1JBAA

Unmyristoylated gcap-2 with three calcium ions bound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
GQQFSWEEAEENGAVGAADAAQLQEWYKKFLEECPSGTLFMHEFKRFFKVPDNEEATQYVEAMFRAFDTNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRQELLDIVESIYKLKKACSVEVEAEQQGKLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (GUANYLATE CYCLASE ACTIVATING PROTEIN 2)
publication title Three-dimensional structure of guanylyl cyclase activating protein-2, a calcium-sensitive modulator of photoreceptor guanylyl cyclases.
pubmed doi rcsb
source organism Bos taurus
total genus 41
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 1999-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jbaA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jbaA01
2LVKA 3SIAA 1IG5A 2F8PA 1B4CA 2WNDA 1D1OA 1K90D 2LC5A 1IH0A 2Y4QA 3DF0A 2LUXA 2L4HA 4MEWA 2L5XB 2D8NA 2BL0C 1AJ5A 1AK8A 3TUYC 2WORA 1SCMB 4P2YB 4YI8A 5DKQA 4OR9B 3D0YB 2Y1MA 2MJWB 2JOJA 1QV0A 3I5HC 3IQOA 1M39A 2LMUA 2P6BB 2K8MB 1YR5A 3BUNB 3DVJA 2KQ6A 1TN4A 1K96A 1CLBA 2AAOA 3KEVA 1H8BA 1M45A 1GJYA 2K7DA 1RECA 3BQ3A 4XYNA 2KAVA 1NPQA 1ZUZA 2KSPA 2NCPA 3A4UB 4U8DA 1CKKA 3IQQA 1B8RA 1BF5A 1S36A 3IF7A 3JTDB 2KYFA 5HYDA 2MA2A 4GUKA 4PHJA 5D69A 1DT7B 1K8UA 2LE9B 5KSZA 2SASA 5K89A 3DVEA 3RM1A 4DUQA 1IJ5A 4P5OE 1DJIA 2K61A 3C1VA 4DIRA 1FF1A 1S5GZ 2O5GA 1BR4B 1DF0A 1BODA 2KNEA 1Y1UA 2FOTA 2GV5A 3WHTB 1XK4A 2L51A 4GPLB 1NX1A 2OTGB 3VRQA 1KSMA 2JT8A 2BE6A 1W7IB 3EK4A 4GAOA 4M2OA 3OHMB 3SJSA 2M49B 2KBIA 4JWQA 2KGRA 4OCIA 1UUSA 1LINA 1TOPA 2LMTA 2EC6C 3SG5A 1XK4C 2JT3A 3LK0A 3DD4A 4JQ0D 1OMVA 2LMVA 4D1EA 5I8NA 1WRZA 1BG1A 1QVIZ 3JTDC 1JC2A 2K0JA 1B7TZ 1XYDA 4OVNF 3F45A 2ZNEA 1FPWA 4C0LA 2L0PA 2LP2A 2ZRSA 1PK0D 1CFCA 2BECA 1DJHA 1TCFA 1YTZC 1Y1AA 1NSHA 1XFWO 4F0ZB 4ZCUA 3SG4A 1YUTA 1VRKA 1CB1A 2I7AA 1S6CA 2A4JA 4HRGA 2ZNDA 5CSFA 2F3ZA 1B1GA 2OTGC 1SKTA 2BCBA 1B47A 1A4PA 1GGZA 1UHNA 1HQVA 2KI6D 4PALA 4DRWA 1KQVA 1MUXA 2CTNA 3GOFA 2LLSA 4PE4A 4MVFA 1N0YA 1BJFA 2ZN9A 2HQWA 1QV1A 4I5KA 1PRWA 1XO5A 2HPSA 3BUMB 1CMGA 2OS8B 1QX2A 4DCKA 3NSOA 5TNCA 4PE0A 2KI4B 3CTNA 2HF5A 3H4SE 1EG4A 4PCWA 3BYAA 1SCVA 1KK7Y 2JT0A 2PMYA 5F6TA 4AQIA 1NCYA 2COLB 5DKRA 1FI6A 3LK1A 1SL7A 1RROA 4C0KA 5AERA 3SG7A 4N5XA 5AANA 1ZMZA 1EXRA 2JRFA 2NZ0A 1XA5A 3BOWB 3WHUB 1IWQA 4YGEB 2BL0B 1MF8B 1RK9A 2I94A 2LLUA 1Y1XA 2FCEA 4MSPA 1W7JB 3I5HB 4FQOA 1XFUO 1JBAA 1SY9A 1NCZA 2ZRTA 2O60A 2F3YA 3I5GB 3NXAA 1J55A 1TCOB 1IQ3A 1K95A 1DJZA 1M46A 1OQPA 2KI4C 3DVKA 1QXPA 3EVVA 1X02A 5I2OA 1J7QA 3ZWHA 1K9UA 1UHJA 2H61A 1SYMA 4PHMA 5HLOA 2V53A 4I5JA 1OZOA 1BU3A 2HQ8A 2KBMA 1DJXA 2LLTA 2ZN8A 2B1UA 2JZIA 3NSIA 2MRDA 1A2XA 3PATA 2PRUA 4PE1A 5HLVA 4PHNA 4ZCVA 3OX5A 1AJ4A 4NQGA 1JFJA 1KFXS 2FCDA 2H61C 3VROA 1G8IA 1ZOTB 1UHHA 2L50A 4A4CA 2K7BA 2LV7A 3TDUA 1DJYA 3I5GC 2M3WA 2MBXA 3OP0A 2WCFA 2K2AA 5CSNA 1ZACA 2Y5IA 2LNKA 2K7CA 2Q4UA 2BCAA 1UURA 3KO0A 1DF0B 2VRGA 4GGFA 2M0RA 4NDCA 2EC6B 3CR4X 2CCMA 2G9BA 1PVAA 1XFXO 1S3PA 1C7VA 4TNCA 4ICBA 1PVBA 2AMIA 3CWGA 1QS7A 3AAJA 3LCPC 1DMOA 3EVRA 4GGFC 2FJUB 2BKHB 3CR2A 1J7OA 5CSJA 1S5GY 2JXLA 3TDIA 1KCYA 1H4BA 2LVJA 2MLFC 2BBNA 4MZJA 1Y6WA 4QJ3B 4OV2A 1WRKA 1QLSA 4CIDA 2PVBA 1J7PA 1K9KA 2Y1NA 1YX8A 4WQ3A 3ZNIA 2WCEA 4GGNA 5JOLA 3TDZA 3OB1B 3AKBA 2F2OA 1SRAA 1BT6A 4ORCB 3A8RA 3BUXB 4AOMA 1XVJA 1NX3A 2ZKMX 3CZTX 2G2BA 3VRPA 2WCBA 2NCOA 1QVIY 1NP8A 4N1FA 1B7TY 1S6IA 2LP3A 5AFPA 1RFJA 3O78A 1WLMA 2NXQA 1TNWA 2OPOA 3JVTB 4L9MA 3AAKA 1IJ6A 5CSIA 2KFFA 1FBVA 1IKUA 1YURA 1NX0A 2QACA 1WRLA 2DOQA 5FYXA 1F70A 1BMOA 1RTP1 3KHEA 4BY5A 5PALA 1BOCA 1E8AA 2WOSA 3HX4A 5G08A 2BKIB 1PSBA 4FTGA 1UWOA 1C07A 3EKJA 1B9AA 1QIVA 5BPJA 1PULA 1B8CA 2KHNA 1EH2A 1KQMC 3WNXB 2I18A 5I2LA 1JF2A 1K9PA 2LCPA 3M0WA 2JPTA 3BUWB 1RJVA 2KQYA 1F8HA 3PN7B 1KFUS 2QPTA 3CGAA 1J7RA 1YRTB 5HKZA 4MZKA 3WXAA 1WY9A 1AVSA 4MN0A 2AUCA 1OOJA 2KDHA 1CDNA 1V1FA 1QIWA 3OX6A 1SW8A 1TRFA 2KAYA 1CLLA 1MXEA 1JFKA 2E30A 3JVTC 1DGUA 1QASA 1IGVA 3D10A 4MRYA 4YRUA 3MSEB 1CMFA 1DGVA 3O2PA 1Y0VH 1DVIA 1OSAA 3SG6A 3GK1A 1LVCD 4E68A 1KWOB 4GNKB 2K7OA 5KTYA 3PM8A 2NLNA 2CXJA 5KU1A 2SCPA 3CLNA 4YGBB 2M7NA 4HRHA 4CFRA 1FW4A 4YGAA 1SK6D 3DVMA 3FWCA 1WLZA 3EKHA 2K2FA 3KF9A 2LAPA 3PN7C 1F4QA 1AUIB 3VRNA 1F54A 4MZLA 1J1DA 1LXFC 2MHHA 1YUUA 4AQJA 1ODBA 2ZFDA 3PSRA 1YVHA 1M31A 1XFVO 4HSZA 4WQ2A 4C0JA 1M63B 1J1EA 2LANA 3LLEA 2M97A 1OMRA 3O6BA 3HCMA 3GK2A 2KYCA 1KWOC 1S1EA 5ER5A 1GQMA 3ICBA 4NDBA 4QJ5B 2L2EA 1QLKA 1SR6B 4NDDA 2H2KA 1UHKA 1UHIA 5ER4X 1QTXA 1NUBA 2JTTA 1N65A 2GGZA 3FWBA 5CPVA 2M1UA 