2M49B

Structural insights into human s100b and basic fibroblast growth factor (fgf2) interaction
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/metal binding protein
molecule keywords Fibroblast growth factor 2
publication title Structural insights into the interaction of human S100B and basic fibroblast growth factor (FGF2): Effects on FGFR1 receptor signaling
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m49B00
3E3RA 2L98A 2P6BB 1TNWA 1IQ3A 1Y1AA 5CSJA 1M45A 1SL7A 3EVVA 1S6JA 4PE7A 3SG4A 1B7TZ 3GK4X 4L9MA 5HKWA 1DF0A 1PSBA 2JZIA 2LHIA 3JVTC 3C1VA 4NQGA 2KAYA 1SL9A 5KU1A 1J55A 2L0PA 1EJ3A 5IBWA 2WORA 2NZ0A 4DIRA 1OE9B 2M3WA 4DS7A 2IS9A 1UUSA 3LK0A 1JUOA 1D1OA 4DCKA 2F3YA 3SIAA 1XFXO 1XFWO 1KQMC 1CKKA 1GQMA 2VRGA 4YRUA 1Y0VH 1F70A 3OP0A 4I5LB 4C0JA 2H61A 1CFPA 4MLWA 3F45A 1QX5B 1NX1A 3HX4A 3SG5A 3PFVA 1BODA 1K9PA 2HF5A 1B8CA 1CLBA 2MA2A 3EKHA 2KOTA 1UP5A 1OZSA 1SYMA 3NSOA 5GQQC 2M0RA 4ORBB 2LLTA 4QJ5B 2ZNEA 1KWOC 3GK2A 1B8LA 1B9AA 3MSEB 3VGOA 3DF0B 1S5GZ 2Y4QA 1FBVA 1C07A 3LLEA 3D0YB 1YTZC 2LLUA 1CFDA 1AK8A 3O2PA 4YI8A 2MBXA 1CLMA 1SNLA 5AXIA 1N2DA 3BUMB 2LVJA 3SIBA 3IQOA 4QJ4B 2RGIA 3VRRA 4CIDA 1LINA 1ZFSA 3TUYB 4MVFA 1J7RA 1KK7Y 2BL0C 2V53A 2BE6A 3PALA 3VRNA 1KQVA 3LK1A 1A4PA 2KQ6A 1PALA 4GFTA 4GPLB 3I5GC 5ER5A 5ER4X 2FJUB 3SG7A 1YX7A 1B8RA 2LCPA 1CFCA 4N1FA 3LCPC 2LVKA 1A75B 5CSFA 1EG4A 1KK8B 1QJTA 1VRKA 1SW8A 2H61C 2HQ8A 2I18A 2M49B 3I5FC 1IKUA 1DJXA 3A8RA 5HLOA 1IWQA 3K21A 1WRLA 2LLSA 4PALA 4PE0A 1R2UA 2Q91A 1BMOA 2BCAA 3WHUB 5B8IB 2JT3A 4TNCA 3GK1A 3I5HB 1UHNA 1JSAA 1QIWA 2E6WA 1YURA 3RLZA 2LE9B 1K2HA 1K90D 3BUOB 4FQOA 2L4HA 4PHKA 3JTDB 1CLLA 2LVVA 2LMVA 2CXJA 1SL8A 1RTP1 4YGAA 3SG3A 1XK4A 1A03A 4JPZB 1XYDA 1AP4A 1MHOA 1PSRA 1CMFA 1K9KA 1M46A 1MF8B 1CTRA 2MLFC 3NSIA 1OMVA 1XO5A 3OHMB 1JBAA 2JOJA 2PALA 1XVJA 2G2BA 3BQ3A 1K94A 4PE1A 1GGWA 2SCPA 1GJYA 3BOWB 2M7LA 1F55A 3CWGA 1A29A 1CMGA 2BCBA 2CT9A 2QACA 4XJKB 1NIWA 2QPTA 1A75A 1TIZA 1QV1A 4F0ZB 1Q80A 2K8MB 1F4OA 3SG2A 2K7CA 1LXFC 1WY9A 1SR6B 1YVLA 1ZOTB 3CGAA 5D69A 5HLVA 1YRTB 3IQQA 1IRJA 4I5KA 2EC6B 3DVJA 1WRZA 1F4QA 2L51A 1J1EA 1V1FA 1MXLC 1K93D 3ZWHA 1G4YR 4GBAA 4JQ0D 2L2EA 3OB2B 3EVUA 1JF0A 2MRDA 1BLQA 2KQYA 5D7FA 1G8IA 1L2OB 1DGVA 1K9UA 2WOSA 3OX5A 3PM8A 2LMUA 1SY9A 4I5NB 4HRHA 2LVIA 2LUCA 1SKTA 4GAOA 1S6CA 1XK4C 2JT8A 4NDBA 1SCMB 4P2YB 3TUYC 1UHJA 2AUCA 2FOTA 1DT7B 1QVIZ 1QTXA 4XJKA 2JU0A 3CTNA 2FCEA 4HREE 1K95A 4AOMA 1AJ4A 1Y1XA 2KYFA 1UURA 4NDCA 5AANA 1DJHA 1IJ6A 3CR2A 2NLNA 1KK8C 1NX0A 3BUNB 1CDPA 1UHKA 1TNQA 1DJZA 3DD4A 2FCDA 1N0YA 2BKHB 1CFFA 1QXPA 2DOQA 2ZFDA 1CDMA 1NX3A 1TN4A 2K2FA 1SCVA 2KFHA 3A4UB 5I2QA 4MEWA 1Y6WA 1N65A 3PN7B 4HRGA 1BR4B 2BCXA 1OMDA 2K61A 2ZN9A 3M0WA 4DUQA 3JTDC 3SJSA 4OR9B 2M29A 3CR5X 5CPVA 1TRFA 2KHNA 4NDDA 2CBLA 3TDUA 4CLNA 1W7IB 3AKAA 1SK6D 2I7AA 1X02A 1S6IA 4BY4A 1DGUA 2M1KB 5I2OA 2JT0A 2M8UA 1CB1A 3DVMA 2GV5A 3KEVA 3NSKA 1NX2A 3IF7A 5I2LA 1C7WA 4D1EA 4P5OE 2CCMA 2PRUA 1TCFA 3GOFA 2BKIB 2LANA 2KGRA 4QJ3B 1U5IB 1EL4A 1WDCC 3KPXA 3H4SE 4WRIA 1SMGA 4Q04A 1PVAA 2Y1NA 1SR6C 4AQJA 1OMRA 2F8PA 1E8AA 2I94A 3NXAA 1AJ5A 4ORCB 1M63B 2KI6D 3ICBA 2ZRTA 5JJGA 1MR8A 3TDZA 2Y1MA 2EC6C 2JTTA 5AFPA 1JWDA 4M2OA 1YUUA 4UPGA 1J7PA 1EXRA 1ZMZA 1PVBA 5KTYA 1WLZA 1ZACA 3BUXB 1J7OA 4I5JA 4FTGA 1NCZA 1CNPA 1FI6A 2HQWA 1EH2A 2K7BA 3EVRA 4YGEB 4DRWA 2E30A 2LHLA 1K8UA 1L2OC 3DF0A 3D0YA 1FF1A 3PLFB 1S26D 1SCMC 2O60A 1B4CA 3BYAA 4YBHB 2JTZA 2F2PA 3O78A 1YUSA 4XYNA 1PK0D 2GGZA 1BR1B 2WCBA 2JNXA 5J3XA 2LP2A 1NPQA 2ZRSA 5K89A 3FIAA 1B7TY 4MZLA 1NCXA 4YGCB 3TDIA 2PSRA 2CTNA 3KO0A 3AKBA 4MSPA 2WCFA 1LKJA 3QRXA 3VRPA 1JF2A 3CS1A 1WRKA 2BBNA 1IGVA 1QS7A 4OCIA 1M39A 2O5GA 3SG6A 1FPWA 4HSZA 3BXKA 1MQ1A 5HKYA 1PRWA 1KFUS 2PVBA 1KK7Z 2M9GA 2OTGB 4U8DA 4CFRA 3PN7C 3FS7A 1KFXL 1YRUB 3PATA 1IH0A 4PHNA 2MHHA 2WCEA 2AAOA 1W7JB 3CLNA 3TS5B 1MXEA 1KFXS 2BL0B 3PSRA 3RM1A 2KFGA 1JFJA 2JXCA 1CDLA 1B47A 2JULA 2TN4A 4GUKA 1HT9A 2F33A 2L50A 4PDZA 3BUWB 4GGNA 3BOWA 4C0LA 5BPJA 1DVIA 1S5GY 5TNCA 2KAXA 5CSNA 1FW4A 1L7ZA 2L4IA 2LUXA 2CNPA 1IQ5A 3TZ1A 2KI6C 1BJFA 2HPSA 2JWWA 1F8HA 2KI4B 4MZKA 1G33A 4YGDB 1DTLA 1YUTA 1BU3A 1DJGA 1EG3A 1F54A 1QIVA 2M97A 2OS8B 1H8BA 4CFQA 2KSPA 4C0KA 2JPTA 4ZCUA 1YX8A 2KBIA 1M31A 1QASA 1PULA 3O4YA 4PCWA 3FWBA 3I5HC 4MBEA 4GGFA 1RWYA 1XFVO 2BECA 1MUXA 2SASA 2PMYA 3HCMA 5F6TA 1OQPA 4ORAB 1RK9A 2F2OA 3KF9A 1DMOA 4BY5A 2KDHA 3FWCA 1H4BA 4PE4A 2M1UA 2PASA 2MLEC 4JWQA 2ZKMX 2NXQA 2I2RE 1C7VA 2Q4UA 1CM1A 1UWOA 3AAJA 2MJWB 2LMTA 3WXAA 2HETA 2Y5IA 3EK4A 5CSIA 4ZCVA 2JRFA 4WQ3A 2L5XB 1BG1A 1QX2A 2LNKA 4GNKB 4N1GA 1KCYA 2K7OA 3DVEA 1UHHA 2COLB 4M2PA 4MN0A 2LP3A 5DKNA 1NUBA 3DVKA 1J7QA 2OTGC 1QLKA 5PALA 1TTXA 3I5IB 5FYXA 1S3PA 5DKRA 3WHTB 1OSAA 1S1EA 3VRQA 1SBJA 2A4JA 2MAZA 1WLMA 1JC2A 4MRYA 1GGZA 3TS5C 2F3ZA 4GGFC 3JVTB 2WC8A 1YVHA 4USLA 1S36A 1SPYA 1AHRA 4IL1A 4A4CA 4YGBB 1NP8A 4MZJA 2BBMA 5I8NA 1J1DA 1XA5A 1CDNA 4A4BA 2KGBC 1F71A 1OZOA 2NCPA 1HQVA 4OV2A 1R6PA 1LA0A 1ALVA 1KQMB 1NYAA 2ZNDA 3OB1B 1DJWA 1ZUZA 3ZNIA 1U5IA 2KAVA 1CM4A 1JFKA 4ETOA 1BOCA 4M2QA 2GGMA 1QATA 2JC2A 1LVCD 5KSZA 5JOLA 5HKZA 2KNEA 2K0JA 1BT6A 4AQIA 2KI4C 2KYCA 1QLSA 1TCOB 3NSLA 3D10A 2LV7A 3OX6A 2OS8C 1IJ5A 1TNPA 1QVIY 1KFUL 2LC5A 3LL8B 5HYDA 2LAPA 2WNDA 2EGDA 4N5XA 5AERA 2JNFA 1QX7A 2OPOA 2JQ6A 3EKJA 2BE4A 3AAKA 1KWOB 5AEQA 1MWNA 2AMIA 1DJIA 1LA3A 1NWDA 4YI9A 1ALWA 4R1EA 2K2AA 1BF5A 1Y1UA 1SRAA 2D8NA 1DF0B 2K7DA 2B1UA 1UHIA 3KHEA 2M7NA 1TNXA 1YR5A 5DKQA 1XFUO 4ICBA 4OKHA 3CZTX 1FI5A 1XFYO 3EK8A 1NSHA 1XFZO 1WDCB 2R2IA 1ODBA 2H2KA 1V1GA 2G9BA 1KSOA 2LM5A 4PHJA 2KFFA 4PHMA 2ZN8A 1RJVA 4E68A 3I5GB 2EHBA 3O6BA 1AVSA 1IG5A 1TOPA 2JXLA 2ISDA 1AUIB 1RROA 4WQ2A 4CPVA 2KBMA 3VROA 1K96A 1B1GA 1RFJA 1NCYA 1KSMA 1OOJA 3I5FB 5G08A 3EK7A 4MRXA 1QV0A 3WNXB 1RECA 1DJYA 4OVNF 1A2XA 2NCOA 3I5IC 3CR4X
