2LUCA

Solution structure of human s100 calcium-binding protein a11
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A11
publication title NMR structure note: the structure of human calcium-bound S100A11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lucA00
3KHEA 4OV2A 1K2HA 1NCZA 2KI6D 1E8AA 3DF0A 1H8BA 1Y0VH 1KQMB 1YUSA 2Q4UA 2OPOA 2JWWA 1XVJA 1SPYA 1X02A 2LVIA 3I5GB 2JXCA 1C7WA 2LC5A 4ORCB 2ZNDA 1NUBA 1SBJA 1Y1AA 2ZNEA 5B8IB 1YUUA 1YRTB 3RM1A 1DGUA 1MXEA 1TNQA 2M29A 3CWGA 3HCMA 2OS8C 3LL8B 3O6BA 1OMDA 1XYDA 2HPSA 4JPZB 2M8UA 3ZNIA 1QX2A 1F55A 2G9BA 4MSPA 1J1EA 3BXKA 5J3XA 1S3PA 2M9GA 1QS7A 1CDNA 1LXFC 4ZCVA 2WCBA 4GUKA 4QJ5B 2I2RE 5IBWA 2KI4B 4CLNA 4DRWA 3TS5C 1KK8B 2AUCA 3BUMB 1ZMZA 3I5FC 2BECA 3BQ3A 4UPGA 3JVTC 3EKHA 5HLVA 2LLUA 2M49B 1YX8A 2WC8A 3VRRA 2K61A 5HLOA 1HT9A 3KF9A 4YGEB 2M1KB 5TNCA 1QVIZ 1DGVA 2NXQA 5F6TA 1IJ6A 1BU3A 2PMYA 1TN4A 2LVVA 1K9UA 5DKNA 1FI6A 1N0YA 3LLEA 2MHHA 5ER4X 1R2UA 3MSEB 2CNPA 3CTNA 1JFJA 3KO0A 1B7TZ 1FF1A 1B8LA 1H4BA 1YUTA 1IQ3A 2KAVA 2L50A 1SCMC 4PE1A 1SYMA 1NP8A 1MXLC 2KDHA 1B9AA 1KFUL 1QLKA 3OB2B 1JF2A 2QPTA 5KSZA 3O4YA 1QX5B 3C1VA 1ZFSA 3CR2A 2M1UA 2EHBA 3I5GC 3LK0A 1KSOA 2EC6B 1QIWA 2K0JA 1W7IB 5AEQA 1A2XA 4WRIA 3GK2A 2ZRTA 1KFUS 1WY9A 2KFGA 2QACA 2FJUB 1CKKA 1LA3A 1MR8A 1NYAA 1ZUZA 1YTZC 2GV5A 1CLMA 3PALA 2JPTA 1IRJA 3SIBA 1B8CA 2M0RA 3BUNB 1AVSA 2KBIA 2TN4A 4YGAA 1YR5A 1G4YR 2LAPA 3BUWB 2L4IA 2WCFA 3SG2A 1QIVA 3GK1A 1CB1A 2PRUA 5AERA 1Y1UA 1MF8B 2Y1NA 1GQMA 1RJVA 3LCPC 1EXRA 2KI4C 4D1EA 4YRUA 1NCXA 2LLSA 4NQGA 4HRGA 3PN7C 2G2BA 1ZACA 4P2YB 3VROA 1J7RA 3DVMA 1DJWA 1WDCB 1CFCA 2H61C 1FI5A 2BBMA 3K21A 4PHKA 1V1GA 1XFYO 2BCBA 1NIWA 1IH0A 2R2IA 4I5JA 2ZRSA 2PVBA 2LHIA 1UP5A 1CDMA 2KQYA 3VRQA 1F71A 1IGVA 2K8MB 5JOLA 1Y6WA 4DUQA 1PSRA 4YBHB 3GK4X 1QXPA 1RK9A 2MBXA 3DVKA 2LLTA 2Y4QA 2JRFA 1A75B 5KTYA 3A8RA 2I94A 3IQQA 1BT6A 4GAOA 3TZ1A 4U8DA 1NX2A 3EK4A 3FS7A 1PRWA 2F2PA 4PE0A 1K95A 2CTNA 3OX5A 4JQ0D 4YI8A 4MZKA 1XO5A 2O5GA 3DVJA 3WXAA 1TNPA 1RFJA 2LUXA 3BYAA 3AKBA 4DS7A 1WLMA 5BPJA 2I7AA 2K2AA 4QJ4B 4OR9B 2LV7A 2O60A 2PASA 3E3RA 1DTLA 1Q80A 1YURA 2M7NA 1SKTA 2P6BB 3SG3A 3O78A 1CFFA 1DVIA 1DJIA 2JT0A 5AFPA 1M31A 1J55A 3NSIA 1SNLA 3OX6A 2BKIB 2E30A 1KWOB 1Y1XA 2FCDA 1A75A 1CFDA 1SR6C 2LM5A 1JF0A 1IWQA 2WORA 1YVLA 1B4CA 2LE9B 2LUCA 2M3WA 1FBVA 3TDIA 2BL0B 1KFXL 2KFFA 4DCKA 1EL4A 4A4BA 1K90D 1UURA 1TRFA 1UWOA 2F3YA 2HF5A 4CIDA 4HSZA 2BCXA 1FW4A 4PE7A 1GGZA 4GBAA 1G8IA 4PE4A 5CPVA 5HYDA 5I2OA 3D0YB 4MLWA 3LK1A 1S6CA 1F8HA 1KCYA 1DT7B 4CPVA 4CFRA 2OTGC 1NWDA 3I5IC 5DKRA 2L4HA 5AANA 1CLBA 1DJZA 3I5HB 4QJ3B 1YX7A 4IL1A 2BCAA 2JT3A 2JOJA 2IS9A 5HKZA 1UHKA 3PFVA 1NX3A 2KSPA 4N5XA 4MBEA 4OKHA 1AHRA 2LANA 3WHTB 1WRKA 1BR4B 2M97A 1PSBA 5FYXA 2COLB 4GFTA 1W7JB 2L98A 1KQMC 4F0ZB 2JC2A 2KAXA 1GJYA 3D0YA 1QTXA 2KOTA 3TDZA 2JNXA 3TDUA 1JC2A 1D1OA 3CR4X 4NDBA 1VRKA 1K94A 3A4UB 4AOMA 3CR5X 3BOWB 1XFVO 2LMTA 1QX7A 3BUOB 1CMFA 3OP0A 2FOTA 4HREE 1J1DA 1HQVA 2KYCA 2NLNA 4XJKB 4XYNA 4PCWA 3AAJA 1L7ZA 1BLQA 2LVJA 1GGWA 3AAKA 2HQ8A 3EVVA 1AP4A 1QVIY 2Y1MA 3FWBA 3QRXA 4ZCUA 1L2OB 2EGDA 1NSHA 3RLZA 2BL0C 4YGBB 4NDCA 1F70A 2L0PA 1KK8C 3NSLA 1SW8A 3CGAA 4L9MA 1SL8A 2D8NA 1B7TY 4OCIA 1N65A 1M63B 1OOJA 1TCFA 1XFUO 1M46A 4M2PA 2JZIA 1S36A 3BOWA 4M2OA 1QJTA 2CBLA 2LNKA 5D7FA 2LMVA 1F54A 1RTP1 3NSKA 4XJKA 2K2FA 1S1EA 2OS8B 1MUXA 2LMUA 1DF0B 3BUXB 3ZWHA 1QLSA 3NXAA 3TUYB 1NCYA 2LCPA 1S5GZ 3D10A 1K96A 2LP2A 2KHNA 4GGFA 2BKHB 1EG3A 1B8RA 2KGBC 2F3ZA 2LVKA 4BY5A 1BG1A 2NCOA 2ZN8A 2SASA 4FQOA 4Q04A 1OMVA 3TS5B 2NCPA 2MLFC 2ZFDA 4A4CA 3I5FB 1CDLA 1J7OA 1S26D 1N2DA 1J7QA 1C07A 1YRUB 2BBNA 1AUIB 1K93D 2M7LA 1IJ5A 2EC6C 1CM1A 2K7CA 1KK7Z 1XFXO 3SG5A 1SCVA 2BE6A 1ALWA 2I18A 2B1UA 2MJWB 3SG4A 1PVAA 2AMIA 4JWQA 2RGIA 2KYFA 1SK6D 1JFKA 3SIAA 3VGOA 2WCEA 1DF0A 4R1EA 3PSRA 1M45A 2KQ6A 4DIRA 4GNKB 1WLZA 1WRZA 3PATA 2PSRA 1BODA 4GGFC 4MEWA 3M0WA 1JUOA 2WNDA 4TNCA 1B1GA 1XFZO 1S5GY 3JTDB 2VRGA 4PDZA 1ODBA 5HKYA 4WQ3A 4MRXA 1TTXA 4GGNA 3CLNA 5AXIA 1OSAA 1RWYA 1S6JA 1AJ5A 1DJXA 1WDCC 1SRAA 3EVUA 3PM8A 1SL9A 5PALA 2Q91A 2ZKMX 5GQQC 1S6IA 1CFPA 3EKJA 2HQWA 2CXJA 1MQ1A 1TCOB 3WNXB 4AQIA 3WHUB 1KFXS 3SG7A 1U5IA 1LKJA 2GGZA 5I2LA 3VRNA 1A03A 2L2EA 1CDPA 2FCEA 1K9KA 2SCPA 3TUYC 3FIAA 2JXLA 1IQ5A 1KK7Y 4USLA 1LVCD 1K9PA 2LP3A 2MLEC 4GPLB 2H2KA 5CSFA 3OHMB 1OMRA 2Y5IA 4OVNF 1QATA 2AAOA 5DKQA 1V1FA 3PN7B 4I5KA 4I5LB 4YI9A 5G08A 5I2QA 1C7VA 2JULA 2L5XB 4C0LA 1UUSA 1FPWA 2MAZA 4ICBA 1UHJA 1R6PA 3H4SE 1LA0A 1SMGA 4N1FA 4CFQA 4FTGA 1DJGA 4C0KA 2KAYA 3KEVA 3GOFA 5K89A 1BR1B 4YGCB 3SG6A 1WRLA 3ICBA 1UHHA 1XK4A 1IG5A 1CLLA 2ISDA 1MHOA 3DD4A 3KPXA 2JTZA 4MVFA 1AK8A 1J7PA 4ORAB 2K7BA 2L51A 2GGMA 1KSMA 1KWOC 2K7OA 5I8NA 3EVRA 1IKUA 1SL7A 1LINA 2BE4A 1TNWA 2CCMA 2WOSA 1M39A 4ORBB 1UHNA 5D69A 3OB1B 1G33A 4BY4A 2F8PA 2JNFA 3VRPA 1QV0A 1NX1A 2KGRA 1PULA 3JTDC 2KI6C 2F33A 4NDDA 4YGDB 1MWNA 1EG4A 1BMOA 1NX0A 2H61A 1TOPA 1K8UA 1A4PA 1OZOA 1XA5A 4P5OE 5HKWA 1JWDA 2CT9A 1TIZA 4I5NB 1EH2A 4E68A 5CSJA 2KBMA 1TNXA 1NPQA 2E6WA 1QASA 1CTRA 1PK0D 4HRHA 4PHNA 1DJHA 3O2PA 4ETOA 1XK4C 5KU1A 3NSOA 5CSNA 1BJFA 2MA2A 4MZJA 1XFWO 5JJGA 2PALA 1SR6B 2HETA 3SJSA 1UHIA 1RROA 1SY9A 3I5HC 3CZTX 3AKAA 2NZ0A 2V53A 4MRYA 4PALA 2KNEA 1CM4A 1RECA 2DOQA 3EK8A 1JSAA 1A29A 2KFHA 1JBAA 1ZOTB 3IQOA 2ZN9A 3IF7A 2JU0A 1CMGA 3CS1A 4MZLA 2MRDA 4C0JA 3JVTB 3DF0B 5CSIA 1BF5A 5ER5A 1OZSA 1OE9B 2JQ6A 1F4QA 1F4OA 2F2OA 1B47A 1ALVA 2OTGB 3I5IB 1OQPA 3FWCA 1KQVA 3DVEA 1YVHA 2JTTA 3EK7A 1DJYA 2JT8A 1QV1A 3PLFB 4MN0A 2A4JA 4PHMA 1U5IB 1CNPA 3HX4A 2LHLA 1EJ3A 1AJ4A 1PVBA 4M2QA 2K7DA 4PHJA 4WQ2A 3F45A 1PALA 4AQJA 1SCMB 1BOCA 4N1GA 1L2OC 1DMOA
