2LUCA

Solution structure of human s100 calcium-binding protein a11
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
b'MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A11
publication title NMR structure note: the structure of human calcium-bound S100A11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lucA00
1BG1A 1F71A 1SL8A 2O60A 1IKUA 1C7WA 2JT3A 2FOTA 2G2BA 3FWCA 1YUUA 4DIRA 1WLMA 1IRJA 4PHNA 3C1VA 2KI6C 1SL9A 3TDUA 4AOMA 4GUKA 1R2UA 1K8UA 4DS7A 3I5IC 4WRIA 4C0JA 2K2AA 2LMTA 1NX1A 2PRUA 1S5GZ 2OTGB 4YGEB 3VRQA 4MBEA 1K95A 3EK4A 3SJSA 2KHNA 1K96A 1MWNA 3CR2A 2BCBA 1TNXA 3LL8B 1QV0A 1UP5A 2L4IA 5HKWA 1YUTA 4FTGA 4M2OA 2LC5A 3TS5B 1WRZA 1OQPA 3KO0A 2BBNA 1KFUS 5BPJA 1HT9A 1OZSA 1XFVO 2HPSA 1WLZA 4U8DA 1GJYA 2KQ6A 2ZN9A 1WDCC 2CNPA 1XO5A 2BKIB 2KAYA 1SCVA 5KTYA 1PVAA 1JF2A 2OS8C 1FPWA 3LLEA 2KGRA 1NIWA 1IGVA 1K9KA 2KI6D 1G4YR 3CR4X 2LUXA 3I5HC 2JXCA 4DCKA 3JVTC 1IWQA 2M8UA 1A29A 2WC8A 4PHMA 2LCPA 2WOSA 1KK7Z 4CFQA 2JOJA 1ZOTB 1B4CA 1B47A 5CSNA 5F6TA 3DD4A 1QX5B 1ZUZA 2I7AA 3AKBA 3DF0B 1QX2A 2L0PA 1Y1UA 3A4UB 1L2OB 2EC6B 2LV7A 3SG5A 1PK0D 2LMVA 2ISDA 1EH2A 2M7NA 1CDNA 4D1EA 5B8IB 2NLNA 1DJGA 2M97A 2KGBC 5DKRA 1BR4B 1ZACA 4PHJA 1EG3A 4YI9A 2QACA 3BUXB 2KYCA 2LM5A 4QJ4B 4JPZB 1CDPA 2KBIA 2K7CA 2LAPA 2H61C 4XJKA 3MSEB 4CFRA 1GQMA 1LVCD 1LXFC 3CLNA 1KFXL 3AAJA 3E3RA 2JTTA 3NSLA 3WNXB 1AK8A 3SIBA 1ZMZA 4R1EA 2BL0B 3EVVA 5JOLA 1IQ3A 1BLQA 1F70A 1NX3A 3DVKA 1BF5A 3LK0A 1YVHA 2RGIA 2O5GA 1M39A 5HKYA 1KSOA 1YTZC 3CR5X 4TNCA 1BR1B 1S36A 2Q91A 3EKJA 2LMUA 2FJUB 2F2OA 4PALA 4P2YB 4PDZA 3WHTB 3NSIA 1JC2A 2LANA 1FF1A 1UHIA 3KHEA 1BODA 5I2QA 2K2FA 3HX4A 1CFPA 1AUIB 2COLB 1NWDA 2CTNA 1EJ3A 4L9MA 3FS7A 3KF9A 2K7DA 1QATA 2KI4B 3I5FB 4OKHA 5ER4X 2CCMA 2K61A 1LA0A 3OX5A 2BE6A 3CTNA 1SR6C 2I94A 3NSOA 2BE4A 1GGZA 1XVJA 3DVEA 4CIDA 1FBVA 2PASA 2SASA 3PFVA 2MLFC 1K9PA 4OCIA 1DMOA 1RROA 3PM8A 1H4BA 1KCYA 3EK8A 2LP2A 1KQVA 1N2DA 1OSAA 4MRXA 3OB1B 4HRHA 4N1GA 3WHUB 2KFGA 4JWQA 3H4SE 2JT8A 1G33A 3VRPA 3BYAA 4HREE 1J7OA 2B1UA 4YGCB 1QLSA 1SNLA 1B8LA 5J3XA 1DJZA 1RWYA 2OTGC 5DKNA 4ZCVA 1KWOB 2F2PA 1FI5A 2MA2A 4MVFA 1E8AA 1KK7Y 4GGFA 1DVIA 4MZKA 1W7JB 1IQ5A 1B8CA 2DOQA 4MSPA 1IJ5A 1NX0A 2LVVA 2NXQA 3BOWB 3SG3A 3CZTX 4FQOA 1N65A 2GV5A 1Y0VH 2LVIA 5D7FA 2FCDA 4GNKB 3TS5C 2FCEA 2M1KB 1U5IB 1SW8A 1NCXA 4WQ2A 2WORA 3F45A 1K93D 1UHKA 4JQ0D 1FI6A 5JJGA 2I18A 4OVNF 5HYDA 1MXEA 1ALVA 4M2QA 3RLZA 2KSPA 4NQGA 1F55A 2I2RE 2BCAA 3IQQA 4NDCA 4YGAA 2M49B 1SPYA 1EL4A 2WCEA 4MRYA 5FYXA 4GPLB 2JPTA 2CBLA 3O4YA 1Y1XA 4ORBB 1CNPA 1XFYO 1TOPA 2ZFDA 1KSMA 3TZ1A 2A4JA 2JZIA 1JSAA 2GGMA 1ALWA 3AKAA 4PCWA 1AP4A 1LA3A 5D69A 1H8BA 4I5LB 2P6BB 2KAXA 4QJ3B 1LKJA 1PSBA 1V1GA 1EXRA 2CT9A 3BXKA 1L2OC 1QLKA 2EC6C 3NSKA 3OX6A 2IS9A 2BECA 3EKHA 1MQ1A 1F54A 1WRKA 2MRDA 1BJFA 1KK8B 5AEQA 3HCMA 2TN4A 4DUQA 2H2KA 2EHBA 4I5NB 3GK4X 1UHHA 1VRKA 1XK4C 2G9BA 3PN7B 2NCOA 5G08A 3QRXA 3KEVA 1MF8B 2MJWB 2HQ8A 4N1FA 5GQQC 1K2HA 1SMGA 2LE9B 3JTDB 2VRGA 1J55A 3GK1A 1YX7A 2F8PA 2LUCA 4Q04A 5CSIA 2NCPA 1CM1A 2BL0C 1QVIY 4YGDB 1QXPA 3TUYB 2JWWA 1AVSA 4I5JA 2D8NA 4I5KA 1DF0A 1BMOA 4MZLA 2WCBA 3SIAA 3BQ3A 3BUOB 1YUSA 1SCMB 2PMYA 2HQWA 1TTXA 1OMVA 1DJIA 3SG7A 1CLLA 2H61A 4AQIA 1F8HA 3VROA 2JULA 4PE1A 3BUWB 1BU3A 1CFCA 1KFUL 1JWDA 1D1OA 2F3ZA 3EK7A 1CMGA 1TN4A 2PALA 2LLSA 3PLFB 4UPGA 2CXJA 1A03A 2JT0A 2M9GA 3I5FC 1SYMA 2KI4C 1DGUA 1S3PA 1F4QA 2AAOA 2KDHA 2ZNDA 5AXIA 1N0YA 1IJ6A 2JU0A 1YRUB 1SRAA 1IG5A 2LHIA 1A75A 4XJKB 1CFDA 3LCPC 3BUMB 4OV2A 1XA5A 1S6IA 1A2XA 2BKHB 2KFFA 1KQMB 2L98A 1S6JA 2L50A 2LP3A 4BY5A 2JNFA 3O6BA 2K8MB 1OZOA 1L7ZA 1DTLA 2KOTA 1AJ4A 3I5GB 1NX2A 4A4CA 1KWOC 1QVIZ 5CSFA 4DRWA 4AQJA 1XYDA 1C7VA 2ZKMX 2L2EA 1TNPA 1J7RA 1K9UA 1DT7B 4ICBA 4USLA 2KBMA 1UUSA 1TIZA 4YGBB 2HETA 3DVMA 5AANA 4M2PA 3AAKA 2L4HA 3KPXA 2LLUA 3BUNB 1TNWA 1B7TZ 1ODBA 1AHRA 1YRTB 3VGOA 2Y1MA 2JNXA 2KYFA 1W7IB 4QJ5B 3GOFA 2M0RA 5CPVA 1B1GA 2MLEC 4HSZA 1IH0A 1OMRA 1PRWA 3O2PA 4PE7A 2Y4QA 3OHMB 1RK9A 4CLNA 1SY9A 1X02A 1QS7A 2GGZA 4NDDA 5KSZA 2E6WA 4MEWA 2LHLA 1CMFA 2PVBA 3CWGA 1K90D 1MR8A 3CGAA 1CB1A 2Q4UA 2PSRA 2KQYA 1MUXA 5CSJA 1XFUO 2NZ0A 2Y1NA 4PE4A 1YURA 1Y1AA 4GFTA 4P5OE 1QX7A 2M1UA 1A4PA 1AJ5A 1DJHA 1QASA 4E68A 4MN0A 4YBHB 3ZWHA 2LVKA 1WY9A 3FWBA 4GBAA 1BT6A 1QIVA 3GK2A 1JF0A 1NSHA 2ZRTA 3OB2B 1MXLC 1KK8C 2KAVA 2WCFA 5AERA 1Y6WA 1JFJA 2KNEA 3D0YA 3PN7C 3SG6A 4YRUA 2F33A 1KFXS 1UHJA 3WXAA 5AFPA 3I5IB 3JTDC 4MLWA 1NYAA 1PVBA 2WNDA 2HF5A 4OR9B 3LK1A 2Y5IA 1PULA 4GAOA 1M63B 1M45A 3DF0A 1UHNA 1NP8A 1ZFSA 3TUYC 3PSRA 1NCYA 2M7LA 5HLVA 4XYNA 1J7PA 1RTP1 1SCMC 4ORAB 5DKQA 5I2OA 2MBXA 5HLOA 1LINA 1CLBA 2BBMA 1UWOA 4PE0A 3VRRA 1SKTA 4IL1A 3DVJA 1UURA 3D10A 4A4BA 1TRFA 1XK4A 2K0JA 3CS1A 1SBJA 4GGNA 4MZJA 4BY4A 2SCPA 2JRFA 3D0YB 2ZN8A 3SG4A 1RFJA 4ORCB 3PALA 1CM4A 2AMIA 2LNKA 2M3WA 1QV1A 1HQVA 1OOJA 2K7OA 1M46A 3PATA 1WDCB 2E30A 1B7TY 2K7BA 2KFHA 2L51A 2OS8B 1DJXA 2BCXA 1GGWA 3OP0A 1CDLA 2JQ6A 2V53A 3ZNIA 4CPVA 1CLMA 1Q80A 1XFXO 1CTRA 3I5HB 3JVTB 1G8IA 2JC2A 5I2LA 2LVJA 3A8RA 1KQMC 1CKKA 1S6CA 4PHKA 1WRLA 1V1FA 1NUBA 3NXAA 2M29A 3SG2A 1JBAA 2F3YA 1DF0B 1MHOA 1TNQA 1PSRA 4YI8A 5ER5A 3FIAA 4N5XA 1XFWO 3I5GC 2MHHA 1DJYA 1RECA 1BOCA 1DGVA 1S26D 1OE9B 2OPOA 1SL7A 5PALA 3M0WA 1J7QA 3EVUA 4ZCUA 5HKZA 1CFFA 4C0KA 1C07A 1RJVA 1S5GY 1OMDA 3O78A 2LLTA 1EG4A 2L5XB 5I8NA 3RM1A 1JFKA 2AUCA 5IBWA 2JXLA 1QIWA 1TCFA 4C0LA 1FW4A 4HRGA 1PALA 4NDBA 3TDZA 1NPQA 4ETOA 1A75B 2ZRSA 5TNCA 3IF7A 1YVLA 1YR5A 2QPTA 1F4OA 1NCZA 1SK6D 1YX8A 2R2IA 3BOWA 3VRNA 1QJTA 1R6PA 2EGDA 1DJWA 1JUOA 4F0ZB 2MAZA 1J1DA 3EVRA 1QTXA 3ICBA 3IQOA 3TDIA 1K94A 1U5IA 5KU1A 1J1EA 1XFZO 2ZNEA 1TCOB 3K21A 1CDMA 1M31A 4GGFC 1B8RA 1SR6B 4WQ3A 5K89A 2JTZA 1S1EA 1B9AA