chains in the Genus database with same CATH superfamily
2P71A 3E3RA 2L98A 2P6BB 1TNWA 1IQ3A 1Y1AA 5CSJA 1M45A 1SL7A 1TWOA 3EVVA 1S6JA 4PE7A 3SG4A 1B7TZ 3GK4X 4L9MA 5HKWA 1DF0A 1PSBA 2JZIA 2LHIA 3JVTC 3C1VA 4NQGA 2KAYA 1SL9A 5KU1A 1J55A 2L0PA 1EJ3A 5IBWA 2WORA 1C3YA 2NZ0A 4DIRA 1OE9B 2M3WA 4DS7A 2IS9A 1UUSA 3LK0A 3Q8IA 1JUOA 1D1OA 4DCKA 2F3YA 3EG5B 3SIAA 1C3ZA 1XFXO 1XFWO 1KQMC 4OZDA 1CKKA 1GQMA 2VRGA 4YRUA 1Y0VH 1F70A 3BFAA 3OP0A 4I5LB 3D75A 4I5NB 2H61A 4C0JA 1CFPA 4MLWA 3F45A 1QX5B 1NX1A 3HX4A 3SG5A 3PFVA 1BODA 1K9PA 2HF5A 1B8CA 1CLBA 2MA2A 3EKHA 2KOTA 1UP5A 1OZSA 1SYMA 3S0EA 3NSOA 5GQQC 2M0RA 4ORBB 3L47A 2LLTA 4QJ5B 2ZNEA 1KWOC 3GK2A 3VB1A 1B8LA 1B9AA 3MSEB 3CZ0A 3VGOA 3DF0B 1S5GZ 2Y4QA 1FBVA 1QWVA 1C07A 3LLEA 3D0YB 1YTZC 2LLUA 1CFDA 1AK8A 3O2PA 4YI8A 2MBXA 1CLMA 1SNLA 5AXIA 1N2DA 3BUMB 2LVJA 3SIBA 3IQOA 4QJ4B 2RGIA 3VRRA 4CIDA 1LINA 1ZFSA 3TUYB 4MVFA 1J7RA 1KK7Y 2BL0C 2V53A 2BE6A 3PALA 2WCJA 3VRNA 1KQVA 3LK1A 1A4PA 2KQ6A 3L4LA 1PALA 4GFTA 4GPLB 3I5GC 5ER5A 5ER4X 2FJUB 3SG7A 1YX7A 1B8RA 2LCPA 1CFCA 4N1FA 3LCPC 4JD9A 2LVKA 1A75B 5CSFA 1DELA 1EG4A 3D77A 1KK8B 1QJTA 1VRKA 1SW8A 2H61C 2HQ8A 2I18A 2M49B 3I5FC 1IKUA 1DJXA 3A8RA 5HLOA 1IWQA 3K21A 1WRLA 2LLSA 4PALA 4PE0A 1R2UA 3CZ2A 2Q91A 1BMOA 2BCAA 3WHUB 5B8IB 2JT3A 4TNCA 3GK1A 3I5HB 1UHNA 3S0AA 1JSAA 1QIWA 2E6WA 1YURA 3RLZA 2LE9B 3S0DA 1K2HA 1K90D 3BUOB 4FQOA 2L4HA 4PHKA 3JTDB 3SS4A 1IIOA 1CLLA 2LVVA 2LMVA 2CXJA 1SL8A 1RTP1 4YGAA 3SG3A 1XK4A 1A03A 4JPZB 1XYDA 1AP4A 1MHOA 1PSRA 1CMFA 1K9KA 1M46A 1MF8B 1CTRA 2MLFC 3NSIA 1OMVA 1XO5A 3OHMB 1JBAA 2JOJA 2PALA 1XVJA 3B87A 2G2BA 3BQ3A 1K94A 4PE1A 1GGWA 2SCPA 1GJYA 3BOWB 2M7LA 2QEHA 3CWGA 2WCMA 1F55A 1A29A 1CMGA 2BCBA 2CT9A 2QACA 4XJKB 1NIWA 2QPTA 1A75A 1TIZA 1OOIX 1QV1A 4F0ZB 1Q80A 2K8MB 1F4OA 3SG2A 2K7CA 1GM0A 1LXFC 1WY9A 1SR6B 1YVLA 1ZOTB 3CGAA 3L4AA 5D69A 5HLVA 3UNWA 1YRTB 3IQQA 1IRJA 3R1VA 1Z2CB 4I5KA 2EC6B 3DVJA 1WRZA 1F4QA 2L51A 2QEOA 1J1EA 1V1FA 1MXLC 1K93D 3ZWHA 1G4YR 4GBAA 4JQ0D 2L2EA 3OB2B 3EVUA 1JF0A 3O4XA 2MRDA 1BLQA 2KQYA 5D7FA 1G8IA 1L2OB 1DGVA 1K9UA 2WOSA 3OX5A 3PM8A 2LMUA 1SY9A 2QEVA 4HRHA 2LVIA 3SS5A 2LUCA 1SKTA 4GAOA 1S6CA 1XK4C 2JT8A 4NDBA 1SCMB 4P2YB 1Z4HA 3TUYC 1UHJA 2AUCA 3DZTA 2FOTA 1DT7B 1QVIZ 1QTXA 4XJKA 2JU0A 3CTNA 2FCEA 4HREE 1K95A 4AOMA 1AJ4A 2ERBA 1Y1XA 3V2LA 4F7FA 4INXA 2KYFA 1UURA 4NDCA 5AANA 2GTEA 1DJHA 1IJ6A 3CR2A 3S0GA 1DEKA 2NLNA 1KK8C 1NX0A 1TUJA 3BUNB 3D73A 1CDPA 1UHKA 1TNQA 2WC6A 1DJZA 3I5IC 3DD4A 2FCDA 3N7HA 1N0YA 2BKHB 1CFFA 3D74A 1QXPA 2DOQA 2ZFDA 1CDMA 1NX3A 1TN4A 2K2FA 1SCVA 2KFHA 3A4UB 3UO9A 2KPHA 5I2QA 4MEWA 1Y6WA 1N65A 3PN7B 4HRGA 1BR4B 2BCXA 1OMDA 2K61A 2ZN9A 3M0WA 4DUQA 3JTDC 3SJSA 4OR9B 2M29A 3CR5X 5CPVA 1TRFA 2KHNA 4NDDA 2CBLA 3TDUA 4CLNA 1W7IB 3AKAA 1SK6D 2I7AA 1X02A 1S6IA 4BY4A 1DGUA 2M1KB 5I2OA 2JT0A 2M8UA 2H8VA 1CB1A 1T14A 3DVMA 2GV5A 1ORGA 3KEVA 3NSKA 1NX2A 3FE6A 3IF7A 5I2LA 1C7WA 4D1EA 4P5OE 2BNXA 2CCMA 2PRUA 1TCFA 3GOFA 2BKIB 2LANA 2KGRA 4QJ3B 1U5IB 1EL4A 1WDCC 3KPXA 3K1EA 3H4SE 4WRIA 1SMGA 2WCKA 1PVAA 2Y1NA 1SR6C 4Q04A 1OMRA 4AQJA 4IJ7A 2F8PA 1OOGA 1E8AA 2I94A 3NXAA 1AJ5A 4ORCB 1M63B 2KI6D 3ICBA 3R72A 2ZRTA 5JJGA 1MR8A 3TDZA 2Y1MA 1W9ZA 3RZSA 2EC6C 2KLDA 2JTTA 5AFPA 1JWDA 4M2OA 1YUUA 4UPGA 1J7PA 1EXRA 1ZMZA 1PVBA 2P70A 5KTYA 1WLZA 1ZACA 3BFHA 3BUXB 3B86A 4I5JA 1J7OA 4FTGA 1NCZA 1CNPA 3SS3A 1FI6A 2HQWA 1DQEA 1EH2A 2K7BA 3EVRA 4YGEB 4DRWA 2E30A 2LHLA 1K8UA 1L2OC 3DF0A 5D3OA 3D0YA 1FF1A 3PLFB 1S26D 1SCMC 2O60A 1B4CA 3BYAA 3NGVA 4YBHB 2JTZA 2F2PA 3O78A 1YUSA 1XFRA 4XYNA 1PK0D 2GGZA 1BR1B 2WCBA 2JNXA 2WC5A 5J3XA 2LP2A 1NPQA 2ZRSA 5K89A 3FIAA 1B7TY 4MZLA 5EL2A 1LS8A 1NCXA 4YGCB 3TDIA 2PSRA 2CTNA 3KO0A 3AKBA 4MSPA 2WCFA 1LKJA 3QRXA 3VRPA 1JF2A 3CS1A 1WRKA 2BBNA 1IGVA 1QS7A 4OCIA 1M39A 2O5GA 3SG6A 1FPWA 4HSZA 3BXKA 1MQ1A 5HKYA 1PRWA 1KFUS 2PVBA 1KK7Z 2M9GA 2OTGB 4U8DA 4CFRA 3PN7C 3FS7A 1KFXL 1YRUB 3PATA 1IH0A 4PHNA 1SSEB 2MHHA 2WCEA 2AAOA 1W7JB 3CLNA 3TS5B 1MXEA 5HL1A 1KFXS 4FQTA 2BL0B 3PSRA 3RM1A 5I94A 2KFGA 1JFJA 2JXCA 1CDLA 1B47A 2JULA 2TN4A 4GUKA 1HT9A 2F33A 2L50A 4PDZA 3R1PA 3BUWB 4GGNA 3BOWA 4C0LA 5BPJA 1DVIA 1S5GY 5TNCA 2KAXA 5CSNA 1FW4A 1L7ZA 2L4IA 2FJYA 2LUXA 2CNPA 1IQ5A 3TZ1A 2KI6C 1BJFA 2HPSA 2JWWA 1F8HA 2KI4B 4MZKA 1G33A 4YGDB 1DTLA 1YUTA 4JKTA 1BU3A 1DJGA 1EG3A 3CABA 3D78A 1QIVA 1F54A 2M97A 2OS8B 1H8BA 4CFQA 2KSPA 4C0KA 2JPTA 4ZCUA 1YX8A 2KBIA 1M31A 1QASA 1PULA 3O4YA 4PCWA 3FWBA 3I5HC 3NHIA 4MBEA 4GGFA 1RWYA 1XFVO 2BECA 1MUXA 2SASA 2PMYA 3HCMA 5FI7A 5F6TA 1OQPA 4ORAB 1RK9A 2F2OA 2L2CA 5FI2A 3KF9A 3DYEA 1DMOA 4BY5A 2KDHA 3CZ1A 3FWCA 5FI6A 1H4BA 4PE4A 2M1UA 2PASA 2MLEC 4JWQA 2ZKMX 1DC1A 2NXQA 3PM2A 2I2RE 3OBVA 1C7VA 3B88A 2Q4UA 1CM1A 1UWOA 3B7AA 3AAJA 2MJWB 2LMTA 3WXAA 2HETA 2Y5IA 3B6XA 3BFBA 3EK4A 5CSIA 4ZCVA 2JRFA 2QEBA 4WQ3A 2L5XB 3S0BA 1BG1A 3FE8A 3PJIA 1QX2A 2LNKA 4GNKB 4N1GA 1KCYA 2KLEA 2K7OA 3DVEA 1UHHA 2COLB 4M2PA 4MN0A 1TUZA 2LP3A 1NUBA 3DVKA 5DKNA 2OTGC 1QLKA 3QMEA 5PALA 1J7QA 