chains in the Genus database with same CATH superfamily
3KHEA 4OV2A 1K2HA 1NCZA 2KI6D 1E8AA 3DF0A 1H8BA 1Y0VH 1KQMB 1YUSA 2Q4UA 2BNXA 2OPOA 3D73A 2JWWA 1XVJA 1SPYA 1X02A 2LVIA 3I5GB 3S0GA 3DZTA 2JXCA 1C7WA 2LC5A 4ORCB 3BFHA 2ZNDA 3B87A 1Y1AA 1NUBA 1SBJA 2ZNEA 5B8IB 1DQEA 1YUUA 1YRTB 3RM1A 1DGUA 1OOIX 1MXEA 1TNQA 2M29A 3CWGA 3HCMA 2OS8C 3LL8B 2L5YA 3O6BA 1OMDA 1XYDA 2HPSA 4JPZB 2M8UA 3ZNIA 1QX2A 1F55A 2G9BA 3L47A 4MSPA 1J1EA 3BXKA 5J3XA 1S3PA 2M9GA 1QS7A 1CDNA 1LXFC 4ZCVA 2WCBA 4GUKA 4QJ5B 2I2RE 5IBWA 3D77A 2KI4B 5DICA 4CLNA 4DRWA 3TS5C 1KK8B 2AUCA 3BUMB 1ZMZA 3I5FC 2BECA 3BQ3A 4UPGA 3JVTC 3EKHA 1ORGA 5HLVA 2LLUA 2M49B 4PT1A 1OW4A 1YX8A 2WC8A 3VRRA 2K61A 3DY9A 3R1OA 5HLOA 1HT9A 3KF9A 4YGEB 2M1KB 5TNCA 1QVIZ 1DGVA 2NXQA 5F6TA 3SS5A 1IJ6A 1BU3A 2PMYA 1TN4A 2LVVA 1K9UA 5DKNA 1W9ZA 1FI6A 1N0YA 3LLEA 2MHHA 5ER4X 1R2UA 3MSEB 2CNPA 3CTNA 1JFJA 3KO0A 1B7TZ 1FF1A 1B8LA 1H4BA 1YUTA 1IQ3A 2KAVA 2L50A 1SCMC 4PE1A 1SYMA 2WC5A 1NP8A 1MXLC 2KDHA 1B9AA 1KFUL 1QLKA 3OB2B 1JF2A 2QPTA 5KSZA 3O4YA 1QX5B 3C1VA 1ZFSA 3CR2A 2M1UA 2EHBA 3I5GC 3LK0A 1KSOA 2EC6B 1QIWA 2K0JA 1W7IB 5AEQA 1A2XA 4WRIA 3GK2A 2ZRTA 1KFUS 1WY9A 2KFGA 2QACA 2FJUB 1XFRA 3CYZA 3O4XA 1CKKA 1LA3A 1MR8A 1NYAA 1ZUZA 1YTZC 2GV5A 1CLMA 3PALA 2JPTA 1IRJA 3SIBA 1B8CA 2M0RA 2K60A 1AVSA 2KBIA 2TN4A 3BUNB 4YGAA 3CZ2A 1YR5A 1G4YR 2LAPA 3BUWB 2L4IA 2WCFA 3SG2A 1QIVA 3BFBA 3GK1A 1CB1A 2PRUA 5AERA 3D75A 1Y1UA 1MF8B 2Y1NA 1GQMA 3S0FA 1RJVA 3LCPC 1EXRA 2KI4C 1Z2CB 4D1EA 4YRUA 1NCXA 2LLSA 4NQGA 4HRGA 3PN7C 2G2BA 1ZACA 4P2YB 3DYEA 3SS4A 3VROA 1J7RA 3DVMA 1DJWA 1WDCB 3S0AA 1CFCA 2H61C 2JPOA 1FI5A 2BBMA 3K21A 4PHKA 1V1GA 1XFYO 2BCBA 3CZ1A 4OZDA 1NIWA 1IH0A 2QEOA 2R2IA 3NHTA 4JKTA 4I5JA 2ZRSA 2PVBA 2LHIA 1UP5A 1CDMA 2KQYA 3VRQA 3B88A 1IGVA 1F71A 2K8MB 5JOLA 1Y6WA 4DUQA 2PQLA 1PSRA 4YBHB 3GK4X 1QXPA 1RK9A 2MBXA 3DVKA 2LLTA 2Y4QA 2JRFA 1A75B 5KTYA 3RZSA 3A8RA 2I94A 2PYQA 1BT6A 3IQQA 4GAOA 4U8DA 4KYNA 3TZ1A 1NX2A 3EK4A 3FS7A 1PRWA 2F2PA 4PE0A 1K95A 2CTNA 3OX5A 4JQ0D 4YI8A 1IIOA 2WCMA 3Q8IA 1XO5A 2O5GA 4MZKA 3DVJA 1Z4HA 3WXAA 1TNPA 1RFJA 2LUXA 3BYAA 3AKBA 4DS7A 1WLMA 2GTEA 5BPJA 2I7AA 2K2AA 4QJ4B 2WCLA 4OR9B 2LV7A 2O60A 2PASA 3E3RA 3IVTA 1DTLA 1Q80A 1YURA 2M7NA 1SKTA 2P6BB 3SG3A 3O78A 1CFFA 1DVIA 1DJIA 2JT0A 5AFPA 1M31A 1J55A 3NSIA 1SNLA 3OX6A 2BKIB 2E30A 1QWVA 2H8VA 1KWOB 5HL1A 1Y1XA 2FCDA 1A75A 1CFDA 3R1PA 1SR6C 2LM5A 1JF0A 2KLDA 1IWQA 2WORA 1YVLA 1B4CA 2LE9B 5EL2A 2LUCA 3OGNA 2M3WA 2KLEA 1FBVA 3TDIA 4JD9A 2BL0B 1KFXL 2KFFA 4FQTA 4DCKA 1EL4A 4A4BA 1K90D 1UURA 1TRFA 1UWOA 2F3YA 2HF5A 4CIDA 5FI2A 4HSZA 1FW4A 2BCXA 2KPHA 3D74A 4PE7A 1GGZA 4GBAA 1G8IA 4PE4A 5CPVA 5HYDA 2WCHA 5I2OA 3D0YB 4MLWA 3LK1A 1S6CA 1F8HA 1KCYA 1DT7B 5FI6A 2QEVA 4CPVA 4CFRA 2OTGC 1NWDA 3I5IC 2ERBA 2L4HA 5DKRA 5AANA 3CABA 3PM2A 3BJHA 1CLBA 1DJZA 3I5HB 4QJ3B 1YX7A 4IL1A 2BCAA 2JT3A 2JOJA 2IS9A 1P28A 5HKZA 1UHKA 3PFVA 1NX3A 2KSPA 4N5XA 1OOGA 4MBEA 4OKHA 1AHRA 2LANA 3WHTB 1WRKA 1BR4B 2M97A 3VB1A 1PSBA 5FYXA 2COLB 2QEBA 4GFTA 1W7JB 2L98A 1KQMC 4F0ZB 3B7AA 2JC2A 2WCKA 2KAXA 1GJYA 3D0YA 1QTXA 2KOTA 1TWOA 2JNXA 3TDUA 3TDZA 1JC2A 1D1OA 3CR4X 4NDBA 1VRKA 1K94A 3A4UB 4AOMA 3CR5X 3BOWB 1XFVO 2LMTA 1QX7A 3BUOB 1CMFA 3OP0A 2FOTA 4HREE 1J1DA 1HQVA 2KYCA 2NLNA 4XJKB 4XYNA 4PCWA 2P70A 3AAJA 1L7ZA 1BLQA 2LVJA 1GGWA 3AAKA 2HQ8A 3EVVA 1AP4A 1QVIY 2Y1MA 3FWBA 3QRXA 4ZCUA 1L2OB 1OOHA 1NSHA 2EGDA 2BL0C 3RLZA 4YGBB 4NDCA 1F70A 2L0PA 3FE6A 1KK8C 3NSLA 1SW8A 2P71A 3CGAA 3D78A 1SL8A 2D8NA 1T14A 1B7TY 4INXA 4L9MA 1N65A 4OCIA 1M63B 1SSEB 1OOJA 1TCFA 1XFUO 1M46A 4M2PA 2JZIA 1S36A 3BOWA 4M2OA 3R72A 1QJTA 2CBLA 2LNKA 5D7FA 2LMVA 1F54A 1RTP1 3NSKA 4XJKA 2K2FA 1S1EA 2OS8B 1MUXA 2LMUA 1DF0B 5FI7A 3BUXB 3FE8A 3ZWHA 3OBVA 1QLSA 3NXAA 3TUYB 1NCYA 2LCPA 1S5GZ 3D10A 2L2CA 1K96A 2LP2A 2KHNA 4GGFA 2BKHB 1EG3A 1B8RA 2KGBC 2F3ZA 2LVKA 4BY5A 1BG1A 2NCOA 2ZN8A 2SASA 4FQOA 4Q04A 1OMVA 3TS5B 2NCPA 2MLFC 2ZFDA 4A4CA 3I5FB 1CDLA 1C3ZA 1J7OA 3B86A 1S26D 1N2DA 1J7QA 1C07A 1YRUB 2BBNA 1AUIB 1K93D 2M7LA 1IJ5A 2EC6C 1CM1A 2K7CA 1KK7Z 1XFXO 3SG5A 1SCVA 1ALWA 2BE6A 2I18A 2B1UA 2MJWB 3SG4A 1PVAA 2AMIA 4JWQA 2RGIA 1TUZA 2KYFA 1SK6D 1JFKA 3SIAA 3VGOA 2WCEA 1DF0A 4R1EA 3PSRA 1M45A 2KQ6A 3UO9A 5D3OA 3DXLA 4DIRA 4GNKB 1WLZA 1WRZA 3PATA 2PSRA 1BODA 4GGFC 3EG5B 4MEWA 3M0WA 1GM0A 1JUOA 2WNDA 4TNCA 1B1GA 1LS8A 1OOFA 1XFZO 1S5GY 3JTDB 2VRGA 4PDZA 1ODBA 5HKYA 4WQ3A 4MRXA 1TTXA 4GGNA 3CLNA 5AXIA 1OSAA 1RWYA 1S6JA 1AJ5A 1DJXA 1WDCC 1SRAA 3EVUA 3PM8A 1SL9A 5PALA 2Q91A 2ZKMX 5GQQC 1S6IA 1C3YA 1CFPA 3EKJA 2HQWA 1DEKA 2CXJA 1MQ1A 1TCOB 3WNXB 4AQIA 3WHUB 1KFXS 3SG7A 1U5IA 1LKJA 2GGZA 5I2LA 3VRNA 1A03A 2L2EA 1CDPA 2FCEA 1K9KA 2SCPA 3TUYC 3FIAA 2JXLA 1IQ5A 1KK7Y 4USLA 1LVCD 3QMEA 2QDIA 1K9PA 3V2LA 2LP3A 2MLEC 4GPLB 2H2KA 5CSFA 3OHMB 1OMRA 2Y5IA 4OVNF 1QATA 3NHIA 2AAOA 5DKQA 1V1FA 3PN7B 1TUJA 4I5KA 4I5LB 4YI9A 5G08A 5I2QA 1C7VA 3BFAA 2JULA 2L5XB 4C0LA 1UUSA 1FPWA 2MAZA 4ICBA 3SS3A 1UHJA 4INWA 1R6PA 3H4SE 1LA0A 3NGVA 1SMGA 4N1FA 4CFQA 4FTGA 1DJGA 4C0KA 2KAYA 3KEVA 3GOFA 5K89A 1BR1B 3S0DA 4YGCB 3SG6A 1WRLA 3ICBA 1UHHA 1XK4A 1IG5A 1CLLA 2ISDA 1MHOA 