1BLQA 1CDLA 1EG3A 5IBWA 4CPVA 2JTZA 1OZSA 3PLFB 1HT9A 2KAXA 1CDPA 1B8LA 1U5IA 2BBMA 1L7ZA 1V1GA 1YVLA 1ALVA 2LM5A 5GQQC 5HKYA 1CFFA 2L4IA 3I5FC 4N1GA 3AKAA 1KFUL 1Q80A 1SPYA 2M29A 4ORBB 5D7FA 1AP4A 2HETA 1GGWA 2R2IA 2CT9A 3LL8B 3NSKA 2KFHA 2JC2A 1DJWA 4HREE 1QX5B 3CR5X 1MWNA 2M1KB 2PSRA 1NCXA 1SR6C 1XFZO 1YX7A 4I5NB 4QJ4B 1CTRA 1RWYA 1EL4A 1YRUB 2JU0A 4I5LB 3TS5B 2JULA 3O4YA 3VGOA 4BY4A 4PE7A 3TZ1A 1AHRA 1NYAA 1KSOA 3FS7A 2LVIA 3D0YA 1BR1B 1KQMB 1MXLC 2F33A 1EJ3A 1S26D 2F2PA 2M8UA 3SIBA 4OKHA 1ZFSA 2EGDA 2GGMA 3SG2A 1TNQA 3SG3A 1SCMC 1SL8A 5AEQA 3CS1A 3OB2B 1SL9A 3EK8A 2MAZA 3KPXA 2JNFA 1CFPA 1C7WA 3BXKA 4USLA 1JWDA 1K93D 1CDMA 1R2UA 1UP5A 2MLEC 1TIZA 3TS5C 1A75B 1TTXA 2KGBC 1XFYO 1PALA 1OE9B 4MLWA 2JXCA 1CM4A 4XJKB 2ISDA 1F71A 1R6PA 1NX2A 4R1EA 3I5IB 2LHIA 2PALA 4Q04A 1CNPA 1A29A 3QRXA 1KFXL 4MBEA 2PASA 1CLMA 1OMDA 4JPZB 4MRXA 1DJGA 1TNPA 2LVVA 4UPGA 1KK8B 1MQ1A 2CBLA 1NIWA 4GBAA 4A4BA 1FI5A 1A75A 1JUOA 2JWWA 4PHKA 1SNLA 3GK4X 4CFQA 1L2OB 2JNXA 2E6WA 4XJKA 4ETOA 1NWDA 2KOTA 1LA3A 2EHBA 3EK7A 1MHOA 5J3XA 4YGDB 3NSLA 4IL1A 2LHLA 2TN4A 4YBHB 1WDCB 4M2QA 5HKWA 2JQ6A 3VRRA 1LKJA 1DTLA 1QATA 1F55A 3I5IC 2WC8A 5AXIA 1PSRA 1QX7A 1S6JA 1SBJA 2L98A 1ALWA 2Q91A 3BUOB 1N2DA 3K21A 3RLZA 5JJGA 1KK7Z 4ORAB 1KK8C 1CM1A 2IS9A 1YUSA 4PDZA 4YI9A 1CFDA 2KFGA 1L2OC 1MR8A 2BCXA 1LA0A 1K94A 3E3RA 1IQ5A 4WRIA 1A03A 3PFVA 3I5FB 3TUYB 5I2QA 1F4OA 4CLNA 2M7LA 4DS7A 1WDCC 1K2HA 5B8IB 2RGIA 2CNPA 2M9GA 4GFTA 1U5IB 2LUCA 2I2RE 3DF0B 1JF0A 1QJTA 2OS8C 3FIAA 3EVUA 3PALA 4YGCB 2BE4A 3BOWA 1G4YR 2KI6C 1G33A 1TNXA 4M2PA 5DKNA 1SMGA 1JSAA 1IRJA
chains in the Genus database with same CATH superfamily
2LVKA 3SIAA 1IG5A 4INXA 1OW4A 2F8PA 1B4CA 2WNDA 1D1OA 1K90D 2LC5A 1IH0A 2Y4QA 3NHTA 3DF0A 2LUXA 2L4HA 3DYEA 2L5XB 4MEWA 2D8NA 2BL0C 2P71A 1AJ5A 3SS4A 1AK8A 3TUYC 2WORA 1SCMB 4P2YB 4YI8A 5DKQA 4OR9B 3D0YB 2Y1MA 2MJWB 2JOJA 1QV0A 3I5HC 3IQOA 1M39A 2LMUA 2P6BB 2WCMA 2K8MB 1YR5A 3BUNB 3DVJA 2KQ6A 1TN4A 1K96A 1CLBA 2AAOA 3KEVA 1H8BA 1M45A 1GJYA 2K7DA 1RECA 2YGUA 3BQ3A 4JD9A 2KAVA 1NPQA 1ZUZA 2KSPA 2NCPA 4XYNA 3A4UB 4U8DA 1C3ZA 1CKKA 3IQQA 1B8RA 1BF5A 1S36A 3IF7A 3JTDB 2KYFA 5HYDA 2MA2A 4GUKA 4PHJA 5D69A 1DT7B 1K8UA 1C3YA 2LE9B 5KSZA 2SASA 5K89A 3K1EA 3DVEA 3RM1A 4DUQA 1IJ5A 4P5OE 1DJIA 2K61A 3C1VA 4DIRA 1FF1A 1S5GZ 2O5GA 1BR4B 1DF0A 1BODA 2KNEA 1Y1UA 2FOTA 2GV5A 3WHTB 1XK4A 5D3OA 2L51A 4GPLB 1NX1A 2OTGB 3VRQA 1KSMA 2JT8A 2BE6A 1GM0A 1W7IB 3EK4A 4GAOA 4M2OA 3OHMB 3S0DA 3SJSA 2M49B 2KBIA 4JWQA 2KGRA 4OCIA 1UUSA 1LINA 1TOPA 2LMTA 3DY9A 2EC6C 3SG5A 1XK4C 2JT3A 3LK0A 3DD4A 4JQ0D 1OMVA 2LMVA 4D1EA 5I8NA 1WRZA 1BG1A 1QVIZ 3JTDC 1JC2A 2K0JA 1B7TZ 1XYDA 4OVNF 3F45A 2ZNEA 1FPWA 4C0LA 2L0PA 2LP2A 2ZRSA 3CYZA 1PK0D 1CFCA 1TCFA 1DJHA 2BECA 1YTZC 1Y1AA 1NSHA 1XFWO 2WCJA 4F0ZB 4ZCUA 3SG4A 1YUTA 1VRKA 3CZ0A 1CB1A 2I7AA 1S6CA 2A4JA 4HRGA 2ZNDA 5CSFA 2F3ZA 1B1GA 2OTGC 1SKTA 2BCBA 1UHNA 1B47A 1A4PA 1GGZA 1HQVA 2KI6D 3FE9A 4PALA 3SS3A 1MUXA 1KQVA 1P28A 2CTNA 3GOFA 2LLSA 3BFHA 4MVFA 4PE4A 1N0YA 1BJFA 2L5YA 2ZN9A 2HQWA 3B86A 1QV1A 4I5KA 1PRWA 1XO5A 2HPSA 3BUMB 1CMGA 2OS8B 1QX2A 4DCKA 3NSOA 1TUJA 5TNCA 4PE0A 2KI4B 3CTNA 2HF5A 3H4SE 1EG4A 4PCWA 3BYAA 1SCVA 1KK7Y 2JT0A 2PMYA 5F6TA 4AQIA 1NCYA 2COLB 5DKRA 1FI6A 1ORGA 3LK1A 1SL7A 1RROA 3DZTA 3PM2A 4C0KA 5AERA 4PT1A 5DICA 3SG7A 4N5XA 5AANA 1ZMZA 1EXRA 2JRFA 2NZ0A 1XA5A 3BOWB 3WHUB 1IWQA 4YGEB 2BL0B 1MF8B 1RK9A 2I94A 2LLUA 1Y1XA 2FCEA 4MSPA 2L2CA 1W7JB 5I94A 3FE6A 3I5HB 4FQOA 1XFUO 1JBAA 1SY9A 3EG5B 3Q8IA 3D76A 1NCZA 2ZRTA 2O60A 1TUZA 2F3YA 3I5GB 3NXAA 1J55A 2JPOA 1TCOB 1IQ3A 1K95A 1DJZA 1M46A 1OQPA 2KI4C 4JKTA 3DVKA 1QXPA 2PYQA 3EVVA 1X02A 5I2OA 1J7QA 3ZWHA 1K9UA 1UHJA 2H61A 1SYMA 4PHMA 5HLOA 2V53A 4I5JA 1OZOA 1BU3A 2HQ8A 2KBMA 1DJXA 2LLTA 2ZN8A 2B1UA 2JZIA 2BAPA 3D78A 3NSIA 2MRDA 1A2XA 3PATA 2PRUA 4PE1A 5HLVA 4PHNA 4ZCVA 3OX5A 1AJ4A 4NQGA 1JFJA 1KFXS 2FCDA 2H61C 3VROA 3D77A 1G8IA 1ZOTB 1UHHA 2L50A 4A4CA 2K7BA 2LV7A 2QEOA 4KYNA 3TDUA 3BJHA 1DJYA 3S0EA 5EL2A 3I5GC 2M3WA 2MBXA 3OP0A 2WCFA 2K60A 4DRWA 2K2AA 5CSNA 1ZACA 2Y5IA 2LNKA 2K7CA 3R1OA 2Q4UA 2BCAA 1UURA 3KO0A 1DF0B 2VRGA 4GGFA 2M0RA 4NDCA 2EC6B 3CR4X 2CCMA 2G9BA 1PVAA 1XFXO 1S3PA 1C7VA 4OZDA 2GTEA 2ERBA 2FJYA 4ICBA 1PVBA 4TNCA 3VB1A 3BFBA 2AMIA 3CWGA 1QS7A 3AAJA 3LCPC 1DMOA 1IIOA 3EVRA 4GGFC 2FJUB 3B7AA 2BKHB 3R72A 3CR2A 1J7OA 5CSJA 1S5GY 2JXLA 3TDIA 1KCYA 1H4BA 2LVJA 2MLFC 2BBNA 4MZJA 1Y6WA 4QJ3B 4OV2A 1WRKA 1QLSA 4CIDA 2PVBA 1J7PA 2WC5A 1K9KA 2Y1NA 1YX8A 4WQ3A 3IVTA 3ZNIA 2WCEA 4GGNA 5JOLA 3TDZA 