1TTXA 3I5IB 5FYXA 1S3PA 5DKRA 3WHTB 1OSAA 1S1EA 3VRQA 1SBJA 2A4JA 2MAZA 1WLMA 1JC2A 2JPOA 4MRYA 3CDNA 3NHTA 3S0FA 1GGZA 3TS5C 2F3ZA 4GGFC 3JVTB 1OOHA 1YVHA 2WC8A 1S36A 1SPYA 1AHRA 4IL1A 4USLA 4A4CA 4YGBB 1NP8A 4MZJA 2BBMA 5I8NA 1J1DA 1XA5A 1CDNA 4A4BA 2KGBC 2QDIA 1OZOA 1F71A 4INWA 2YGUA 3DY9A 2NCPA 1HQVA 4OV2A 2WCHA 1R6PA 1LA0A 1ALVA 1KQMB 1NYAA 2ZNDA 3OB1B 1DJWA 1ZUZA 3CYZA 1U5IA 3IVTA 2KAVA 5DICA 3ZNIA 1CM4A 1JFKA 4ETOA 1BOCA 4M2QA 2GGMA 1QATA 2JC2A 1LVCD 4KYNA 5KSZA 5JOLA 5HKZA 2KNEA 2K0JA 1BT6A 4AQIA 2KI4C 2KYCA 1QLSA 1TCOB 3NSLA 3D10A 2LV7A 3OX6A 2OS8C 1IJ5A 1TNPA 1QVIY 1KFUL 2LC5A 3LL8B 5HYDA 2LAPA 2WNDA 2EGDA 4N5XA 5AERA 2JNFA 1QX7A 1OW4A 2OPOA 2JQ6A 3EKJA 2BE4A 3AAKA 1KWOB 5AEQA 1OOFA 1MWNA 2AMIA 1DJIA 1LA3A 1NWDA 4YI9A 3DXLA 1ALWA 4R1EA 2K2AA 1BF5A 1Y1UA 2BAPA 1SRAA 2D8NA 1DF0B 2K7DA 2B1UA 1UHIA 2PQLA 3KHEA 2M7NA 1TNXA 1YR5A 5DKQA 1XFUO 3OGNA 4ICBA 4OKHA 3CZTX 1FI5A 1XFYO 3EK8A 1NSHA 1XFZO 1WDCB 2L5YA 2R2IA 3BJHA 1ODBA 2H2KA 1V1GA 2WCLA 2G9BA 1KSOA 2LM5A 4PHJA 2KFFA 4PHMA 2ZN8A 1RJVA 4E68A 3FE9A 2EHBA 3I5GB 3O6BA 1AVSA 1IG5A 1TOPA 2JXLA 2ISDA 1AUIB 1RROA 3R1OA 4WQ2A 4CPVA 2KBMA 3VROA 1K96A 1B1GA 1RFJA 1NCYA 1KSMA 1OOJA 3I5FB 1P28A 3EK7A 4MRXA 5G08A 1QV0A 3WNXB 1RECA 3D76A 2PYQA 1DJYA 4PT1A 4OVNF 1A2XA 2NCOA 2K60A 3CR4X
chains in the Genus database with same CATH topology
3E3RA 2L98A 2P6BB 1TNWA 1IQ3A 1Y1AA 5CSJA 1M45A 1SL7A 3EVVA 1S6JA 4PE7A 3SG4A 1B7TZ 3GK4X 4L9MA 5HKWA 1DF0A 1PSBA 2JZIA 2LHIA 3JVTC 3C1VA 4NQGA 2KAYA 1SL9A 5KU1A 1J55A 2L0PA 1EJ3A 5IBWA 2WORA 2NZ0A 4DIRA 1OE9B 2M3WA 4DS7A 2IS9A 1UUSA 3LK0A 1JUOA 1D1OA 4DCKA 2F3YA 3SIAA 1XFXO 1XFWO 1KQMC 1CKKA 1GQMA 2VRGA 4YRUA 1Y0VH 1F70A 3OP0A 4I5LB 4C0JA 2H61A 1CFPA 4MLWA 3F45A 1QX5B 1NX1A 3HX4A 3SG5A 3PFVA 1BODA 1K9PA 2HF5A 1B8CA 1CLBA 2MA2A 3EKHA 2KOTA 1UP5A 1OZSA 1SYMA 3NSOA 5GQQC 2M0RA 4ORBB 2LLTA 4QJ5B 2ZNEA 1KWOC 3GK2A 1B8LA 1B9AA 3MSEB 3VGOA 3DF0B 1S5GZ 2Y4QA 1FBVA 1C07A 3LLEA 3D0YB 1YTZC 2LLUA 1CFDA 1AK8A 3O2PA 4YI8A 2MBXA 1CLMA 1SNLA 5AXIA 1N2DA 3BUMB 2LVJA 3SIBA 3IQOA 4QJ4B 2RGIA 3VRRA 4CIDA 1LINA 1ZFSA 3TUYB 4MVFA 1J7RA 1KK7Y 2BL0C 2V53A 2BE6A 3PALA 3VRNA 1KQVA 3LK1A 1A4PA 2KQ6A 1PALA 4GFTA 4GPLB 3I5GC 5ER5A 5ER4X 2FJUB 3SG7A 1YX7A 1B8RA 2LCPA 1CFCA 4N1FA 3LCPC 2LVKA 1A75B 5CSFA 1EG4A 1KK8B 1QJTA 1VRKA 1SW8A 2H61C 2HQ8A 2I18A 2M49B 3I5FC 1IKUA 1DJXA 3A8RA 5HLOA 1IWQA 3K21A 1WRLA 2LLSA 4PALA 4PE0A 1R2UA 2Q91A 1BMOA 2BCAA 3WHUB 5B8IB 2JT3A 4TNCA 3GK1A 3I5HB 1UHNA 1JSAA 1QIWA 2E6WA 1YURA 3RLZA 2LE9B 1K2HA 1K90D 3BUOB 4FQOA 2L4HA 4PHKA 3JTDB 1CLLA 2LVVA 2LMVA 2CXJA 1SL8A 1RTP1 4YGAA 3SG3A 1XK4A 1A03A 4JPZB 1XYDA 1AP4A 1MHOA 1PSRA 1CMFA 1K9KA 1M46A 1MF8B 1CTRA 2MLFC 3NSIA 1OMVA 1XO5A 3OHMB 1JBAA 2JOJA 2PALA 1XVJA 2G2BA 3BQ3A 1K94A 4PE1A 1GGWA 2SCPA 1GJYA 3BOWB 2M7LA 1F55A 3CWGA 1A29A 1CMGA 2BCBA 2CT9A 2QACA 4XJKB 1NIWA 2QPTA 1A75A 1TIZA 1QV1A 4F0ZB 1Q80A 2K8MB 1F4OA 3SG2A 2K7CA 1LXFC 1WY9A 1SR6B 1YVLA 1ZOTB 3CGAA 5D69A 5HLVA 1YRTB 3IQQA 1IRJA 4I5KA 2EC6B 3DVJA 1WRZA 1F4QA 2L51A 1J1EA 1V1FA 1MXLC 1K93D 3ZWHA 1G4YR 4GBAA 4JQ0D 2L2EA 3OB2B 3EVUA 1JF0A 2MRDA 1BLQA 2KQYA 5D7FA 1G8IA 1L2OB 1DGVA 1K9UA 2WOSA 3OX5A 3PM8A 2LMUA 1SY9A 4I5NB 4HRHA 2LVIA 2LUCA 1SKTA 4GAOA 1S6CA 1XK4C 2JT8A 4NDBA 1SCMB 4P2YB 3TUYC 1UHJA 2AUCA 2FOTA 1DT7B 1QVIZ 1QTXA 4XJKA 2JU0A 3CTNA 2FCEA 4HREE 1K95A 4AOMA 1AJ4A 1Y1XA 2KYFA 1UURA 4NDCA 5AANA 1DJHA 1IJ6A 3CR2A 2NLNA 1KK8C 1NX0A 3BUNB 1CDPA 1UHKA 1TNQA 1DJZA 3DD4A 2FCDA 1N0YA 2BKHB 1CFFA 1QXPA 2DOQA 2ZFDA 1CDMA 1NX3A 1TN4A 2K2FA 1SCVA 2KFHA 3A4UB 5I2QA 4MEWA 1Y6WA 1N65A 3PN7B 4HRGA 1BR4B 2BCXA 1OMDA 2K61A 2ZN9A 3M0WA 4DUQA 3JTDC 3SJSA 4OR9B 2M29A 3CR5X 5CPVA 1TRFA 2KHNA 4NDDA 2CBLA 3TDUA 4CLNA 1W7IB 3AKAA 1SK6D 2I7AA 1X02A 1S6IA 4BY4A 1DGUA 2M1KB 5I2OA 2JT0A 2M8UA 1CB1A 3DVMA 2GV5A 3KEVA 3NSKA 1NX2A 3IF7A 5I2LA 1C7WA 4D1EA 4P5OE 2CCMA 2PRUA 1TCFA 3GOFA 2BKIB 2LANA 2KGRA 4QJ3B 1U5IB 1EL4A 1WDCC 3KPXA 3H4SE 4WRIA 1SMGA 4Q04A 1PVAA 2Y1NA 1SR6C 4AQJA 1OMRA 2F8PA 1E8AA 2I94A 3NXAA 1AJ5A 4ORCB 1M63B 2KI6D 3ICBA 2ZRTA 5JJGA 1MR8A 3TDZA 2Y1MA 2EC6C 2JTTA 5AFPA 1JWDA 4M2OA 1YUUA 4UPGA 1J7PA 1EXRA 1ZMZA 1PVBA 5KTYA 1WLZA 1ZACA 3BUXB 1J7OA 4I5JA 4FTGA 1NCZA 1CNPA 1FI6A 2HQWA 1EH2A 2K7BA 3EVRA 4YGEB 4DRWA 2E30A 2LHLA 1K8UA 1L2OC 3DF0A 3D0YA 1FF1A 3PLFB 1S26D 1SCMC 2O60A 1B4CA 3BYAA 4YBHB 2JTZA 2F2PA 3O78A 1YUSA 4XYNA 1PK0D 2GGZA 1BR1B 2WCBA 2JNXA 5J3XA 2LP2A 1NPQA 2ZRSA 5K89A 3FIAA 1B7TY 4MZLA 1NCXA 4YGCB 3TDIA 2PSRA 2CTNA 3KO0A 3AKBA 4MSPA 2WCFA 1LKJA 3QRXA 3VRPA 1JF2A 3CS1A 1WRKA 2BBNA 1IGVA 1QS7A 4OCIA 1M39A 2O5GA 3SG6A 1FPWA 4HSZA 3BXKA 1MQ1A 5HKYA 1PRWA 1KFUS 2PVBA 1KK7Z 2M9GA 2OTGB 4U8DA 4CFRA 3PN7C 3FS7A 1KFXL 1YRUB 3PATA 1IH0A 4PHNA 2MHHA 2WCEA 2AAOA 1W7JB 3CLNA 3TS5B 1MXEA 1KFXS 2BL0B 3PSRA 3RM1A 2KFGA 1JFJA 2JXCA 1CDLA 1B47A 2JULA 2TN4A 4GUKA 1HT9A 2F33A 2L50A 4PDZA 3BUWB 4GGNA 3BOWA 4C0LA 5BPJA 1DVIA 1S5GY 5TNCA 2KAXA 5CSNA 1FW4A 1L7ZA 2L4IA 2LUXA 2CNPA 1IQ5A 3TZ1A 2KI6C 1BJFA 2HPSA 2JWWA 1F8HA 2KI4B 4MZKA 1G33A 4YGDB 1DTLA 1YUTA 1BU3A 1DJGA 1EG3A 1F54A 1QIVA 2M97A 2OS8B 1H8BA 4CFQA 2KSPA 4C0KA 2JPTA 4ZCUA 1YX8A 2KBIA 1M31A 1QASA 1PULA 3O4YA 4PCWA 3FWBA 3I5HC 4MBEA 4GGFA 1RWYA 1XFVO 2BECA 1MUXA 2SASA 2PMYA 3HCMA 5F6TA 1OQPA 4ORAB 1RK9A 2F2OA 3KF9A 1DMOA 4BY5A 2KDHA 3FWCA 1H4BA 4PE4A 2M1UA 2PASA 2MLEC 4JWQA 2ZKMX 2NXQA 2I2RE 1C7VA 2Q4UA 1CM1A 1UWOA 