3DD4A 3KPXA 2JTZA 4MVFA 1AK8A 1J7PA 4ORAB 3S0BA 2K7BA 3PJIA 2L51A 2GGMA 1KSMA 1KWOC 2K7OA 5I8NA 3EVRA 1IKUA 1SL7A 1LINA 2BE4A 1TNWA 2CCMA 2WOSA 3S0EA 1DELA 1M39A 4ORBB 1UHNA 5D69A 3OB1B 1G33A 4BY4A 2F8PA 2JNFA 3D76A 3VRPA 1QV0A 1NX1A 2KGRA 1PULA 3JTDC 2YGUA 2KI6C 2F33A 4NDDA 4YGDB 1MWNA 1EG4A 1BMOA 1NX0A 2H61A 1TOPA 1K8UA 1A4PA 1OZOA 1XA5A 4P5OE 5HKWA 1JWDA 3R1VA 2CT9A 1TIZA 4I5NB 3L4AA 1EH2A 4E68A 5CSJA 2KBMA 1TNXA 3K1EA 3UNWA 1NPQA 2E6WA 1QASA 1CTRA 1PK0D 4HRHA 4PHNA 1DJHA 3O2PA 4ETOA 1XK4C 5KU1A 3NSOA 5CSNA 1BJFA 2MA2A 4F7FA 4MZJA 2QEHA 1XFWO 5JJGA 3N7HA 4IJ7A 2PALA 1SR6B 2HETA 3SJSA 1UHIA 1RROA 1SY9A 3I5HC 3CZTX 3AKAA 2NZ0A 2V53A 4MRYA 4PALA 2KNEA 1CM4A 1RECA 2DOQA 3EK8A 1JSAA 1A29A 2KFHA 1JBAA 1ZOTB 2BAPA 3IQOA 2ZN9A 1DC1A 3IF7A 2JU0A 1CMGA 3CS1A 4MZLA 2WCJA 2MRDA 4C0JA 3JVTB 3DF0B 5CSIA 3FE9A 1BF5A 5ER5A 1OZSA 2FJYA 1OE9B 2JQ6A 1F4QA 1F4OA 2F2OA 1B47A 1ALVA 2OTGB 3I5IB 1OQPA 2WC6A 3FWCA 1KQVA 3DVEA 3CZ0A 1YVHA 2JTTA 3L4LA 3EK7A 1DJYA 2JT8A 1QV1A 3PLFB 4MN0A 2A4JA 4PHMA 1U5IB 1CNPA 3HX4A 2LHLA 5I94A 1EJ3A 1AJ4A 1PVBA 4M2QA 2K7DA 3CDNA 4PHJA 3F45A 1PALA 4WQ2A 4AQJA 1SCMB 3B6XA 1BOCA 4N1GA 1L2OC 1DMOA
chains in the Genus database with same CATH topology
3KHEA 4OV2A 1K2HA 1NCZA 2KI6D 1E8AA 3DF0A 1H8BA 1Y0VH 1KQMB 1YUSA 2Q4UA 2OPOA 2JWWA 1XVJA 1SPYA 1X02A 2LVIA 3I5GB 2JXCA 1C7WA 2LC5A 4ORCB 2ZNDA 1NUBA 1SBJA 1Y1AA 2ZNEA 5B8IB 1YUUA 1YRTB 3RM1A 1DGUA 1MXEA 1TNQA 2M29A 3CWGA 3HCMA 2OS8C 3LL8B 3O6BA 1OMDA 1XYDA 2HPSA 4JPZB 2M8UA 3ZNIA 1QX2A 1F55A 2G9BA 4MSPA 1J1EA 3BXKA 5J3XA 1S3PA 2M9GA 1QS7A 1CDNA 1LXFC 4ZCVA 2WCBA 4GUKA 4QJ5B 2I2RE 5IBWA 2KI4B 4CLNA 4DRWA 3TS5C 1KK8B 2AUCA 3BUMB 1ZMZA 3I5FC 2BECA 3BQ3A 4UPGA 3JVTC 3EKHA 5HLVA 2LLUA 2M49B 1YX8A 2WC8A 3VRRA 2K61A 5HLOA 1HT9A 3KF9A 4YGEB 2M1KB 5TNCA 1QVIZ 1DGVA 2NXQA 5F6TA 1IJ6A 1BU3A 2PMYA 1TN4A 2LVVA 1K9UA 5DKNA 1FI6A 1N0YA 3LLEA 2MHHA 5ER4X 1R2UA 3MSEB 2CNPA 3CTNA 1JFJA 3KO0A 1B7TZ 1FF1A 1B8LA 1H4BA 1YUTA 1IQ3A 2KAVA 2L50A 1SCMC 4PE1A 1SYMA 1NP8A 1MXLC 2KDHA 1B9AA 1KFUL 1QLKA 3OB2B 1JF2A 2QPTA 5KSZA 3O4YA 1QX5B 3C1VA 1ZFSA 3CR2A 2M1UA 2EHBA 3I5GC 3LK0A 1KSOA 2EC6B 1QIWA 2K0JA 1W7IB 5AEQA 1A2XA 4WRIA 3GK2A 2ZRTA 1KFUS 1WY9A 2KFGA 2QACA 2FJUB 1CKKA 1LA3A 1MR8A 1NYAA 1ZUZA 1YTZC 2GV5A 1CLMA 3PALA 2JPTA 1IRJA 3SIBA 1B8CA 2M0RA 3BUNB 1AVSA 2KBIA 2TN4A 4YGAA 1YR5A 1G4YR 2LAPA 3BUWB 2L4IA 2WCFA 3SG2A 1QIVA 3GK1A 1CB1A 2PRUA 5AERA 1Y1UA 1MF8B 2Y1NA 1GQMA 1RJVA 3LCPC 1EXRA 2KI4C 4D1EA 4YRUA 1NCXA 2LLSA 4NQGA 4HRGA 3PN7C 2G2BA 1ZACA 4P2YB 3VROA 1J7RA 3DVMA 1DJWA 1WDCB 1CFCA 2H61C 1FI5A 2BBMA 3K21A 4PHKA 1V1GA 1XFYO 2BCBA 1NIWA 1IH0A 2R2IA 4I5JA 2ZRSA 2PVBA 2LHIA 1UP5A 1CDMA 2KQYA 3VRQA 1F71A 1IGVA 2K8MB 5JOLA 1Y6WA 4DUQA 1PSRA 4YBHB 3GK4X 1QXPA 1RK9A 2MBXA 3DVKA 2LLTA 2Y4QA 2JRFA 1A75B 5KTYA 3A8RA 2I94A 3IQQA 1BT6A 4GAOA 3TZ1A 4U8DA 1NX2A 3EK4A 3FS7A 1PRWA 2F2PA 4PE0A 1K95A 2CTNA 3OX5A 4JQ0D 4YI8A 4MZKA 1XO5A 2O5GA 3DVJA 3WXAA 1TNPA 1RFJA 2LUXA 3BYAA 3AKBA 4DS7A 1WLMA 5BPJA 2I7AA 2K2AA 4QJ4B 4OR9B 2LV7A 2O60A 2PASA 3E3RA 1DTLA 1Q80A 1YURA 2M7NA 1SKTA 2P6BB 3SG3A 3O78A 1CFFA 1DVIA 1DJIA 2JT0A 5AFPA 1M31A 1J55A 3NSIA 1SNLA 3OX6A 2BKIB 2E30A 1KWOB 1Y1XA 2FCDA 1A75A 1CFDA 1SR6C 2LM5A 1JF0A 1IWQA 2WORA 1YVLA 1B4CA 2LE9B 2LUCA 2M3WA 1FBVA 3TDIA 2BL0B 1KFXL 2KFFA 4DCKA 1EL4A 4A4BA 1K90D 1UURA 1TRFA 1UWOA 2F3YA 2HF5A 4CIDA 4HSZA 2BCXA 1FW4A 4PE7A 1GGZA 4GBAA 1G8IA 4PE4A 5CPVA 5HYDA 5I2OA 3D0YB 4MLWA 3LK1A 1S6CA 1F8HA 1KCYA 1DT7B 4CPVA 4CFRA 2OTGC 1NWDA 3I5IC 5DKRA 2L4HA 5AANA 1CLBA 1DJZA 3I5HB 4QJ3B 1YX7A 4IL1A 2BCAA 2JT3A 2JOJA 2IS9A 5HKZA 1UHKA 3PFVA 1NX3A 2KSPA 4N5XA 4MBEA 4OKHA 1AHRA 2LANA 3WHTB 1WRKA 1BR4B 2M97A 1PSBA 5FYXA 2COLB 4GFTA 1W7JB 2L98A 1KQMC 4F0ZB 2JC2A 2KAXA 1GJYA 3D0YA 1QTXA 2KOTA 3TDZA 2JNXA 3TDUA 1JC2A 1D1OA 3CR4X 4NDBA 1VRKA 1K94A 3A4UB 4AOMA 3CR5X 3BOWB 1XFVO 2LMTA 1QX7A 3BUOB 1CMFA 3OP0A 2FOTA 4HREE 1J1DA 1HQVA 2KYCA 2NLNA 4XJKB 4XYNA 4PCWA 3AAJA 1L7ZA 1BLQA 2LVJA 1GGWA 3AAKA 2HQ8A 3EVVA 1AP4A 1QVIY 2Y1MA 3FWBA 3QRXA 4ZCUA 1L2OB 2EGDA 1NSHA 3RLZA 2BL0C 4YGBB 4NDCA 1F70A 2L0PA 1KK8C 3NSLA 1SW8A 3CGAA 4L9MA 1SL8A 2D8NA 1B7TY 4OCIA 1N65A 1M63B 1OOJA 1TCFA 1XFUO 1M46A 4M2PA 2JZIA 1S36A 3BOWA 4M2OA 1QJTA 2CBLA 2LNKA 5D7FA 2LMVA 1F54A 1RTP1 3NSKA 4XJKA 2K2FA 1S1EA 2OS8B 1MUXA 2LMUA 1DF0B 3BUXB 3ZWHA 1QLSA 3NXAA 3TUYB 1NCYA 2LCPA 1S5GZ 3D10A 1K96A 2LP2A 2KHNA 4GGFA 2BKHB 1EG3A 1B8RA 2KGBC 2F3ZA 2LVKA 4BY5A 1BG1A 2NCOA 2ZN8A 2SASA 4FQOA 4Q04A 1OMVA 3TS5B 2NCPA 2MLFC 2ZFDA 4A4CA 3I5FB 1CDLA 1J7OA 1S26D 1N2DA 1J7QA 1C07A 1YRUB 2BBNA 1AUIB 1K93D 2M7LA 1IJ5A 2EC6C 1CM1A 2K7CA 1KK7Z 1XFXO 3SG5A 1SCVA 2BE6A 1ALWA 2I18A 2B1UA 2MJWB 3SG4A 1PVAA 2AMIA 4JWQA 2RGIA 2KYFA 1SK6D 1JFKA 3SIAA 3VGOA 2WCEA 1DF0A 4R1EA 3PSRA 1M45A 2KQ6A 4DIRA 4GNKB 1WLZA 1WRZA 3PATA 2PSRA 1BODA 4GGFC 4MEWA 3M0WA 1JUOA 2WNDA 4TNCA 1B1GA 1XFZO 1S5GY 3JTDB 2VRGA 4PDZA 1ODBA 5HKYA 4WQ3A 4MRXA 1TTXA 4GGNA 3CLNA 5AXIA 1OSAA 1RWYA 1S6JA 1AJ5A 1DJXA 1WDCC 1SRAA 3EVUA 3PM8A 1SL9A 5PALA 2Q91A 2ZKMX 5GQQC 1S6IA 1CFPA 3EKJA 2HQWA 2CXJA 1MQ1A 1TCOB 3WNXB 4AQIA 3WHUB 1KFXS 3SG7A 1U5IA 1LKJA 2GGZA 5I2LA 3VRNA 1A03A 2L2EA 1CDPA 2FCEA 1K9KA 2SCPA 3TUYC 3FIAA 2JXLA 1IQ5A 1KK7Y 4USLA 1LVCD 1K9PA 2LP3A 2MLEC 4GPLB 2H2KA 5CSFA 3OHMB 1OMRA 2Y5IA 4OVNF 1QATA 2AAOA 5DKQA 1V1FA 3PN7B 4I5KA 4I5LB 4YI9A 5G08A 5I2QA 1C7VA 