QTX A;  2AUC A;  1IKU A;  1S6J A;  1XK4 A;  1J7P A;  2TN4 A;  2ZN8 A;  3BQ3 A;  1DGU A;  1QIW A;  1H8B A;  1NCY A;  1SNL A;  1KK7 Y;  1NX1 A;  1RRO A;  2Y5I A;  4ZCV A;  2JT8 A;  5AXI A;  1YRT B;  4ORC B;  1WRK A;  1LVC D;  3KPX A;  1F54 A;  4ETO A;  1NX2 A;  1CLB A;  1OMD A;  1JUO A;  5CSI A;  1MF8 B;  1RWY A;  3I5G C;  1J1E A;  2L4I A;  3LLE A;  4MZJ A;  1BOC A;  1XO5 A;  2KI6 D;  2GV5 A;  1LXF C;  2H2K A;  1WRZ A;  1AUI B;  1EH2 A;  4PE4 A;  3I5F C;  1NIW A;  2MA2 A;  4WQ3 A;  1NCZ A;  1A4P A;  1LIN A;  2SAS A;  1B1G A;  3I5I C;  2FCD A;  1SCV A;  1FI6 A;  5TNC A;  3CGA A;  1TNP A;  2M1K B;  4I5L B;  3GK1 A;  4M2O A;  1BT6 A;  1AK8 A;  1Y1X A;  1IQ3 A;  2G2B A;  2K7B A;  2LAN A;  3SG2 A;  5F6T A;  1C07 A;  4JPZ B;  1B9A A;  1ZFS A;  1LA0 A;  2BE4 A;  2JOJ A;  2LHI A;  4MRY A;  2SCP A;  4XJK B;  1CFC A;  2LE9 B;  2OS8 B;  1KFU S;  4HRH A;  5DKQ A;  2CXJ A;  2D8N A;  1J7O A;  2LVI A;  4GFT A;  2BCA A;  1KQM B;  1B4C A;  1QLK A;  2ZRT A;  1V1G A;  1DJZ A;  1MQ1 A;  5ER4 X;  2KI6 C;  1NSH A;  1OMR A;  4N5X A;  1QX7 A;  5K89 A;  3I5H C;  2LVJ A;  5JOL A;  2LAP A;  4USL A;  2LLS A;  5IBW A;  1WDC B;  1SY9 A;  5D69 A;  4PHK A;  4C0J A;  1KSM A;  1UHN A;  1KK8 C;  2O5G A;  1DJY A;  1A2X A;  1ZOT B;  4ZCU A;  1YVH A;  4PHM A;  1CMF A;  2JRF A;  2JPT A;  2FOT A;  4YI8 A;  3EK7 A;  2K0J A;  3BUN B;  2LV7 A;  1BR1 B;  4MZK A;  2CCM A;  5AEQ A;  4GGF A;  2ZRS A;  3K21 A;  2JXL A;  1WY9 A;  1G8I A;  2HPS A;  1H4B A;  1SPY A;  2LCP A;  4DRW A;  1XYD A;  4FQO A;  3SG3 A;  1EXR A;  1TCF A;  2I94 A;  3GK2 A;  1F70 A;  3VRP A;  2LVK A;  2L5X B;  1K9U A;  1OMV A;  1EJ3 A;  1KFX L;  4C0K A;  1SRA A;  3DD4 A;  3DVE A;  1KK7 Z;  1N0Y A;  2KGR A;  1ALW A;  1G4Y R;  4R1E A;  2G9B A;  4MN0 A;  2LNK A;  1Q80 A;  1S5G Z;  1PVA A;  3OX5 A;  1DT7 B;  3M0W A;  2OTG B;  3SIB A;  1SCM C;  1M46 A;  1B8R A;  5AAN A;  3JVT B;  1QLS A;  4HSZ A;  1C7W A;  1YUS A;  1A29 A;  4YGD B;  2ZFD A;  3SG6 A;  2KYF A;  1OZS A; 
#chains in the Genus database with same CATH topology
 4AQI A;  1TNQ A;  3RZS A;  3KO0 A;  4NDD A;  5KTY A;  1R2U A;  1XFV O;  1BF5 A;  1TWO A;  2CBL A;  2H8V A;  5FI7 A;  2NXQ A;  3CTN A;  3DVJ A;  1AP4 A;  4OVN F;  3QME A;  3D0Y B;  1KSO A;  3BFB A;  1FF1 A;  1DEK A;  1TNX A;  2JUL A;  1QS7 A;  2A4J A;  2HF5 A;  4DIR A;  1G33 A;  2F3Y A;  1JC2 A;  1IH0 A;  1YTZ C;  5KU1 A;  2LVV A;  1PK0 D;  1TCO B;  