3OB1B 3AKBA 2F2OA 1SRAA 1BT6A 4ORCB 2PQLA 3A8RA 3BUXB 4AOMA 1XVJA 1NX3A 2ZKMX 3OGNA 3CZTX 2G2BA 3VRPA 2WCBA 2NCOA 1QVIY 1NP8A 4N1FA 1B7TY 5FI2A 1S6IA 2LP3A 5AFPA 3L47A 1RFJA 3O78A 1WLMA 3CDNA 2NXQA 1TNWA 2OPOA 3JVTB 4L9MA 3AAKA 1IJ6A 5CSIA 2KFFA 1FBVA 1IKUA 1YURA 1NX0A 2QACA 1WRLA 2DOQA 5FYXA 1F70A 1BMOA 1RTP1 2BNXA 3KHEA 3L4AA 5PALA 4BY5A 1BOCA 1E8AA 2WOSA 3HX4A 5G08A 2BKIB 1PSBA 4FTGA 1UWOA 1C07A 3EKJA 1B9AA 1QIVA 5BPJA 1PULA 1B8CA 2KHNA 3NGVA 1KQMC 3WNXB 1EH2A 2I18A 5FI6A 5I2LA 1JF2A 1K9PA 2LCPA 1DEKA 2JPTA 3M0WA 1OOHA 1OOFA 1RJVA 2KQYA 2QEBA 3BUWB 1F8HA 2KLDA 3PN7B 1KFUS 2QPTA 3CGAA 1J7RA 1YRTB 3S0FA 5HKZA 4MZKA 3WXAA 1WY9A 3S0AA 2WCLA 1AVSA 4MN0A 2AUCA 1OOJA 1QWVA 2KDHA 3D75A 1V1FA 1QIWA 1CDNA 3OX6A 1SW8A 1TRFA 2KAYA 1CLLA 1MXEA 1JFKA 2E30A 3JVTC 1DGUA 2H8VA 1QASA 1IGVA 3D10A 4MRYA 4YRUA 3MSEB 1CMFA 1DGVA 3O2PA 1Y0VH 1DQEA 1DVIA 1OSAA 3SG6A 3GK1A 3S0GA 1LVCD 4E68A 1KWOB 4GNKB 2K7OA 5KTYA 3PM8A 2NLNA 2CXJA 1DELA 5KU1A 2SCPA 3CLNA 4YGBB 2M7NA 4HRHA 4CFRA 1FW4A 4YGAA 1SK6D 3DVMA 3FWCA 3RZSA 1WLZA 3EKHA 2K2FA 3KF9A 2LAPA 3NHIA 3R1PA 3PN7C 1F4QA 1AUIB 2KLEA 3VRNA 1F54A 3SS5A 4MZLA 1J1DA 1LXFC 1XFRA 2MHHA 1YUUA 4AQJA 1ODBA 3S0BA 2ZFDA 3CZ2A 3PSRA 1OOIX 3V2LA 2WCHA 2WCKA 1YVHA 1M31A 1XFVO 4HSZA 4WQ2A 4C0JA 1M63B 1J1EA 2LANA 3LLEA 2M97A 1OMRA 3O6BA 2QEHA 3GK2A 3HCMA 3O4XA 2KYCA 1KWOC 1S1EA 5ER5A 1GQMA 3ICBA 4NDBA 4QJ5B 2L2EA 4F7FA 1QLKA 1SR6B 4NDDA 2H2KA 1UHKA 1UHIA 5ER4X 1QTXA 1NUBA 2JTTA 1N65A 2GGZA 3UNWA 3FWBA 2KPHA 5CPVA 2M1UA 1BLQA 1CDLA 1EG3A 5IBWA 4CPVA 1OOGA 2JTZA 1OZSA 2P70A 3PLFB 1HT9A 2KAXA 1CDPA 1B8LA 1U5IA 1L7ZA 1V1GA 2BBMA 1YVLA 1T14A 1ALVA 2LM5A 5GQQC 3B6XA 5HKYA 1CFFA 2L4IA 1W9ZA 3I5FC 4N1GA 3AKAA 1KFUL 1Q80A 1SPYA 2M29A 4ORBB 5D7FA 1AP4A 2HETA 2QEVA 1GGWA 2R2IA 1SSEB 2CT9A 3LL8B 3NSKA 2KFHA 2JC2A 1DJWA 4HREE 1QX5B 3CR5X 1MWNA 3UO9A 2M1KB 2PSRA 1NCXA 1SR6C 1XFZO 1YX7A 4I5NB 4QJ4B 1CTRA 1RWYA 1YRUB 1EL4A 2JU0A 4I5LB 3TS5B 2JULA 3O4YA 3VGOA 4BY4A 4PE7A 3TZ1A 1AHRA 1NYAA 1KSOA 3FS7A 2LVIA 3D0YA 1BR1B 1KQMB 1MXLC 2F33A 1EJ3A 1S26D 2F2PA 2M8UA 3SIBA 3DXLA 4OKHA 1ZFSA 2EGDA 2GGMA 1LS8A 3SG2A 1TNQA 3SG3A 3D73A 1SCMC 3B87A 1SL8A 5FI7A 5AEQA 3CS1A 3OB2B 1SL9A 3EK8A 2MAZA 3KPXA 2JNFA 1CFPA 3CZ1A 1C7WA 3BXKA 4USLA 1JWDA 1K93D 1CDMA 1R2UA 1UP5A 2MLEC 5HL1A 3QMEA 1TIZA 3PJIA 1A75B 3TS5C 1TTXA 4FQTA 2KGBC 1XFYO 1PALA 1OE9B 4MLWA 2JXCA 1CM4A 3OBVA 4XJKB 2ISDA 1F71A 1R6PA 1NX2A 4R1EA 3I5IB 3N7HA 1DC1A 2LHIA 2PALA 4Q04A 1CNPA 1A29A 3QRXA 1KFXL 4MBEA 3B88A 2PASA 1CLMA 1Z4HA 1OMDA 3BFAA 4JPZB 4MRXA 1DJGA 1TNPA 2LVVA 4UPGA 1KK8B 1MQ1A 2CBLA 1NIWA 4GBAA 4A4BA 1FI5A 1A75A 1JUOA 2JWWA 4PHKA 1SNLA 3GK4X 4CFQA 1L2OB 2JNXA 2E6WA 4XJKA 2WC6A 4ETOA 1NWDA 2KOTA 1LA3A 2EHBA 3EK7A 1MHOA 5J3XA 4YGDB 3NSLA 4IL1A 2LHLA 2QDIA 2TN4A 4YBHB 1WDCB 4M2QA 5HKWA 2JQ6A 3VRRA 1LKJA 1DTLA 1QATA 1F55A 3I5IC 2WC8A 5AXIA 1PSRA 1QX7A 1S6JA 1SBJA 2L98A 1ALWA 2Q91A 3BUOB 1N2DA 3FE8A 3K21A 3RLZA 5JJGA 1KK7Z 3D74A 4ORAB 1KK8C 1CM1A 2IS9A 1YUSA 4PDZA 4YI9A 1CFDA 2KFGA 1L2OC 1MR8A 2BCXA 1LA0A 1K94A 3E3RA 3CABA 1IQ5A 4WRIA 1A03A 3PFVA 3I5FB 3TUYB 5I2QA 3L4LA 3R1VA 1F4OA 4CLNA 2M7LA 4IJ7A 4DS7A 1WDCC 1K2HA 5B8IB 2RGIA 2CNPA 2M9GA 4GFTA 1U5IB 2LUCA 2I2RE 3DF0B 1JF0A 1TWOA 1QJTA 2OS8C 3FIAA 1Z2CB 3EVUA 3PALA 4YGCB 2BE4A 3BOWA 1G4YR 2KI6C 1G33A 1TNXA 4M2PA 5DKNA 1SMGA 4INWA 1JSAA 1IRJA
chains in the Genus database with same CATH topology
2LVKA 3SIAA 1IG5A 2F8PA 1B4CA 2WNDA 1D1OA 1K90D 2LC5A 1IH0A 2Y4QA 3DF0A 2LUXA 2L4HA 4MEWA 2L5XB 2D8NA 2BL0C 1AJ5A 1AK8A 3TUYC 2WORA 1SCMB 4P2YB 4YI8A 5DKQA 4OR9B 3D0YB 2Y1MA 2MJWB 2JOJA 1QV0A 3I5HC 3IQOA 1M39A 2LMUA 2P6BB 2K8MB 1YR5A 3BUNB 3DVJA 2KQ6A 1TN4A 1K96A 1CLBA 2AAOA 3KEVA 1H8BA 1M45A 1GJYA 2K7DA 1RECA 3BQ3A 4XYNA 2KAVA 1NPQA 1ZUZA 2KSPA 2NCPA 3A4UB 4U8DA 1CKKA 3IQQA 1B8RA 1BF5A 1S36A 3IF7A 3JTDB 2KYFA 5HYDA 2MA2A 4GUKA 4PHJA 5D69A 1DT7B 1K8UA 2LE9B 5KSZA 2SASA 5K89A 3DVEA 3RM1A 4DUQA 1IJ5A 4P5OE 1DJIA 2K61A 3C1VA 4DIRA 1FF1A 1S5GZ 2O5GA 1BR4B 1DF0A 1BODA 2KNEA 1Y1UA 2FOTA 2GV5A 3WHTB 1XK4A 2L51A 4GPLB 1NX1A 2OTGB 3VRQA 1KSMA 2JT8A 2BE6A 1W7IB 3EK4A 4GAOA 4M2OA 3OHMB 3SJSA 2M49B 2KBIA 4JWQA 2KGRA 4OCIA 1UUSA 1LINA 1TOPA 2LMTA 2EC6C 3SG5A 1XK4C 2JT3A 3LK0A 3DD4A 4JQ0D 1OMVA 2LMVA 4D1EA 5I8NA 1WRZA 1BG1A 1QVIZ 3JTDC 1JC2A 2K0JA 1B7TZ 1XYDA 4OVNF 3F45A 2ZNEA 1FPWA 4C0LA 2L0PA 2LP2A 2ZRSA 1PK0D 1CFCA 2BECA 1DJHA 1TCFA 1YTZC 1Y1AA 1NSHA 1XFWO 4F0ZB 4ZCUA 3SG4A 1YUTA 1VRKA 1CB1A 2I7AA 1S6CA 2A4JA 4HRGA 2ZNDA 5CSFA 2F3ZA 1B1GA 2OTGC 1SKTA 