2JULA 2L5XB 4C0LA 1UUSA 1FPWA 2MAZA 4ICBA 1UHJA 1R6PA 3H4SE 1LA0A 1SMGA 4N1FA 4CFQA 4FTGA 1DJGA 4C0KA 2KAYA 3KEVA 3GOFA 5K89A 1BR1B 4YGCB 3SG6A 1WRLA 3ICBA 1UHHA 1XK4A 1IG5A 1CLLA 2ISDA 1MHOA 3DD4A 3KPXA 2JTZA 4MVFA 1AK8A 1J7PA 4ORAB 2K7BA 2L51A 2GGMA 1KSMA 1KWOC 2K7OA 5I8NA 3EVRA 1IKUA 1SL7A 1LINA 2BE4A 1TNWA 2CCMA 2WOSA 1M39A 4ORBB 1UHNA 5D69A 3OB1B 1G33A 4BY4A 2F8PA 2JNFA 3VRPA 1QV0A 1NX1A 2KGRA 1PULA 3JTDC 2KI6C 2F33A 4NDDA 4YGDB 1MWNA 1EG4A 1BMOA 1NX0A 2H61A 1TOPA 1K8UA 1A4PA 1OZOA 1XA5A 4P5OE 5HKWA 1JWDA 2CT9A 1TIZA 4I5NB 1EH2A 4E68A 5CSJA 2KBMA 1TNXA 1NPQA 2E6WA 1QASA 1CTRA 1PK0D 4HRHA 4PHNA 1DJHA 3O2PA 4ETOA 1XK4C 5KU1A 3NSOA 5CSNA 1BJFA 2MA2A 4MZJA 1XFWO 5JJGA 2PALA 1SR6B 2HETA 3SJSA 1UHIA 1RROA 1SY9A 3I5HC 3CZTX 3AKAA 2NZ0A 2V53A 4MRYA 4PALA 2KNEA 1CM4A 1RECA 2DOQA 3EK8A 1JSAA 1A29A 2KFHA 1JBAA 1ZOTB 3IQOA 2ZN9A 3IF7A 2JU0A 1CMGA 3CS1A 4MZLA 2MRDA 4C0JA 3JVTB 3DF0B 5CSIA 1BF5A 5ER5A 1OZSA 1OE9B 2JQ6A 1F4QA 1F4OA 2F2OA 1B47A 1ALVA 2OTGB 3I5IB 1OQPA 3FWCA 1KQVA 3DVEA 1YVHA 2JTTA 3EK7A 1DJYA 2JT8A 1QV1A 3PLFB 4MN0A 2A4JA 4PHMA 1U5IB 1CNPA 3HX4A 2LHLA 1EJ3A 1AJ4A 1PVBA 4M2QA 2K7DA 4PHJA 4WQ2A 3F45A 1PALA 4AQJA 1SCMB 1BOCA 4N1GA 1L2OC 1DMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHE A;  4OV2 A;  1K2H A;  1NCZ A;  2KI6 D;  1E8A A;  3DF0 A;  1H8B A;  1Y0V H;  1KQM B;  1YUS A;  2Q4U A;  2OPO A;  2JWW A;  1XVJ A;  1SPY A;  1X02 A;  2LVI A;  3I5G B;  2JXC A;  1C7W A;  2LC5 A;  4ORC B;  2ZND A;  1NUB A;  1SBJ A;  1Y1A A;  2ZNE A;  5B8I B;  1YUU A;  1YRT B;  3RM1 A;  1DGU A;  1MXE A;  1TNQ A;  2M29 A;  3CWG A;  3HCM A;  2OS8 C;  3LL8 B;  3O6B A;  1OMD A;  1XYD A;  2HPS A;  4JPZ B;  2M8U A;  3ZNI A;  1QX2 A;  1F55 A;  2G9B A;  4MSP A;  1J1E A;  3BXK A;  5J3X A;  1S3P A;  2M9G A;  1QS7 A;  1CDN A;  1LXF C;  4ZCV A;  2WCB A;  4GUK A;  4QJ5 B;  2I2R E;  5IBW A;  2KI4 B;  4CLN A;  4DRW A;  3TS5 C;  1KK8 B;  2AUC A;  3BUM B;  1ZMZ A;  3I5F C;  2BEC A;  3BQ3 A;  4UPG A;  3JVT C;  3EKH A;  5HLV A;  2LLU A;  2M49 B;  1YX8 A;  2WC8 A;  3VRR A;  2K61 A;  5HLO A;  1HT9 A;  3KF9 A;  4YGE B;  2M1K B;  5TNC A;  1QVI Z;  1DGV A;  2NXQ A;  5F6T A;  1IJ6 A;  1BU3 A;  2PMY A;  1TN4 A;  2LVV A;  1K9U A;  5DKN A;  1FI6 A;  1N0Y A;  3LLE A;  2MHH A;  5ER4 X;  1R2U A;  3MSE B;  2CNP A;  3CTN A;  1JFJ A;  3KO0 A;  1B7T Z;  1FF1 A;  1B8L A;  1H4B A;  1YUT A;  1IQ3 A;  2KAV A;  2L50 A;  1SCM C;  4PE1 A;  1SYM A;  1NP8 A;  1MXL C;  2KDH A;  1B9A A;  1KFU L;  1QLK A;  3OB2 B;  1JF2 A;  2QPT A;  5KSZ A;  3O4Y A;  1QX5 B;  3C1V A;  1ZFS A;  3CR2 A;  2M1U A;  2EHB A;  3I5G C;  3LK0 A;  1KSO A;  2EC6 B;  1QIW A;  2K0J A;  1W7I B;  5AEQ A;  1A2X A;  4WRI A;  3GK2 A;  2ZRT A;  1KFU S;  1WY9 A;  2KFG A;  2QAC A;  2FJU B;  1CKK A;  1LA3 A;  1MR8 A;  1NYA A;  1ZUZ A;  1YTZ C;  2GV5 A;  1CLM A;  3PAL A;  2JPT A;  1IRJ A;  3SIB A;  1B8C A;  2M0R A;  3BUN B;  1AVS A;  2KBI A;  2TN4 A;  4YGA A;  1YR5 A;  1G4Y R;  2LAP A;  3BUW B;  2L4I A;  2WCF A;  3SG2 A;  1QIV A;  3GK1 A;  1CB1 A;  2PRU A;  5AER A;  1Y1U A;  1MF8 B;  2Y1N A;  1GQM A;  1RJV A;  3LCP C;  1EXR A;  2KI4 C;  4D1E A;  4YRU A;  1NCX A;  2LLS A;  4NQG A;  4HRG A;  3PN7 C;  2G2B A;  1ZAC A;  4P2Y B;  3VRO A;  1J7R A;  3DVM A;  1DJW A;  1WDC B;  1CFC A;  2H61 C;  1FI5 A;  2BBM A;  3K21 A;  4PHK A;  1V1G A;  1XFY O;  2BCB A;  1NIW A;  1IH0 A;  2R2I A;  4I5J A;  2ZRS A;  2PVB A;  2LHI A;  1UP5 A;  1CDM A;  2KQY A;  3VRQ A;  1F71 A;  1IGV A;  2K8M B;  5JOL A;  1Y6W A;  4DUQ A;  1PSR A;  4YBH B;  3GK4 X;  1QXP A;  1RK9 A;  2MBX A;  3DVK A;  2LLT A;  2Y4Q A;  2JRF A;  1A75 B;  5KTY A;  3A8R A;  2I94 A;  3IQQ A;  1BT6 A;  4GAO A;  3TZ1 A;  4U8D A;  1NX2 A;  3EK4 A;  3FS7 A;  1PRW A;  2F2P A;  4PE0 A;  1K95 A;  2CTN A;  3OX5 A;  4JQ0 D;  4YI8 A;  4MZK A;  1XO5 A;  2O5G A;  3DVJ A;  3WXA A;  1TNP A;  1RFJ A;  2LUX A;  3BYA A;  3AKB A;  4DS7 A;  1WLM A;  5BPJ A;  2I7A A;  2K2A A;  4QJ4 B;  4OR9 B;  2LV7 A;  2O60 A;  2PAS A;  3E3R A;  1DTL A;  1Q80 A;  1YUR A;  2M7N A;  1SKT A;  2P6B B;  3SG3 A;  3O78 A;  1CFF A;  1DVI A;  1DJI A;  2JT0 A;  5AFP A;  1M31 A;  1J55 A;  3NSI A;  1SNL A;  3OX6 A;  2BKI B;  2E30 A;  1KWO B;  1Y1X A;  2FCD A;  1A75 A;  1CFD A;  1SR6 C;  2LM5 A;  1JF0 A;  1IWQ A;  2WOR A;  1YVL A;  1B4C A;  2LE9 B;  2LUC A;  2M3W A;  1FBV A;  3TDI A;  2BL0 B;  1KFX L;  2KFF A;  4DCK A;  1EL4 A;  4A4B A;  1K90 D;  1UUR A;  1TRF A;  1UWO A;  2F3Y A;  2HF5 A;  4CID A;  4HSZ A;  2BCX A;  1FW4 A;  4PE7 A;  1GGZ A;  4GBA A;  1G8I A;  4PE4 A;  5CPV A;  5HYD A;  5I2O A;  3D0Y B;  4MLW A;  3LK1 A;  1S6C A;  1F8H A;  1KCY A;  1DT7 B;  4CPV A;  4CFR A;  2OTG C;  1NWD A;  3I5I C;  5DKR A;  2L4H A;  5AAN A;  1CLB A;  1DJZ A;  3I5H B;  4QJ3 B;  1YX7 A;  4IL1 A;  2BCA A;  2JT3 A;  2JOJ A;  2IS9 A;  5HKZ A;  1UHK A;  3PFV A;  1NX3 A;  2KSP A;  4N5X A;  4MBE A;  4OKH A;  1AHR A;  2LAN A;  3WHT B;  1WRK A;  1BR4 B;  2M97 A;  1PSB A;  5FYX A;  2COL B;  4GFT A;  1W7J B;  2L98 A;  1KQM C;  4F0Z B;  2JC2 A;  2KAX A;  1GJY A;  3D0Y A;  1QTX A;  2KOT A;  3TDZ A;  2JNX A;  3TDU A;  1JC2 A;  1D1O A;  3CR4 X;  4NDB A;  1VRK A;  1K94 A;  3A4U B;  4AOM A;  3CR5 X;  3BOW B;  1XFV O;  2LMT A;  1QX7 A;  3BUO B;  1CMF A;  3OP0 A;  2FOT A;  4HRE E;  1J1D A;  1HQV A;  2KYC A;  2NLN A;  4XJK B;  4XYN A;  4PCW A;  3AAJ A;  1L7Z A;  1BLQ A;  2LVJ A;  1GGW A;  3AAK A;  2HQ8 A;  3EVV A;  1AP4 A;  1QVI Y;  2Y1M A;  3FWB A;  3QRX A;  4ZCU A;  1L2O B;  2EGD A;  1NSH A;  3RLZ A;  2BL0 C;  4YGB B;  4NDC A;  1F70 A;  2L0P A;  1KK8 C;  3NSL A;  1SW8 A;  3CGA A;  4L9M A;  1SL8 A;  2D8N A;  1B7T Y;  4OCI A;  1N65 A;  1M63 B;  1OOJ A;  1TCF A;  1XFU O;  1M46 A;  4M2P A;  2JZI A;  1S36 A;  3BOW A;  4M2O A;  1QJT A;  2CBL A;  2LNK A;  5D7F A;  2LMV A;  1F54 A;  1RTP 1;  3NSK A;  4XJK A;  2K2F A;  1S1E A;  2OS8 B;  1MUX A;  2LMU A;  1DF0 B;  3BUX B;  3ZWH A;  1QLS A;  3NXA A;  3TUY B;  1NCY A;  2LCP A;  1S5G Z;  3D10 A;  1K96 A;  2LP2 A;  2KHN A;  4GGF A;  2BKH B;  1EG3 A;  1B8R A;  2KGB C;  2F3Z A;  2LVK A;  4BY5 A;  1BG1 A;  2NCO A;  2ZN8 A;  2SAS A;  4FQO A;  4Q04 A;  1OMV A;  3TS5 B;  2NCP A;  2MLF C;  2ZFD A;  4A4C A;  3I5F B;  1CDL A;  1J7O A;  1S26 D;  1N2D A;  1J7Q A;  1C07 A;  1YRU B;  2BBN A;  1AUI B;  1K93 D;  2M7L A;  1IJ5 A;  2EC6 C;  1CM1 A;  2K7C A;  1KK7 Z;  1XFX O;  3SG5 A;  1SCV A;  2BE6 A;  1ALW A;  2I18 A;  2B1U A;  2MJW B;  3SG4 A;  1PVA A;  2AMI A;  4JWQ A;  2RGI A;  2KYF A;  1SK6 D;  1JFK A;  3SIA A;  3VGO A;  2WCE A;  1DF0 A;  4R1E A;  3PSR A;  1M45 A;  2KQ6 A;  4DIR A;  4GNK B;  1WLZ A;  1WRZ A;  3PAT A;  2PSR A;  1BOD A;  4GGF C;  4MEW A;  3M0W A;  1JUO A;  2WND A;  4TNC A;  1B1G A;  1XFZ O;  1S5G Y;  3JTD B;  2VRG A;  4PDZ A;  1ODB A;  5HKY A;  4WQ3 A;  4MRX A;  1TTX A;  4GGN A;  3CLN A;  5AXI A;  1OSA A;  1RWY A;  1S6J A;  1AJ5 A;  1DJX A;  1WDC C;  1SRA A;  3EVU A;  3PM8 A;  1SL9 A;  5PAL A;  2Q91 A;  2ZKM X;  5GQQ C;  1S6I A;  1CFP A;  3EKJ A;  2HQW A;  2CXJ A;  1MQ1 A;  1TCO B;  3WNX B;  4AQI A;  3WHU B;  1KFX S;  3SG7 A;  1U5I A;  1LKJ A;  2GGZ A;  5I2L A;  3VRN A;  1A03 A;  2L2E A;  1CDP A;  2FCE A;  1K9K A;  2SCP A;  3TUY C;  3FIA A;  2JXL A;  1IQ5 A;  1KK7 Y;  4USL A;  1LVC D;  1K9P A;  2LP3 A;  2MLE C;  4GPL B;  2H2K A;  5CSF A;  3OHM B;  1OMR A;  2Y5I A;  4OVN F;  1QAT A;  2AAO A;  5DKQ A;  1V1F A;  3PN7 B;  4I5K A;  4I5L B;  4YI9 A;  5G08 A;  5I2Q A;  1C7V A;  2JUL A;  2L5X B;  4C0L A;  1UUS A;  1FPW A;  2MAZ A;  4ICB A;  1UHJ A;  1R6P A;  3H4S E;  1LA0 A;  1SMG A;  4N1F A;  4CFQ A;  4FTG A;  1DJG A;  4C0K A;  2KAY A;  3KEV A;  3GOF A;  5K89 A;  1BR1 B;  4YGC B;  3SG6 A;  1WRL A;  3ICB A;  1UHH A;  1XK4 A;  1IG5 A;  1CLL A;  2ISD A;  1MHO A;  3DD4 A;  3KPX A;  2JTZ A;  4MVF A;  1AK8 A;  1J7P A;  4ORA B;  2K7B A;  2L51 A;  2GGM A;  1KSM A;  1KWO C;  2K7O A;  5I8N A;  3EVR A;  1IKU A;  1SL7 A;  1LIN A;  2BE4 A;  1TNW A;  2CCM A;  2WOS A;  1M39 A;  4ORB B;  1UHN A;  5D69 A;  3OB1 B;  1G33 A;  4BY4 A;  2F8P A;  2JNF A;  3VRP A;  1QV0 A;  1NX1 A;  2KGR A;  1PUL A;  3JTD C;  2KI6 C;  2F33 A;  4NDD A;  4YGD B;  1MWN A;  1EG4 A;  1BMO A;  1NX0 A;  2H61 A;  1TOP A;  1K8U A;  1A4P A;  1OZO A;  1XA5 A;  4P5O E;  5HKW A;  1JWD A;  2CT9 A;  1TIZ A;  4I5N B;  1EH2 A;  4E68 A;  5CSJ A;  2KBM A;  1TNX A;  1NPQ A;  2E6W A;  1QAS A;  1CTR A;  1PK0 D;  4HRH A;  4PHN A;  1DJH A;  3O2P A;  4ETO A;  1XK4 C;  5KU1 A;  3NSO A;  5CSN A;  1BJF A;  2MA2 A;  4MZJ A;  1XFW O;  5JJG A;  2PAL A;  1SR6 B;  2HET A;  3SJS A;  1UHI A;  1RRO A;  1SY9 A;  3I5H C;  3CZT X;  3AKA A;  2NZ0 A;  2V53 A;  4MRY A;  4PAL A;  2KNE A;  1CM4 A;  1REC A;  2DOQ A;  3EK8 A;  1JSA A;  1A29 A;  2KFH A;  1JBA A;  1ZOT B;  3IQO A;  2ZN9 A;  3IF7 A;  2JU0 A;  1CMG A;  3CS1 A;  4MZL A;  2MRD A;  4C0J A;  3JVT B;  3DF0 B;  5CSI A;  1BF5 A;  5ER5 A;  1OZS A;  1OE9 B;  2JQ6 A;  1F4Q A;  1F4O A;  2F2O A;  1B47 A;  1ALV A;  2OTG B;  3I5I B;  1OQP A;  3FWC A;  1KQV A;  3DVE A;  1YVH A;  2JTT A;  3EK7 A;  1DJY A;  2JT8 A;  1QV1 A;  3PLF B;  4MN0 A;  2A4J A;  4PHM A;  1U5I B;  1CNP A;  3HX4 A;  2LHL A;  1EJ3 A;  1AJ4 A;  1PVB A;  4M2Q A;  2K7D A;  4PHJ A;  4WQ2 A;  3F45 A;  1PAL A;  4AQJ A;  1SCM B;  1BOC A;  4N1G A;  1L2O C;  1DMO A; 
#chains in the Genus database with same CATH topology
 3KHE A;  4OV2 A;  1K2H A;  1NCZ A;  2KI6 D;  1E8A A;  3DF0 A;  1H8B A;  1Y0V H;  1KQM B;  1YUS A;  2Q4U A;  2BNX A;  2OPO A;  3D73 A;  2JWW A;  1XVJ A;  1SPY A;  1X02 A;  2LVI A;  3I5G B;  3S0G A;  3DZT A;  2JXC A;  1C7W A;  2LC5 A;  4ORC B;  3BFH A;  2ZND A;  3B87 A;  1Y1A A;  1NUB A;  1SBJ A;  2ZNE A;  5B8I B;  1DQE A;  1YUU A;  1YRT B;  3RM1 A;  1DGU A;  1OOI X;  1MXE A;  1TNQ A;  2M29 A;  3CWG A;  3HCM A;  2OS8 C;  3LL8 B;  2L5Y A;  3O6B A;  1OMD A;  1XYD A;  2HPS A;  4JPZ B;  2M8U A;  3ZNI A;  1QX2 A;  1F55 A;  2G9B A;  3L47 A;  4MSP A;  1J1E A;  3BXK A;  5J3X A;  1S3P A;  2M9G A;  1QS7 A;  1CDN A;  1LXF C;  4ZCV A;  2WCB A;  4GUK A;  4QJ5 B;  2I2R E;  5IBW A;  3D77 A;  2KI4 B;  5DIC A;  4CLN A;  4DRW A;  3TS5 C;  1KK8 B;  2AUC A;  3BUM B;  1ZMZ A;  3I5F C;  2BEC A;  3BQ3 A;  4UPG A;  3JVT C;  3EKH A;  1ORG A;  5HLV A;  2LLU A;  2M49 B;  4PT1 A;  1OW4 A;  1YX8 A;  2WC8 A;  3VRR A;  2K61 A;  3DY9 A;  3R1O A;  5HLO A;  1HT9 A;  3KF9 A;  4YGE B;  2M1K B;  5TNC A;  1QVI Z;  1DGV A;  2NXQ A;  5F6T A;  3SS5 A;  1IJ6 A;  1BU3 A;  2PMY A;  1TN4 A;  2LVV A;  1K9U A;  5DKN A;  1W9Z A;  1FI6 A;  1N0Y A;  3LLE A;  2MHH A;  5ER4 X;  1R2U A;  3MSE B;  2CNP A;  3CTN A;  1JFJ A;  3KO0 A;  1B7T Z;  1FF1 A;  1B8L A;  1H4B A;  1YUT A;  1IQ3 A;  2KAV A;  2L50 A;  1SCM C;  4PE1 A;  1SYM A;  2WC5 A;  