chains in the Genus database with same CATH superfamily
3BFBA 1BG1A 3B88A 1F71A 1SL8A 2O60A 1IKUA 1C7WA 2JT3A 2FOTA 2G2BA 3FWCA 1YUUA 4DIRA 1WLMA 1IRJA 4PHNA 3C1VA 2KI6C 1SL9A 3TDUA 4AOMA 4GUKA 1R2UA 1K8UA 4DS7A 3I5IC 3N7HA 4WRIA 4C0JA 2K2AA 2LMTA 1NX1A 1ORGA 2PRUA 1S5GZ 2OTGB 4YGEB 3VRQA 4MBEA 2QEHA 4OZDA 1K95A 3EK4A 4JD9A 3SJSA 2KHNA 1K96A 1MWNA 3CR2A 3K1EA 3NGVA 2BCBA 1TNXA 3LL8B 1QV0A 1UP5A 2BAPA 2L4IA 5HKWA 1YUTA 4FTGA 4M2OA 2LC5A 3TS5B 1WRZA 3R1VA 1OQPA 3KO0A 2BBNA 1KFUS 5BPJA 1HT9A 1OZSA 1XFVO 2HPSA 1WLZA 3CABA 4U8DA 1GJYA 2KQ6A 2ZN9A 1WDCC 2CNPA 1XO5A 2BKIB 2KAYA 1SCVA 4PT1A 5KTYA 3R1OA 1PVAA 1JF2A 2OS8C 3CZ1A 1FPWA 1OOFA 3LLEA 4IJ7A 2KGRA 1NIWA 2WCJA 1IGVA 1K9KA 2KI6D 1G4YR 3CR4X 2LUXA 2KLEA 3I5HC 2JXCA 4DCKA 3JVTC 1IWQA 2M8UA 1A29A 2WC8A 4PHMA 2LCPA 2WOSA 1KK7Z 4CFQA 2JOJA 1ZOTB 2QEOA 1B4CA 1B47A 5CSNA 5F6TA 3DD4A 1QX5B 1ZUZA 2I7AA 3AKBA 3DF0B 1QX2A 2L0PA 1Y1UA 3A4UB 1L2OB 2EC6B 2LV7A 3SG5A 1PK0D 2LMVA 2ISDA 1EH2A 2M7NA 1CDNA 4D1EA 3S0GA 2NLNA 5B8IB 1DJGA 2M97A 2KGBC 5DKRA 1BR4B 1ZACA 4PHJA 1EG3A 4YI9A 2QACA 3BUXB 2KYCA 2LM5A 4QJ4B 4JPZB 1CDPA 2KBIA 2K7CA 2LAPA 2H61C 3B87A 1C3YA 4XJKA 3MSEB 4CFRA 1GQMA 1LVCD 1LXFC 3CLNA 1KFXL 3AAJA 3E3RA 2FJYA 2JTTA 3NSLA 3WNXB 1AK8A 3SIBA 1ZMZA 4R1EA 3R72A 2BL0B 3EVVA 5JOLA 1IQ3A 1BLQA 1F70A 1NX3A 3DVKA 1BF5A 3LK0A 1YVHA 2RGIA 2O5GA 1M39A 3CYZA 5HKYA 2BNXA 3D78A 1KSOA 1YTZC 3CR5X 4TNCA 2L2CA 1BR1B 1S36A 2Q91A 3EKJA 5DICA 2LMUA 2FJUB 2F2OA 4PALA 1IIOA 4P2YB 4PDZA 2P70A 3NSIA 3WHTB 2LANA 3S0FA 1JC2A 1FF1A 1UHIA 3KHEA 1BODA 2YGUA 1LS8A 5I2QA 2K2FA 3HX4A 1CFPA 1AUIB 1DELA 2COLB 1NWDA 2CTNA 1EJ3A 4L9MA 3FS7A 3KF9A 2K7DA 1QATA 2KI4B 3I5FB 4OKHA 5ER4X 2CCMA 2K61A 1LA0A 3OX5A 2BE6A 3CTNA 1SR6C 2I94A 3NSOA 2BE4A 1GGZA 1XVJA 2P71A 3DVEA 4CIDA 1FBVA 2PASA 1Z4HA 2SASA 3PFVA 2MLFC 3S0DA 1K9PA 4OCIA 1DMOA 1RROA 3PM8A 3QMEA 1H4BA 1KCYA 3EK8A 2LP2A 1KQVA 1N2DA 1OSAA 4MRXA 4KYNA 3OB1B 4HRHA 4N1GA 3WHUB 2KFGA 4JWQA 3H4SE 2JT8A 1G33A 3VRPA 3BYAA 4HREE 5D3OA 2B1UA 1J7OA 4YGCB 1QLSA 1SNLA 1B8LA 5J3XA 1DJZA 1RWYA 2OTGC 5DKNA 4ZCVA 1KWOB 2F2PA 1FI5A 2MA2A 4MVFA 1E8AA 1KK7Y 4GGFA 1DVIA 4MZKA 1W7JB 2QDIA 1IQ5A 1B8CA 2DOQA 2QEVA 4MSPA 1IJ5A 1NX0A 2LVVA 2NXQA 3BOWB 3SG3A 3CZTX 4FQOA 1N65A 2GV5A 1Y0VH 2LVIA 5D7FA 2FCDA 4GNKB 3TS5C 3B6XA 2FCEA 3VB1A 2M1KB 1U5IB 1SW8A 1NCXA 4WQ2A 2WORA 3F45A 1K93D 1UHKA 4JQ0D 1FI6A 3D76A 5JJGA 2I18A 4OVNF 5HYDA 1MXEA 1ALVA 4M2QA 2QEBA 3RLZA 2KSPA 5HL1A 1QWVA 4NQGA 2I2RE 1F55A 2BCAA 3IQQA 4NDCA 4YGAA 2M49B 5I94A 1SPYA 2WC6A 1EL4A 2WCEA 4MRYA 5FYXA 4GPLB 2JPTA 2CBLA 3O4YA 1Y1XA 4ORBB 1CNPA 1XFYO 3R1PA 1TOPA 2ZFDA 1KSMA 3TZ1A 2A4JA 2JZIA 1JSAA 2GGMA 1OW4A 1ALWA 3AKAA 4PCWA 1AP4A 1LA3A 5D69A 1H8BA 4I5LB 2P6BB 2KAXA 4QJ3B 1LKJA 1PSBA 1V1GA 1EXRA 2CT9A 3BXKA 1L2OC 1QLKA 1Z2CB 2EC6C 3NSKA 3OX6A 2IS9A 2BECA 2WCLA 3EKHA 1MQ1A 3D73A 3DXLA 4F7FA 1XFRA 1F54A 1C3ZA 1WRKA 2MRDA 1BJFA 1KK8B 5AEQA 3HCMA 2TN4A 4DUQA 2H2KA 2EHBA 4I5NB 3GK4X 1UHHA 1VRKA 1XK4C 2G9BA 3PN7B 2NCOA 5G08A 3QRXA 3KEVA 1MF8B 2MJWB 2HQ8A 3DZTA 4N1FA 5GQQC 1K2HA 1SMGA 2LE9B 3JTDB 2VRGA 1J55A 3GK1A 1YX7A 2F8PA 3L47A 2LUCA 4Q04A 5CSIA 2NCPA 1CM1A 2BL0C 1QVIY 4YGDB 1QXPA 3TUYB 2JWWA 1AVSA 4I5JA 2D8NA 3B86A 4I5KA 1DF0A 1BMOA 4MZLA 2WCBA 3SIAA 5FI7A 3BQ3A 1OOIX 3BUOB 1YUSA 1SCMB 2PMYA 2HQWA 1TTXA 3Q8IA 5FI6A 1OMVA 1SSEB 1DJIA 3S0BA 3SG7A 1CLLA 2H61A 4AQIA 1F8HA 3VROA 2JULA 4PE1A 3BUWB 1BU3A 1CFCA 2H8VA 1KFUL 2PYQA 1JWDA 1D1OA 2F3ZA 3EK7A 1CMGA 1TN4A 2PALA 2LLSA 2KLDA 1W9ZA 2PQLA 1DEKA 3PLFB 4UPGA 2CXJA 1A03A 2JT0A 2M9GA 3I5FC 1SYMA 2KI4C 1DGUA 1S3PA 1F4QA 2AAOA 2KDHA 2ZNDA 5AXIA 1N0YA 1IJ6A 2JU0A 1YRUB 1SRAA 1IG5A 2LHIA 3S0AA 1A75A 4XJKB 1CFDA 3LCPC 3BUMB 4OV2A 1XA5A 1S6IA 1A2XA 1OOGA 2BKHB 2KFFA 1KQMB 2L98A 1S6JA 2L50A 2LP3A 2WCHA 3D75A 2JNFA 3FE8A 3O6BA 2K8MB 1OZOA 4BY5A 1L7ZA 2JPOA 3BFHA 3L4LA 5EL2A 1DTLA 2KOTA 1AJ4A 3I5GB 1NX2A 3FE6A 4A4CA 1KWOC 1QVIZ 1DC1A 5CSFA 4DRWA 4AQJA 1XYDA 1C7VA 2ZKMX 2L2EA 3NHTA 1TNPA 1J7RA 1K9UA 1DT7B 4ICBA 4USLA 2KBMA 1UUSA 3BFAA 1TIZA 4YGBB 2HETA 3V2LA 3DVMA 5AANA 4M2PA 3AAKA 2L4HA 3KPXA 2LLUA 3SS5A 3BUNB 1TNWA 1B7TZ 3UO9A 1ODBA 1AHRA 1YRTB 3VGOA 2Y1MA 2JNXA 2KYFA 1W7IB 4QJ5B 3GOFA 2M0RA 5CPVA 1B1GA 2MLEC 4HSZA 1IH0A 1T14A 1OMRA 1PRWA 3O2PA 4PE7A 2Y4QA 3OHMB 1RK9A 4CLNA 1SY9A 1X02A 1QS7A 2GGZA 4NDDA 5KSZA 2E6WA 4MEWA 2LHLA 1CMFA 2PVBA 3CWGA 1K90D 1MR8A 3CGAA 1CB1A 2Q4UA 2PSRA 2KQYA 1MUXA 5CSJA 1XFUO 2NZ0A 2Y1NA 4PE4A 1YURA 1Y1AA 4GFTA 4P5OE 1QX7A 2M1UA 1A4PA 1AJ5A 1DJHA 1QASA 4E68A 4MN0A 3OBVA 1TWOA 2WCMA 4YBHB 3ZWHA 2LVKA 1WY9A 3FWBA 4GBAA 1BT6A 1QIVA 3GK2A 3EG5B 1JF0A 1NSHA 2ZRTA 3OB2B 2ERBA 1MXLC 1KK8C 2KAVA 2WCFA 5AERA 1Y6WA 3D77A 2KNEA 3CZ0A 1JFJA 3D0YA 3PN7C 3SG6A 3NHIA 4YRUA 2F33A 1KFXS 1UHJA 1TUJA 3WXAA 5AFPA 3I5IB 3JTDC 4MLWA 3DYEA 1NYAA 1PVBA 2WNDA 2HF5A 2WC5A 3LK1A 2Y5IA 1PULA 4GAOA 4OR9B 1M63B 1M45A 3DF0A 1UHNA 1NP8A 1ZFSA 2K60A 3TUYC 3PSRA 1NCYA 2M7LA 5HLVA 4XYNA 1J7PA 1RTP1 1SCMC 4ORAB 1TUZA 5DKQA 5I2OA 2MBXA 5HLOA 1LINA 1CLBA 4INXA 2BBMA 1UWOA 4PE0A 3VRRA 1SKTA 3B7AA 3DVJA 