2BCBA 1B47A 1A4PA 1GGZA 1UHNA 1HQVA 2KI6D 4PALA 4DRWA 1KQVA 1MUXA 2CTNA 3GOFA 2LLSA 4PE4A 4MVFA 1N0YA 1BJFA 2ZN9A 2HQWA 1QV1A 4I5KA 1PRWA 1XO5A 2HPSA 3BUMB 1CMGA 2OS8B 1QX2A 4DCKA 3NSOA 5TNCA 4PE0A 2KI4B 3CTNA 2HF5A 3H4SE 1EG4A 4PCWA 3BYAA 1SCVA 1KK7Y 2JT0A 2PMYA 5F6TA 4AQIA 1NCYA 2COLB 5DKRA 1FI6A 3LK1A 1SL7A 1RROA 4C0KA 5AERA 3SG7A 4N5XA 5AANA 1ZMZA 1EXRA 2JRFA 2NZ0A 1XA5A 3BOWB 3WHUB 1IWQA 4YGEB 2BL0B 1MF8B 1RK9A 2I94A 2LLUA 1Y1XA 2FCEA 4MSPA 1W7JB 3I5HB 4FQOA 1XFUO 1JBAA 1SY9A 1NCZA 2ZRTA 2O60A 2F3YA 3I5GB 3NXAA 1J55A 1TCOB 1IQ3A 1K95A 1DJZA 1M46A 1OQPA 2KI4C 3DVKA 1QXPA 3EVVA 1X02A 5I2OA 1J7QA 3ZWHA 1K9UA 1UHJA 2H61A 1SYMA 4PHMA 5HLOA 2V53A 4I5JA 1OZOA 1BU3A 2HQ8A 2KBMA 1DJXA 2LLTA 2ZN8A 2B1UA 2JZIA 3NSIA 2MRDA 1A2XA 3PATA 2PRUA 4PE1A 5HLVA 4PHNA 4ZCVA 3OX5A 1AJ4A 4NQGA 1JFJA 1KFXS 2FCDA 2H61C 3VROA 1G8IA 1ZOTB 1UHHA 2L50A 4A4CA 2K7BA 2LV7A 3TDUA 1DJYA 3I5GC 2M3WA 2MBXA 3OP0A 2WCFA 2K2AA 5CSNA 1ZACA 2Y5IA 2LNKA 2K7CA 2Q4UA 2BCAA 1UURA 3KO0A 1DF0B 2VRGA 4GGFA 2M0RA 4NDCA 2EC6B 3CR4X 2CCMA 2G9BA 1PVAA 1XFXO 1S3PA 1C7VA 4TNCA 4ICBA 1PVBA 2AMIA 3CWGA 1QS7A 3AAJA 3LCPC 1DMOA 3EVRA 4GGFC 2FJUB 2BKHB 3CR2A 1J7OA 5CSJA 1S5GY 2JXLA 3TDIA 1KCYA 1H4BA 2LVJA 2MLFC 2BBNA 4MZJA 1Y6WA 4QJ3B 4OV2A 1WRKA 1QLSA 4CIDA 2PVBA 1J7PA 1K9KA 2Y1NA 1YX8A 4WQ3A 3ZNIA 2WCEA 4GGNA 5JOLA 3TDZA 3OB1B 3AKBA 2F2OA 1SRAA 1BT6A 4ORCB 3A8RA 3BUXB 4AOMA 1XVJA 1NX3A 2ZKMX 3CZTX 2G2BA 3VRPA 2WCBA 2NCOA 1QVIY 1NP8A 4N1FA 1B7TY 1S6IA 2LP3A 5AFPA 1RFJA 3O78A 1WLMA 2NXQA 1TNWA 2OPOA 3JVTB 4L9MA 3AAKA 1IJ6A 5CSIA 2KFFA 1FBVA 1IKUA 1YURA 1NX0A 2QACA 1WRLA 2DOQA 5FYXA 1F70A 1BMOA 1RTP1 3KHEA 4BY5A 5PALA 1BOCA 1E8AA 2WOSA 3HX4A 5G08A 2BKIB 1PSBA 4FTGA 1UWOA 1C07A 3EKJA 1B9AA 1QIVA 5BPJA 1PULA 1B8CA 2KHNA 1EH2A 1KQMC 3WNXB 2I18A 5I2LA 1JF2A 1K9PA 2LCPA 3M0WA 2JPTA 3BUWB 1RJVA 2KQYA 1F8HA 3PN7B 1KFUS 2QPTA 3CGAA 1J7RA 1YRTB 5HKZA 4MZKA 3WXAA 1WY9A 1AVSA 4MN0A 2AUCA 1OOJA 2KDHA 1CDNA 1V1FA 1QIWA 3OX6A 1SW8A 1TRFA 2KAYA 1CLLA 1MXEA 1JFKA 2E30A 3JVTC 1DGUA 1QASA 1IGVA 3D10A 4MRYA 4YRUA 3MSEB 1CMFA 1DGVA 3O2PA 1Y0VH 1DVIA 1OSAA 3SG6A 3GK1A 1LVCD 4E68A 1KWOB 4GNKB 2K7OA 5KTYA 3PM8A 2NLNA 2CXJA 5KU1A 2SCPA 3CLNA 4YGBB 2M7NA 4HRHA 4CFRA 1FW4A 4YGAA 1SK6D 3DVMA 3FWCA 1WLZA 3EKHA 2K2FA 3KF9A 2LAPA 3PN7C 1F4QA 1AUIB 3VRNA 1F54A 4MZLA 1J1DA 1LXFC 2MHHA 1YUUA 4AQJA 1ODBA 2ZFDA 3PSRA 1YVHA 1M31A 1XFVO 4HSZA 4WQ2A 4C0JA 1M63B 1J1EA 2LANA 3LLEA 2M97A 1OMRA 3O6BA 3HCMA 3GK2A 2KYCA 1KWOC 1S1EA 5ER5A 1GQMA 3ICBA 4NDBA 4QJ5B 2L2EA 1QLKA 1SR6B 4NDDA 2H2KA 1UHKA 1UHIA 5ER4X 1QTXA 1NUBA 2JTTA 1N65A 2GGZA 3FWBA 5CPVA 2M1UA 1BLQA 1CDLA 1EG3A 5IBWA 4CPVA 2JTZA 1OZSA 3PLFB 1HT9A 2KAXA 1CDPA 1B8LA 1U5IA 2BBMA 1L7ZA 1V1GA 1YVLA 1ALVA 2LM5A 5GQQC 5HKYA 1CFFA 2L4IA 3I5FC 4N1GA 3AKAA 1KFUL 1Q80A 1SPYA 2M29A 4ORBB 5D7FA 1AP4A 2HETA 1GGWA 2R2IA 2CT9A 3LL8B 3NSKA 2KFHA 2JC2A 1DJWA 4HREE 1QX5B 3CR5X 1MWNA 2M1KB 2PSRA 1NCXA 1SR6C 1XFZO 1YX7A 4I5NB 4QJ4B 1CTRA 1RWYA 1EL4A 1YRUB 2JU0A 4I5LB 3TS5B 2JULA 3O4YA 3VGOA 4BY4A 4PE7A 3TZ1A 1AHRA 1NYAA 1KSOA 3FS7A 2LVIA 3D0YA 1BR1B 1KQMB 1MXLC 2F33A 1EJ3A 1S26D 2F2PA 2M8UA 3SIBA 4OKHA 1ZFSA 2EGDA 2GGMA 3SG2A 1TNQA 3SG3A 1SCMC 1SL8A 5AEQA 3CS1A 3OB2B 1SL9A 3EK8A 2MAZA 3KPXA 2JNFA 1CFPA 1C7WA 3BXKA 4USLA 1JWDA 1K93D 1CDMA 1R2UA 1UP5A 2MLEC 1TIZA 3TS5C 1A75B 1TTXA 2KGBC 1XFYO 1PALA 1OE9B 4MLWA 2JXCA 1CM4A 4XJKB 2ISDA 1F71A 1R6PA 1NX2A 4R1EA 3I5IB 2LHIA 2PALA 4Q04A 1CNPA 1A29A 3QRXA 1KFXL 4MBEA 2PASA 1CLMA 1OMDA 4JPZB 4MRXA 1DJGA 1TNPA 2LVVA 4UPGA 1KK8B 1MQ1A 2CBLA 1NIWA 4GBAA 4A4BA 1FI5A 1A75A 1JUOA 2JWWA 4PHKA 1SNLA 3GK4X 4CFQA 1L2OB 2JNXA 2E6WA 4XJKA 4ETOA 1NWDA 2KOTA 1LA3A 2EHBA 3EK7A 1MHOA 5J3XA 4YGDB 3NSLA 4IL1A 2LHLA 2TN4A 4YBHB 1WDCB 4M2QA 5HKWA 2JQ6A 3VRRA 1LKJA 1DTLA 1QATA 1F55A 3I5IC 2WC8A 5AXIA 1PSRA 1QX7A 1S6JA 1SBJA 2L98A 1ALWA 2Q91A 3BUOB 1N2DA 3K21A 3RLZA 5JJGA 1KK7Z 4ORAB 1KK8C 1CM1A 2IS9A 1YUSA 4PDZA 4YI9A 1CFDA 2KFGA 1L2OC 1MR8A 2BCXA 1LA0A 1K94A 3E3RA 1IQ5A 4WRIA 1A03A 3PFVA 3I5FB 3TUYB 5I2QA 1F4OA 4CLNA 2M7LA 4DS7A 1WDCC 1K2HA 5B8IB 2RGIA 2CNPA 2M9GA 4GFTA 1U5IB 2LUCA 2I2RE 3DF0B 1JF0A 1QJTA 2OS8C 3FIAA 3EVUA 3PALA 4YGCB 2BE4A 3BOWA 1G4YR 2KI6C 1G33A 1TNXA 4M2PA 5DKNA 1SMGA 1JSAA 1IRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVK A;  3SIA A;  1IG5 A;  2F8P A;  1B4C A;  2WND A;  1D1O A;  1K90 D;  2LC5 A;  1IH0 A;  2Y4Q A;  3DF0 A;  2LUX A;  2L4H A;  4MEW A;  2L5X B;  2D8N A;  2BL0 C;  1AJ5 A;  1AK8 A;  3TUY C;  2WOR A;  1SCM B;  4P2Y B;  