1NP8 A;  1MXL C;  2KDH A;  1B9A A;  1KFU L;  1QLK A;  3OB2 B;  1JF2 A;  2QPT A;  5KSZ A;  3O4Y A;  1QX5 B;  3C1V A;  1ZFS A;  3CR2 A;  2M1U A;  2EHB A;  3I5G C;  3LK0 A;  1KSO A;  2EC6 B;  1QIW A;  2K0J A;  1W7I B;  5AEQ A;  1A2X A;  4WRI A;  3GK2 A;  2ZRT A;  1KFU S;  1WY9 A;  2KFG A;  2QAC A;  2FJU B;  1XFR A;  3CYZ A;  3O4X A;  1CKK A;  1LA3 A;  1MR8 A;  1NYA A;  1ZUZ A;  1YTZ C;  2GV5 A;  1CLM A;  3PAL A;  2JPT A;  1IRJ A;  3SIB A;  1B8C A;  2M0R A;  2K60 A;  1AVS A;  2KBI A;  2TN4 A;  3BUN B;  4YGA A;  3CZ2 A;  1YR5 A;  1G4Y R;  2LAP A;  3BUW B;  2L4I A;  2WCF A;  3SG2 A;  1QIV A;  3BFB A;  3GK1 A;  1CB1 A;  2PRU A;  5AER A;  3D75 A;  1Y1U A;  1MF8 B;  2Y1N A;  1GQM A;  3S0F A;  1RJV A;  3LCP C;  1EXR A;  2KI4 C;  1Z2C B;  4D1E A;  4YRU A;  1NCX A;  2LLS A;  4NQG A;  4HRG A;  3PN7 C;  2G2B A;  1ZAC A;  4P2Y B;  3DYE A;  3SS4 A;  3VRO A;  1J7R A;  3DVM A;  1DJW A;  1WDC B;  3S0A A;  1CFC A;  2H61 C;  2JPO A;  1FI5 A;  2BBM A;  3K21 A;  4PHK A;  1V1G A;  1XFY O;  2BCB A;  3CZ1 A;  4OZD A;  1NIW A;  1IH0 A;  2QEO A;  2R2I A;  3NHT A;  4JKT A;  4I5J A;  2ZRS A;  2PVB A;  2LHI A;  1UP5 A;  1CDM A;  2KQY A;  3VRQ A;  3B88 A;  1IGV A;  1F71 A;  2K8M B;  5JOL A;  1Y6W A;  4DUQ A;  2PQL A;  1PSR A;  4YBH B;  3GK4 X;  1QXP A;  1RK9 A;  2MBX A;  3DVK A;  2LLT A;  2Y4Q A;  2JRF A;  1A75 B;  5KTY A;  3RZS A;  3A8R A;  2I94 A;  2PYQ A;  1BT6 A;  3IQQ A;  4GAO A;  4U8D A;  4KYN A;  3TZ1 A;  1NX2 A;  3EK4 A;  3FS7 A;  1PRW A;  2F2P A;  4PE0 A;  1K95 A;  2CTN A;  3OX5 A;  4JQ0 D;  4YI8 A;  1IIO A;  2WCM A;  3Q8I A;  1XO5 A;  2O5G A;  4MZK A;  3DVJ A;  1Z4H A;  3WXA A;  1TNP A;  1RFJ A;  2LUX A;  3BYA A;  3AKB A;  4DS7 A;  1WLM A;  2GTE A;  5BPJ A;  2I7A A;  2K2A A;  4QJ4 B;  2WCL A;  4OR9 B;  2LV7 A;  2O60 A;  2PAS A;  3E3R A;  3IVT A;  1DTL A;  1Q80 A;  1YUR A;  2M7N A;  1SKT A;  2P6B B;  3SG3 A;  3O78 A;  1CFF A;  1DVI A;  1DJI A;  2JT0 A;  5AFP A;  1M31 A;  1J55 A;  3NSI A;  1SNL A;  3OX6 A;  2BKI B;  2E30 A;  1QWV A;  2H8V A;  1KWO B;  5HL1 A;  1Y1X A;  2FCD A;  1A75 A;  1CFD A;  3R1P A;  1SR6 C;  2LM5 A;  1JF0 A;  2KLD A;  1IWQ A;  2WOR A;  1YVL A;  1B4C A;  2LE9 B;  5EL2 A;  2LUC A;  3OGN A;  2M3W A;  2KLE A;  1FBV A;  3TDI A;  4JD9 A;  2BL0 B;  1KFX L;  2KFF A;  4FQT A;  4DCK A;  1EL4 A;  4A4B A;  1K90 D;  1UUR A;  1TRF A;  1UWO A;  2F3Y A;  2HF5 A;  4CID A;  5FI2 A;  4HSZ A;  1FW4 A;  2BCX A;  2KPH A;  3D74 A;  4PE7 A;  1GGZ A;  4GBA A;  1G8I A;  4PE4 A;  5CPV A;  5HYD A;  2WCH A;  5I2O A;  3D0Y B;  4MLW A;  3LK1 A;  1S6C A;  1F8H A;  1KCY A;  1DT7 B;  5FI6 A;  2QEV A;  4CPV A;  4CFR A;  2OTG C;  1NWD A;  3I5I C;  2ERB A;  2L4H A;  5DKR A;  5AAN A;  3CAB A;  3PM2 A;  3BJH A;  1CLB A;  1DJZ A;  3I5H B;  4QJ3 B;  1YX7 A;  4IL1 A;  2BCA A;  2JT3 A;  2JOJ A;  2IS9 A;  1P28 A;  5HKZ A;  1UHK A;  3PFV A;  1NX3 A;  2KSP A;  4N5X A;  1OOG A;  4MBE A;  4OKH A;  1AHR A;  2LAN A;  3WHT B;  1WRK A;  1BR4 B;  2M97 A;  3VB1 A;  1PSB A;  5FYX A;  2COL B;  2QEB A;  4GFT A;  1W7J B;  2L98 A;  1KQM C;  4F0Z B;  3B7A A;  2JC2 A;  2WCK A;  2KAX A;  1GJY A;  3D0Y A;  1QTX A;  2KOT A;  1TWO A;  2JNX A;  3TDU A;  3TDZ A;  1JC2 A;  1D1O A;  3CR4 X;  4NDB A;  1VRK A;  1K94 A;  3A4U B;  4AOM A;  3CR5 X;  3BOW B;  1XFV O;  2LMT A;  1QX7 A;  3BUO B;  1CMF A;  3OP0 A;  2FOT A;  4HRE E;  1J1D A;  1HQV A;  2KYC A;  2NLN A;  4XJK B;  4XYN A;  4PCW A;  2P70 A;  3AAJ A;  1L7Z A;  1BLQ A;  2LVJ A;  1GGW A;  3AAK A;  2HQ8 A;  3EVV A;  1AP4 A;  1QVI Y;  2Y1M A;  3FWB A;  3QRX A;  4ZCU A;  1L2O B;  1OOH A;  1NSH A;  2EGD A;  2BL0 C;  3RLZ A;  4YGB B;  4NDC A;  1F70 A;  2L0P A;  3FE6 A;  1KK8 C;  3NSL A;  1SW8 A;  2P71 A;  3CGA A;  3D78 A;  1SL8 A;  2D8N A;  1T14 A;  1B7T Y;  4INX A;  4L9M A;  1N65 A;  4OCI A;  1M63 B;  1SSE B;  1OOJ A;  1TCF A;  1XFU O;  1M46 A;  4M2P A;  2JZI A;  1S36 A;  3BOW A;  4M2O A;  3R72 A;  1QJT A;  2CBL A;  2LNK A;  5D7F A;  2LMV A;  1F54 A;  1RTP 1;  3NSK A;  4XJK A;  2K2F A;  1S1E A;  2OS8 B;  1MUX A;  2LMU A;  1DF0 B;  5FI7 A;  3BUX B;  3FE8 A;  3ZWH A;  3OBV A;  1QLS A;  3NXA A;  3TUY B;  1NCY A;  2LCP A;  1S5G Z;  3D10 A;  2L2C A;  1K96 A;  2LP2 A;  2KHN A;  4GGF A;  2BKH B;  1EG3 A;  1B8R A;  2KGB C;  2F3Z A;  2LVK A;  4BY5 A;  1BG1 A;  2NCO A;  2ZN8 A;  2SAS A;  4FQO A;  4Q04 A;  1OMV A;  3TS5 B;  2NCP A;  2MLF C;  2ZFD A;  4A4C A;  3I5F B;  1CDL A;  1C3Z A;  1J7O A;  3B86 A;  1S26 D;  1N2D A;  1J7Q A;  1C07 A;  1YRU B;  2BBN A;  1AUI B;  1K93 D;  2M7L A;  1IJ5 A;  2EC6 C;  1CM1 A;  2K7C A;  1KK7 Z;  1XFX O;  3SG5 A;  1SCV A;  1ALW A;  2BE6 A;  2I18 A;  2B1U A;  2MJW B;  3SG4 A;  1PVA A;  2AMI A;  4JWQ A;  2RGI A;  1TUZ A;  2KYF A;  1SK6 D;  1JFK A;  3SIA A;  3VGO A;  2WCE A;  1DF0 A;  4R1E A;  3PSR A;  1M45 A;  2KQ6 A;  3UO9 A;  5D3O A;  3DXL A;  4DIR A;  4GNK B;  1WLZ A;  1WRZ A;  3PAT A;  2PSR A;  1BOD A;  4GGF C;  3EG5 B;  4MEW A;  3M0W A;  1GM0 A;  1JUO A;  2WND A;  4TNC A;  1B1G A;  1LS8 A;  1OOF A;  1XFZ O;  1S5G Y;  3JTD B;  2VRG A;  4PDZ A;  1ODB A;  5HKY A;  4WQ3 A;  4MRX A;  1TTX A;  4GGN A;  3CLN A;  5AXI A;  1OSA A;  1RWY A;  1S6J A;  1AJ5 A;  1DJX A;  1WDC C;  1SRA A;  3EVU A;  3PM8 A;  1SL9 A;  5PAL A;  2Q91 A;  2ZKM X;  5GQQ C;  1S6I A;  1C3Y A;  1CFP A;  3EKJ A;  2HQW A;  1DEK A;  2CXJ A;  1MQ1 A;  