1CMG A;  1KWO B;  3BOW A;  3DY9 A;  2L2E A;  4BY5 A;  2GGM A;  4QJ4 B;  1RTP 1;  1QJT A;  3TZ1 A;  2EC6 C;  3MSE B;  4FQT A;  2NCP A;  1GJY A;  2F2O A;  2JNX A;  4A4C A;  1DJG A;  1CTR A;  1UHJ A;  2B1U A;  2KBM A;  1OZO A;  2M0R A;  2PVB A;  2WC8 A;  2FCE A;  3D76 A;  5I8N A;  1B8C A;  2JQ6 A;  1HT9 A;  1M63 B;  1NYA A;  2DOQ A;  2JT3 A;  3NSI A;  1RJV A;  1BLQ A;  2BE6 A;  2KFG A;  2M29 A;  3A8R A;  1L7Z A;  2F33 A;  4A4B A;  1OSA A;  2K60 A;  2PRU A;  3D74 A;  5HLV A;  2BL0 B;  1W7I B;  1ZMZ A;  4IL1 A;  4PAL A;  2LMT A;  4HRG A;  2WCL A;  4YGA A;  4Q04 A;  1S5G Y;  1XFW O;  1ZAC A;  1QIV A;  2ZND A;  3EKH A;  4WRI A;  3TUY B;  1FPW A;  3SS4 A;  1SKT A;  4E68 A;  3PN7 C;  1BG1 A;  1YUT A;  3D78 A;  3OB1 B;  1A75 A;  2FJU B;  3EKJ A;  1M31 A;  1DTL A;  1UHK A;  4D1E A;  4GNK B;  4L9M A;  3KEV A;  1CDN A;  2IS9 A;  2WCH A;  2WCK A;  1EG4 A;  4JD9 A;  5CSJ A;  4N1F A;  2KI4 B;  2LHL A;  2BKH B;  5DKR A;  3D0Y A;  2CTN A;  3D77 A;  4PT1 A;  1KCY A;  1S36 A;  3HCM A;  4TNC A;  4CPV A;  1L2O B;  1GGW A;  3AKA A;  2KLD A;  3PLF B;  4I5J A;  5I2L A;  2KYC A;  1Y6W A;  4M2P A;  4HRE E;  1MHO A;  3OX6 A;  3KF9 A;  4NDC A;  1EG3 A;  3BUM B;  3FE6 A;  3BUO B;  4JQ0 D;  2ISD A;  1TIZ A;  1MWN A;  1QAS A;  3O78 A;  4KYN A;  5PAL A;  2AMI A;  3K1E A;  5CSN A;  5FYX A;  3VGO A;  2PSR A;  3PM8 A;  2MJW B;  3EG5 B;  2E6W A;  3B88 A;  3GOF A;  3NSO A;  3NGV A;  3L4A A;  1OOJ A;  1KFX S;  3AKB A;  3OB2 B;  3FIA A;  1QVI Z;  2OPO A;  4WQ2 A;  2P71 A;  5CPV A;  3DYE A;  3TS5 B;  1S6C A;  1TUZ A;  2MLE C;  1YUU A;  1XFU O;  3B87 A;  2KQ6 A;  1N2D A;  1CM1 A;  1M45 A;  2M3W A;  3D73 A;  2M49 B;  2PAS A;  2K8M B;  4PHJ A;  4C0L A;  2QPT A;  3CZ2 A;  1S6I A;  2K7O A;  1MR8 A;  3R72 A;  1DMO A;  1OOF A;  3PFV A;  4CLN A;  2PMY A;  1YX7 A;  4JWQ A;  4NQG A;  1J1D A;  2L4H A;  1GGZ A;  4MLW A;  1CM4 A;  1NCX A;  2KAV A;  3BOW B;  2MAZ A;  3CZ0 A;  3NHT A;  3SS3 A;  2MRD A;  2WCJ A;  3AAJ A;  4CFR A;  2VRG A;  1SR6 B;  1CFP A;  1K94 A;  4P5O E;  2JU0 A;  3DF0 B;  2OS8 C;  2K7D A;  3NHI A;  2KDH A;  1BJF A;  5D7F A;  1KQM C;  1XFX O;  4MZL A;  3OP0 A;  4GPL B;  2WCB A;  4PCW A;  3O6B A;  4F7F A;  3IF7 A;  1NX0 A;  1WDC C;  1PAL A;  2KLE A;  4IJ7 A;  3FWC A;  1V1F A;  2CNP A;  2JC2 A;  3NXA A;  1NWD A;  2QAC A;  1DQE A;  3O2P A;  1K93 D;  3SIA A;  2P70 A;  2K61 A;  2RGI A;  1DF0 A;  1ALV A;  1U5I B;  2JTT A;  3EK8 