3AAJA 2MJWB 2LMTA 3WXAA 2HETA 2Y5IA 3EK4A 5CSIA 4ZCVA 2JRFA 4WQ3A 2L5XB 1BG1A 1QX2A 2LNKA 4GNKB 4N1GA 1KCYA 2K7OA 3DVEA 1UHHA 2COLB 4M2PA 4MN0A 2LP3A 5DKNA 1NUBA 3DVKA 1J7QA 2OTGC 1QLKA 5PALA 1TTXA 3I5IB 5FYXA 1S3PA 5DKRA 3WHTB 1OSAA 1S1EA 3VRQA 1SBJA 2A4JA 2MAZA 1WLMA 1JC2A 4MRYA 1GGZA 3TS5C 2F3ZA 4GGFC 3JVTB 2WC8A 1YVHA 4USLA 1S36A 1SPYA 1AHRA 4IL1A 4A4CA 4YGBB 1NP8A 4MZJA 2BBMA 5I8NA 1J1DA 1XA5A 1CDNA 4A4BA 2KGBC 1F71A 1OZOA 2NCPA 1HQVA 4OV2A 1R6PA 1LA0A 1ALVA 1KQMB 1NYAA 2ZNDA 3OB1B 1DJWA 1ZUZA 3ZNIA 1U5IA 2KAVA 1CM4A 1JFKA 4ETOA 1BOCA 4M2QA 2GGMA 1QATA 2JC2A 1LVCD 5KSZA 5JOLA 5HKZA 2KNEA 2K0JA 1BT6A 4AQIA 2KI4C 2KYCA 1QLSA 1TCOB 3NSLA 3D10A 2LV7A 3OX6A 2OS8C 1IJ5A 1TNPA 1QVIY 1KFUL 2LC5A 3LL8B 5HYDA 2LAPA 2WNDA 2EGDA 4N5XA 5AERA 2JNFA 1QX7A 2OPOA 2JQ6A 3EKJA 2BE4A 3AAKA 1KWOB 5AEQA 1MWNA 2AMIA 1DJIA 1LA3A 1NWDA 4YI9A 1ALWA 4R1EA 2K2AA 1BF5A 1Y1UA 1SRAA 2D8NA 1DF0B 2K7DA 2B1UA 1UHIA 3KHEA 2M7NA 1TNXA 1YR5A 5DKQA 1XFUO 4ICBA 4OKHA 3CZTX 1FI5A 1XFYO 3EK8A 1NSHA 1XFZO 1WDCB 2R2IA 1ODBA 2H2KA 1V1GA 2G9BA 1KSOA 2LM5A 4PHJA 2KFFA 4PHMA 2ZN8A 1RJVA 4E68A 3I5GB 2EHBA 3O6BA 1AVSA 1IG5A 1TOPA 2JXLA 2ISDA 1AUIB 1RROA 4WQ2A 4CPVA 2KBMA 3VROA 1K96A 1B1GA 1RFJA 1NCYA 1KSMA 1OOJA 3I5FB 5G08A 3EK7A 4MRXA 1QV0A 3WNXB 1RECA 1DJYA 4OVNF 1A2XA 2NCOA 3I5IC 3CR4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3R A;  2L98 A;  2P6B B;  1TNW A;  1IQ3 A;  1Y1A A;  5CSJ A;  1M45 A;  1SL7 A;  3EVV A;  1S6J A;  4PE7 A;  3SG4 A;  1B7T Z;  3GK4 X;  4L9M A;  5HKW A;  1DF0 A;  1PSB A;  2JZI A;  2LHI A;  3JVT C;  3C1V A;  4NQG A;  2KAY A;  1SL9 A;  5KU1 A;  1J55 A;  2L0P A;  1EJ3 A;  5IBW A;  2WOR A;  2NZ0 A;  4DIR A;  1OE9 B;  2M3W A;  4DS7 A;  2IS9 A;  1UUS A;  3LK0 A;  1JUO A;  1D1O A;  4DCK A;  2F3Y A;  3SIA A;  1XFX O;  1XFW O;  1KQM C;  1CKK A;  1GQM A;  2VRG A;  4YRU A;  1Y0V H;  1F70 A;  3OP0 A;  4I5L B;  4C0J A;  2H61 A;  1CFP A;  4MLW A;  3F45 A;  1QX5 B;  1NX1 A;  3HX4 A;  3SG5 A;  3PFV A;  1BOD A;  1K9P A;  2HF5 A;  1B8C A;  1CLB A;  2MA2 A;  3EKH A;  2KOT A;  1UP5 A;  1OZS A;  1SYM A;  3NSO A;  5GQQ C;  2M0R A;  4ORB B;  2LLT A;  4QJ5 B;  2ZNE A;  1KWO C;  3GK2 A;  1B8L A;  1B9A A;  3MSE B;  3VGO A;  3DF0 B;  1S5G Z;  2Y4Q A;  1FBV A;  1C07 A;  3LLE A;  3D0Y B;  1YTZ C;  2LLU A;  1CFD A;  1AK8 A;  3O2P A;  4YI8 A;  2MBX A;  1CLM A;  1SNL A;  5AXI A;  1N2D A;  3BUM B;  2LVJ A;  3SIB A;  3IQO A;  4QJ4 B;  2RGI A;  3VRR A;  4CID A;  1LIN A;  1ZFS A;  3TUY B;  4MVF A;  1J7R A;  1KK7 Y;  2BL0 C;  2V53 A;  2BE6 A;  3PAL A;  3VRN A;  1KQV A;  3LK1 A;  1A4P A;  2KQ6 A;  1PAL A;  4GFT A;  4GPL B;  3I5G C;  5ER5 A;  5ER4 X;  2FJU B;  3SG7 A;  1YX7 A;  1B8R A;  2LCP A;  1CFC A;  4N1F A;  3LCP C;  2LVK A;  1A75 B;  5CSF A;  1EG4 A;  1KK8 B;  1QJT A;  1VRK A;  1SW8 A;  2H61 C;  2HQ8 A;  2I18 A;  2M49 B;  3I5F C;  1IKU A;  1DJX A;  3A8R A;  5HLO A;  1IWQ A;  3K21 A;  1WRL A;  2LLS A;  4PAL A;  4PE0 A;  1R2U A;  2Q91 A;  1BMO A;  2BCA A;  3WHU B;  5B8I B;  2JT3 A;  4TNC A;  3GK1 A;  3I5H B;  1UHN A;  1JSA A;  1QIW A;  2E6W A;  1YUR A;  3RLZ A;  2LE9 B;  1K2H A;  1K90 D;  3BUO B;  4FQO A;  2L4H A;  4PHK A;  3JTD B;  1CLL A;  2LVV A;  2LMV A;  2CXJ A;  1SL8 A;  1RTP 1;  4YGA A;  3SG3 A;  1XK4 A;  1A03 A;  4JPZ B;  1XYD A;  1AP4 A;  1MHO A;  1PSR A;  1CMF A;  1K9K A;  1M46 A;  1MF8 B;  1CTR A;  2MLF C;  3NSI A;  1OMV A;  1XO5 A;  3OHM B;  1JBA A;  2JOJ A;  2PAL A;  1XVJ A;  2G2B A;  3BQ3 A;  1K94 A;  4PE1 A;  1GGW A;  2SCP A;  1GJY A;  3BOW B;  2M7L A;  1F55 A;  3CWG A;  1A29 A;  1CMG A;  2BCB A;  2CT9 A;  2QAC A;  4XJK B;  1NIW A;  2QPT A;  1A75 A;  1TIZ A;  1QV1 A;  4F0Z B;  1Q80 A;  2K8M B;  1F4O A;  3SG2 A;  2K7C A;  1LXF C;  1WY9 A;  1SR6 B;  1YVL A;  1ZOT B;  3CGA A;  5D69 A;  5HLV A;  1YRT B;  3IQQ A;  1IRJ A;  4I5K A;  2EC6 B;  3DVJ A;  1WRZ A;  1F4Q A;  2L51 A;  1J1E A;  1V1F A;  1MXL C;  1K93 D;  3ZWH A;  1G4Y R;  4GBA A;  4JQ0 D;  2L2E A;  3OB2 B;  3EVU A;  1JF0 A;  2MRD A;  1BLQ A;  2KQY A;  5D7F A;  1G8I A;  1L2O B;  1DGV A;  1K9U A;  2WOS A;  3OX5 A;  3PM8 A;  2LMU A;  1SY9 A;  4I5N B;  4HRH A;  2LVI A;  2LUC A;  1SKT A;  4GAO A;  1S6C A;  1XK4 C;  2JT8 A;  4NDB A;  1SCM B;  4P2Y B;  3TUY C;  1UHJ A;  2AUC A;  2FOT A;  1DT7 B;  1QVI Z;  1QTX A;  4XJK A;  2JU0 A;  3CTN A;  2FCE A;  4HRE E;  1K95 A;  4AOM A;  1AJ4 A;  1Y1X A;  2KYF A;  1UUR A;  4NDC A;  5AAN A;  1DJH A;  1IJ6 A;  3CR2 A;  2NLN A;  1KK8 C;  1NX0 A;  3BUN B;  1CDP A;  1UHK A;  1TNQ A;  1DJZ A;  3DD4 A;  2FCD A;  1N0Y A;  2BKH B;  1CFF A;  1QXP A;  2DOQ A;  2ZFD A;  1CDM A;  1NX3 A;  1TN4 A;  2K2F A;  1SCV A;  2KFH A;  3A4U B;  5I2Q A;  4MEW A;  1Y6W A;  1N65 A;  3PN7 B;  4HRG A;  1BR4 B;  2BCX A;  1OMD A;  2K61 A;  2ZN9 A;  3M0W A;  4DUQ A;  3JTD C;  3SJS A;  4OR9 B;  2M29 A;  3CR5 X;  5CPV A;  1TRF A;  2KHN A;  4NDD A;  2CBL A;  3TDU A;  4CLN A;  1W7I B;  3AKA A;  1SK6 D;  2I7A A;  1X02 A;  1S6I A;  4BY4 A;  1DGU A;  2M1K B;  5I2O A;  2JT0 A;  2M8U A;  1CB1 A;  3DVM A;  2GV5 A;  3KEV A;  3NSK A;  1NX2 A;  3IF7 A;  5I2L A;  1C7W A;  4D1E A;  4P5O E;  2CCM A;  2PRU A;  1TCF A;  3GOF A;  2BKI B;  2LAN A;  2KGR A;  4QJ3 B;  1U5I B;  1EL4 A;  1WDC C;  3KPX A;  3H4S E;  4WRI A;  1SMG A;  4Q04 A;  1PVA A;  2Y1N A;  1SR6 C;  4AQJ A;  1OMR A;  2F8P A;  1E8A A;  2I94 A;  3NXA A;  1AJ5 A;  4ORC