4YI8 A;  5DKQ A;  4OR9 B;  3D0Y B;  2Y1M A;  2MJW B;  2JOJ A;  1QV0 A;  3I5H C;  3IQO A;  1M39 A;  2LMU A;  2P6B B;  2K8M B;  1YR5 A;  3BUN B;  3DVJ A;  2KQ6 A;  1TN4 A;  1K96 A;  1CLB A;  2AAO A;  3KEV A;  1H8B A;  1M45 A;  1GJY A;  2K7D A;  1REC A;  3BQ3 A;  4XYN A;  2KAV A;  1NPQ A;  1ZUZ A;  2KSP A;  2NCP A;  3A4U B;  4U8D A;  1CKK A;  3IQQ A;  1B8R A;  1BF5 A;  1S36 A;  3IF7 A;  3JTD B;  2KYF A;  5HYD A;  2MA2 A;  4GUK A;  4PHJ A;  5D69 A;  1DT7 B;  1K8U A;  2LE9 B;  5KSZ A;  2SAS A;  5K89 A;  3DVE A;  3RM1 A;  4DUQ A;  1IJ5 A;  4P5O E;  1DJI A;  2K61 A;  3C1V A;  4DIR A;  1FF1 A;  1S5G Z;  2O5G A;  1BR4 B;  1DF0 A;  1BOD A;  2KNE A;  1Y1U A;  2FOT A;  2GV5 A;  3WHT B;  1XK4 A;  2L51 A;  4GPL B;  1NX1 A;  2OTG B;  3VRQ A;  1KSM A;  2JT8 A;  2BE6 A;  1W7I B;  3EK4 A;  4GAO A;  4M2O A;  3OHM B;  3SJS A;  2M49 B;  2KBI A;  4JWQ A;  2KGR A;  4OCI A;  1UUS A;  1LIN A;  1TOP A;  2LMT A;  2EC6 C;  3SG5 A;  1XK4 C;  2JT3 A;  3LK0 A;  3DD4 A;  4JQ0 D;  1OMV A;  2LMV A;  4D1E A;  5I8N A;  1WRZ A;  1BG1 A;  1QVI Z;  3JTD C;  1JC2 A;  2K0J A;  1B7T Z;  1XYD A;  4OVN F;  3F45 A;  2ZNE A;  1FPW A;  4C0L A;  2L0P A;  2LP2 A;  2ZRS A;  1PK0 D;  1CFC A;  2BEC A;  1DJH A;  1TCF A;  1YTZ C;  1Y1A A;  1NSH A;  1XFW O;  4F0Z B;  4ZCU A;  3SG4 A;  1YUT A;  1VRK A;  1CB1 A;  2I7A A;  1S6C A;  2A4J A;  4HRG A;  2ZND A;  5CSF A;  2F3Z A;  1B1G A;  2OTG C;  1SKT A;  2BCB A;  1B47 A;  1A4P A;  1GGZ A;  1UHN A;  1HQV A;  2KI6 D;  4PAL A;  4DRW A;  1KQV A;  1MUX A;  2CTN A;  3GOF A;  2LLS A;  4PE4 A;  4MVF A;  1N0Y A;  1BJF A;  2ZN9 A;  2HQW A;  1QV1 A;  4I5K A;  1PRW A;  1XO5 A;  2HPS A;  3BUM B;  1CMG A;  2OS8 B;  1QX2 A;  4DCK A;  3NSO A;  5TNC A;  4PE0 A;  2KI4 B;  3CTN A;  2HF5 A;  3H4S E;  1EG4 A;  4PCW A;  3BYA A;  1SCV A;  1KK7 Y;  2JT0 A;  2PMY A;  5F6T A;  4AQI A;  1NCY A;  2COL B;  5DKR A;  1FI6 A;  3LK1 A;  1SL7 A;  1RRO A;  4C0K A;  5AER A;  3SG7 A;  4N5X A;  5AAN A;  1ZMZ A;  1EXR A;  2JRF A;  2NZ0 A;  1XA5 A;  3BOW B;  3WHU B;  1IWQ A;  4YGE B;  2BL0 B;  1MF8 B;  1RK9 A;  2I94 A;  2LLU A;  1Y1X A;  2FCE A;  4MSP A;  1W7J B;  3I5H B;  4FQO A;  1XFU O;  1JBA A;  1SY9 A;  1NCZ A;  2ZRT A;  2O60 A;  2F3Y A;  3I5G B;  3NXA A;  1J55 A;  1TCO B;  1IQ3 A;  1K95 A;  1DJZ A;  1M46 A;  1OQP A;  2KI4 C;  3DVK A;  1QXP A;  3EVV A;  1X02 A;  5I2O A;  1J7Q A;  3ZWH A;  1K9U A;  1UHJ A;  2H61 A;  1SYM A;  4PHM A;  5HLO A;  2V53 A;  4I5J A;  1OZO A;  1BU3 A;  2HQ8 A;  2KBM A;  1DJX A;  2LLT A;  2ZN8 A;  2B1U A;  2JZI A;  3NSI A;  2MRD A;  1A2X A;  3PAT A;  2PRU A;  4PE1 A;  5HLV A;  4PHN A;  4ZCV A;  3OX5 A;  1AJ4 A;  4NQG A;  1JFJ A;  1KFX S;  2FCD A;  2H61 C;  3VRO A;  1G8I A;  1ZOT B;  1UHH A;  2L50 A;  4A4C A;  2K7B A;  2LV7 A;  3TDU A;  1DJY A;  3I5G C;  2M3W A;  2MBX A;  3OP0 A;  2WCF A;  2K2A A;  5CSN A;  1ZAC A;  2Y5I A;  2LNK A;  2K7C A;  2Q4U A;  2BCA A;  1UUR A;  3KO0 A;  1DF0 B;  2VRG A;  4GGF A;  2M0R A;  4NDC A;  2EC6 B;  3CR4 X;  2CCM A;  2G9B A;  1PVA A;  1XFX O;  1S3P A;  1C7V A;  4TNC A;  4ICB A;  1PVB A;  2AMI A;  3CWG A;  1QS7 A;  3AAJ A;  3LCP C;  1DMO A;  3EVR A;  4GGF C;  2FJU B;  2BKH B;  3CR2 A;  1J7O A;  5CSJ A;  1S5G Y;  2JXL A;  3TDI A;  1KCY A;  1H4B A;  2LVJ A;  2MLF C;  2BBN A;  4MZJ A;  1Y6W A;  4QJ3 B;  4OV2 A;  1WRK A;  1QLS A;  4CID A;  2PVB A;  1J7P A;  1K9K A;  2Y1N A;  1YX8 A;  4WQ3 A;  3ZNI A;  2WCE A;  4GGN A;  5JOL A;  3TDZ A;  3OB1 B;  3AKB A;  2F2O A;  1SRA A;  1BT6 A;  4ORC B;  3A8R A;  3BUX B;  4AOM A;  1XVJ A;  1NX3 A;  2ZKM X;  3CZT X;  2G2B A;  3VRP A;  2WCB A;  2NCO A;  1QVI Y;  1NP8 A;  4N1F A;  1B7T Y;  1S6I A;  2LP3 A;  5AFP A;  1RFJ A;  3O78 A;  1WLM A;  2NXQ A;  1TNW A;  2OPO A;  3JVT B;  4L9M A;  3AAK A;  1IJ6 A;  5CSI A;  2KFF A;  1FBV A;  1IKU A;  1YUR A;  1NX0 A;  2QAC A;  1WRL A;  2DOQ A;  5FYX A;  1F70 A;  1BMO A;  1RTP 1;  3KHE A;  4BY5 A;  5PAL A;  1BOC A;  1E8A A;  2WOS A;  3HX4 A;  5G08 A;  2BKI B;  1PSB A;  4FTG A;  1UWO A;  1C07 A;  3EKJ A;  1B9A A;  1QIV A;  5BPJ A;  1PUL A;  1B8C A;  2KHN A;  1EH2 A;  1KQM C;  3WNX B;  2I18 A;  5I2L A;  1JF2 A;  1K9P A;  2LCP A;  3M0W A;  2JPT A;  3BUW B;  1RJV A;  2KQY A;  1F8H A;  3PN7 B;  1KFU S;  2QPT A;  3CGA A;  1J7R A;  1YRT B;  5HKZ A;  4MZK A;  3WXA A;  1WY9 A;  1AVS A;  4MN0 A;  2AUC A;  1OOJ A;  2KDH A;  1CDN A;  1V1F A;  1QIW A;  3OX6 A;  1SW8 A;  1TRF A;  2KAY A;  1CLL A;  1MXE A;  1JFK A;  2E30 A;  3JVT C;  1DGU A;  1QAS A;  1IGV A;  3D10 A;  