A;  2M97 A;  4GGN A;  3RLZ A;  1WLM A;  4BY4 A;  5DIC A;  1A75 B;  3ZNI A;  3LCP C;  2LC5 A;  2NLN A;  2Q4U A;  4INW A;  3DVK A;  2BNX A;  2PQL A;  1UWO A;  3CR5 X;  1M39 A;  4ICB A;  4YI9 A;  2E30 A;  5GQQ C;  1QVI Y;  2L51 A;  1XA5 A;  1BU3 A;  4YGE B;  5D3O A;  3ICB A;  2ZKM X;  1MXL C;  2JXC A;  3NSK A;  1CLM A;  4ORA B;  5DKN A;  2Y1M A;  3UNW A;  3RM1 A;  3QRX A;  2Y4Q A;  4FTG A;  4QJ3 B;  2JTZ A;  3L4L A;  1YRU B;  2BBM A;  1S26 D;  4GUK A;  1JF2 A;  1D1O A;  2LMV A;  1IQ5 A;  1QV0 A;  2KPH A;  4DCK A;  2JWW A;  3BXK A;  4GBA A;  1XK4 C;  3B86 A;  2JZI A;  3CWG A;  3CZ1 A;  3DF0 A;  1OOG A;  2K7C A;  5I2O A;  3S0B A;  1LA3 A;  2L5Y A;  3CR2 A;  1JBA A;  3LK0 A;  1PSR A;  4MVF A;  2OTG C;  3DVM A;  1TTX A;  1UUR A;  3I5G B;  1XFY O;  4PE1 A;  2PAL A;  2MHH A;  1OQP A;  3I5F B;  1LKJ A;  2KNE A;  2R2I A;  2O60 A;  1TRF A;  2K2F A;  3JVT C;  1NUB A;  4I5N B;  1K2H A;  3I5I B;  2KQY A;  1NX3 A;  2M9G A;  1WLZ A;  1F55 A;  1B7T Z;  1IWQ A;  1IGV A;  1IG5 A;  1PVB A;  1AJ4 A;  1X02 A;  2ERB A;  2JPO A;  3CS1 A;  3S0E A;  4N1G A;  1Z2C B;  4PE0 A;  2MBX A;  2H61 A;  1U5I A;  1DJX A;  2KBI A;  4OR9 B;  3CDN A;  5J3X A;  4F0Z B;  1DJW A;  3OHM B;  3UO9 A;  1J7R A;  1PSB A;  3JTD C;  1RFJ A;  2EHB A;  2LLU A;  3VRN A;  4CFQ A;  1DVI A;  1BR4 B;  2M7N A;  1DGV A;  3EVU A;  1JF0 A;  3SG5 A;  1JFK A;  1CDL A;  1OOI X;  1REC A;  2AAO A;  1JSA A;  2KFF A;  5I2Q A;  1KWO C;  1YX8 A;  4AOM A;  2BKI B;  3S0G A;  2HQ8 A;  1MXE A;  2MLF C;  1GQM A;  1MUX A;  3I5H B;  4NDB A;  1SBJ A;  3CZT X;  5HL1 A;  1IIO A;  2BCX A;  1CFF A;  3TDU A;  2BAP A;  1R6P A;  2ZNE A;  1KQV A;  3TDI A;  3R1P A;  1AHR A;  1KK8 B;  3O4Y A;  3FS7 A;  5HKY A;  3F45 A;  2I2R E;  4OCI A;  3S0A A;  3V2L A;  2WOS A;  1K9P A;  2BL0 C;  3A4U B;  3PJI A;  1YUR A;  1OE9 B;  4M2Q A;  2BEC A;  3D10 A;  2M7L A;  2LP2 A;  2CT9 A;  3TUY C;  1VRK A;  2HQW A;  3BYA A;  3WHU B;  1CNP A;  1DF0 B;  1K90 D;  3C1V A;  2YGU A;  4OV2 A;  3PM2 A;  3SS5 A;  2GTE A;  2BCB A;  2WCE A;  2GGZ A;  5HKZ A;  3DXL A;  1N65 A;  1QX2 A;  4XYN A;  1DJH A;  1SW8 A;  1B7T Y;  2Y1N A;  1Y1U A;  3AAK A;  4MEW A;  1JWD A;  4GGF C;  3WHT B;  2BBN A;  3HX4 A;  5EL2 A;  3ZWH A;  5B8I B;  1SK6 D;  4P2Y B;  2KI4 C;  1S1E A;  3NSL A;  1IJ5 A;  1K95 A;  1QXP A;  2F3Z A;  3PAT A;  1BMO A;  3S0F A;  4QJ5 B;  2I18 A;  3LK1 A;  1TNW A;  1L2O C;  3GK4 X;  2KHN A;  2LMU