B;  1M63 B;  2KI6 D;  3ICB A;  2ZRT A;  5JJG A;  1MR8 A;  3TDZ A;  2Y1M A;  2EC6 C;  2JTT A;  5AFP A;  1JWD A;  4M2O A;  1YUU A;  4UPG A;  1J7P A;  1EXR A;  1ZMZ A;  1PVB A;  5KTY A;  1WLZ A;  1ZAC A;  3BUX B;  1J7O A;  4I5J A;  4FTG A;  1NCZ A;  1CNP A;  1FI6 A;  2HQW A;  1EH2 A;  2K7B A;  3EVR A;  4YGE B;  4DRW A;  2E30 A;  2LHL A;  1K8U A;  1L2O C;  3DF0 A;  3D0Y A;  1FF1 A;  3PLF B;  1S26 D;  1SCM C;  2O60 A;  1B4C A;  3BYA A;  4YBH B;  2JTZ A;  2F2P A;  3O78 A;  1YUS A;  4XYN A;  1PK0 D;  2GGZ A;  1BR1 B;  2WCB A;  2JNX A;  5J3X A;  2LP2 A;  1NPQ A;  2ZRS A;  5K89 A;  3FIA A;  1B7T Y;  4MZL A;  1NCX A;  4YGC B;  3TDI A;  2PSR A;  2CTN A;  3KO0 A;  3AKB A;  4MSP A;  2WCF A;  1LKJ A;  3QRX A;  3VRP A;  1JF2 A;  3CS1 A;  1WRK A;  2BBN A;  1IGV A;  1QS7 A;  4OCI A;  1M39 A;  2O5G A;  3SG6 A;  1FPW A;  4HSZ A;  3BXK A;  1MQ1 A;  5HKY A;  1PRW A;  1KFU S;  2PVB A;  1KK7 Z;  2M9G A;  2OTG B;  4U8D A;  4CFR A;  3PN7 C;  3FS7 A;  1KFX L;  1YRU B;  3PAT A;  1IH0 A;  4PHN A;  2MHH A;  2WCE A;  2AAO A;  1W7J B;  3CLN A;  3TS5 B;  1MXE A;  1KFX S;  2BL0 B;  3PSR A;  3RM1 A;  2KFG A;  1JFJ A;  2JXC A;  1CDL A;  1B47 A;  2JUL A;  2TN4 A;  4GUK A;  1HT9 A;  2F33 A;  2L50 A;  4PDZ A;  3BUW B;  4GGN A;  3BOW A;  4C0L A;  5BPJ A;  1DVI A;  1S5G Y;  5TNC A;  2KAX A;  5CSN A;  1FW4 A;  1L7Z A;  2L4I A;  2LUX A;  2CNP A;  1IQ5 A;  3TZ1 A;  2KI6 C;  1BJF A;  2HPS A;  2JWW A;  1F8H A;  2KI4 B;  4MZK A;  1G33 A;  4YGD B;  1DTL A;  1YUT A;  1BU3 A;  1DJG A;  1EG3 A;  1F54 A;  1QIV A;  2M97 A;  2OS8 B;  1H8B A;  4CFQ A;  2KSP A;  4C0K A;  2JPT A;  4ZCU A;  1YX8 A;  2KBI A;  1M31 A;  1QAS A;  1PUL A;  3O4Y A;  4PCW A;  3FWB A;  3I5H C;  4MBE A;  4GGF A;  1RWY A;  1XFV O;  2BEC A;  1MUX A;  2SAS A;  2PMY A;  3HCM A;  5F6T A;  1OQP A;  4ORA B;  1RK9 A;  2F2O A;  3KF9 A;  1DMO A;  4BY5 A;  2KDH A;  3FWC A;  1H4B A;  4PE4 A;  2M1U A;  2PAS A;  2MLE C;  4JWQ A;  2ZKM X;  2NXQ A;  2I2R E;  1C7V A;  2Q4U A;  1CM1 A;  1UWO A;  3AAJ A;  2MJW B;  2LMT A;  3WXA A;  2HET A;  2Y5I A;  3EK4 A;  5CSI A;  4ZCV A;  2JRF A;  4WQ3 A;  2L5X B;  1BG1 A;  1QX2 A;  2LNK A;  4GNK B;  4N1G A;  1KCY A;  2K7O A;  3DVE A;  1UHH A;  2COL B;  4M2P A;  4MN0 A;  2LP3 A;  5DKN A;  1NUB A;  3DVK A;  1J7Q A;  2OTG C;  1QLK A;  5PAL A;  1TTX A;  3I5I B;  5FYX A;  1S3P A;  5DKR A;  3WHT B;  1OSA A;  1S1E A;  3VRQ A;  1SBJ A;  2A4J A;  2MAZ A;  1WLM A;  1JC2 A;  4MRY A;  1GGZ A;  3TS5 C;  2F3Z A;  4GGF C;  3JVT B;  2WC8 A;  1YVH A;  4USL A;  1S36 A;  1SPY A;  1AHR A;  4IL1 A;  4A4C A;  4YGB B;  1NP8 A;  4MZJ A;  2BBM A;  5I8N A;  1J1D A;  1XA5 A;  1CDN A;  4A4B A;  2KGB C;  1F71 A;  1OZO A;  2NCP A;  1HQV A;  4OV2 A;  1R6P A;  1LA0 A;  1ALV A;  1KQM B;  1NYA A;  2ZND A;  3OB1 B;  1DJW A;  1ZUZ A;  3ZNI A;  1U5I A;  2KAV A;  1CM4 A;  1JFK A;  4ETO A;  1BOC A;  4M2Q A;  2GGM A;  1QAT A;  2JC2 A;  1LVC D;  5KSZ A;  5JOL A;  5HKZ A;  2KNE A;  2K0J A;  1BT6 A;  4AQI A;  2KI4 C;  2KYC A;  1QLS A;  1TCO B;  3NSL A;  3D10 A;  2LV7 A;  3OX6 A;  2OS8 C;  1IJ5 A;  1TNP A;  1QVI Y;  1KFU L;  2LC5 A;  3LL8 B;  5HYD A;  2LAP A;  2WND A;  2EGD A;  4N5X A;  5AER A;  2JNF A;  1QX7 A;  2OPO A;  2JQ6 A;  3EKJ A;  2BE4 A;  3AAK A;  1KWO B;  5AEQ A;  1MWN A;  2AMI A;  1DJI A;  1LA3 A;  1NWD A;  4YI9 A;  1ALW A;  4R1E A;  2K2A A;  1BF5 A;  1Y1U A;  1SRA A;  2D8N A;  1DF0 B;  2K7D A;  2B1U A;  1UHI A;  3KHE A;  2M7N A;  1TNX A;  1YR5 A;  5DKQ A;  1XFU O;  4ICB A;  4OKH A;  3CZT X;  1FI5 A;  1XFY O;  3EK8 A;  1NSH A;  1XFZ O;  1WDC B;  2R2I A;  1ODB A;  2H2K A;  1V1G A;  2G9B A;  1KSO A;  2LM5 A;  4PHJ A;  2KFF A;  4PHM A;  2ZN8 A;  1RJV A;  4E68 A;  3I5G B;  2EHB A;  3O6B A;  1AVS A;  1IG5 A;  1TOP A;  2JXL A;  2ISD A;  1AUI B;  1RRO A;  4WQ2 A;  4CPV A;  2KBM A;  3VRO A;  1K96 A;  1B1G A;  1RFJ A;  1NCY A;  1KSM A;  1OOJ A;  3I5F B;  5G08 A;  3EK7 A;  4MRX A;  1QV0 A;  3WNX B;  1REC A;  1DJY A;  4OVN F;  1A2X A;  2NCO A;  3I5I C;  3CR4 X; 
#chains in the Genus database with same CATH topology
 2P71 A;  3E3R A;  2L98 A;  2P6B B;  1TNW A;  1IQ3 A;  1Y1A A;  5CSJ A;  1M45 A;  1SL7 A;  1TWO A;  3EVV A;  1S6J A;  4PE7 A;  3SG4 A;  1B7T Z;  3GK4 X;  4L9M A;  5HKW A;  1DF0 A;  1PSB A;  2JZI A;  2LHI A;  3JVT C;  3C1V A;  4NQG A;  2KAY A;  1SL9 A;  5KU1 A;  1J55 A;  2L0P A;  1EJ3 A;  5IBW A;  2WOR A;  1C3Y A;  2NZ0 A;  4DIR A;  1OE9 B;  2M3W A;  4DS7 A;  2IS9 A;  1UUS A;  3LK0 A;  3Q8I A;  1JUO A;  1D1O A;  4DCK A;  2F3Y A;  3EG5 B;  3SIA A;  1C3Z A;  1XFX O;  1XFW O;  1KQM C;  4OZD A;  1CKK A;  1GQM A;  2VRG A;  4YRU A;  1Y0V H;  1F70 A;  3BFA A;  3OP0 A;  4I5L B;  3D75 A;  4I5N B;  2H61 A;  4C0J A;  1CFP A;  4MLW A;  3F45 A;  1QX5 B;  1NX1 A;  3HX4 A;  3SG5 A;  3PFV A;  1BOD A;  1K9P A;  2HF5 A;  1B8C A;  1CLB A;  2MA2 A;  3EKH A;  2KOT A;  1UP5 A;  1OZS A;  1SYM A;  3S0E A;  3NSO A;  5GQQ C;  2M0R A;  4ORB B;  3L47 A;  2LLT A;  4QJ5 B;  2ZNE A;  1KWO C;  3GK2 A;  3VB1 A;  1B8L A;  1B9A A;  3MSE B;  3CZ0 A;  3VGO A;  3DF0 B;  1S5G Z;  2Y4Q A;  1FBV A;  1QWV A;  1C07 A;  3LLE A;  3D0Y B;  1YTZ C;  2LLU A;  1CFD A;  1AK8 A;  3O2P A;  4YI8 A;  2MBX A;  1CLM A;  1SNL A;  5AXI A;  1N2D A;  3BUM B;  2LVJ A;  3SIB A;  3IQO A;  4QJ4 B;  2RGI A;  3VRR A;  4CID A;  1LIN A;  1ZFS A;  3TUY B;  4MVF A;  1J7R A;  1KK7 Y;  2BL0 C;  