4IL1A 1UURA 3D10A 4A4BA 1TRFA 1XK4A 2K0JA 3CS1A 2GTEA 1SBJA 4GGNA 4MZJA 4BY4A 1P28A 2SCPA 2JRFA 3D0YB 2ZN8A 3SG4A 1RFJA 4ORCB 3PALA 1CM4A 3BJHA 2AMIA 2LNKA 2M3WA 1QV1A 1HQVA 1OOJA 2K7OA 1M46A 3PATA 1WDCB 2E30A 1B7TY 2K7BA 2KFHA 2L51A 2OS8B 1DJXA 2BCXA 1GGWA 3OP0A 1CDLA 2JQ6A 2V53A 3ZNIA 4CPVA 1CLMA 1Q80A 1XFXO 1CTRA 3I5HB 3JVTB 1G8IA 2JC2A 2L5YA 5I2LA 2LVJA 3A8RA 1KQMC 1CKKA 1S6CA 4PHKA 1WRLA 1V1FA 1NUBA 3NXAA 2M29A 3SG2A 1JBAA 2F3YA 3DY9A 1DF0B 1MHOA 4JKTA 1TNQA 1PSRA 4YI8A 5ER5A 3FIAA 4N5XA 1XFWO 3I5GC 3PJIA 2MHHA 3IVTA 1DJYA 1RECA 3CZ2A 1BOCA 1DGVA 1S26D 1OE9B 2OPOA 1SL7A 5PALA 3M0WA 3SS3A 1J7QA 3EVUA 3SS4A 3FE9A 4ZCUA 3D74A 1GM0A 5HKZA 1CFFA 4C0KA 1C07A 1RJVA 1S5GY 1OMDA 3O78A 2LLTA 1EG4A 2KPHA 2L5XB 5I8NA 3RM1A 3RZSA 1JFKA 2AUCA 5IBWA 1DQEA 3UNWA 2JXLA 1QIWA 1TCFA 3PM2A 4C0LA 1FW4A 4HRGA 1PALA 4NDBA 3S0EA 3TDZA 1NPQA 4ETOA 1A75B 1OOHA 2ZRSA 3IF7A 5TNCA 3CDNA 1YVLA 1YR5A 2QPTA 5FI2A 1F4OA 1NCZA 1SK6D 1YX8A 2R2IA 3BOWA 3VRNA 1QJTA 1R6PA 2EGDA 1DJWA 4FQTA 1JUOA 4F0ZB 2MAZA 3OGNA 1J1DA 3EVRA 1QTXA 3ICBA 3IQOA 3TDIA 1K94A 1U5IA 3O4XA 3L4AA 5KU1A 1J1EA 1XFZO 2ZNEA 2WCKA 1TCOB 3K21A 1CDMA 1M31A 4GGFC 1B8RA 1SR6B 4WQ3A 5K89A 4INWA 2JTZA 1S1EA 1B9AA
chains in the Genus database with same CATH topology
1BG1A 1F71A 1SL8A 2O60A 1IKUA 1C7WA 2JT3A 2FOTA 2G2BA 3FWCA 1YUUA 4DIRA 1WLMA 1IRJA 4PHNA 3C1VA 2KI6C 1SL9A 3TDUA 4AOMA 4GUKA 1R2UA 1K8UA 4DS7A 3I5IC 4WRIA 4C0JA 2K2AA 2LMTA 1NX1A 2PRUA 1S5GZ 2OTGB 4YGEB 3VRQA 4MBEA 1K95A 3EK4A 3SJSA 2KHNA 1K96A 1MWNA 3CR2A 2BCBA 1TNXA 3LL8B 1QV0A 1UP5A 2L4IA 5HKWA 1YUTA 4FTGA 4M2OA 2LC5A 3TS5B 1WRZA 1OQPA 3KO0A 2BBNA 1KFUS 5BPJA 1HT9A 1OZSA 1XFVO 2HPSA 1WLZA 4U8DA 1GJYA 2KQ6A 2ZN9A 1WDCC 2CNPA 1XO5A 2BKIB 2KAYA 1SCVA 5KTYA 1PVAA 1JF2A 2OS8C 1FPWA 3LLEA 2KGRA 1NIWA 1IGVA 1K9KA 2KI6D 1G4YR 3CR4X 2LUXA 3I5HC 2JXCA 4DCKA 3JVTC 1IWQA 2M8UA 1A29A 2WC8A 4PHMA 2LCPA 2WOSA 1KK7Z 4CFQA 2JOJA 1ZOTB 1B4CA 1B47A 5CSNA 5F6TA 3DD4A 1QX5B 1ZUZA 2I7AA 3AKBA 3DF0B 1QX2A 2L0PA 1Y1UA 3A4UB 1L2OB 2EC6B 2LV7A 3SG5A 1PK0D 2LMVA 2ISDA 1EH2A 2M7NA 1CDNA 4D1EA 5B8IB 2NLNA 1DJGA 2M97A 2KGBC 5DKRA 1BR4B 1ZACA 4PHJA 1EG3A 4YI9A 2QACA 3BUXB 2KYCA 2LM5A 4QJ4B 4JPZB 1CDPA 2KBIA 2K7CA 2LAPA 2H61C 4XJKA 3MSEB 4CFRA 1GQMA 1LVCD 1LXFC 3CLNA 1KFXL 3AAJA 3E3RA 2JTTA 3NSLA 3WNXB 1AK8A 3SIBA 1ZMZA 4R1EA 2BL0B 3EVVA 5JOLA 1IQ3A 1BLQA 1F70A 1NX3A 3DVKA 1BF5A 3LK0A 1YVHA 2RGIA 2O5GA 1M39A 5HKYA 1KSOA 1YTZC 3CR5X 4TNCA 1BR1B 1S36A 2Q91A 3EKJA 2LMUA 2FJUB 2F2OA 4PALA 4P2YB 4PDZA 3WHTB 3NSIA 1JC2A 2LANA 1FF1A 1UHIA 3KHEA 1BODA 5I2QA 2K2FA 3HX4A 1CFPA 1AUIB 2COLB 1NWDA 2CTNA 1EJ3A 4L9MA 3FS7A 3KF9A 2K7DA 1QATA 2KI4B 3I5FB 4OKHA 5ER4X 2CCMA 2K61A 1LA0A 3OX5A 2BE6A 3CTNA 1SR6C 2I94A 3NSOA 2BE4A 1GGZA 1XVJA 3DVEA 4CIDA 1FBVA 2PASA 2SASA 3PFVA 2MLFC 1K9PA 4OCIA 1DMOA 1RROA 3PM8A 1H4BA 1KCYA 3EK8A 2LP2A 1KQVA 1N2DA 1OSAA 4MRXA 3OB1B 4HRHA 4N1GA 3WHUB 2KFGA 4JWQA 3H4SE 2JT8A 1G33A 3VRPA 3BYAA 4HREE 1J7OA 2B1UA 4YGCB 1QLSA 1SNLA 1B8LA 5J3XA 1DJZA 1RWYA 2OTGC 5DKNA 4ZCVA 1KWOB 2F2PA 1FI5A 2MA2A 4MVFA 1E8AA 1KK7Y 4GGFA 1DVIA 4MZKA 1W7JB 1IQ5A 1B8CA 2DOQA 4MSPA 1IJ5A 1NX0A 2LVVA 2NXQA 3BOWB 3SG3A 3CZTX 4FQOA 1N65A 2GV5A 1Y0VH 2LVIA 5D7FA 2FCDA 4GNKB 3TS5C 2FCEA 2M1KB 1U5IB 1SW8A 1NCXA 4WQ2A 2WORA 3F45A 1K93D 1UHKA 4JQ0D 1FI6A 5JJGA 2I18A 4OVNF 5HYDA 1MXEA 1ALVA 4M2QA 3RLZA 2KSPA 4NQGA 1F55A 2I2RE 2BCAA 3IQQA 4NDCA 4YGAA 2M49B 1SPYA 1EL4A 2WCEA 4MRYA 5FYXA 4GPLB 2JPTA 2CBLA 3O4YA 1Y1XA 4ORBB 1CNPA 1XFYO 1TOPA 2ZFDA 1KSMA 3TZ1A 2A4JA 2JZIA 1JSAA 2GGMA 1ALWA 3AKAA 4PCWA 1AP4A 1LA3A 5D69A 1H8BA 4I5LB 2P6BB 2KAXA 4QJ3B 1LKJA 1PSBA 1V1GA 1EXRA 2CT9A 3BXKA 1L2OC 1QLKA 2EC6C 3NSKA 3OX6A 2IS9A 2BECA 3EKHA 1MQ1A 1F54A 1WRKA 2MRDA 1BJFA 1KK8B 5AEQA 3HCMA 2TN4A 4DUQA 2H2KA 2EHBA 4I5NB 3GK4X 1UHHA 1VRKA 1XK4C 2G9BA 3PN7B 2NCOA 5G08A 3QRXA 3KEVA 1MF8B 2MJWB 2HQ8A 4N1FA 5GQQC 1K2HA 1SMGA 2LE9B 3JTDB 2VRGA 1J55A 3GK1A 1YX7A 2F8PA 2LUCA 4Q04A 5CSIA 2NCPA 1CM1A 2BL0C 1QVIY 4YGDB 1QXPA 3TUYB 2JWWA 1AVSA 4I5JA 2D8NA 4I5KA 1DF0A 1BMOA 4MZLA 2WCBA 3SIAA 3BQ3A 3BUOB 1YUSA 1SCMB 2PMYA 2HQWA 1TTXA 1OMVA 1DJIA 3SG7A 1CLLA 2H61A 4AQIA 1F8HA 3VROA 2JULA 4PE1A 3BUWB 1BU3A 1CFCA 1KFUL 1JWDA 1D1OA 2F3ZA 3EK7A 1CMGA 1TN4A 2PALA 2LLSA 3PLFB 4UPGA 2CXJA 1A03A 2JT0A 2M9GA 3I5FC 1SYMA 2KI4C 1DGUA 1S3PA 1F4QA 2AAOA 2KDHA 2ZNDA 5AXIA 1N0YA 1IJ6A 2JU0A 1YRUB 1SRAA 1IG5A 2LHIA 1A75A 4XJKB 1CFDA 3LCPC 3BUMB 4OV2A 1XA5A 1S6IA 1A2XA 2BKHB 2KFFA 1KQMB 2L98A 1S6JA 2L50A 2LP3A 4BY5A 2JNFA 3O6BA 2K8MB 1OZOA 1L7ZA 1DTLA 2KOTA 1AJ4A 3I5GB 1NX2A 4A4CA 1KWOC 1QVIZ 5CSFA 4DRWA 4AQJA 1XYDA 1C7VA 2ZKMX 2L2EA 1TNPA 1J7RA 1K9UA 1DT7B 4ICBA 4USLA 2KBMA 1UUSA 1TIZA 4YGBB 2HETA 3DVMA 5AANA 4M2PA 3AAKA 2L4HA 3KPXA 2LLUA 3BUNB 1TNWA 1B7TZ 1ODBA 1AHRA 1YRTB 3VGOA 2Y1MA 2JNXA 2KYFA 1W7IB 4QJ5B 3GOFA 2M0RA 5CPVA 1B1GA 2MLEC 4HSZA 1IH0A 1OMRA 1PRWA 3O2PA 4PE7A 2Y4QA 3OHMB 1RK9A 4CLNA 1SY9A 1X02A 1QS7A 2GGZA 4NDDA 5KSZA 2E6WA 4MEWA 2LHLA 1CMFA 2PVBA 3CWGA 1K90D 1MR8A 3CGAA 1CB1A 2Q4UA 2PSRA 2KQYA 1MUXA 5CSJA 1XFUO 2NZ0A 2Y1NA 4PE4A 1YURA 1Y1AA 4GFTA 4P5OE 1QX7A 2M1UA 1A4PA 1AJ5A 1DJHA 1QASA 4E68A 4MN0A 4YBHB 3ZWHA 2LVKA 1WY9A 3FWBA 4GBAA 1BT6A 1QIVA 3GK2A 1JF0A 1NSHA 2ZRTA 3OB2B 1MXLC 1KK8C 2KAVA 2WCFA 5AERA 1Y6WA 1JFJA 2KNEA 3D0YA 3PN7C 3SG6A 4YRUA 2F33A 1KFXS 1UHJA 3WXAA 5AFPA 3I5IB 3JTDC 4MLWA 1NYAA 1PVBA 