A;  2M8U A;  2WC5 A;  3PSR A;  3E3R A;  4YRU A;  3Q8I A;  4YGB B;  1K9K A;  4AQJ A;  5I94 A;  2L2C A;  1SCM B;  4MSP A;  1J55 A;  5HYD A;  2Q91 A;  5JJG A;  2LLT A;  3IQQ A;  1CB1 A;  1W7J B;  2EGD A;  1IJ6 A;  3VRR A;  1CFD A;  1SSE B;  4INX A;  1F4Q A;  4PE7 A;  3SJS A;  2QEO A;  1C3Z A;  4CID A;  1KFU L;  1UHH A;  4YBH B;  2LUX A;  1FI5 A;  1UP5 A;  1SMG A;  3IQO A;  4PHN A;  1SYM A;  2LM5 A;  1AJ5 A;  1XVJ A;  2KOT A;  1WRL A;  1FBV A;  2KFH A;  4GAO A;  1QX5 B;  3TS5 C;  2JNF A;  3D75 A;  1AVS A;  1PRW A;  1EL4 A;  2QEB A;  1IRJ A;  2F8P A;  2KAX A;  4DS7 A;  5AFP A;  1F71 A;  1FW4 A;  1ODB A;  2ZN9 A;  5KSZ A;  3OBV A;  1K96 A;  2P6B B;  2LP3 A;  2L98 A;  2EC6 B;  1SL8 A;  3BUX B;  2LUC A;  1QWV A;  4XJK A;  1CDM A;  5FI6 A;  1JFJ A;  4MBE A;  1TUJ A;  5BPJ A;  1F4O A;  4I5K A;  1J7Q A;  1S3P A;  2KGB C;  2NZ0 A;  5CSF A;  5ER5 A;  1XFZ O;  1HQV A;  1B8L A;  1SL7 A;  2QDI A;  1SR6 C;  3EVV A;  4OKH A;  2F2P A;  2QEH A;  4ORB B;  1SL9 A;  1QAT A;  5HLO A;  3PAL A;  1C7V A;  4OZD A;  4UPG A;  2COL B;  1CLL A;  3EK4 A;  1RK9 A;  2L0P A;  4DUQ A;  1Y0V H;  2K2A A;  1BOD A;  3L47 A;  3WNX B;  1DJI A;  3BFA A;  2WOR A;  3FWB A;  1NP8 A;  3CR4 X;  1TOP A;  5G08 A;  1E8A A;  3PN7 B;  3KHE A;  3SG7 A;  2KAY A;  1ZUZ A;  3JTD B;  3B7A A;  1PUL A;  3N7H A;  3VRO A;  2M1U A;  1F8H A;  1K8U A;  2NCO A;  3FE8 A;  4PDZ A;  2V53 A;  2H61 C;  2I7A A;  3BUW B;  1B47 A;  2HET A;  4YGC B;  1UHI A;  1YR5 A;  2KSP A;  1NPQ A;  3CLN A;  3VRQ A;  3EVR A;  3SG4 A;  3TDZ A;  4U8D A;  4MRX A;  3H4S E;  5AER A;  1GM0 A;  2JT0 A;  1QV1 A;  1Y1A A;  2L50 A;  1A03 A;  1YVL A;  2WCF A;  3LL8 B;  1UUS A;  1TN4 A;  2WND A;  3CYZ A;  5HKW A;  3S0D A;  1CDP A;  3WXA A;  1CKK A;  1P28 A;  3R1O A;  1QTX A;  2AUC A;  1IKU A;  1S6J A;  1XK4 A;  1J7P A;  2TN4 A;  2ZN8 A;  3BQ3 A;  1DGU A;  3CAB A;  1QIW A;  3B6X A;  1H8B A;  3OGN A;  1NCY A;  1SNL A;  1KK7 Y;  1NX1 A;  1RRO A;  2Y5I A;  4ZCV A;  2JT8 A;  5AXI A;  1YRT B;  4ORC B;  1WRK A;  3IVT A;  1LVC D;  3KPX A;  1F54 A;  1XFR A;  4ETO A;  1NX2 A;  1CLB A;  1OMD A;  1JUO A;  5CSI A;  1MF8 B;  1RWY A;  1C3Y A;  3BFH A;  3I5G C;  1J1E A;  4JKT A;  2L4I A;  3LLE A;  4MZJ A;  1BOC A;  1XO5 A;  2KI6 D;  2GV5 A;  1LXF C;  2H2K A;  1WRZ A;  1AUI B;  1EH2 A;  4PE4 A;  3I5F C;  1NIW A;  2MA2 A;  4WQ3 A;  1NCZ A;  1A4P A;  1LIN A;  2SAS A;  1B1G A;  3I5I C;  2FCD A;  1SCV A;  