1TCO B;  3WNX B;  4AQI A;  3WHU B;  1KFX S;  3SG7 A;  1U5I A;  1LKJ A;  2GGZ A;  5I2L A;  3VRN A;  1A03 A;  2L2E A;  1CDP A;  2FCE A;  1K9K A;  2SCP A;  3TUY C;  3FIA A;  2JXL A;  1IQ5 A;  1KK7 Y;  4USL A;  1LVC D;  3QME A;  2QDI A;  1K9P A;  3V2L A;  2LP3 A;  2MLE C;  4GPL B;  2H2K A;  5CSF A;  3OHM B;  1OMR A;  2Y5I A;  4OVN F;  1QAT A;  3NHI A;  2AAO A;  5DKQ A;  1V1F A;  3PN7 B;  1TUJ A;  4I5K A;  4I5L B;  4YI9 A;  5G08 A;  5I2Q A;  1C7V A;  3BFA A;  2JUL A;  2L5X B;  4C0L A;  1UUS A;  1FPW A;  2MAZ A;  4ICB A;  3SS3 A;  1UHJ A;  4INW A;  1R6P A;  3H4S E;  1LA0 A;  3NGV A;  1SMG A;  4N1F A;  4CFQ A;  4FTG A;  1DJG A;  4C0K A;  2KAY A;  3KEV A;  3GOF A;  5K89 A;  1BR1 B;  3S0D A;  4YGC B;  3SG6 A;  1WRL A;  3ICB A;  1UHH A;  1XK4 A;  1IG5 A;  1CLL A;  2ISD A;  1MHO A;  3DD4 A;  3KPX A;  2JTZ A;  4MVF A;  1AK8 A;  1J7P A;  4ORA B;  3S0B A;  2K7B A;  3PJI A;  2L51 A;  2GGM A;  1KSM A;  1KWO C;  2K7O A;  5I8N A;  3EVR A;  1IKU A;  1SL7 A;  1LIN A;  2BE4 A;  1TNW A;  2CCM A;  2WOS A;  3S0E A;  1DEL A;  1M39 A;  4ORB B;  1UHN A;  5D69 A;  3OB1 B;  1G33 A;  4BY4 A;  2F8P A;  2JNF A;  3D76 A;  3VRP A;  1QV0 A;  1NX1 A;  2KGR A;  1PUL A;  3JTD C;  2YGU A;  2KI6 C;  2F33 A;  4NDD A;  4YGD B;  1MWN A;  1EG4 A;  1BMO A;  1NX0 A;  2H61 A;  1TOP A;  1K8U A;  1A4P A;  1OZO A;  1XA5 A;  4P5O E;  5HKW A;  1JWD A;  3R1V A;  2CT9 A;  1TIZ A;  4I5N B;  3L4A A;  1EH2 A;  4E68 A;  5CSJ A;  2KBM A;  1TNX A;  3K1E A;  3UNW A;  1NPQ A;  2E6W A;  1QAS A;  1CTR A;  1PK0 D;  4HRH A;  4PHN A;  1DJH A;  3O2P A;  4ETO A;  1XK4 C;  5KU1 A;  3NSO A;  5CSN A;  1BJF A;  2MA2 A;  4F7F A;  4MZJ A;  2QEH A;  1XFW O;  5JJG A;  3N7H A;  4IJ7 A;  2PAL A;  1SR6 B;  2HET A;  3SJS A;  1UHI A;  1RRO A;  1SY9 A;  3I5H C;  3CZT X;  3AKA A;  2NZ0 A;  2V53 A;  4MRY A;  4PAL A;  2KNE A;  1CM4 A;  1REC A;  2DOQ A;  3EK8 A;  1JSA A;  1A29 A;  2KFH A;  1JBA A;  1ZOT B;  2BAP A;  3IQO A;  2ZN9 A;  1DC1 A;  3IF7 A;  2JU0 A;  1CMG A;  3CS1 A;  4MZL A;  2WCJ A;  2MRD A;  4C0J A;  3JVT B;  3DF0 B;  5CSI A;  3FE9 A;  1BF5 A;  5ER5 A;  1OZS A;  2FJY A;  1OE9 B;  2JQ6 A;  1F4Q A;  1F4O A;  2F2O A;  1B47 A;  1ALV A;  2OTG B;  3I5I B;  1OQP A;  2WC6 A;  3FWC A;  1KQV A;  3DVE A;  3CZ0 A;  1YVH A;  2JTT A;  3L4L A;  3EK7 A;  1DJY A;  2JT8 A;  1QV1 A;  3PLF B;  4MN0 A;  2A4J A;  4PHM A;  1U5I B;  1CNP A;  3HX4 A;  2LHL A;  5I94 A;  1EJ3 A;  1AJ4 A;  1PVB A;  4M2Q A;  2K7D A;  3CDN A;  4PHJ A;  3F45 A;  1PAL A;  4WQ2 A;  4AQJ A;  1SCM B;  3B6X A;  1BOC A;  4N1G A;  1L2O C;  1DMO A; 
#chains in the Genus database with same CATH homology
 3KHE A;  4OV2 A;  1K2H A;  1NCZ A;  2KI6 D;  1E8A A;  3DF0 A;  1H8B A;  1Y0V H;  1KQM B;  1YUS A;  2Q4U A;  2OPO A;  2JWW A;  1XVJ A;  1SPY A;  1X02 A;  2LVI A;  3I5G B;  2JXC A;  1C7W A;  2LC5 A;  4ORC B;  2ZND A;  1NUB A;  1SBJ A;  1Y1A A;  2ZNE A;  5B8I B;  1YUU A;  1YRT B;  3RM1 A;  1DGU A;  1MXE A;  1TNQ A;  2M29 A;  3CWG A;  3HCM A;  2OS8 C;  3LL8 B;  3O6B A;  1OMD A;  1XYD A;  2HPS A;  4JPZ B;  2M8U A;  3ZNI A;  1QX2 A;  1F55 A;  2G9B A;  4MSP A;  1J1E A;  3BXK A;  5J3X A;  1S3P A;  2M9G A;  1QS7 A;  1CDN A;  1LXF C;  4ZCV A;  2WCB A;  4GUK A;  4QJ5 B;  2I2R E;  5IBW A;  2KI4 B;  4CLN A;  4DRW A;  3TS5 C;  1KK8 B;  2AUC A;  3BUM B;  1ZMZ A;  3I5F C;  2BEC A;  3BQ3 A;  4UPG A;  3JVT C;  3EKH A;  5HLV A;  2LLU A;  2M49 B;  1YX8 A;  2WC8 A;  3VRR A;  2K61 A;  5HLO A;  1HT9 A;  3KF9 A;  4YGE B;  2M1K B;  5TNC A;  1QVI Z;  1DGV A;  2NXQ A;  5F6T A;  1IJ6 A;  1BU3 A;  2PMY A;  1TN4 A;  2LVV A;  1K9U A;  5DKN A;  1FI6 A;  1N0Y A;  3LLE A;  2MHH A;  5ER4 X;  1R2U A;  3MSE B;  2CNP A;  3CTN A;  1JFJ A;  3KO0 A;  1B7T Z;  1FF1 A;  1B8L A;  1H4B A;  1YUT A;  1IQ3 A;  2KAV A;  2L50 A;  1SCM C;  4PE1 A;  1SYM A;  1NP8 A;  1MXL C;  2KDH A;  1B9A A;  1KFU L;  1QLK A;  3OB2 B;  1JF2 A;  2QPT A;  5KSZ A;  3O4Y A;  1QX5 B;  3C1V A;  1ZFS A;  3CR2 A;  2M1U A;  2EHB A;  3I5G C;  3LK0 A;  1KSO A;  2EC6 B;  1QIW A;  2K0J A;  1W7I B;  5AEQ A;  1A2X A;  4WRI A;  3GK2 A;  2ZRT A;  1KFU S;  1WY9 A;  2KFG A;  2QAC A;  2FJU B;  1CKK A;  1LA3 A;  1MR8 A;  1NYA A;  1ZUZ A;  1YTZ C;  2GV5 A;  1CLM A;  3PAL A;  2JPT A;  1IRJ A;  3SIB A;  1B8C A;  2M0R A;  3BUN B;  1AVS A;  2KBI A;  2TN4 A;  4YGA A;  1YR5 A;  1G4Y R;  2LAP A;  3BUW B;  2L4I A;  2WCF A;  3SG2 A;  1QIV A;  3GK1 A;  1CB1 A;  2PRU A;  5AER A;  1Y1U A;  1MF8 B;  2Y1N A;  1GQM A;  1RJV A;  3LCP C;  1EXR A;  2KI4 C;  4D1E A;  4YRU A;  1NCX A;  2LLS A;  4NQG A;  4HRG A;  3PN7 C;  2G2B A;  1ZAC A;  4P2Y B;  3VRO A;  1J7R A;  3DVM A;  1DJW A;  1WDC B;  1CFC A;  2H61 C;  1FI5 A;  2BBM A;  3K21 A;  4PHK A;  1V1G A;  1XFY O;  2BCB A;  1NIW A;  1IH0 A;  2R2I A;  4I5J A;  2ZRS A;  2PVB A;  2LHI A;  1UP5 A;  1CDM A;  2KQY A;  3VRQ A;  1F71 A;  1IGV A;  2K8M B;  5JOL A;  1Y6W A;  4DUQ A;  1PSR A;  4YBH B;  3GK4 X;  1QXP A;  1RK9 A;  2MBX A;  3DVK A;  2LLT A;  2Y4Q A;  2JRF A;  1A75 B;  5KTY A;  3A8R A;  2I94 A;  3IQQ A;  1BT6 A;  4GAO A;  3TZ1 A;  4U8D A;  1NX2 A;  3EK4 A;  3FS7 A;  1PRW A;  2F2P A;  4PE0 A;  1K95 A;  2CTN A;  3OX5 A;  4JQ0 D;  4YI8 A;  4MZK A;  1XO5 A;  2O5G A;  3DVJ A;  3WXA A;  1TNP A;  1RFJ A;  2LUX A;  3BYA A;  3AKB A;  4DS7 A;  1WLM A;  5BPJ A;  2I7A A;  2K2A A;  4QJ4 B;  4OR9 B;  2LV7 A;  