2WNDA 2HF5A 4OR9B 3LK1A 2Y5IA 1PULA 4GAOA 1M63B 1M45A 3DF0A 1UHNA 1NP8A 1ZFSA 3TUYC 3PSRA 1NCYA 2M7LA 5HLVA 4XYNA 1J7PA 1RTP1 1SCMC 4ORAB 5DKQA 5I2OA 2MBXA 5HLOA 1LINA 1CLBA 2BBMA 1UWOA 4PE0A 3VRRA 1SKTA 4IL1A 3DVJA 1UURA 3D10A 4A4BA 1TRFA 1XK4A 2K0JA 3CS1A 1SBJA 4GGNA 4MZJA 4BY4A 2SCPA 2JRFA 3D0YB 2ZN8A 3SG4A 1RFJA 4ORCB 3PALA 1CM4A 2AMIA 2LNKA 2M3WA 1QV1A 1HQVA 1OOJA 2K7OA 1M46A 3PATA 1WDCB 2E30A 1B7TY 2K7BA 2KFHA 2L51A 2OS8B 1DJXA 2BCXA 1GGWA 3OP0A 1CDLA 2JQ6A 2V53A 3ZNIA 4CPVA 1CLMA 1Q80A 1XFXO 1CTRA 3I5HB 3JVTB 1G8IA 2JC2A 5I2LA 2LVJA 3A8RA 1KQMC 1CKKA 1S6CA 4PHKA 1WRLA 1V1FA 1NUBA 3NXAA 2M29A 3SG2A 1JBAA 2F3YA 1DF0B 1MHOA 1TNQA 1PSRA 4YI8A 5ER5A 3FIAA 4N5XA 1XFWO 3I5GC 2MHHA 1DJYA 1RECA 1BOCA 1DGVA 1S26D 1OE9B 2OPOA 1SL7A 5PALA 3M0WA 1J7QA 3EVUA 4ZCUA 5HKZA 1CFFA 4C0KA 1C07A 1RJVA 1S5GY 1OMDA 3O78A 2LLTA 1EG4A 2L5XB 5I8NA 3RM1A 1JFKA 2AUCA 5IBWA 2JXLA 1QIWA 1TCFA 4C0LA 1FW4A 4HRGA 1PALA 4NDBA 3TDZA 1NPQA 4ETOA 1A75B 2ZRSA 5TNCA 3IF7A 1YVLA 1YR5A 2QPTA 1F4OA 1NCZA 1SK6D 1YX8A 2R2IA 3BOWA 3VRNA 1QJTA 1R6PA 2EGDA 1DJWA 1JUOA 4F0ZB 2MAZA 1J1DA 3EVRA 1QTXA 3ICBA 3IQOA 3TDIA 1K94A 1U5IA 5KU1A 1J1EA 1XFZO 2ZNEA 1TCOB 3K21A 1CDMA 1M31A 4GGFC 1B8RA 1SR6B 4WQ3A 5K89A 2JTZA 1S1EA 1B9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BG1 A;  1F71 A;  1SL8 A;  2O60 A;  1IKU A;  1C7W A;  2JT3 A;  2FOT A;  2G2B A;  3FWC A;  1YUU A;  4DIR A;  1WLM A;  1IRJ A;  4PHN A;  3C1V A;  2KI6 C;  1SL9 A;  3TDU A;  4AOM A;  4GUK A;  1R2U A;  1K8U A;  4DS7 A;  3I5I C;  4WRI A;  4C0J A;  2K2A A;  2LMT A;  1NX1 A;  2PRU A;  1S5G Z;  2OTG B;  4YGE B;  3VRQ A;  4MBE A;  1K95 A;  3EK4 A;  3SJS A;  2KHN A;  1K96 A;  1MWN A;  3CR2 A;  2BCB A;  1TNX A;  3LL8 B;  1QV0 A;  1UP5 A;  2L4I A;  5HKW A;  1YUT A;  4FTG A;  4M2O A;  2LC5 A;  3TS5 B;  1WRZ A;  1OQP A;  3KO0 A;  2BBN A;  1KFU S;  5BPJ A;  1HT9 A;  1OZS A;  1XFV O;  2HPS A;  1WLZ A;  4U8D A;  1GJY A;  2KQ6 A;  2ZN9 A;  1WDC C;  2CNP A;  1XO5 A;  2BKI B;  2KAY A;  1SCV A;  5KTY A;  1PVA A;  1JF2 A;  2OS8 C;  1FPW A;  3LLE A;  2KGR A;  1NIW A;  1IGV A;  1K9K A;  2KI6 D;  1G4Y R;  3CR4 X;  2LUX A;  3I5H C;  2JXC A;  4DCK A;  3JVT C;  1IWQ A;  2M8U A;  1A29 A;  2WC8 A;  4PHM A;  2LCP A;  2WOS A;  1KK7 Z;  4CFQ A;  2JOJ A;  1ZOT B;  1B4C A;  1B47 A;  5CSN A;  5F6T A;  3DD4 A;  1QX5 B;  1ZUZ A;  2I7A A;  3AKB A;  3DF0 B;  1QX2 A;  2L0P A;  1Y1U A;  3A4U B;  1L2O B;  2EC6 B;  2LV7 A;  3SG5 A;  1PK0 D;  2LMV A;  2ISD A;  1EH2 A;  2M7N A;  1CDN A;  4D1E A;  5B8I B;  2NLN A;  1DJG A;  2M97 A;  2KGB C;  5DKR A;  1BR4 B;  1ZAC A;  4PHJ A;  1EG3 A;  4YI9 A;  2QAC A;  3BUX B;  2KYC A;  2LM5 A;  4QJ4 B;  4JPZ B;  1CDP A;  2KBI A;  2K7C A;  2LAP A;  2H61 C;  4XJK A;  3MSE B;  4CFR A;  1GQM A;  1LVC D;  1LXF C;  3CLN A;  1KFX L;  3AAJ A;  3E3R A;  2JTT A;  3NSL A;  3WNX B;  1AK8 A;  3SIB A;  1ZMZ A;  4R1E A;  2BL0 B;  3EVV A;  5JOL A;  1IQ3 A;  1BLQ A;  1F70 A;  1NX3 A;  3DVK A;  1BF5 A;  3LK0 A;  1YVH A;  2RGI A;  2O5G A;  1M39 A;  5HKY A;  1KSO A;  1YTZ C;  3CR5 X;  4TNC A;  1BR1 B;  1S36 A;  2Q91 A;  3EKJ A;  2LMU A;  2FJU B;  2F2O A;  4PAL A;  4P2Y B;  4PDZ A;  3WHT B;  3NSI A;  1JC2 A;  2LAN A;  1FF1 A;  1UHI A;  3KHE A;  1BOD A;  5I2Q A;  2K2F A;  3HX4 A;  1CFP A;  1AUI B;  2COL B;  1NWD A;  2CTN A;  1EJ3 A;  4L9M A;  3FS7 A;  3KF9 A;  2K7D A;  1QAT A;  2KI4 B;  3I5F B;  4OKH A;  5ER4 X;  2CCM A;  2K61 A;  1LA0 A;  3OX5 A;  2BE6 A;  3CTN A;  1SR6 C;  2I94 A;  3NSO A;  2BE4 A;  1GGZ A;  1XVJ A;  3DVE A;  4CID A;  1FBV A;  2PAS A;  2SAS A;  3PFV A;  2MLF C;  1K9P A;  4OCI A;  1DMO A;  1RRO A;  3PM8 A;  1H4B A;  1KCY A;  3EK8 A;  2LP2 A;  1KQV A;  1N2D A;  1OSA A;  4MRX A;  3OB1 B;  4HRH A;  4N1G A;  3WHU B;  2KFG A;  4JWQ A;  3H4S E;  2JT8 A;  1G33 A;  3VRP A;  3BYA A;  4HRE E;  1J7O A;  2B1U A;  4YGC B;  1QLS A;  1SNL A;  1B8L A;  5J3X A;  1DJZ A;  1RWY A;  2OTG C;  5DKN A;  4ZCV A;  1KWO B;  2F2P A;  1FI5 A;  2MA2 A;  4MVF A;  1E8A A;  1KK7 Y;  4GGF A;  1DVI A;  4MZK A;  1W7J B;  1IQ5 A;  1B8C A;  2DOQ A;  4MSP A;  1IJ5 A;  1NX0 A;  2LVV A;  2NXQ A;  3BOW B;  3SG3 A;  3CZT X;  4FQO A;  1N65 A;  2GV5 A;  1Y0V H;  2LVI A;  5D7F A;  2FCD A;  4GNK B;  3TS5 C;  2FCE A;  2M1K B;  1U5I B;  1SW8 A;  1NCX A;  4WQ2 A;  2WOR A;  3F45 A;  1K93 D;  1UHK A;  4JQ0 D;  1FI6 A;  5JJG A;  2I18 A;  4OVN F;  5HYD A;  1MXE A;  1ALV A;  4M2Q A;  3RLZ A;  2KSP A;  4NQG A;  1F55 A;  2I2R E;  2BCA A;  3IQQ A;  4NDC A;  4YGA A;  2M49 B;  1SPY A;  1EL4 A;  2WCE A;  4MRY A;  5FYX A;  4GPL B;  2JPT A;  2CBL A;  3O4Y A;  1Y1X A;  4ORB B;  1CNP A;  1XFY O;  1TOP A;  2ZFD A;  1KSM A;  3TZ1 A;  2A4J A;  2JZI A;  1JSA A;  2GGM A;  1ALW A;  3AKA A;  4PCW A;  1AP4 A;  1LA3 A;  5D69 A;  1H8B A;  4I5L B;  2P6B B;  2KAX A;  4QJ3 B;  1LKJ A;  1PSB A;  1V1G A;  1EXR A;  2CT9 A;  3BXK A;  1L2O C;  1QLK A;  2EC6 C;  3NSK A;  3OX6 A;  2IS9 A;  2BEC A;  3EKH A;  1MQ1 A;  1F54 A;  1WRK A;  2MRD A;  1BJF A;  1KK8 B;  5AEQ A;  3HCM A;  2TN4 A;  4DUQ A;  2H2K A;  2EHB A;  4I5N B;  3GK4 X;  1UHH A;  1VRK A;  1XK4 C;  2G9B A;  3PN7 B;  2NCO A;  5G08 A;  3QRX A;  3KEV A;  1MF8 B;  2MJW B;  2HQ8 A;  4N1F A;  5GQQ C;  1K2H A;  1SMG A;  2LE9 B;  3JTD B;  2VRG A;  1J55 A;  3GK1 A;  1YX7 A;  2F8P A;  2LUC A;  4Q04 A;  5CSI A;  2NCP A;  1CM1 A;  2BL0 C;  1QVI