1FI6 A;  5TNC A;  3CGA A;  1TNP A;  1T14 A;  2M1K B;  2PYQ A;  4I5L B;  3GK1 A;  4M2O A;  1BT6 A;  1AK8 A;  1W9Z A;  1Y1X A;  1IQ3 A;  2G2B A;  2K7B A;  2LAN A;  3SG2 A;  5F6T A;  1C07 A;  4JPZ B;  1B9A A;  1ZFS A;  1LA0 A;  5FI2 A;  2BE4 A;  2JOJ A;  2LHI A;  4MRY A;  2SCP A;  4XJK B;  1CFC A;  1DEL A;  2LE9 B;  2OS8 B;  1KFU S;  4HRH A;  5DKQ A;  2CXJ A;  2D8N A;  1Z4H A;  1J7O A;  2LVI A;  4GFT A;  2BCA A;  1KQM B;  1B4C A;  1QLK A;  2ZRT A;  3DZT A;  1V1G A;  1DJZ A;  3VB1 A;  1MQ1 A;  5ER4 X;  2KI6 C;  1NSH A;  1OMR A;  4N5X A;  1QX7 A;  5K89 A;  3I5H C;  2LVJ A;  5JOL A;  2LAP A;  2WC6 A;  2LLS A;  4USL A;  1WDC B;  5IBW A;  1SY9 A;  5D69 A;  4PHK A;  4C0J A;  1KSM A;  1UHN A;  1KK8 C;  2O5G A;  1DJY A;  1A2X A;  1ZOT B;  4ZCU A;  1YVH A;  4PHM A;  1CMF A;  3BJH A;  2JRF A;  2JPT A;  2FOT A;  4YI8 A;  2FJY A;  3EK7 A;  2K0J A;  3BUN B;  2LV7 A;  1BR1 B;  4MZK A;  2CCM A;  5AEQ A;  4GGF A;  2ZRS A;  3K21 A;  2JXL A;  1WY9 A;  1G8I A;  2HPS A;  1H4B A;  1SPY A;  3O4X A;  2LCP A;  2WCM A;  4DRW A;  1XYD A;  4FQO A;  3SG3 A;  1EXR A;  1OW4 A;  1TCF A;  2I94 A;  3GK2 A;  1F70 A;  3VRP A;  2LVK A;  1OOH A;  2L5X B;  1K9U A;  1OMV A;  1EJ3 A;  1KFX L;  1LS8 A;  4C0K A;  1SRA A;  3DD4 A;  3DVE A;  1KK7 Z;  1N0Y A;  2KGR A;  1ALW A;  1G4Y R;  4R1E A;  2G9B A;  4MN0 A;  2LNK A;  1Q80 A;  1S5G Z;  1PVA A;  3OX5 A;  1DT7 B;  3M0W A;  2OTG B;  3SIB A;  1SCM C;  1M46 A;  3FE9 A;  1ORG A;  1B8R A;  5AAN A;  3JVT B;  1QLS A;  1DC1 A;  2QEV A;  3R1V A;  4HSZ A;  1C7W A;  1YUS A;  1A29 A;  4YGD B;  2ZFD A;  3SG6 A;  2KYF A;  1OZS A; 
#chains in the Genus database with same CATH homology
 4AQI A;  1TNQ A;  3KO0 A;  4NDD A;  5KTY A;  1R2U A;  1XFV O;  1BF5 A;  2CBL A;  2NXQ A;  3CTN A;  3DVJ A;  1AP4 A;  4OVN F;  3D0Y B;  1KSO A;  1FF1 A;  1TNX A;  2JUL A;  1QS7 A;  2A4J A;  2HF5 A;  4DIR A;  1G33 A;  2F3Y A;  1JC2 A;  1IH0 A;  1YTZ C;  5KU1 A;  2LVV A;  1PK0 D;  1TCO B;  1CMG A;  1KWO B;  3BOW A;  2L2E A;  4BY5 A;  2GGM A;  4QJ4 B;  1RTP 1;  1QJT A;  3TZ1 A;  2EC6 C;  3MSE B;  2NCP A;  1GJY A;  2F2O A;  2JNX A;  4A4C A;  1DJG A;  1CTR A;  1UHJ A;  2B1U A;  2KBM A;  1OZO A;  2M0R A;  2PVB A;  2WC8 A;  2FCE A;  5I8N A;  1B8C A;  2JQ6 A;  1HT9 A;  1M63 B;  1NYA A;  2DOQ A;  2JT3 A;  3NSI A;  1RJV A;  1BLQ A;  2BE6 A;  2KFG A;  2M29 A;  3A8R A;  1L7Z A;  2F33 A;  4A4B A;  1OSA A;  2PRU A;  5HLV A;  