2O60 A;  2PAS A;  3E3R A;  1DTL A;  1Q80 A;  1YUR A;  2M7N A;  1SKT A;  2P6B B;  3SG3 A;  3O78 A;  1CFF A;  1DVI A;  1DJI A;  2JT0 A;  5AFP A;  1M31 A;  1J55 A;  3NSI A;  1SNL A;  3OX6 A;  2BKI B;  2E30 A;  1KWO B;  1Y1X A;  2FCD A;  1A75 A;  1CFD A;  1SR6 C;  2LM5 A;  1JF0 A;  1IWQ A;  2WOR A;  1YVL A;  1B4C A;  2LE9 B;  2LUC A;  2M3W A;  1FBV A;  3TDI A;  2BL0 B;  1KFX L;  2KFF A;  4DCK A;  1EL4 A;  4A4B A;  1K90 D;  1UUR A;  1TRF A;  1UWO A;  2F3Y A;  2HF5 A;  4CID A;  4HSZ A;  2BCX A;  1FW4 A;  4PE7 A;  1GGZ A;  4GBA A;  1G8I A;  4PE4 A;  5CPV A;  5HYD A;  5I2O A;  3D0Y B;  4MLW A;  3LK1 A;  1S6C A;  1F8H A;  1KCY A;  1DT7 B;  4CPV A;  4CFR A;  2OTG C;  1NWD A;  3I5I C;  5DKR A;  2L4H A;  5AAN A;  1CLB A;  1DJZ A;  3I5H B;  4QJ3 B;  1YX7 A;  4IL1 A;  2BCA A;  2JT3 A;  2JOJ A;  2IS9 A;  5HKZ A;  1UHK A;  3PFV A;  1NX3 A;  2KSP A;  4N5X A;  4MBE A;  4OKH A;  1AHR A;  2LAN A;  3WHT B;  1WRK A;  1BR4 B;  2M97 A;  1PSB A;  5FYX A;  2COL B;  4GFT A;  1W7J B;  2L98 A;  1KQM C;  4F0Z B;  2JC2 A;  2KAX A;  1GJY A;  3D0Y A;  1QTX A;  2KOT A;  3TDZ A;  2JNX A;  3TDU A;  1JC2 A;  1D1O A;  3CR4 X;  4NDB A;  1VRK A;  1K94 A;  3A4U B;  4AOM A;  3CR5 X;  3BOW B;  1XFV O;  2LMT A;  1QX7 A;  3BUO B;  1CMF A;  3OP0 A;  2FOT A;  4HRE E;  1J1D A;  1HQV A;  2KYC A;  2NLN A;  4XJK B;  4XYN A;  4PCW A;  3AAJ A;  1L7Z A;  1BLQ A;  2LVJ A;  1GGW A;  3AAK A;  2HQ8 A;  3EVV A;  1AP4 A;  1QVI Y;  2Y1M A;  3FWB A;  3QRX A;  4ZCU A;  1L2O B;  2EGD A;  1NSH A;  3RLZ A;  2BL0 C;  4YGB B;  4NDC A;  1F70 A;  2L0P A;  1KK8 C;  3NSL A;  1SW8 A;  3CGA A;  4L9M A;  1SL8 A;  2D8N A;  1B7T Y;  4OCI A;  1N65 A;  1M63 B;  1OOJ A;  1TCF A;  1XFU O;  1M46 A;  4M2P A;  2JZI A;  1S36 A;  3BOW A;  4M2O A;  1QJT A;  2CBL A;  2LNK A;  5D7F A;  2LMV A;  1F54 A;  1RTP 1;  3NSK A;  4XJK A;  2K2F A;  1S1E A;  2OS8 B;  1MUX A;  2LMU A;  1DF0 B;  3BUX B;  3ZWH A;  1QLS A;  3NXA A;  3TUY B;  1NCY A;  2LCP A;  1S5G Z;  3D10 A;  1K96 A;  2LP2 A;  2KHN A;  4GGF A;  2BKH B;  1EG3 A;  1B8R A;  2KGB C;  2F3Z A;  2LVK A;  4BY5 A;  1BG1 A;  2NCO A;  2ZN8 A;  2SAS A;  4FQO A;  4Q04 A;  1OMV A;  3TS5 B;  2NCP A;  2MLF C;  2ZFD A;  4A4C A;  3I5F B;  1CDL A;  1J7O A;  1S26 D;  1N2D A;  1J7Q A;  1C07 A;  1YRU B;  2BBN A;  1AUI B;  1K93 D;  2M7L A;  1IJ5 A;  2EC6 C;  1CM1 A;  2K7C A;  1KK7 Z;  1XFX O;  3SG5 A;  1SCV A;  2BE6 A;  1ALW A;  2I18 A;  2B1U A;  2MJW B;  3SG4 A;  1PVA A;  2AMI A;  4JWQ A;  2RGI A;  2KYF A;  1SK6 D;  1JFK A;  3SIA A;  3VGO A;  2WCE A;  1DF0 A;  4R1E A;  3PSR A;  1M45 A;  2KQ6 A;  4DIR A;  4GNK B;  1WLZ A;  1WRZ A;  3PAT A;  2PSR A;  1BOD A;  4GGF C;  4MEW A;  3M0W A;  1JUO A;  2WND A;  4TNC A;  1B1G A;  1XFZ O;  1S5G Y;  3JTD B;  2VRG A;  4PDZ A;  1ODB A;  5HKY A;  4WQ3 A;  4MRX A;  1TTX A;  4GGN A;  3CLN A;  5AXI A;  1OSA A;  1RWY A;  1S6J A;  1AJ5 A;  1DJX A;  1WDC C;  1SRA A;  3EVU A;  3PM8 A;  1SL9 A;  5PAL A;  2Q91 A;  2ZKM X;  5GQQ C;  1S6I A;  1CFP A;  3EKJ A;  2HQW A;  2CXJ A;  1MQ1 A;  1TCO B;  3WNX B;  4AQI A;  3WHU B;  1KFX S;  3SG7 A;  1U5I A;  1LKJ A;  2GGZ A;  5I2L A;  3VRN A;  1A03 A;  2L2E A;  1CDP A;  2FCE A;  1K9K A;  2SCP A;  3TUY C;  3FIA A;  2JXL A;  1IQ5 A;  1KK7 Y;  4USL A;  1LVC D;  1K9P A;  2LP3 A;  2MLE C;  4GPL B;  2H2K A;  5CSF A;  3OHM B;  1OMR A;  2Y5I A;  4OVN F;  1QAT A;  2AAO A;  5DKQ A;  1V1F A;  3PN7 B;  4I5K A;  4I5L B;  4YI9 A;  5G08 A;  5I2Q A;  1C7V A;  2JUL A;  2L5X B;  4C0L A;  1UUS A;  1FPW A;  2MAZ A;  4ICB A;  1UHJ A;  1R6P A;  3H4S E;  1LA0 A;  1SMG A;  4N1F A;  4CFQ A;  4FTG A;  1DJG A;  4C0K A;  2KAY A;  3KEV A;  3GOF A;  5K89 A;  1BR1 B;  4YGC B;  3SG6 A;  1WRL A;  3ICB A;  1UHH A;  1XK4 A;  1IG5 A;  1CLL A;  2ISD A;  1MHO A;  3DD4 A;  3KPX A;  2JTZ A;  4MVF A;  1AK8 A;  1J7P A;  4ORA B;  2K7B A;  2L51 A;  2GGM A;  1KSM A;  1KWO C;  2K7O A;  5I8N A;  3EVR A;  1IKU A;  1SL7 A;  1LIN A;  2BE4 A;  1TNW A;  2CCM A;  2WOS A;  1M39 A;  4ORB B;  1UHN A;  5D69 A;  3OB1 B;  1G33 A;  4BY4 A;  2F8P A;  2JNF A;  3VRP A;  1QV0 A;  1NX1 A;  2KGR A;  1PUL A;  3JTD C;  2KI6 C;  2F33 A;  4NDD A;  4YGD B;  1MWN A;  1EG4 A;  1BMO A;  1NX0 A;  2H61 A;  1TOP A;  1K8U A;  1A4P A;  1OZO A;  1XA5 A;  4P5O E;  5HKW A;  1JWD A;  2CT9 A;  1TIZ A;  4I5N B;  1EH2 A;  4E68 A;  5CSJ A;  2KBM A;  1TNX A;  1NPQ A;  2E6W A;  1QAS A;  1CTR A;  1PK0 D;  4HRH A;  4PHN A;  1DJH A;  3O2P A;  4ETO A;  1XK4 C;  5KU1 A;  3NSO A;  5CSN A;  1BJF A;  2MA2 A;  4MZJ A;  1XFW O;  5JJG A;  2PAL A;  1SR6 B;  2HET A;  3SJS A;  1UHI A;  1RRO A;  1SY9 A;  3I5H C;  3CZT X;  3AKA A;  2NZ0 A;  2V53 A;  4MRY A;  4PAL A;  2KNE A;  1CM4 A;  1REC A;  2DOQ A;  3EK8 A;  1JSA A;  1A29 A;  2KFH A;  1JBA A;  1ZOT B;  3IQO A;  2ZN9 A;  3IF7 A;  2JU0 A;  1CMG A;  3CS1 A;  4MZL A;  2MRD A;  4C0J A;  3JVT B;  3DF0 B;  5CSI A;  1BF5 A;  5ER5 A;  1OZS A;  1OE9 B;  2JQ6 A;  1F4Q A;  1F4O A;  2F2O A;  1B47 A;  1ALV A;  2OTG B;  3I5I B;  1OQP A;  3FWC A;  1KQV A;  3DVE A;  1YVH A;  2JTT A;  3EK7 A;  1DJY A;  2JT8 A;  1QV1 A;  3PLF B;  4MN0 A;  2A4J A;  4PHM A;  1U5I B;  1CNP A;  3HX4 A;  2LHL A;  1EJ3 A;  1AJ4 A;  1PVB A;  4M2Q A;  2K7D A;  4PHJ A;  4WQ2 A;  3F45 A;  1PAL A;  4AQJ A;  1SCM B;  1BOC A;  4N1G A;  1L2O C;  1DMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...