4MRY A;  4YRU A;  3MSE B;  1CMF A;  1DGV A;  3O2P A;  1Y0V H;  1DVI A;  1OSA A;  3SG6 A;  3GK1 A;  1LVC D;  4E68 A;  1KWO B;  4GNK B;  2K7O A;  5KTY A;  3PM8 A;  2NLN A;  2CXJ A;  5KU1 A;  2SCP A;  3CLN A;  4YGB B;  2M7N A;  4HRH A;  4CFR A;  1FW4 A;  4YGA A;  1SK6 D;  3DVM A;  3FWC A;  1WLZ A;  3EKH A;  2K2F A;  3KF9 A;  2LAP A;  3PN7 C;  1F4Q A;  1AUI B;  3VRN A;  1F54 A;  4MZL A;  1J1D A;  1LXF C;  2MHH A;  1YUU A;  4AQJ A;  1ODB A;  2ZFD A;  3PSR A;  1YVH A;  1M31 A;  1XFV O;  4HSZ A;  4WQ2 A;  4C0J A;  1M63 B;  1J1E A;  2LAN A;  3LLE A;  2M97 A;  1OMR A;  3O6B A;  3HCM A;  3GK2 A;  2KYC A;  1KWO C;  1S1E A;  5ER5 A;  1GQM A;  3ICB A;  4NDB A;  4QJ5 B;  2L2E A;  1QLK A;  1SR6 B;  4NDD A;  2H2K A;  1UHK A;  1UHI A;  5ER4 X;  1QTX A;  1NUB A;  2JTT A;  1N65 A;  2GGZ A;  3FWB A;  5CPV A;  2M1U A;  1BLQ A;  1CDL A;  1EG3 A;  5IBW A;  4CPV A;  2JTZ A;  1OZS A;  3PLF B;  1HT9 A;  2KAX A;  1CDP A;  1B8L A;  1U5I A;  2BBM A;  1L7Z A;  1V1G A;  1YVL A;  1ALV A;  2LM5 A;  5GQQ C;  5HKY A;  1CFF A;  2L4I A;  3I5F C;  4N1G A;  3AKA A;  1KFU L;  1Q80 A;  1SPY A;  2M29 A;  4ORB B;  5D7F A;  1AP4 A;  2HET A;  1GGW A;  2R2I A;  2CT9 A;  3LL8 B;  3NSK A;  2KFH A;  2JC2 A;  1DJW A;  4HRE E;  1QX5 B;  3CR5 X;  1MWN A;  2M1K B;  2PSR A;  1NCX A;  1SR6 C;  1XFZ O;  1YX7 A;  4I5N B;  4QJ4 B;  1CTR A;  1RWY A;  1EL4 A;  1YRU B;  2JU0 A;  4I5L B;  3TS5 B;  2JUL A;  3O4Y A;  3VGO A;  4BY4 A;  4PE7 A;  3TZ1 A;  1AHR A;  1NYA A;  1KSO A;  3FS7 A;  2LVI A;  3D0Y A;  1BR1 B;  1KQM B;  1MXL C;  2F33 A;  1EJ3 A;  1S26 D;  2F2P A;  2M8U A;  3SIB A;  4OKH A;  1ZFS A;  2EGD A;  2GGM A;  3SG2 A;  1TNQ A;  3SG3 A;  1SCM C;  1SL8 A;  5AEQ A;  3CS1 A;  3OB2 B;  1SL9 A;  3EK8 A;  2MAZ A;  3KPX A;  2JNF A;  1CFP A;  1C7W A;  3BXK A;  4USL A;  1JWD A;  1K93 D;  1CDM A;  1R2U A;  1UP5 A;  2MLE C;  1TIZ A;  3TS5 C;  1A75 B;  1TTX A;  2KGB C;  1XFY O;  1PAL A;  1OE9 B;  4MLW A;  2JXC A;  1CM4 A;  4XJK B;  2ISD A;  1F71 A;  1R6P A;  1NX2 A;  4R1E A;  3I5I B;  2LHI A;  2PAL A;  4Q04 A;  1CNP A;  1A29 A;  3QRX A;  1KFX L;  4MBE A;  2PAS A;  1CLM A;  1OMD A;  4JPZ B;  4MRX A;  1DJG A;  1TNP A;  2LVV A;  4UPG A;  1KK8 B;  1MQ1 A;  2CBL A;  1NIW A;  4GBA A;  4A4B A;  1FI5 A;  1A75 A;  1JUO A;  2JWW A;  4PHK A;  1SNL A;  3GK4 X;  4CFQ A;  1L2O B;  2JNX A;  2E6W A;  4XJK A;  4ETO A;  1NWD A;  2KOT A;  1LA3 A;  2EHB A;  3EK7 A;  1MHO A;  5J3X A;  4YGD B;  3NSL A;  4IL1 A;  2LHL A;  2TN4 A;  4YBH B;  1WDC B;  4M2Q A;  5HKW A;  2JQ6 A;  3VRR A;  1LKJ A;  1DTL A;  1QAT A;  1F55 A;  3I5I C;  2WC8 A;  5AXI A;  1PSR A;  1QX7 A;  1S6J A;  1SBJ A;  2L98 A;  1ALW A;  2Q91 A;  3BUO B;  1N2D A;  3K21 A;  3RLZ A;  5JJG A;  1KK7 Z;  4ORA B;  1KK8 C;  1CM1 A;  2IS9 A;  1YUS A;  4PDZ A;  4YI9 A;  1CFD A;  2KFG A;  1L2O C;  1MR8 A;  2BCX A;  1LA0 A;  1K94 A;  3E3R A;  1IQ5 A;  4WRI A;  1A03 A;  3PFV A;  3I5F B;  3TUY B;  5I2Q A;  1F4O A;  4CLN A;  2M7L A;  4DS7 A;  1WDC C;  1K2H A;  5B8I B;  2RGI A;  2CNP A;  2M9G A;  4GFT A;  1U5I B;  2LUC A;  2I2R E;  3DF0 B;  1JF0 A;  1QJT A;  2OS8 C;  3FIA A;  3EVU A;  3PAL A;  4YGC B;  2BE4 A;  3BOW A;  1G4Y R;  2KI6 C;  1G33 A;  1TNX A;  4M2P A;  5DKN A;  1SMG A;  1JSA A;  1IRJ A; 
#chains in the Genus database with same CATH topology
 2LVK A;  3SIA A;  1IG5 A;  4INX A;  1OW4 A;  2F8P A;  1B4C A;  2WND A;  1D1O A;  1K90 D;  2LC5 A;  1IH0 A;  2Y4Q A;  3NHT A;  3DF0 A;  2LUX A;  2L4H A;  3DYE A;  2L5X B;  4MEW A;  2D8N A;  2BL0 C;  2P71 A;  1AJ5 A;  3SS4 A;  1AK8 A;  3TUY C;  2WOR A;  1SCM B;  4P2Y B;  4YI8 A;  5DKQ A;  4OR9 B;  3D0Y B;  2Y1M A;  2MJW B;  2JOJ A;  1QV0 A;  3I5H C;  3IQO A;  1M39 A;  2LMU A;  2P6B B;  2WCM A;  2K8M B;  1YR5 A;  3BUN B;  3DVJ A;  2KQ6 A;  1TN4 A;  1K96 A;  1CLB A;  2AAO A;  3KEV A;  1H8B A;  1M45 A;  1GJY A;  2K7D A;  1REC A;  2YGU A;  3BQ3 A;  4JD9 A;  2KAV A;  1NPQ A;  1ZUZ A;  2KSP A;  2NCP A;  4XYN A;  3A4U B;  4U8D A;  1C3Z A;  1CKK A;  3IQQ A;  1B8R A;  1BF5 A;  1S36 A;  3IF7 A;  3JTD B;  2KYF A;  5HYD A;  2MA2 A;  4GUK A;  4PHJ A;  5D69 A;  1DT7 B;  1K8U A;  1C3Y A;  2LE9 B;  5KSZ A;  2SAS A;  5K89 A;  3K1E A;  3DVE A;  3RM1 A;  4DUQ A;  1IJ5 A;  4P5O E;  1DJI A;  2K61 A;  3C1V A;  4DIR A;  1FF1 A;  1S5G Z;  2O5G A;  1BR4 B;  1DF0 A;  1BOD A;  2KNE A;  1Y1U A;  2FOT A;  2GV5 A;  3WHT B;  1XK4 A;  5D3O A;  2L51 A;  4GPL B;  1NX1 A;  2OTG B;  3VRQ A;  1KSM A;  2JT8 A;  2BE6 A;  1GM0 A;  1W7I B;  3EK4 A;  4GAO A;  