2BL0 B;  1W7I B;  1ZMZ A;  4IL1 A;  4PAL A;  2LMT A;  4HRG A;  4YGA A;  4Q04 A;  1S5G Y;  1XFW O;  1ZAC A;  1QIV A;  2ZND A;  3EKH A;  4WRI A;  3TUY B;  1FPW A;  1SKT A;  4E68 A;  3PN7 C;  1BG1 A;  1YUT A;  3OB1 B;  1A75 A;  2FJU B;  3EKJ A;  1M31 A;  1DTL A;  1UHK A;  4D1E A;  4GNK B;  4L9M A;  3KEV A;  1CDN A;  2IS9 A;  5CSJ A;  1EG4 A;  4N1F A;  2KI4 B;  2LHL A;  2BKH B;  5DKR A;  3D0Y A;  2CTN A;  1KCY A;  1S36 A;  3HCM A;  4TNC A;  4CPV A;  1L2O B;  1GGW A;  3AKA A;  3PLF B;  4I5J A;  5I2L A;  2KYC A;  1Y6W A;  4M2P A;  4HRE E;  1MHO A;  3OX6 A;  3KF9 A;  4NDC A;  1EG3 A;  3BUM B;  3BUO B;  4JQ0 D;  2ISD A;  1TIZ A;  1MWN A;  1QAS A;  3O78 A;  5PAL A;  2AMI A;  5CSN A;  5FYX A;  3VGO A;  2PSR A;  3PM8 A;  2MJW B;  2E6W A;  3NSO A;  3GOF A;  1OOJ A;  1KFX S;  3AKB A;  3OB2 B;  3FIA A;  1QVI Z;  2OPO A;  4WQ2 A;  5CPV A;  3TS5 B;  1S6C A;  2MLE C;  1YUU A;  1XFU O;  2KQ6 A;  1N2D A;  1CM1 A;  1M45 A;  2M3W A;  2M49 B;  2PAS A;  2K8M B;  4PHJ A;  4C0L A;  2QPT A;  1S6I A;  2K7O A;  1MR8 A;  1DMO A;  3PFV A;  4CLN A;  2PMY A;  1YX7 A;  4JWQ A;  4NQG A;  1J1D A;  2L4H A;  1GGZ A;  4MLW A;  1CM4 A;  1NCX A;  2KAV A;  3BOW B;  2MAZ A;  2MRD A;  3AAJ A;  4CFR A;  2VRG A;  1SR6 B;  1CFP A;  1K94 A;  4P5O E;  2JU0 A;  3DF0 B;  2OS8 C;  2K7D A;  2KDH A;  1BJF A;  5D7F A;  1KQM C;  1XFX O;  4MZL A;  3OP0 A;  4GPL B;  2WCB A;  4PCW A;  3O6B A;  3IF7 A;  1NX0 A;  1WDC C;  1PAL A;  3FWC A;  1V1F A;  2CNP A;  2JC2 A;  3NXA A;  1NWD A;  2QAC A;  3O2P A;  1K93 D;  3SIA A;  2K61 A;  2RGI A;  1DF0 A;  1ALV A;  1U5I B;  2JTT A;  3EK8 A;  2M97 A;  4GGN A;  3RLZ A;  1WLM A;  4BY4 A;  1A75 B;  3ZNI A;  3LCP C;  2LC5 A;  2NLN A;  2Q4U A;  3DVK A;  3CR5 X;  1UWO A;  1M39 A;  4ICB A;  4YI9 A;  2E30 A;  5GQQ C;  1QVI Y;  2L51 A;  1XA5 A;  1BU3 A;  4YGE B;  3ICB A;  2ZKM X;  1MXL C;  2JXC A;  3NSK A;  1CLM A;  4ORA B;  5DKN A;  2Y1M A;  3RM1 A;  3QRX A;  2Y4Q A;  4FTG A;  4QJ3 B;  2JTZ A;  1YRU B;  2BBM A;  1S26 D;  4GUK A;  1JF2 A;  1D1O A;  2LMV A;  1IQ5 A;  1QV0 A;  4DCK A;  2JWW A;  3BXK A;  4GBA A;  1XK4 C;  2JZI A;  3CWG A;  3DF0 A;  2K7C A;  5I2O A;  1LA3 A;  3CR2 A;  1JBA A;  3LK0 A;  1PSR A;  4MVF A;  2OTG C;  3DVM A;  1TTX A;  1UUR A;  3I5G B;  1XFY O;  4PE1 A;  2PAL A;  2MHH A;  1OQP A;  3I5F B;  1LKJ A;  2KNE A;  2R2I A;  2O60 A;  1TRF A;  2K2F A;  3JVT C;  1NUB A;  4I5N B;  1K2H A;  3I5I B;  