Y;  4YGD B;  1QXP A;  3TUY B;  2JWW A;  1AVS A;  4I5J A;  2D8N A;  4I5K A;  1DF0 A;  1BMO A;  4MZL A;  2WCB A;  3SIA A;  3BQ3 A;  3BUO B;  1YUS A;  1SCM B;  2PMY A;  2HQW A;  1TTX A;  1OMV A;  1DJI A;  3SG7 A;  1CLL A;  2H61 A;  4AQI A;  1F8H A;  3VRO A;  2JUL A;  4PE1 A;  3BUW B;  1BU3 A;  1CFC A;  1KFU L;  1JWD A;  1D1O A;  2F3Z A;  3EK7 A;  1CMG A;  1TN4 A;  2PAL A;  2LLS A;  3PLF B;  4UPG A;  2CXJ A;  1A03 A;  2JT0 A;  2M9G A;  3I5F C;  1SYM A;  2KI4 C;  1DGU A;  1S3P A;  1F4Q A;  2AAO A;  2KDH A;  2ZND A;  5AXI A;  1N0Y A;  1IJ6 A;  2JU0 A;  1YRU B;  1SRA A;  1IG5 A;  2LHI A;  1A75 A;  4XJK B;  1CFD A;  3LCP C;  3BUM B;  4OV2 A;  1XA5 A;  1S6I A;  1A2X A;  2BKH B;  2KFF A;  1KQM B;  2L98 A;  1S6J A;  2L50 A;  2LP3 A;  4BY5 A;  2JNF A;  3O6B A;  2K8M B;  1OZO A;  1L7Z A;  1DTL A;  2KOT A;  1AJ4 A;  3I5G B;  1NX2 A;  4A4C A;  1KWO C;  1QVI Z;  5CSF A;  4DRW A;  4AQJ A;  1XYD A;  1C7V A;  2ZKM X;  2L2E A;  1TNP A;  1J7R A;  1K9U A;  1DT7 B;  4ICB A;  4USL A;  2KBM A;  1UUS A;  1TIZ A;  4YGB B;  2HET A;  3DVM A;  5AAN A;  4M2P A;  3AAK A;  2L4H A;  3KPX A;  2LLU A;  3BUN B;  1TNW A;  1B7T Z;  1ODB A;  1AHR A;  1YRT B;  3VGO A;  2Y1M A;  2JNX A;  2KYF A;  1W7I B;  4QJ5 B;  3GOF A;  2M0R A;  5CPV A;  1B1G A;  2MLE C;  4HSZ A;  1IH0 A;  1OMR A;  1PRW A;  3O2P A;  4PE7 A;  2Y4Q A;  3OHM B;  1RK9 A;  4CLN A;  1SY9 A;  1X02 A;  1QS7 A;  2GGZ A;  4NDD A;  5KSZ A;  2E6W A;  4MEW A;  2LHL A;  1CMF A;  2PVB A;  3CWG A;  1K90 D;  1MR8 A;  3CGA A;  1CB1 A;  2Q4U A;  2PSR A;  2KQY A;  1MUX A;  5CSJ A;  1XFU O;  2NZ0 A;  2Y1N A;  4PE4 A;  1YUR A;  1Y1A A;  4GFT A;  4P5O E;  1QX7 A;  2M1U A;  1A4P A;  1AJ5 A;  1DJH A;  1QAS A;  4E68 A;  4MN0 A;  4YBH B;  3ZWH A;  2LVK A;  1WY9 A;  3FWB A;  4GBA A;  1BT6 A;  1QIV A;  3GK2 A;  1JF0 A;  1NSH A;  2ZRT A;  3OB2 B;  1MXL C;  1KK8 C;  2KAV A;  2WCF A;  5AER A;  1Y6W A;  1JFJ A;  2KNE A;  3D0Y A;  3PN7 C;  3SG6 A;  4YRU A;  2F33 A;  1KFX S;  1UHJ A;  3WXA A;  5AFP A;  3I5I B;  3JTD C;  4MLW A;  1NYA A;  1PVB A;  2WND A;  2HF5 A;  4OR9 B;  3LK1 A;  2Y5I A;  1PUL A;  4GAO A;  1M63 B;  1M45 A;  3DF0 A;  1UHN A;  1NP8 A;  1ZFS A;  3TUY C;  3PSR A;  1NCY A;  2M7L A;  5HLV A;  4XYN A;  1J7P A;  1RTP 1;  1SCM C;  4ORA B;  5DKQ A;  5I2O A;  2MBX A;  5HLO A;  1LIN A;  1CLB A;  2BBM A;  1UWO A;  4PE0 A;  3VRR A;  1SKT A;  4IL1 A;  3DVJ A;  1UUR A;  3D10 A;  4A4B A;  1TRF A;  1XK4 A;  2K0J A;  3CS1 A;  1SBJ A;  4GGN A;  4MZJ A;  4BY4 A;  2SCP A;  2JRF A;  3D0Y B;  2ZN8 A;  3SG4 A;  1RFJ A;  4ORC B;  3PAL A;  1CM4 A;  2AMI A;  2LNK A;  2M3W A;  1QV1 A;  1HQV A;  1OOJ A;  2K7O A;  1M46 A;  3PAT A;  1WDC B;  2E30 A;  1B7T Y;  2K7B A;  2KFH A;  2L51 A;  2OS8 B;  1DJX A;  2BCX A;  1GGW A;  3OP0 A;  1CDL A;  2JQ6 A;  2V53 A;  3ZNI A;  4CPV A;  1CLM A;  1Q80 A;  1XFX O;  1CTR A;  3I5H B;  3JVT B;  1G8I A;  2JC2 A;  5I2L A;  2LVJ A;  3A8R A;  1KQM C;  1CKK A;  1S6C A;  4PHK A;  1WRL A;  1V1F A;  1NUB A;  3NXA A;  2M29 A;  3SG2 A;  1JBA A;  2F3Y A;  1DF0 B;  1MHO A;  1TNQ A;  1PSR A;  4YI8 A;  5ER5 A;  3FIA A;  4N5X A;  1XFW O;  3I5G C;  2MHH A;  1DJY A;  1REC A;  1BOC A;  1DGV A;  1S26 D;  1OE9 B;  2OPO A;  1SL7 A;  5PAL A;  3M0W A;  1J7Q A;  3EVU A;  4ZCU A;  5HKZ A;  1CFF A;  4C0K A;  1C07 A;  1RJV A;  1S5G Y;  1OMD A;  3O78 A;  2LLT A;  1EG4 A;  2L5X B;  5I8N A;  3RM1 A;  1JFK A;  2AUC A;  5IBW A;  2JXL A;  1QIW A;  1TCF A;  4C0L A;  1FW4 A;  4HRG A;  1PAL A;  4NDB A;  3TDZ A;  1NPQ A;  4ETO A;  1A75 B;  2ZRS A;  5TNC A;  3IF7 A;  1YVL A;  1YR5 A;  2QPT A;  1F4O A;  1NCZ A;  1SK6 D;  1YX8 A;  2R2I A;  3BOW A;  3VRN A;  1QJT A;  1R6P A;  2EGD A;  1DJW A;  1JUO A;  4F0Z B;  2MAZ A;  1J1D A;  3EVR A;  1QTX A;  3ICB A;  3IQO A;  3TDI A;  1K94 A;  1U5I A;  5KU1 A;  1J1E A;  1XFZ O;  2ZNE A;  1TCO B;  3K21 A;  1CDM A;  1M31 A;  4GGF C;  1B8R A;  1SR6 B;  4WQ3 A;  5K89 A;  2JTZ A;  1S1E A;  1B9A A; 
#chains in the Genus database with same CATH topology
 3BFB A;  1BG1 A;  3B88 A;  1F71 A;  1SL8 A;  2O60 A;  1IKU A;  1C7W A;  2JT3 A;  2FOT A;  2G2B A;  3FWC A;  1YUU A;  4DIR A;  1WLM A;  1IRJ A;  4PHN A;  3C1V A;  2KI6 C;  1SL9 A;  3TDU A;  4AOM A;  4GUK A;  1R2U A;  1K8U A;  4DS7 A;  3I5I C;  3N7H A;  4WRI A;  4C0J A;  2K2A A;  2LMT A;  1NX1 A;  1ORG A;  2PRU A;  1S5G Z;  2OTG B;  4YGE B;  3VRQ A;  4MBE A;  2QEH A;  4OZD A;  1K95 A;  3EK4 A;  4JD9 A;  3SJS A;  2KHN A;  1K96 A;  1MWN A;  3CR2 A;  3K1E A;  3NGV A;  2BCB A;  1TNX A;  3LL8 B;  1QV0 A;  1UP5 A;  2BAP A;  2L4I A;  5HKW A;  1YUT A;  4FTG A;  4M2O A;  2LC5 A;  3TS5 B;  1WRZ A;  3R1V A;  1OQP A;  3KO0 A;  2BBN A;  1KFU S;  5BPJ A;  1HT9 A;  1OZS A;  1XFV O;  2HPS A;  1WLZ A;  3CAB A;  4U8D A;  1GJY A;  2KQ6 A;  2ZN9 A;  1WDC C;  2CNP A;  1XO5 A;  2BKI B;  2KAY A;  1SCV A;  4PT1 A;  5KTY A;  3R1O A;  1PVA A;  1JF2 A;  2OS8 C;  3CZ1 A;  1FPW A;  1OOF A;  3LLE A;  4IJ7 A;  2KGR A;  1NIW A;  2WCJ A;  1IGV A;  1K9K A;  2KI6 D;  1G4Y R;  3CR4 X;  2LUX A;  2KLE A;  3I5H C;  2JXC A;  4DCK A;  3JVT C;  1IWQ A;  2M8U A;  1A29 A;  2WC8 A;  4PHM A;  2LCP A;  2WOS A;  1KK7 Z;  4CFQ A;  2JOJ A;  1ZOT B;  2QEO A;  1B4C A;  1B47 A;  5CSN A;  5F6T A;  3DD4 A;  1QX5 B;  1ZUZ A;  2I7A A;  3AKB A;  3DF0 B;  1QX2 A;  2L0P A;  1Y1U A;  3A4U B;  1L2O B;  2EC6 B;  2LV7 A;  3SG5 