4M2O A;  3OHM B;  3S0D A;  3SJS A;  2M49 B;  2KBI A;  4JWQ A;  2KGR A;  4OCI A;  1UUS A;  1LIN A;  1TOP A;  2LMT A;  3DY9 A;  2EC6 C;  3SG5 A;  1XK4 C;  2JT3 A;  3LK0 A;  3DD4 A;  4JQ0 D;  1OMV A;  2LMV A;  4D1E A;  5I8N A;  1WRZ A;  1BG1 A;  1QVI Z;  3JTD C;  1JC2 A;  2K0J A;  1B7T Z;  1XYD A;  4OVN F;  3F45 A;  2ZNE A;  1FPW A;  4C0L A;  2L0P A;  2LP2 A;  2ZRS A;  3CYZ A;  1PK0 D;  1CFC A;  1TCF A;  1DJH A;  2BEC A;  1YTZ C;  1Y1A A;  1NSH A;  1XFW O;  2WCJ A;  4F0Z B;  4ZCU A;  3SG4 A;  1YUT A;  1VRK A;  3CZ0 A;  1CB1 A;  2I7A A;  1S6C A;  2A4J A;  4HRG A;  2ZND A;  5CSF A;  2F3Z A;  1B1G A;  2OTG C;  1SKT A;  2BCB A;  1UHN A;  1B47 A;  1A4P A;  1GGZ A;  1HQV A;  2KI6 D;  3FE9 A;  4PAL A;  3SS3 A;  1MUX A;  1KQV A;  1P28 A;  2CTN A;  3GOF A;  2LLS A;  3BFH A;  4MVF A;  4PE4 A;  1N0Y A;  1BJF A;  2L5Y A;  2ZN9 A;  2HQW A;  3B86 A;  1QV1 A;  4I5K A;  1PRW A;  1XO5 A;  2HPS A;  3BUM B;  1CMG A;  2OS8 B;  1QX2 A;  4DCK A;  3NSO A;  1TUJ A;  5TNC A;  4PE0 A;  2KI4 B;  3CTN A;  2HF5 A;  3H4S E;  1EG4 A;  4PCW A;  3BYA A;  1SCV A;  1KK7 Y;  2JT0 A;  2PMY A;  5F6T A;  4AQI A;  1NCY A;  2COL B;  5DKR A;  1FI6 A;  1ORG A;  3LK1 A;  1SL7 A;  1RRO A;  3DZT A;  3PM2 A;  4C0K A;  5AER A;  4PT1 A;  5DIC A;  3SG7 A;  4N5X A;  5AAN A;  1ZMZ A;  1EXR A;  2JRF A;  2NZ0 A;  1XA5 A;  3BOW B;  3WHU B;  1IWQ A;  4YGE B;  2BL0 B;  1MF8 B;  1RK9 A;  2I94 A;  2LLU A;  1Y1X A;  2FCE A;  4MSP A;  2L2C A;  1W7J B;  5I94 A;  3FE6 A;  3I5H B;  4FQO A;  1XFU O;  1JBA A;  1SY9 A;  3EG5 B;  3Q8I A;  3D76 A;  1NCZ A;  2ZRT A;  2O60 A;  1TUZ A;  2F3Y A;  3I5G B;  3NXA A;  1J55 A;  2JPO A;  1TCO B;  1IQ3 A;  1K95 A;  1DJZ A;  1M46 A;  1OQP A;  2KI4 C;  4JKT A;  3DVK A;  1QXP A;  2PYQ A;  3EVV A;  1X02 A;  5I2O A;  1J7Q A;  3ZWH A;  1K9U A;  1UHJ A;  2H61 A;  1SYM A;  4PHM A;  5HLO A;  2V53 A;  4I5J A;  1OZO A;  1BU3 A;  2HQ8 A;  2KBM A;  1DJX A;  2LLT A;  2ZN8 A;  2B1U A;  2JZI A;  2BAP A;  3D78 A;  3NSI A;  2MRD A;  1A2X A;  3PAT A;  2PRU A;  4PE1 A;  5HLV A;  4PHN A;  4ZCV A;  3OX5 A;  1AJ4 A;  4NQG A;  1JFJ A;  1KFX S;  2FCD A;  2H61 C;  3VRO A;  3D77 A;  1G8I A;  1ZOT B;  1UHH A;  2L50 A;  4A4C A;  2K7B A;  2LV7 A;  2QEO A;  4KYN A;  3TDU A;  3BJH A;  1DJY A;  3S0E A;  5EL2 A;  3I5G C;  2M3W A;  2MBX A;  3OP0 A;  2WCF A;  2K60 A;  4DRW A;  2K2A A;  5CSN A;  1ZAC A;  2Y5I A;  2LNK A;  2K7C A;  3R1O A;  2Q4U A;  2BCA A;  1UUR A;  3KO0 A;  1DF0 B;  2VRG A;  4GGF A;  2M0R A;  4NDC A;  2EC6 B;  3CR4 X;  2CCM A;  2G9B A;  1PVA A;  1XFX O;  1S3P A;  1C7V A;  4OZD A;  2GTE A;  2ERB A;  2FJY A;  4ICB A;  1PVB A;  4TNC A;  3VB1 A;  3BFB A;  2AMI A;  3CWG A;  1QS7 A;  3AAJ A;  3LCP C;  1DMO A;  1IIO A;  3EVR A;  4GGF C;  2FJU B;  3B7A A;  2BKH B;  3R72 A;  3CR2 A;  1J7O A;  5CSJ A;  1S5G Y;  2JXL A;  3TDI A;  1KCY A;  1H4B A;  2LVJ A;  2MLF C;  2BBN A;  4MZJ A;  1Y6W A;  4QJ3 B;  4OV2 A;  1WRK A;  1QLS A;  4CID A;  2PVB A;  1J7P A;  2WC5 A;  1K9K A;  2Y1N A;  1YX8 A;  4WQ3 A;  3IVT A;  3ZNI A;  2WCE A;  4GGN A;  5JOL A;  3TDZ A;  3OB1 B;  3AKB A;  2F2O A;  1SRA A;  1BT6 A;  4ORC B;  2PQL A;  3A8R A;  3BUX B;  4AOM A;  1XVJ A;  1NX3 A;  2ZKM X;  3OGN A;  3CZT X;  2G2B A;  3VRP A;  2WCB A;  2NCO A;  1QVI Y;  1NP8 A;  4N1F A;  1B7T Y;  5FI2 A;  1S6I A;  2LP3 A;  5AFP A;  3L47 A;  1RFJ A;  3O78 A;  1WLM A;  3CDN A;  2NXQ A;  1TNW A;  2OPO A;  3JVT B;  4L9M A;  3AAK A;  1IJ6 A;  5CSI A;  2KFF A;  1FBV A;  1IKU A;  1YUR A;  1NX0 A;  2QAC A;  1WRL A;  2DOQ A;  5FYX A;  1F70 A;  1BMO A;  1RTP 1;  2BNX A;  3KHE A;  3L4A A;  5PAL A;  4BY5 A;  1BOC A;  1E8A A;  2WOS A;  3HX4 A;  5G08 A;  2BKI B;  1PSB A;  4FTG A;  1UWO A;  1C07 A;  3EKJ A;  1B9A A;  1QIV A;  5BPJ A;  1PUL A;  1B8C A;  2KHN A;  3NGV A;  1KQM C;  3WNX B;  1EH2 A;  2I18 A;  5FI6 A;  5I2L A;  1JF2 A;  1K9P A;  2LCP A;  1DEK A;  2JPT A;  3M0W A;  1OOH A;  1OOF A;  1RJV A;  2KQY A;  2QEB A;  3BUW B;  1F8H A;  2KLD A;  3PN7 B;  1KFU S;  2QPT A;  3CGA A;  1J7R A;  1YRT B;  3S0F A;  5HKZ A;  4MZK A;  3WXA A;  1WY9 A;  3S0A A;  2WCL A;  1AVS A;  4MN0 A;  2AUC A;  1OOJ A;  1QWV A;  2KDH A;  3D75 A;  1V1F A;  1QIW A;  1CDN A;  3OX6 A;  1SW8 A;  1TRF A;  2KAY A;  1CLL A;  1MXE A;  1JFK A;  2E30 A;  3JVT C;  1DGU A;  2H8V A;  1QAS A;  1IGV A;  3D10 A;  4MRY A;  4YRU A;  3MSE B;  1CMF A;  1DGV A;  3O2P A;  1Y0V H;  1DQE A;  1DVI A;  1OSA A;  3SG6 A;  3GK1 A;  3S0G A;  1LVC D;  4E68 A;  1KWO B;  4GNK B;  2K7O A;  5KTY A;  3PM8 A;  