2KQY A;  1NX3 A;  2M9G A;  1WLZ A;  1F55 A;  1B7T Z;  1IWQ A;  1IGV A;  1IG5 A;  1PVB A;  1AJ4 A;  1X02 A;  3CS1 A;  4N1G A;  4PE0 A;  2MBX A;  2H61 A;  1U5I A;  1DJX A;  2KBI A;  4OR9 B;  5J3X A;  4F0Z B;  1DJW A;  3OHM B;  1J7R A;  1PSB A;  3JTD C;  1RFJ A;  2EHB A;  2LLU A;  3VRN A;  4CFQ A;  1DVI A;  1BR4 B;  2M7N A;  1DGV A;  3EVU A;  1JF0 A;  3SG5 A;  1JFK A;  1CDL A;  2AAO A;  1REC A;  1JSA A;  2KFF A;  5I2Q A;  1KWO C;  1YX8 A;  4AOM A;  2BKI B;  2HQ8 A;  1MXE A;  2MLF C;  1GQM A;  1MUX A;  3I5H B;  4NDB A;  1SBJ A;  3CZT X;  2BCX A;  1CFF A;  3TDU A;  1R6P A;  2ZNE A;  1KQV A;  3TDI A;  1AHR A;  1KK8 B;  3O4Y A;  3FS7 A;  5HKY A;  3F45 A;  2I2R E;  4OCI A;  2WOS A;  1K9P A;  2BL0 C;  3A4U B;  1YUR A;  1OE9 B;  4M2Q A;  2BEC A;  3D10 A;  2M7L A;  2LP2 A;  2CT9 A;  3TUY C;  1VRK A;  2HQW A;  3BYA A;  3WHU B;  1CNP A;  1DF0 B;  1K90 D;  3C1V A;  4OV2 A;  2BCB A;  2WCE A;  2GGZ A;  5HKZ A;  1N65 A;  1QX2 A;  4XYN A;  1DJH A;  1SW8 A;  1B7T Y;  2Y1N A;  1Y1U A;  3AAK A;  4MEW A;  1JWD A;  4GGF C;  3WHT B;  2BBN A;  3HX4 A;  3ZWH A;  5B8I B;  1SK6 D;  4P2Y B;  2KI4 C;  1S1E A;  3NSL A;  1IJ5 A;  1K95 A;  1QXP A;  2F3Z A;  3PAT A;  1BMO A;  4QJ5 B;  2I18 A;  3LK1 A;  1TNW A;  1L2O C;  3GK4 X;  2KHN A;  2LMU A;  2M8U A;  3PSR A;  4YRU A;  3E3R A;  4AQJ A;  4YGB B;  1K9K A;  4MSP A;  1SCM B;  1J55 A;  5HYD A;  2Q91 A;  5JJG A;  2LLT A;  3IQQ A;  1CB1 A;  1W7J B;  2EGD A;  1IJ6 A;  3VRR A;  1CFD A;  1F4Q A;  4PE7 A;  3SJS A;  4CID A;  1KFU L;  1UHH A;  4YBH B;  2LUX A;  1FI5 A;  1UP5 A;  1SMG A;  3IQO A;  4PHN A;  1SYM A;  2LM5 A;  1AJ5 A;  1XVJ A;  2KOT A;  1WRL A;  1FBV A;  2KFH A;  4GAO A;  1QX5 B;  3TS5 C;  2JNF A;  1AVS A;  1PRW A;  1EL4 A;  1IRJ A;  2F8P A;  2KAX A;  4DS7 A;  5AFP A;  1F71 A;  1FW4 A;  1ODB A;  2ZN9 A;  5KSZ A;  1K96 A;  2P6B B;  2LP3 A;  2L98 A;  2EC6 B;  1SL8 A;  3BUX B;  2LUC A;  4XJK A;  1CDM A;  1JFJ A;  4MBE A;  5BPJ A;  1F4O A;  4I5K A;  1J7Q A;  1S3P A;  2KGB C;  2NZ0 A;  5CSF A;  5ER5 A;  1XFZ O;  1HQV A;  1B8L A;  1SL7 A;  1SR6 C;  3EVV A;  4OKH A;  2F2P A;  4ORB B;  1SL9 A;  1QAT A;  5HLO A;  3PAL A;  1C7V A;  4UPG A;  2COL B;  1CLL A;  3EK4 A;  1RK9 A;  2L0P A;  4DUQ A;  1Y0V H;  2K2A A;  1BOD A;  3WNX B;  1DJI A;  2WOR A;  3FWB A;  1NP8 A;  3CR4 X;  1TOP A;  5G08 A;  1E8A A;  3PN7 B;  3KHE A;  3SG7 A;  2KAY A;  1ZUZ A;  3JTD B;  1PUL A;  3VRO A;  2M1U