A;  1PK0 D;  2LMV A;  2ISD A;  1EH2 A;  2M7N A;  1CDN A;  4D1E A;  3S0G A;  2NLN A;  5B8I B;  1DJG A;  2M97 A;  2KGB C;  5DKR A;  1BR4 B;  1ZAC A;  4PHJ A;  1EG3 A;  4YI9 A;  2QAC A;  3BUX B;  2KYC A;  2LM5 A;  4QJ4 B;  4JPZ B;  1CDP A;  2KBI A;  2K7C A;  2LAP A;  2H61 C;  3B87 A;  1C3Y A;  4XJK A;  3MSE B;  4CFR A;  1GQM A;  1LVC D;  1LXF C;  3CLN A;  1KFX L;  3AAJ A;  3E3R A;  2FJY A;  2JTT A;  3NSL A;  3WNX B;  1AK8 A;  3SIB A;  1ZMZ A;  4R1E A;  3R72 A;  2BL0 B;  3EVV A;  5JOL A;  1IQ3 A;  1BLQ A;  1F70 A;  1NX3 A;  3DVK A;  1BF5 A;  3LK0 A;  1YVH A;  2RGI A;  2O5G A;  1M39 A;  3CYZ A;  5HKY A;  2BNX A;  3D78 A;  1KSO A;  1YTZ C;  3CR5 X;  4TNC A;  2L2C A;  1BR1 B;  1S36 A;  2Q91 A;  3EKJ A;  5DIC A;  2LMU A;  2FJU B;  2F2O A;  4PAL A;  1IIO A;  4P2Y B;  4PDZ A;  2P70 A;  3NSI A;  3WHT B;  2LAN A;  3S0F A;  1JC2 A;  1FF1 A;  1UHI A;  3KHE A;  1BOD A;  2YGU A;  1LS8 A;  5I2Q A;  2K2F A;  3HX4 A;  1CFP A;  1AUI B;  1DEL A;  2COL B;  1NWD A;  2CTN A;  1EJ3 A;  4L9M A;  3FS7 A;  3KF9 A;  2K7D A;  1QAT A;  2KI4 B;  3I5F B;  4OKH A;  5ER4 X;  2CCM A;  2K61 A;  1LA0 A;  3OX5 A;  2BE6 A;  3CTN A;  1SR6 C;  2I94 A;  3NSO A;  2BE4 A;  1GGZ A;  1XVJ A;  2P71 A;  3DVE A;  4CID A;  1FBV A;  2PAS A;  1Z4H A;  2SAS A;  3PFV A;  2MLF C;  3S0D A;  1K9P A;  4OCI A;  1DMO A;  1RRO A;  3PM8 A;  3QME A;  1H4B A;  1KCY A;  3EK8 A;  2LP2 A;  1KQV A;  1N2D A;  1OSA A;  4MRX A;  4KYN A;  3OB1 B;  4HRH A;  4N1G A;  3WHU B;  2KFG A;  4JWQ A;  3H4S E;  2JT8 A;  1G33 A;  3VRP A;  3BYA A;  4HRE E;  5D3O A;  2B1U A;  1J7O A;  4YGC B;  1QLS A;  1SNL A;  1B8L A;  5J3X A;  1DJZ A;  1RWY A;  2OTG C;  5DKN A;  4ZCV A;  1KWO B;  2F2P A;  1FI5 A;  2MA2 A;  4MVF A;  1E8A A;  1KK7 Y;  4GGF A;  1DVI A;  4MZK A;  1W7J B;  2QDI A;  1IQ5 A;  1B8C A;  2DOQ A;  2QEV A;  4MSP A;  1IJ5 A;  1NX0 A;  2LVV A;  2NXQ A;  3BOW B;  3SG3 A;  3CZT X;  4FQO A;  1N65 A;  2GV5 A;  1Y0V H;  2LVI A;  5D7F A;  2FCD A;  4GNK B;  3TS5 C;  3B6X A;  2FCE A;  3VB1 A;  2M1K B;  1U5I B;  1SW8 A;  1NCX A;  4WQ2 A;  2WOR A;  3F45 A;  1K93 D;  1UHK A;  4JQ0 D;  1FI6 A;  3D76 A;  5JJG A;  2I18 A;  4OVN F;  5HYD A;  1MXE A;  1ALV A;  4M2Q A;  2QEB A;  3RLZ A;  2KSP A;  5HL1 A;  1QWV A;  4NQG A;  2I2R E;  1F55 A;  2BCA A;  3IQQ A;  4NDC A;  4YGA A;  2M49 B;  5I94 A;  1SPY A;  2WC6 A;  1EL4 A;  2WCE A;  4MRY A;  5FYX A;  4GPL B;  2JPT A;  2CBL A;  3O4Y A;  1Y1X A;  4ORB B;  1CNP A;  1XFY O;  3R1P A;  1TOP A;  2ZFD A;  1KSM A;  3TZ1 A;  2A4J A;  2JZI A;  1JSA A;  2GGM A;  1OW4 A;  1ALW A;  3AKA A;  4PCW A;  1AP4 A;  1LA3 A;  5D69 A;  1H8B A;  4I5L B;  2P6B B;  2KAX A;  4QJ3 B;  1LKJ A;  1PSB A;  1V1G A;  1EXR A;  2CT9 A;  3BXK A;  1L2O C;  1QLK A;  1Z2C B;  2EC6 C;  3NSK A;  3OX6 A;  2IS9 A;  2BEC A;  2WCL A;  3EKH A;  1MQ1 A;  3D73 A;  3DXL A;  4F7F A;  1XFR A;  1F54 A;  1C3Z A;  1WRK A;  2MRD A;  1BJF A;  1KK8 B;  5AEQ A;  3HCM A;  2TN4 A;  4DUQ A;  2H2K A;  2EHB A;  4I5N B;  3GK4 X;  1UHH A;  1VRK A;  1XK4 C;  2G9B A;  3PN7 B;  2NCO A;  5G08 A;  3QRX A;  3KEV A;  1MF8 B;  2MJW B;  2HQ8 A;  3DZT A;  4N1F A;  5GQQ C;  1K2H A;  1SMG A;  2LE9 B;  3JTD B;  2VRG A;  1J55 A;  3GK1 A;  1YX7 A;  2F8P A;  3L47 A;  2LUC A;  4Q04 A;  5CSI A;  2NCP A;  1CM1 A;  2BL0 C;  1QVI Y;  4YGD B;  1QXP A;  3TUY B;  2JWW A;  1AVS A;  4I5J A;  2D8N A;  3B86 A;  4I5K A;  1DF0 A;  1BMO A;  4MZL A;  2WCB A;  3SIA A;  5FI7 A;  3BQ3 A;  1OOI X;  3BUO B;  1YUS A;  1SCM B;  2PMY A;  2HQW A;  1TTX A;  3Q8I A;  5FI6 A;  1OMV A;  1SSE B;  1DJI A;  3S0B A;  3SG7 A;  1CLL A;  2H61 A;  4AQI A;  1F8H A;  3VRO A;  2JUL A;  4PE1 A;  3BUW B;  1BU3 A;  1CFC A;  2H8V A;  1KFU L;  2PYQ A;  1JWD A;  1D1O A;  2F3Z A;  3EK7 A;  1CMG A;  1TN4 A;  2PAL A;  2LLS A;  2KLD A;  1W9Z A;  2PQL A;  1DEK A;  3PLF B;  4UPG A;  2CXJ A;  1A03 A;  2JT0 A;  2M9G A;  3I5F C;  1SYM A;  2KI4 C;  1DGU A;  1S3P A;  1F4Q A;  2AAO A;  2KDH A;  2ZND A;  5AXI A;  1N0Y A;  1IJ6 A;  2JU0 A;  1YRU B;  1SRA A;  1IG5 A;  2LHI A;  3S0A A;  1A75 A;  4XJK B;  1CFD A;  3LCP C;  3BUM B;  4OV2 A;  1XA5 A;  1S6I A;  1A2X A;  1OOG A;  2BKH B;  2KFF A;  1KQM B;  2L98 A;  1S6J A;  2L50 A;  2LP3 A;  2WCH A;  3D75 A;  2JNF A;  3FE8 A;  3O6B A;  2K8M B;  1OZO A;  4BY5 A;  1L7Z A;  2JPO A;  3BFH A;  3L4L A;  5EL2 A;  1DTL A;  2KOT A;  1AJ4 A;  3I5G B;  1NX2 A;  3FE6 A;  4A4C A;  1KWO C;  1QVI Z;  1DC1 A;  5CSF A;  4DRW A;  4AQJ A;  1XYD A;  1C7V A;  2ZKM X;  2L2E A;  3NHT A;  1TNP A;  1J7R A;  1K9U A;  1DT7 B;  4ICB A;  4USL A;  2KBM A;  1UUS A;  3BFA A;  1TIZ A;  4YGB B;  2HET A;  3V2L A;  3DVM A;  5AAN A;  4M2P A;  3AAK A;  2L4H A;  3KPX A;  2LLU A;  3SS5 A;  3BUN B;  1TNW A;  1B7T Z;  3UO9 A;  1ODB A;  1AHR A;  1YRT B;  3VGO A;  2Y1M A;  2JNX A;  2KYF A;  1W7I B;  4QJ5 B;  3GOF A;  2M0R A;  5CPV A;  1B1G A;  2MLE C;  4HSZ A;  1IH0 A;  1T14 A;  1OMR A;  1PRW A;  3O2P A;  4PE7 A;  2Y4Q A;  3OHM B;  1RK9 A;  4CLN A;  1SY9 A;  1X02 A;  1QS7 A;  2GGZ A;  4NDD A;  5KSZ A;  2E6W A;  4MEW A;  2LHL A;  1CMF A;  2PVB A;  3CWG A;  1K90 D;  1MR8 A;  3CGA A;  1CB1 A;  2Q4U A;  2PSR A;  2KQY A;  1MUX A;  5CSJ A;  1XFU O;  2NZ0 A;  2Y1N A;  4PE4 A;  1YUR A;  1Y1A A;  4GFT A;  4P5O E;  1QX7 A;  2M1U A;  1A4P A;  1AJ5 A;  1DJH A;  1QAS A;  4E68 A;  4MN0 A;  3OBV A;  1TWO A;  2WCM A;  4YBH