2V53 A;  2BE6 A;  3PAL A;  2WCJ A;  3VRN A;  1KQV A;  3LK1 A;  1A4P A;  2KQ6 A;  3L4L A;  1PAL A;  4GFT A;  4GPL B;  3I5G C;  5ER5 A;  5ER4 X;  2FJU B;  3SG7 A;  1YX7 A;  1B8R A;  2LCP A;  1CFC A;  4N1F A;  3LCP C;  4JD9 A;  2LVK A;  1A75 B;  5CSF A;  1DEL A;  1EG4 A;  3D77 A;  1KK8 B;  1QJT A;  1VRK A;  1SW8 A;  2H61 C;  2HQ8 A;  2I18 A;  2M49 B;  3I5F C;  1IKU A;  1DJX A;  3A8R A;  5HLO A;  1IWQ A;  3K21 A;  1WRL A;  2LLS A;  4PAL A;  4PE0 A;  1R2U A;  3CZ2 A;  2Q91 A;  1BMO A;  2BCA A;  3WHU B;  5B8I B;  2JT3 A;  4TNC A;  3GK1 A;  3I5H B;  1UHN A;  3S0A A;  1JSA A;  1QIW A;  2E6W A;  1YUR A;  3RLZ A;  2LE9 B;  3S0D A;  1K2H A;  1K90 D;  3BUO B;  4FQO A;  2L4H A;  4PHK A;  3JTD B;  3SS4 A;  1IIO A;  1CLL A;  2LVV A;  2LMV A;  2CXJ A;  1SL8 A;  1RTP 1;  4YGA A;  3SG3 A;  1XK4 A;  1A03 A;  4JPZ B;  1XYD A;  1AP4 A;  1MHO A;  1PSR A;  1CMF A;  1K9K A;  1M46 A;  1MF8 B;  1CTR A;  2MLF C;  3NSI A;  1OMV A;  1XO5 A;  3OHM B;  1JBA A;  2JOJ A;  2PAL A;  1XVJ A;  3B87 A;  2G2B A;  3BQ3 A;  1K94 A;  4PE1 A;  1GGW A;  2SCP A;  1GJY A;  3BOW B;  2M7L A;  2QEH A;  3CWG A;  2WCM A;  1F55 A;  1A29 A;  1CMG A;  2BCB A;  2CT9 A;  2QAC A;  4XJK B;  1NIW A;  2QPT A;  1A75 A;  1TIZ A;  1OOI X;  1QV1 A;  4F0Z B;  1Q80 A;  2K8M B;  1F4O A;  3SG2 A;  2K7C A;  1GM0 A;  1LXF C;  1WY9 A;  1SR6 B;  1YVL A;  1ZOT B;  3CGA A;  3L4A A;  5D69 A;  5HLV A;  3UNW A;  1YRT B;  3IQQ A;  1IRJ A;  3R1V A;  1Z2C B;  4I5K A;  2EC6 B;  3DVJ A;  1WRZ A;  1F4Q A;  2L51 A;  2QEO A;  1J1E A;  1V1F A;  1MXL C;  1K93 D;  3ZWH A;  1G4Y R;  4GBA A;  4JQ0 D;  2L2E A;  3OB2 B;  3EVU A;  1JF0 A;  3O4X A;  2MRD A;  1BLQ A;  2KQY A;  5D7F A;  1G8I A;  1L2O B;  1DGV A;  1K9U A;  2WOS A;  3OX5 A;  3PM8 A;  2LMU A;  1SY9 A;  2QEV A;  4HRH A;  2LVI A;  3SS5 A;  2LUC A;  1SKT A;  4GAO A;  1S6C A;  1XK4 C;  2JT8 A;  4NDB A;  1SCM B;  4P2Y B;  1Z4H A;  3TUY C;  1UHJ A;  2AUC A;  3DZT A;  2FOT A;  1DT7 B;  1QVI Z;  1QTX A;  4XJK A;  2JU0 A;  3CTN A;  2FCE A;  4HRE E;  1K95 A;  4AOM A;  1AJ4 A;  2ERB A;  1Y1X A;  3V2L A;  4F7F A;  4INX A;  2KYF A;  1UUR A;  4NDC A;  5AAN A;  2GTE A;  1DJH A;  1IJ6 A;  3CR2 A;  3S0G A;  1DEK A;  2NLN A;  1KK8 C;  1NX0 A;  1TUJ A;  3BUN B;  3D73 A;  1CDP A;  1UHK A;  1TNQ A;  2WC6 A;  1DJZ A;  3I5I C;  3DD4 A;  2FCD A;  3N7H A;  1N0Y A;  2BKH B;  1CFF A;  3D74 A;  1QXP A;  2DOQ A;  2ZFD A;  1CDM A;  1NX3 A;  1TN4 A;  2K2F A;  1SCV A;  2KFH A;  3A4U B;  3UO9 A;  2KPH A;  5I2Q A;  4MEW A;  1Y6W A;  1N65 A;  3PN7 B;  4HRG A;  1BR4 B;  2BCX A;  1OMD A;  2K61 A;  2ZN9 A;  3M0W A;  4DUQ A;  3JTD C;  3SJS A;  4OR9 B;  2M29 A;  3CR5 X;  5CPV A;  1TRF A;  2KHN A;  4NDD A;  2CBL A;  3TDU A;  4CLN A;  1W7I B;  3AKA A;  1SK6 D;  2I7A A;  1X02 A;  1S6I A;  4BY4 A;  1DGU A;  2M1K B;  5I2O A;  2JT0 A;  2M8U A;  2H8V A;  1CB1 A;  1T14 A;  3DVM A;  2GV5 A;  1ORG A;  3KEV A;  3NSK A;  1NX2 A;  3FE6 A;  3IF7 A;  5I2L A;  1C7W A;  4D1E A;  4P5O E;  2BNX A;  2CCM A;  2PRU A;  1TCF A;  3GOF A;  2BKI B;  2LAN A;  2KGR A;  4QJ3 B;  1U5I B;  1EL4 A;  1WDC C;  3KPX A;  3K1E A;  3H4S E;  4WRI A;  1SMG A;  2WCK A;  1PVA A;  2Y1N A;  1SR6 C;  4Q04 A;  1OMR A;  4AQJ A;  4IJ7 A;  2F8P A;  1OOG A;  1E8A A;  2I94 A;  3NXA A;  1AJ5 A;  4ORC B;  1M63 B;  2KI6 D;  3ICB A;  3R72 A;  2ZRT A;  5JJG A;  1MR8 A;  3TDZ A;  2Y1M A;  1W9Z A;  3RZS A;  2EC6 C;  2KLD A;  2JTT A;  5AFP A;  1JWD A;  4M2O A;  1YUU A;  4UPG A;  1J7P A;  1EXR A;  1ZMZ A;  1PVB A;  2P70 A;  5KTY A;  1WLZ A;  1ZAC A;  3BFH A;  3BUX B;  3B86 A;  4I5J A;  1J7O A;  4FTG A;  1NCZ A;  1CNP A;  3SS3 A;  1FI6 A;  2HQW A;  1DQE A;  1EH2 A;  2K7B A;  3EVR A;  4YGE B;  4DRW A;  2E30 A;  2LHL A;  1K8U A;  1L2O C;  3DF0 A;  5D3O A;  3D0Y A;  1FF1 A;  3PLF B;  1S26 D;  1SCM C;  2O60 A;  1B4C A;  3BYA A;  3NGV A;  4YBH B;  2JTZ A;  2F2P A;  3O78 A;  1YUS A;  1XFR A;  4XYN A;  1PK0 D;  2GGZ A;  1BR1 B;  2WCB A;  2JNX A;  2WC5 A;  5J3X A;  2LP2 A;  1NPQ A;  2ZRS A;  5K89 A;  3FIA A;  1B7T Y;  4MZL A;  5EL2 A;  1LS8 A;  1NCX A;  4YGC B;  3TDI A;  2PSR A;  2CTN A;  3KO0 A;  3AKB A;  4MSP A;  2WCF A;  1LKJ A;  3QRX A;  3VRP A;  1JF2 A;  3CS1 A;  1WRK A;  2BBN A;  1IGV A;  1QS7 A;  4OCI A;  1M39 A;  2O5G A;  3SG6 A;  1FPW A;  4HSZ A;  3BXK A;  1MQ1 A;  5HKY A;  1PRW A;  1KFU S;  2PVB A;  1KK7 Z;  2M9G A;  2OTG B;  4U8D A;  4CFR A;  3PN7 C;  3FS7 A;  1KFX L;  1YRU B;  3PAT A;  1IH0 A;  4PHN A;  1SSE B;  2MHH A;  2WCE A;  2AAO A;  1W7J B;  3CLN A;  3TS5 B;  1MXE A;  5HL1 A;  1KFX S;  4FQT A;  2BL0 B;  3PSR A;  3RM1 A;  5I94 A;  2KFG A;  1JFJ A;  2JXC A;  1CDL A;  1B47 A;  2JUL A;  2TN4 A;  4GUK A;  1HT9 A;  2F33 A;  2L50 A;  4PDZ A;  3R1P A;  3BUW B;  4GGN A;  3BOW A;  4C0L A;  5BPJ A;  1DVI A;  1S5G Y;  5TNC A;  2KAX A;  5CSN A;  1FW4 A;  1L7Z A;  2L4I A;  2FJY A;  2LUX A;  2CNP A;  1IQ5 A;  3TZ1 A;  2KI6 C;  1BJF A;  2HPS A;  2JWW A;  1F8H A;  2KI4 B;  4MZK A;  1G33 A;  4YGD B;  1DTL A;  1YUT A;  4JKT A;  1BU3 A;  1DJG A;  1EG3 A;  3CAB A;  3D78 A;  1QIV A;  1F54 A;  2M97 A;  2OS8 B;  1H8B A;  4CFQ A;  2KSP A;  4C0K A;  2JPT A;  4ZCU A;  1YX8 A;  2KBI A;  1M31 A;  1QAS A;  1PUL A;  3O4Y A;  4PCW A;  3FWB A;  3I5H C;  3NHI A;  4MBE A;  4GGF A;  1RWY A;  1XFV O;  2BEC A;  1MUX A;  2SAS A;  2PMY A;  3HCM A;  5FI7 A;  5F6T A;  1OQP A;  4ORA B;  1RK9 