A;  1F8H A;  1K8U A;  2NCO A;  4PDZ A;  2V53 A;  2H61 C;  2I7A A;  3BUW B;  1B47 A;  2HET A;  4YGC B;  1UHI A;  1YR5 A;  2KSP A;  1NPQ A;  3CLN A;  3VRQ A;  3EVR A;  3SG4 A;  3TDZ A;  4U8D A;  4MRX A;  3H4S E;  5AER A;  2JT0 A;  1QV1 A;  1Y1A A;  2L50 A;  1A03 A;  1YVL A;  2WCF A;  3LL8 B;  1UUS A;  1TN4 A;  2WND A;  5HKW A;  1CDP A;  3WXA A;  1CKK A;  1QTX A;  2AUC A;  1IKU A;  1S6J A;  1XK4 A;  1J7P A;  2TN4 A;  2ZN8 A;  3BQ3 A;  1DGU A;  1QIW A;  1H8B A;  1NCY A;  1SNL A;  1KK7 Y;  1NX1 A;  1RRO A;  2Y5I A;  4ZCV A;  2JT8 A;  5AXI A;  1YRT B;  4ORC B;  1WRK A;  1LVC D;  3KPX A;  1F54 A;  4ETO A;  1NX2 A;  1CLB A;  1OMD A;  1JUO A;  5CSI A;  1MF8 B;  1RWY A;  3I5G C;  1J1E A;  2L4I A;  3LLE A;  4MZJ A;  1BOC A;  1XO5 A;  2KI6 D;  2GV5 A;  1LXF C;  2H2K A;  1WRZ A;  1AUI B;  1EH2 A;  4PE4 A;  3I5F C;  1NIW A;  2MA2 A;  4WQ3 A;  1NCZ A;  1A4P A;  1LIN A;  2SAS A;  1B1G A;  3I5I C;  2FCD A;  1SCV A;  1FI6 A;  5TNC A;  3CGA A;  1TNP A;  2M1K B;  4I5L B;  3GK1 A;  4M2O A;  1BT6 A;  1AK8 A;  1Y1X A;  1IQ3 A;  2G2B A;  2K7B A;  2LAN A;  3SG2 A;  5F6T A;  1C07 A;  4JPZ B;  1B9A A;  1ZFS A;  1LA0 A;  2BE4 A;  2JOJ A;  2LHI A;  4MRY A;  2SCP A;  4XJK B;  1CFC A;  2LE9 B;  2OS8 B;  1KFU S;  4HRH A;  5DKQ A;  2CXJ A;  2D8N A;  1J7O A;  2LVI A;  4GFT A;  2BCA A;  1KQM B;  1B4C A;  1QLK A;  2ZRT A;  1V1G A;  1DJZ A;  1MQ1 A;  5ER4 X;  2KI6 C;  1NSH A;  1OMR A;  4N5X A;  1QX7 A;  5K89 A;  3I5H C;  2LVJ A;  5JOL A;  2LAP A;  4USL A;  2LLS A;  5IBW A;  1WDC B;  1SY9 A;  5D69 A;  4PHK A;  4C0J A;  1KSM A;  1UHN A;  1KK8 C;  2O5G A;  1DJY A;  1A2X A;  1ZOT B;  4ZCU A;  1YVH A;  4PHM A;  1CMF A;  2JRF A;  2JPT A;  2FOT A;  4YI8 A;  3EK7 A;  2K0J A;  3BUN B;  2LV7 A;  1BR1 B;  4MZK A;  2CCM A;  5AEQ A;  4GGF A;  2ZRS A;  3K21 A;  2JXL A;  1WY9 A;  1G8I A;  2HPS A;  1H4B A;  1SPY A;  2LCP A;  4DRW A;  1XYD A;  4FQO A;  3SG3 A;  1EXR A;  1TCF A;  2I94 A;  3GK2 A;  1F70 A;  3VRP A;  2LVK A;  2L5X B;  1K9U A;  1OMV A;  1EJ3 A;  1KFX L;  4C0K A;  1SRA A;  3DD4 A;  3DVE A;  1KK7 Z;  1N0Y A;  2KGR A;  1ALW A;  1G4Y R;  4R1E A;  2G9B A;  4MN0 A;  2LNK A;  1Q80 A;  1S5G Z;  1PVA A;  3OX5 A;  1DT7 B;  3M0W A;  2OTG B;  3SIB A;  1SCM C;  1M46 A;  1B8R A;  5AAN A;  3JVT B;  1QLS A;  4HSZ A;  1C7W A;  1YUS A;  1A29 A;  4YGD B;  2ZFD A;  3SG6 A;  2KYF A;  1OZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...