B;  3ZWH A;  2LVK A;  1WY9 A;  3FWB A;  4GBA A;  1BT6 A;  1QIV A;  3GK2 A;  3EG5 B;  1JF0 A;  1NSH A;  2ZRT A;  3OB2 B;  2ERB A;  1MXL C;  1KK8 C;  2KAV A;  2WCF A;  5AER A;  1Y6W A;  3D77 A;  2KNE A;  3CZ0 A;  1JFJ A;  3D0Y A;  3PN7 C;  3SG6 A;  3NHI A;  4YRU A;  2F33 A;  1KFX S;  1UHJ A;  1TUJ A;  3WXA A;  5AFP A;  3I5I B;  3JTD C;  4MLW A;  3DYE A;  1NYA A;  1PVB A;  2WND A;  2HF5 A;  2WC5 A;  3LK1 A;  2Y5I A;  1PUL A;  4GAO A;  4OR9 B;  1M63 B;  1M45 A;  3DF0 A;  1UHN A;  1NP8 A;  1ZFS A;  2K60 A;  3TUY C;  3PSR A;  1NCY A;  2M7L A;  5HLV A;  4XYN A;  1J7P A;  1RTP 1;  1SCM C;  4ORA B;  1TUZ A;  5DKQ A;  5I2O A;  2MBX A;  5HLO A;  1LIN A;  1CLB A;  4INX A;  2BBM A;  1UWO A;  4PE0 A;  3VRR A;  1SKT A;  3B7A A;  3DVJ A;  4IL1 A;  1UUR A;  3D10 A;  4A4B A;  1TRF A;  1XK4 A;  2K0J A;  3CS1 A;  2GTE A;  1SBJ A;  4GGN A;  4MZJ A;  4BY4 A;  1P28 A;  2SCP A;  2JRF A;  3D0Y B;  2ZN8 A;  3SG4 A;  1RFJ A;  4ORC B;  3PAL A;  1CM4 A;  3BJH A;  2AMI A;  2LNK A;  2M3W A;  1QV1 A;  1HQV A;  1OOJ A;  2K7O A;  1M46 A;  3PAT A;  1WDC B;  2E30 A;  1B7T Y;  2K7B A;  2KFH A;  2L51 A;  2OS8 B;  1DJX A;  2BCX A;  1GGW A;  3OP0 A;  1CDL A;  2JQ6 A;  2V53 A;  3ZNI A;  4CPV A;  1CLM A;  1Q80 A;  1XFX O;  1CTR A;  3I5H B;  3JVT B;  1G8I A;  2JC2 A;  2L5Y A;  5I2L A;  2LVJ A;  3A8R A;  1KQM C;  1CKK A;  1S6C A;  4PHK A;  1WRL A;  1V1F A;  1NUB A;  3NXA A;  2M29 A;  3SG2 A;  1JBA A;  2F3Y A;  3DY9 A;  1DF0 B;  1MHO A;  4JKT A;  1TNQ A;  1PSR A;  4YI8 A;  5ER5 A;  3FIA A;  4N5X A;  1XFW O;  3I5G C;  3PJI A;  2MHH A;  3IVT A;  1DJY A;  1REC A;  3CZ2 A;  1BOC A;  1DGV A;  1S26 D;  1OE9 B;  2OPO A;  1SL7 A;  5PAL A;  3M0W A;  3SS3 A;  1J7Q A;  3EVU A;  3SS4 A;  3FE9 A;  4ZCU A;  3D74 A;  1GM0 A;  5HKZ A;  1CFF A;  4C0K A;  1C07 A;  1RJV A;  1S5G Y;  1OMD A;  3O78 A;  2LLT A;  1EG4 A;  2KPH A;  2L5X B;  5I8N A;  3RM1 A;  3RZS A;  1JFK A;  2AUC A;  5IBW A;  1DQE A;  3UNW A;  2JXL A;  1QIW A;  1TCF A;  3PM2 A;  4C0L A;  1FW4 A;  4HRG A;  1PAL A;  4NDB A;  3S0E A;  3TDZ A;  1NPQ A;  4ETO A;  1A75 B;  1OOH A;  2ZRS A;  3IF7 A;  5TNC A;  3CDN A;  1YVL A;  1YR5 A;  2QPT A;  5FI2 A;  1F4O A;  1NCZ A;  1SK6 D;  1YX8 A;  2R2I A;  3BOW A;  3VRN A;  1QJT A;  1R6P A;  2EGD A;  1DJW A;  4FQT A;  1JUO A;  4F0Z B;  2MAZ A;  3OGN A;  1J1D A;  3EVR A;  1QTX A;  3ICB A;  3IQO A;  3TDI A;  1K94 A;  1U5I A;  3O4X A;  3L4A A;  5KU1 A;  1J1E A;  1XFZ O;  2ZNE A;  2WCK A;  1TCO B;  3K21 A;  1CDM A;  1M31 A;  4GGF C;  1B8R A;  1SR6 B;  4WQ3 A;  5K89 A;  4INW A;  2JTZ A;  1S1E A;  1B9A A; 
#chains in the Genus database with same CATH homology
 1BG1 A;  1F71 A;  1SL8 A;  2O60 A;  1IKU A;  1C7W A;  2JT3 A;  2FOT A;  2G2B A;  3FWC A;  1YUU A;  4DIR A;  1WLM A;  1IRJ A;  4PHN A;  3C1V A;  2KI6 C;  1SL9 A;  3TDU A;  4AOM A;  4GUK A;  1R2U A;  1K8U A;  4DS7 A;  3I5I C;  4WRI A;  4C0J A;  2K2A A;  2LMT A;  1NX1 A;  2PRU A;  1S5G Z;  2OTG B;  4YGE B;  3VRQ A;  4MBE A;  1K95 A;  3EK4 A;  3SJS A;  2KHN A;  1K96 A;  1MWN A;  3CR2 A;  2BCB A;  1TNX A;  3LL8 B;  1QV0 A;  1UP5 A;  2L4I A;  5HKW A;  1YUT A;  4FTG A;  4M2O A;  2LC5 A;  3TS5 B;  1WRZ A;  1OQP A;  3KO0 A;  2BBN A;  1KFU S;  5BPJ A;  1HT9 A;  1OZS A;  1XFV O;  2HPS A;  1WLZ A;  4U8D A;  1GJY A;  2KQ6 A;  2ZN9 A;  1WDC C;  2CNP A;  1XO5 A;  2BKI B;  2KAY A;  1SCV A;  5KTY A;  1PVA A;  1JF2 A;  2OS8 C;  1FPW A;  3LLE A;  2KGR A;  1NIW A;  1IGV A;  1K9K A;  2KI6 D;  1G4Y R;  3CR4 X;  2LUX A;  3I5H C;  2JXC A;  4DCK A;  3JVT C;  1IWQ A;  2M8U A;  1A29 A;  2WC8 A;  4PHM A;  2LCP A;  2WOS A;  1KK7 Z;  4CFQ A;  2JOJ A;  1ZOT B;  1B4C A;  1B47 A;  5CSN A;  5F6T A;  3DD4 A;  1QX5 B;  1ZUZ A;  2I7A A;  3AKB A;  3DF0 B;  1QX2 A;  2L0P A;  1Y1U A;  3A4U B;  1L2O B;  2EC6 B;  2LV7 A;  3SG5 A;  1PK0 D;  2LMV A;  2ISD A;  1EH2 A;  2M7N A;  1CDN A;  4D1E A;  5B8I B;  2NLN A;  1DJG A;  2M97 A;  2KGB C;  5DKR A;  1BR4 B;  1ZAC A;  4PHJ A;  1EG3 A;  4YI9 A;  2QAC A;  3BUX B;  2KYC A;  2LM5 A;  4QJ4 B;  4JPZ B;  1CDP A;  2KBI A;  2K7C A;  2LAP A;  2H61 C;  4XJK A;  3MSE B;  4CFR A;  1GQM A;  1LVC D;  1LXF C;  3CLN A;  1KFX L;  3AAJ A;  3E3R A;  2JTT A;  3NSL A;  3WNX B;  1AK8 A;  3SIB A;  1ZMZ A;  4R1E A;  2BL0 B;  3EVV A;  5JOL A;  1IQ3 A;  1BLQ A;  1F70 A;  1NX3 A;  3DVK A;  1BF5 A;  3LK0 A;  1YVH A;  2RGI A;  2O5G A;  1M39 A;  5HKY A;  1KSO A;  1YTZ C;  3CR5 X;  4TNC A;  1BR1 B;  1S36 A;  2Q91 A;  3EKJ A;  2LMU A;  2FJU B;  2F2O A;  4PAL A;  4P2Y B;  4PDZ A;  3WHT B;  3NSI A;  1JC2 A;  2LAN A;  1FF1 A;  1UHI A;  3KHE A;  1BOD A;  5I2Q A;  2K2F A;  3HX4 A;  1CFP A;  1AUI B;  2COL B;  1NWD A;  2CTN A;  1EJ3 A;  4L9M A;  3FS7 A;  3KF9 A;  2K7D A;  1QAT A;  2KI4 B;  3I5F B;  4OKH A;  5ER4 X;  2CCM A;  2K61 A;  1LA0 A;  3OX5 A;  2BE6 A;  3CTN A;  1SR6 C;  2I94 A;  3NSO A;  2BE4 A;  1GGZ A;  1XVJ A;  3DVE A;  4CID A;  1FBV A;  2PAS A;  2SAS A;  3PFV A;  2MLF C;  1K9P A;  4OCI A;  1DMO A;  1RRO A;  3PM8 A;  1H4B A;  1KCY A;  3EK8 A;  2LP2 A;  1KQV A;  1N2D A;  1OSA A;  4MRX A;  3OB1 B;  4HRH A;  4N1G A;  3WHU B;  2KFG A;  4JWQ A;  3H4S E;  2JT8 A;  1G33 A;  3VRP A;  3BYA A;  4HRE E;  1J7O A;  2B1U A;  4YGC B;  1QLS A;  1SNL A;  1B8L A;  5J3X A;  1DJZ A;  1RWY A;  2OTG C;  5DKN A;  4ZCV A;  1KWO B;  2F2P A;  1FI5 A;  2MA2 A;  4MVF A;  1E8A A;  1KK7 