A;  2F2O A;  2L2C A;  5FI2 A;  3KF9 A;  3DYE A;  1DMO A;  4BY5 A;  2KDH A;  3CZ1 A;  3FWC A;  5FI6 A;  1H4B A;  4PE4 A;  2M1U A;  2PAS A;  2MLE C;  4JWQ A;  2ZKM X;  1DC1 A;  2NXQ A;  3PM2 A;  2I2R E;  3OBV A;  1C7V A;  3B88 A;  2Q4U A;  1CM1 A;  1UWO A;  3B7A A;  3AAJ A;  2MJW B;  2LMT A;  3WXA A;  2HET A;  2Y5I A;  3B6X A;  3BFB A;  3EK4 A;  5CSI A;  4ZCV A;  2JRF A;  2QEB A;  4WQ3 A;  2L5X B;  3S0B A;  1BG1 A;  3FE8 A;  3PJI A;  1QX2 A;  2LNK A;  4GNK B;  4N1G A;  1KCY A;  2KLE A;  2K7O A;  3DVE A;  1UHH A;  2COL B;  4M2P A;  4MN0 A;  1TUZ A;  2LP3 A;  1NUB A;  3DVK A;  5DKN A;  2OTG C;  1QLK A;  3QME A;  5PAL A;  1J7Q A;  1TTX A;  3I5I B;  5FYX A;  1S3P A;  5DKR A;  3WHT B;  1OSA A;  1S1E A;  3VRQ A;  1SBJ A;  2A4J A;  2MAZ A;  1WLM A;  1JC2 A;  2JPO A;  4MRY A;  3CDN A;  3NHT A;  3S0F A;  1GGZ A;  3TS5 C;  2F3Z A;  4GGF C;  3JVT B;  1OOH A;  1YVH A;  2WC8 A;  1S36 A;  1SPY A;  1AHR A;  4IL1 A;  4USL A;  4A4C A;  4YGB B;  1NP8 A;  4MZJ A;  2BBM A;  5I8N A;  1J1D A;  1XA5 A;  1CDN A;  4A4B A;  2KGB C;  2QDI A;  1OZO A;  1F71 A;  4INW A;  2YGU A;  3DY9 A;  2NCP A;  1HQV A;  4OV2 A;  2WCH A;  1R6P A;  1LA0 A;  1ALV A;  1KQM B;  1NYA A;  2ZND A;  3OB1 B;  1DJW A;  1ZUZ A;  3CYZ A;  1U5I A;  3IVT A;  2KAV A;  5DIC A;  3ZNI A;  1CM4 A;  1JFK A;  4ETO A;  1BOC A;  4M2Q A;  2GGM A;  1QAT A;  2JC2 A;  1LVC D;  4KYN A;  5KSZ A;  5JOL A;  5HKZ A;  2KNE A;  2K0J A;  1BT6 A;  4AQI A;  2KI4 C;  2KYC A;  1QLS A;  1TCO B;  3NSL A;  3D10 A;  2LV7 A;  3OX6 A;  2OS8 C;  1IJ5 A;  1TNP A;  1QVI Y;  1KFU L;  2LC5 A;  3LL8 B;  5HYD A;  2LAP A;  2WND A;  2EGD A;  4N5X A;  5AER A;  2JNF A;  1QX7 A;  1OW4 A;  2OPO A;  2JQ6 A;  3EKJ A;  2BE4 A;  3AAK A;  1KWO B;  5AEQ A;  1OOF A;  1MWN A;  2AMI A;  1DJI A;  1LA3 A;  1NWD A;  4YI9 A;  3DXL A;  1ALW A;  4R1E A;  2K2A A;  1BF5 A;  1Y1U A;  2BAP A;  1SRA A;  2D8N A;  1DF0 B;  2K7D A;  2B1U A;  1UHI A;  2PQL A;  3KHE A;  2M7N A;  1TNX A;  1YR5 A;  5DKQ A;  1XFU O;  3OGN A;  4ICB A;  4OKH A;  3CZT X;  1FI5 A;  1XFY O;  3EK8 A;  1NSH A;  1XFZ O;  1WDC B;  2L5Y A;  2R2I A;  3BJH A;  1ODB A;  2H2K A;  1V1G A;  2WCL A;  2G9B A;  1KSO A;  2LM5 A;  4PHJ A;  2KFF A;  4PHM A;  2ZN8 A;  1RJV A;  4E68 A;  3FE9 A;  2EHB A;  3I5G B;  3O6B A;  1AVS A;  1IG5 A;  1TOP A;  2JXL A;  2ISD A;  1AUI B;  1RRO A;  3R1O A;  4WQ2 A;  4CPV A;  2KBM A;  3VRO A;  1K96 A;  1B1G A;  1RFJ A;  1NCY A;  1KSM A;  1OOJ A;  3I5F B;  1P28 A;  3EK7 A;  4MRX A;  5G08 A;  1QV0 A;  3WNX B;  1REC A;  3D76 A;  2PYQ A;  1DJY A;  4PT1 A;  4OVN F;  1A2X A;  2NCO A;  2K60 A;  3CR4 X; 
#chains in the Genus database with same CATH homology
 3E3R A;  2L98 A;  2P6B B;  1TNW A;  1IQ3 A;  1Y1A A;  5CSJ A;  1M45 A;  1SL7 A;  3EVV A;  1S6J A;  4PE7 A;  3SG4 A;  1B7T Z;  3GK4 X;  4L9M A;  5HKW A;  1DF0 A;  1PSB A;  2JZI A;  2LHI A;  3JVT C;  3C1V A;  4NQG A;  2KAY A;  1SL9 A;  5KU1 A;  1J55 A;  2L0P A;  1EJ3 A;  5IBW A;  2WOR A;  2NZ0 A;  4DIR A;  1OE9 B;  2M3W A;  4DS7 A;  2IS9 A;  1UUS A;  3LK0 A;  1JUO A;  1D1O A;  4DCK A;  2F3Y A;  3SIA A;  1XFX O;  1XFW O;  1KQM C;  1CKK A;  1GQM A;  2VRG A;  4YRU A;  1Y0V H;  1F70 A;  3OP0 A;  4I5L B;  4C0J A;  2H61 A;  1CFP A;  4MLW A;  3F45 A;  1QX5 B;  1NX1 A;  3HX4 A;  3SG5 A;  3PFV A;  1BOD A;  1K9P A;  2HF5 A;  1B8C A;  1CLB A;  2MA2 A;  3EKH A;  2KOT A;  1UP5 A;  1OZS A;  1SYM A;  3NSO A;  5GQQ C;  2M0R A;  4ORB B;  2LLT A;  4QJ5 B;  2ZNE A;  1KWO C;  3GK2 A;  1B8L A;  1B9A A;  3MSE B;  3VGO A;  3DF0 B;  1S5G Z;  2Y4Q A;  1FBV A;  1C07 A;  3LLE A;  3D0Y B;  1YTZ C;  2LLU A;  1CFD A;  1AK8 A;  3O2P A;  4YI8 A;  2MBX A;  1CLM A;  1SNL A;  5AXI A;  1N2D A;  3BUM B;  2LVJ A;  3SIB A;  3IQO A;  4QJ4 B;  2RGI A;  3VRR A;  4CID A;  1LIN A;  1ZFS A;  3TUY B;  4MVF A;  1J7R A;  1KK7 Y;  2BL0 C;  2V53 A;  2BE6 A;  3PAL A;  3VRN A;  1KQV A;  3LK1 A;  1A4P A;  2KQ6 A;  1PAL A;  4GFT A;  4GPL B;  3I5G C;  5ER5 A;  5ER4 X;  2FJU B;  3SG7 A;  1YX7 A;  1B8R A;  2LCP A;  1CFC A;  4N1F A;  3LCP C;  2LVK A;  1A75 B;  5CSF A;  1EG4 A;  1KK8 B;  1QJT A;  1VRK A;  1SW8 A;  2H61 C;  2HQ8 A;  2I18 A;  2M49 B;  3I5F C;  1IKU A;  1DJX A;  3A8R A;  5HLO A;  1IWQ A;  3K21 A;  1WRL A;  2LLS A;  4PAL A;  4PE0 A;  1R2U A;  2Q91 A;  1BMO A;  2BCA A;  3WHU B;  5B8I B;  2JT3 A;  4TNC A;  3GK1 A;  3I5H B;  1UHN A;  1JSA A;  1QIW A;  2E6W A;  1YUR A;  3RLZ A;  2LE9 B;  1K2H A;  1K90 D;  3BUO B;  4FQO A;  2L4H A;  4PHK A;  3JTD B;  1CLL A;  2LVV A;  2LMV A;  2CXJ A;  1SL8 A;  1RTP 1;  4YGA A;  3SG3 A;  1XK4 A;  1A03 A;  4JPZ B;  1XYD A;  1AP4 A;  1MHO A;  1PSR A;  1CMF A;  1K9K A;  1M46 A;  1MF8 B;  1CTR A;  2MLF C;  3NSI A;  1OMV A;  1XO5 A;  3OHM B;  1JBA A;  2JOJ A;  2PAL A;  1XVJ A;  2G2B A;  3BQ3 A;  1K94 A;  4PE1 A;  1GGW A;  2SCP A;  1GJY A;  3BOW B;  2M7L A;  1F55 A;  3CWG A;  1A29 A;  1CMG A;  2BCB A;  2CT9 A;  2QAC A;  4XJK B;  1NIW A;  2QPT A;  1A75 A;  1TIZ A;  1QV1 A;  4F0Z B;  1Q80 A;  2K8M B;  1F4O A;  3SG2 A;  2K7C A;  1LXF C;  1WY9 A;  1SR6 B;  1YVL A;  1ZOT B;  3CGA A;  5D69 A;  5HLV A;  1YRT B;  3IQQ A;  1IRJ A;  4I5K A;  2EC6 B;  3DVJ A;  1WRZ A;  1F4Q A;  2L51 A;  1J1E A;  1V1F A;  1MXL C;  1K93 D;  3ZWH A;  1G4Y R;  4GBA A;  4JQ0 D;  2L2E A;  3OB2 B;  3EVU A;  1JF0 A;  2MRD A;  1BLQ A;  2KQY A;  5D7F A;  1G8I A;  1L2O B;  1DGV A;  1K9U A;  2WOS A;  3OX5 A;  3PM8 A;  2LMU A;  1SY9 A;  4I5N B;  4HRH A;  2LVI A;  2LUC A;  1SKT A;  4GAO A;  1S6C A;  1XK4 C;  2JT8 A;  4NDB A;  1SCM B;  4P2Y B;  3TUY C;  1UHJ A;  2AUC A;  2FOT A;  1DT7 B;  1QVI Z;  1QTX A;  4XJK A;  2JU0 A;  3CTN A;  2FCE A;  4HRE E;  1K95 A;  4AOM A;  1AJ4 A;  1Y1X A;  2KYF A;  1UUR A;  4NDC A;  5AAN A;  1DJH A;  1IJ6 A;  3CR2 A;  2NLN A;  1KK8 C;  1NX0 A;  3BUN B;  1CDP A;  1UHK A;  1TNQ A;  1DJZ A;  3DD4 A;  2FCD A;  1N0Y A;  2BKH B;  1CFF A;  1QXP A;  2DOQ A;  2ZFD A;  1CDM A;  1NX3 A;  1TN4 A;  2K2F A;  1SCV A;  2KFH A;  3A4U B;  5I2Q A;  4MEW A;  1Y6W A;  1N65 A;  3PN7 B;  4HRG A;  1BR4 B;  2BCX A;  1OMD A;  2K61 A;  2ZN9 A;  3M0W A;  4DUQ A;  3JTD C;  3SJS A;  4OR9 B;  2M29 A;  3CR5 X;  5CPV A;  1TRF A;  2KHN A;  4NDD A;  2CBL A;  3TDU A;  4CLN A;  1W7I B;  3AKA A;  1SK6 D;  2I7A A;  1X02 A;  1S6I A;  4BY4 A;  1DGU A;  2M1K B;  5I2O A;  2JT0 A;  2M8U A;  1CB1 A;  3DVM A;  2GV5 A;  3KEV A;  3NSK A;  1NX2 A;  3IF7 A;  5I2L A;  1C7W A;  4D1E A;  4P5O E;  2CCM A;  2PRU A;  1TCF A;  3GOF A;  2BKI B;  2LAN A;  2KGR A;  4QJ3 B;  1U5I B;  1EL4 A;  1WDC C;  3KPX A;  3H4S E;  4WRI A;  1SMG A;  4Q04 A;  1PVA A;  2Y1N A;  1SR6 C;  4AQJ A;  1OMR A;  2F8P A;  1E8A A;  2I94 A;  3NXA A;  1AJ5 A;  4ORC B;  1M63 B;  2KI6 D;  3ICB A;  2ZRT A;  5JJG A;  1MR8 A;  3TDZ A;  2Y1M A;  2EC6 C;  2JTT A;  5AFP A;  1JWD A;  4M2O A;  1YUU A;  4UPG A;  1J7P A;  1EXR A;  1ZMZ A;  1PVB A;  5KTY A;  1WLZ A;  1ZAC A;  3BUX B;  1J7O A;  4I5J A;  4FTG A;  1NCZ A;  1CNP A;  1FI6 A;  2HQW A;  1EH2 A;  2K7B A;  3EVR A;  4YGE B;  4DRW A;  2E30 A;  2LHL A;  1K8U A;  1L2O C;  3DF0 A;  3D0Y A;  1FF1 A;  3PLF B;  1S26 D;  1SCM C;  2O60 A;  1B4C A;  3BYA A;  4YBH B;  2JTZ A;  2F2P A;  3O78 A;  1YUS A;  4XYN A;  1PK0 D;  2GGZ A;  1BR1 B;  2WCB A;  2JNX A;  5J3X A;  2LP2 A;  1NPQ A;  2ZRS A;  5K89 A;  3FIA A;  1B7T Y;  4MZL A;  1NCX A;  4YGC B;  3TDI A;  2PSR A;  2CTN A;  3KO0 A;  3AKB A;  4MSP A;  2WCF A;  1LKJ A;  3QRX A;  3VRP A;  1JF2 A;  3CS1 A;  1WRK A;  2BBN A;  1IGV A;  1QS7 A;  4OCI A;  1M39 A;  2O5G A;  3SG6 A;  1FPW A;  4HSZ A;  3BXK A;  1MQ1 A;  5HKY A;  1PRW A;  1KFU S;  2PVB A;  1KK7 Z;  2M9G A;  2OTG B;  4U8D A;  4CFR A;  3PN7 C;  3FS7 A;  1KFX L;  1YRU B;  3PAT A;  1IH0 A;  4PHN A;  2MHH A;  2WCE A;  2AAO A;  1W7J B;  3CLN A;  3TS5 B;  1MXE A;  1KFX S;  2BL0 B;  3PSR A;  3RM1 A;  2KFG A;  1JFJ A;  2JXC A;  1CDL A;  1B47 A;  2JUL A;  2TN4 A;  4GUK A;  1HT9 A;  2F33 A;  2L50 A;  4PDZ A;  3BUW B;  4GGN A;  3BOW A;  4C0L A;  5BPJ A;  1DVI A;  1S5G Y;  5TNC A;  2KAX A;  5CSN A;  1FW4 A;  1L7Z A;  2L4I A;  2LUX A;  2CNP A;  1IQ5 A;  3TZ1 A;  2KI6 C;  1BJF A;  2HPS A;  2JWW A;  1F8H A;  2KI4 B;  4MZK A;  1G33 A;  4YGD B;  1DTL A;  1YUT A;  1BU3 A;  1DJG A;  1EG3 A;  1F54 A;  1QIV A;  2M97 A;  2OS8 B;  1H8B A;  4CFQ A;  2KSP A;  4C0K A;  2JPT A;  4ZCU A;  1YX8 A;  2KBI A;  1M31 A;  1QAS A;  1PUL A;  3O4Y A;  4PCW A;  3FWB A;  3I5H C;  4MBE A;  4GGF A;  1RWY A;  1XFV O;  2BEC A;  1MUX A;  2SAS A;  2PMY A;  3HCM A;  5F6T A;  1OQP A;  4ORA B;  1RK9 A;  2F2O A;  3KF9 A;  1DMO A;  4BY5 A;  2KDH A;  3FWC A;  1H4B A;  4PE4 A;  2M1U A;  2PAS A;  2MLE C;  4JWQ A;  2ZKM X;  2NXQ A;  2I2R E;  1C7V A;  2Q4U A;  1CM1 A;  1UWO A;  3AAJ A;  2MJW B;  2LMT A;  3WXA A;  2HET A;  2Y5I A;  3EK4 A;  5CSI A;  4ZCV A;  2JRF A;  4WQ3 A;  2L5X B;  1BG1 A;  1QX2 A;  2LNK A;  4GNK B;  4N1G A;  1KCY A;  2K7O A;  3DVE A;  1UHH A;  2COL B;  4M2P A;  4MN0 A;  2LP3 A;  5DKN A;  1NUB A;  3DVK A;  1J7Q A;  2OTG C;  1QLK A;  5PAL A;  1TTX A;  3I5I B;  5FYX A;  1S3P A;  5DKR A;  3WHT B;  1OSA A;  1S1E A;  3VRQ A;  1SBJ A;  2A4J A;  2MAZ A;  1WLM A;  1JC2 A;  4MRY A;  1GGZ A;  3TS5 C;  2F3Z A;  4GGF C;  3JVT B;  2WC8 A;  1YVH A;  4USL A;  1S36 A;  1SPY A;  1AHR A;  4IL1 A;  4A4C A;  4YGB B;  1NP8 A;  4MZJ A;  2BBM A;  5I8N A;  1J1D A;  1XA5 A;  1CDN A;  4A4B A;  2KGB C;  1F71 A;  1OZO A;  2NCP A;  1HQV A;  4OV2 A;  1R6P A;  1LA0 A;  1ALV A;  1KQM B;  1NYA A;  2ZND A;  3OB1 B;  1DJW A;  1ZUZ A;  3ZNI A;  1U5I A;  2KAV A;  1CM4 A;  1JFK A;  4ETO A;  1BOC A;  4M2Q A;  2GGM A;  1QAT A;  2JC2 A;  1LVC D;  5KSZ A;  5JOL A;  5HKZ A;  2KNE A;  2K0J A;  1BT6 A;  4AQI A;  2KI4 C;  2KYC A;  1QLS A;  1TCO B;  3NSL A;  3D10 A;  2LV7 A;  3OX6 A;  2OS8 C;  1IJ5 A;  1TNP A;  1QVI Y;  1KFU L;  2LC5 A;  3LL8 B;  5HYD A;  2LAP A;  2WND A;  2EGD A;  4N5X A;  5AER A;  2JNF A;  1QX7 A;  2OPO A;  2JQ6 A;  3EKJ A;  2BE4 A;  3AAK A;  1KWO B;  5AEQ A;  1MWN A;  2AMI A;  1DJI A;  1LA3 A;  1NWD A;  4YI9 A;  1ALW A;  4R1E A;  2K2A A;  1BF5 A;  1Y1U A;  1SRA A;  2D8N A;  1DF0 B;  2K7D A;  2B1U A;  1UHI A;  3KHE A;  2M7N A;  1TNX A;  1YR5 A;  5DKQ A;  1XFU O;  4ICB A;  4OKH A;  3CZT X;  1FI5 A;  1XFY O;  3EK8 A;  1NSH A;  1XFZ O;  1WDC B;  2R2I A;  1ODB A;  2H2K A;  1V1G A;  2G9B A;  1KSO A;  2LM5 A;  4PHJ A;  2KFF A;  4PHM A;  2ZN8 A;  1RJV A;  4E68 A;  3I5G B;  2EHB A;  3O6B A;  1AVS A;  1IG5 A;  1TOP A;  2JXL A;  2ISD A;  1AUI B;  1RRO A;  4WQ2 A;  4CPV A;  2KBM A;  3VRO A;  1K96 A;  1B1G A;  1RFJ A;  1NCY A;  1KSM A;  1OOJ A;  3I5F B;  5G08 A;  3EK7 A;  4MRX A;  1QV0 A;  3WNX B;  1REC A;  1DJY A;  4OVN F;  1A2X A;  2NCO A;  3I5I C;  3CR4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...