Y;  4GGF A;  1DVI A;  4MZK A;  1W7J B;  1IQ5 A;  1B8C A;  2DOQ A;  4MSP A;  1IJ5 A;  1NX0 A;  2LVV A;  2NXQ A;  3BOW B;  3SG3 A;  3CZT X;  4FQO A;  1N65 A;  2GV5 A;  1Y0V H;  2LVI A;  5D7F A;  2FCD A;  4GNK B;  3TS5 C;  2FCE A;  2M1K B;  1U5I B;  1SW8 A;  1NCX A;  4WQ2 A;  2WOR A;  3F45 A;  1K93 D;  1UHK A;  4JQ0 D;  1FI6 A;  5JJG A;  2I18 A;  4OVN F;  5HYD A;  1MXE A;  1ALV A;  4M2Q A;  3RLZ A;  2KSP A;  4NQG A;  1F55 A;  2I2R E;  2BCA A;  3IQQ A;  4NDC A;  4YGA A;  2M49 B;  1SPY A;  1EL4 A;  2WCE A;  4MRY A;  5FYX A;  4GPL B;  2JPT A;  2CBL A;  3O4Y A;  1Y1X A;  4ORB B;  1CNP A;  1XFY O;  1TOP A;  2ZFD A;  1KSM A;  3TZ1 A;  2A4J A;  2JZI A;  1JSA A;  2GGM A;  1ALW A;  3AKA A;  4PCW A;  1AP4 A;  1LA3 A;  5D69 A;  1H8B A;  4I5L B;  2P6B B;  2KAX A;  4QJ3 B;  1LKJ A;  1PSB A;  1V1G A;  1EXR A;  2CT9 A;  3BXK A;  1L2O C;  1QLK A;  2EC6 C;  3NSK A;  3OX6 A;  2IS9 A;  2BEC A;  3EKH A;  1MQ1 A;  1F54 A;  1WRK A;  2MRD A;  1BJF A;  1KK8 B;  5AEQ A;  3HCM A;  2TN4 A;  4DUQ A;  2H2K A;  2EHB A;  4I5N B;  3GK4 X;  1UHH A;  1VRK A;  1XK4 C;  2G9B A;  3PN7 B;  2NCO A;  5G08 A;  3QRX A;  3KEV A;  1MF8 B;  2MJW B;  2HQ8 A;  4N1F A;  5GQQ C;  1K2H A;  1SMG A;  2LE9 B;  3JTD B;  2VRG A;  1J55 A;  3GK1 A;  1YX7 A;  2F8P A;  2LUC A;  4Q04 A;  5CSI A;  2NCP A;  1CM1 A;  2BL0 C;  1QVI Y;  4YGD B;  1QXP A;  3TUY B;  2JWW A;  1AVS A;  4I5J A;  2D8N A;  4I5K A;  1DF0 A;  1BMO A;  4MZL A;  2WCB A;  3SIA A;  3BQ3 A;  3BUO B;  1YUS A;  1SCM B;  2PMY A;  2HQW A;  1TTX A;  1OMV A;  1DJI A;  3SG7 A;  1CLL A;  2H61 A;  4AQI A;  1F8H A;  3VRO A;  2JUL A;  4PE1 A;  3BUW B;  1BU3 A;  1CFC A;  1KFU L;  1JWD A;  1D1O A;  2F3Z A;  3EK7 A;  1CMG A;  1TN4 A;  2PAL A;  2LLS A;  3PLF B;  4UPG A;  2CXJ A;  1A03 A;  2JT0 A;  2M9G A;  3I5F C;  1SYM A;  2KI4 C;  1DGU A;  1S3P A;  1F4Q A;  2AAO A;  2KDH A;  2ZND A;  5AXI A;  1N0Y A;  1IJ6 A;  2JU0 A;  1YRU B;  1SRA A;  1IG5 A;  2LHI A;  1A75 A;  4XJK B;  1CFD A;  3LCP C;  3BUM B;  4OV2 A;  1XA5 A;  1S6I A;  1A2X A;  2BKH B;  2KFF A;  1KQM B;  2L98 A;  1S6J A;  2L50 A;  2LP3 A;  4BY5 A;  2JNF A;  3O6B A;  2K8M B;  1OZO A;  1L7Z A;  1DTL A;  2KOT A;  1AJ4 A;  3I5G B;  1NX2 A;  4A4C A;  1KWO C;  1QVI Z;  5CSF A;  4DRW A;  4AQJ A;  1XYD A;  1C7V A;  2ZKM X;  2L2E A;  1TNP A;  1J7R A;  1K9U A;  1DT7 B;  4ICB A;  4USL A;  2KBM A;  1UUS A;  1TIZ A;  4YGB B;  2HET A;  3DVM A;  5AAN A;  4M2P A;  3AAK A;  2L4H A;  3KPX A;  2LLU A;  3BUN B;  1TNW A;  1B7T Z;  1ODB A;  1AHR A;  1YRT B;  3VGO A;  2Y1M A;  2JNX A;  2KYF A;  1W7I B;  4QJ5 B;  3GOF A;  2M0R A;  5CPV A;  1B1G A;  2MLE C;  4HSZ A;  1IH0 A;  1OMR A;  1PRW A;  3O2P A;  4PE7 A;  2Y4Q A;  3OHM B;  1RK9 A;  4CLN A;  1SY9 A;  1X02 A;  1QS7 A;  2GGZ A;  4NDD A;  5KSZ A;  2E6W A;  4MEW A;  2LHL A;  1CMF A;  2PVB A;  3CWG A;  1K90 D;  1MR8 A;  3CGA A;  1CB1 A;  2Q4U A;  2PSR A;  2KQY A;  1MUX A;  5CSJ A;  1XFU O;  2NZ0 A;  2Y1N A;  4PE4 A;  1YUR A;  1Y1A A;  4GFT A;  4P5O E;  1QX7 A;  2M1U A;  1A4P A;  1AJ5 A;  1DJH A;  1QAS A;  4E68 A;  4MN0 A;  4YBH B;  3ZWH A;  2LVK A;  1WY9 A;  3FWB A;  4GBA A;  1BT6 A;  1QIV A;  3GK2 A;  1JF0 A;  1NSH A;  2ZRT A;  3OB2 B;  1MXL C;  1KK8 C;  2KAV A;  2WCF A;  5AER A;  1Y6W A;  1JFJ A;  2KNE A;  3D0Y A;  3PN7 C;  3SG6 A;  4YRU A;  2F33 A;  1KFX S;  1UHJ A;  3WXA A;  5AFP A;  3I5I B;  3JTD C;  4MLW A;  1NYA A;  1PVB A;  2WND A;  2HF5 A;  4OR9 B;  3LK1 A;  2Y5I A;  1PUL A;  4GAO A;  1M63 B;  1M45 A;  3DF0 A;  1UHN A;  1NP8 A;  1ZFS A;  3TUY C;  3PSR A;  1NCY A;  2M7L A;  5HLV A;  4XYN A;  1J7P A;  1RTP 1;  1SCM C;  4ORA B;  5DKQ A;  5I2O A;  2MBX A;  5HLO A;  1LIN A;  1CLB A;  2BBM A;  1UWO A;  4PE0 A;  3VRR A;  1SKT A;  4IL1 A;  3DVJ A;  1UUR A;  3D10 A;  4A4B A;  1TRF A;  1XK4 A;  2K0J A;  3CS1 A;  1SBJ A;  4GGN A;  4MZJ A;  4BY4 A;  2SCP A;  2JRF A;  3D0Y B;  2ZN8 A;  3SG4 A;  1RFJ A;  4ORC B;  3PAL A;  1CM4 A;  2AMI A;  2LNK A;  2M3W A;  1QV1 A;  1HQV A;  1OOJ A;  2K7O A;  1M46 A;  3PAT A;  1WDC B;  2E30 A;  1B7T Y;  2K7B A;  2KFH A;  2L51 A;  2OS8 B;  1DJX A;  2BCX A;  1GGW A;  3OP0 A;  1CDL A;  2JQ6 A;  2V53 A;  3ZNI A;  4CPV A;  1CLM A;  1Q80 A;  1XFX O;  1CTR A;  3I5H B;  3JVT B;  1G8I A;  2JC2 A;  5I2L A;  2LVJ A;  3A8R A;  1KQM C;  1CKK A;  1S6C A;  4PHK A;  1WRL A;  1V1F A;  1NUB A;  3NXA A;  2M29 A;  3SG2 A;  1JBA A;  2F3Y A;  1DF0 B;  1MHO A;  1TNQ A;  1PSR A;  4YI8 A;  5ER5 A;  3FIA A;  4N5X A;  1XFW O;  3I5G C;  2MHH A;  1DJY A;  1REC A;  1BOC A;  1DGV A;  1S26 D;  1OE9 B;  2OPO A;  1SL7 A;  5PAL A;  3M0W A;  1J7Q A;  3EVU A;  4ZCU A;  5HKZ A;  1CFF A;  4C0K A;  1C07 A;  1RJV A;  1S5G Y;  1OMD A;  3O78 A;  2LLT A;  1EG4 A;  2L5X B;  5I8N A;  3RM1 A;  1JFK A;  2AUC A;  5IBW A;  2JXL A;  1QIW A;  1TCF A;  4C0L A;  1FW4 A;  4HRG A;  1PAL A;  4NDB A;  3TDZ A;  1NPQ A;  4ETO A;  1A75 B;  2ZRS A;  5TNC A;  3IF7 A;  1YVL A;  1YR5 A;  2QPT A;  1F4O A;  1NCZ A;  1SK6 D;  1YX8 A;  2R2I A;  3BOW A;  3VRN A;  1QJT A;  1R6P A;  2EGD A;  1DJW A;  1JUO A;  4F0Z B;  2MAZ A;  1J1D A;  3EVR A;  1QTX A;  3ICB A;  3IQO A;  3TDI A;  1K94 A;  1U5I A;  5KU1 A;  1J1E A;  1XFZ O;  2ZNE A;  1TCO B;  3K21 A;  1CDM A;  1M31 A;  4GGF C;  1B8R A;  1SR6 B;  4WQ3 A;  5K89 A;  2JTZ A;  1S1E A;  1B9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...