2NLN A;  2CXJ A;  1DEL A;  5KU1 A;  2SCP A;  3CLN A;  4YGB B;  2M7N A;  4HRH A;  4CFR A;  1FW4 A;  4YGA A;  1SK6 D;  3DVM A;  3FWC A;  3RZS A;  1WLZ A;  3EKH A;  2K2F A;  3KF9 A;  2LAP A;  3NHI A;  3R1P A;  3PN7 C;  1F4Q A;  1AUI B;  2KLE A;  3VRN A;  1F54 A;  3SS5 A;  4MZL A;  1J1D A;  1LXF C;  1XFR A;  2MHH A;  1YUU A;  4AQJ A;  1ODB A;  3S0B A;  2ZFD A;  3CZ2 A;  3PSR A;  1OOI X;  3V2L A;  2WCH A;  2WCK A;  1YVH A;  1M31 A;  1XFV O;  4HSZ A;  4WQ2 A;  4C0J A;  1M63 B;  1J1E A;  2LAN A;  3LLE A;  2M97 A;  1OMR A;  3O6B A;  2QEH A;  3GK2 A;  3HCM A;  3O4X A;  2KYC A;  1KWO C;  1S1E A;  5ER5 A;  1GQM A;  3ICB A;  4NDB A;  4QJ5 B;  2L2E A;  4F7F A;  1QLK A;  1SR6 B;  4NDD A;  2H2K A;  1UHK A;  1UHI A;  5ER4 X;  1QTX A;  1NUB A;  2JTT A;  1N65 A;  2GGZ A;  3UNW A;  3FWB A;  2KPH A;  5CPV A;  2M1U A;  1BLQ A;  1CDL A;  1EG3 A;  5IBW A;  4CPV A;  1OOG A;  2JTZ A;  1OZS A;  2P70 A;  3PLF B;  1HT9 A;  2KAX A;  1CDP A;  1B8L A;  1U5I A;  1L7Z A;  1V1G A;  2BBM A;  1YVL A;  1T14 A;  1ALV A;  2LM5 A;  5GQQ C;  3B6X A;  5HKY A;  1CFF A;  2L4I A;  1W9Z A;  3I5F C;  4N1G A;  3AKA A;  1KFU L;  1Q80 A;  1SPY A;  2M29 A;  4ORB B;  5D7F A;  1AP4 A;  2HET A;  2QEV A;  1GGW A;  2R2I A;  1SSE B;  2CT9 A;  3LL8 B;  3NSK A;  2KFH A;  2JC2 A;  1DJW A;  4HRE E;  1QX5 B;  3CR5 X;  1MWN A;  3UO9 A;  2M1K B;  2PSR A;  1NCX A;  1SR6 C;  1XFZ O;  1YX7 A;  4I5N B;  4QJ4 B;  1CTR A;  1RWY A;  1YRU B;  1EL4 A;  2JU0 A;  4I5L B;  3TS5 B;  2JUL A;  3O4Y A;  3VGO A;  4BY4 A;  4PE7 A;  3TZ1 A;  1AHR A;  1NYA A;  1KSO A;  3FS7 A;  2LVI A;  3D0Y A;  1BR1 B;  1KQM B;  1MXL C;  2F33 A;  1EJ3 A;  1S26 D;  2F2P A;  2M8U A;  3SIB A;  3DXL A;  4OKH A;  1ZFS A;  2EGD A;  2GGM A;  1LS8 A;  3SG2 A;  1TNQ A;  3SG3 A;  3D73 A;  1SCM C;  3B87 A;  1SL8 A;  5FI7 A;  5AEQ A;  3CS1 A;  3OB2 B;  1SL9 A;  3EK8 A;  2MAZ A;  3KPX A;  2JNF A;  1CFP A;  3CZ1 A;  1C7W A;  3BXK A;  4USL A;  1JWD A;  1K93 D;  1CDM A;  1R2U A;  1UP5 A;  2MLE C;  5HL1 A;  3QME A;  1TIZ A;  3PJI A;  1A75 B;  3TS5 C;  1TTX A;  4FQT A;  2KGB C;  1XFY O;  1PAL A;  1OE9 B;  4MLW A;  2JXC A;  1CM4 A;  3OBV A;  4XJK B;  2ISD A;  1F71 A;  1R6P A;  1NX2 A;  4R1E A;  3I5I B;  3N7H A;  1DC1 A;  2LHI A;  2PAL A;  4Q04 A;  1CNP A;  1A29 A;  3QRX A;  1KFX L;  4MBE A;  3B88 A;  2PAS A;  1CLM A;  1Z4H A;  1OMD A;  3BFA A;  4JPZ B;  4MRX A;  1DJG A;  1TNP A;  2LVV A;  4UPG A;  1KK8 B;  1MQ1 A;  2CBL A;  1NIW A;  4GBA A;  4A4B A;  1FI5 A;  1A75 A;  1JUO A;  2JWW A;  4PHK A;  1SNL A;  3GK4 X;  4CFQ A;  1L2O B;  2JNX A;  2E6W A;  4XJK A;  2WC6 A;  4ETO A;  1NWD A;  2KOT A;  1LA3 A;  2EHB A;  3EK7 A;  1MHO A;  5J3X A;  4YGD B;  3NSL A;  4IL1 A;  2LHL A;  2QDI A;  2TN4 A;  4YBH B;  1WDC B;  4M2Q A;  5HKW A;  2JQ6 A;  3VRR A;  1LKJ A;  1DTL A;  1QAT A;  1F55 A;  3I5I C;  2WC8 A;  5AXI A;  1PSR A;  1QX7 A;  1S6J A;  1SBJ A;  2L98 A;  1ALW A;  2Q91 A;  3BUO B;  1N2D A;  3FE8 A;  3K21 A;  3RLZ A;  5JJG A;  1KK7 Z;  3D74 A;  4ORA B;  1KK8 C;  1CM1 A;  2IS9 A;  1YUS A;  4PDZ A;  4YI9 A;  1CFD A;  2KFG A;  1L2O C;  1MR8 A;  2BCX A;  1LA0 A;  1K94 A;  3E3R A;  3CAB A;  1IQ5 A;  4WRI A;  1A03 A;  3PFV A;  3I5F B;  3TUY B;  5I2Q A;  3L4L A;  3R1V A;  1F4O A;  4CLN A;  2M7L A;  4IJ7 A;  4DS7 A;  1WDC C;  1K2H A;  5B8I B;  2RGI A;  2CNP A;  2M9G A;  4GFT A;  1U5I B;  2LUC A;  2I2R E;  3DF0 B;  1JF0 A;  1TWO A;  1QJT A;  2OS8 C;  3FIA A;  1Z2C B;  3EVU A;  3PAL A;  4YGC B;  2BE4 A;  3BOW A;  1G4Y R;  2KI6 C;  1G33 A;  1TNX A;  4M2P A;  5DKN A;  1SMG A;  4INW A;  1JSA A;  1IRJ A; 
#chains in the Genus database with same CATH homology
 2LVK A;  3SIA A;  1IG5 A;  2F8P A;  1B4C A;  2WND A;  1D1O A;  1K90 D;  2LC5 A;  1IH0 A;  2Y4Q A;  3DF0 A;  2LUX A;  2L4H A;  4MEW A;  2L5X B;  2D8N A;  2BL0 C;  1AJ5 A;  1AK8 A;  3TUY C;  2WOR A;  1SCM B;  4P2Y B;  4YI8 A;  5DKQ A;  4OR9 B;  3D0Y B;  2Y1M A;  2MJW B;  2JOJ A;  1QV0 A;  3I5H C;  3IQO A;  1M39 A;  2LMU A;  2P6B B;  2K8M B;  1YR5 A;  3BUN B;  3DVJ A;  2KQ6 A;  1TN4 A;  1K96 A;  1CLB A;  2AAO A;  3KEV A;  1H8B A;  1M45 A;  1GJY A;  2K7D A;  1REC A;  3BQ3 A;  4XYN A;  2KAV A;  1NPQ A;  1ZUZ A;  2KSP A;  2NCP A;  3A4U B;  4U8D A;  1CKK A;  3IQQ A;  1B8R A;  1BF5 A;  1S36 A;  3IF7 A;  3JTD B;  2KYF A;  5HYD A;  2MA2 A;  4GUK A;  4PHJ A;  5D69 A;  1DT7 B;  1K8U A;  2LE9 B;  5KSZ A;  2SAS A;  5K89 A;  3DVE A;  3RM1 A;  4DUQ A;  1IJ5 A;  4P5O E;  1DJI A;  2K61 A;  3C1V A;  4DIR A;  1FF1 A;  1S5G Z;  2O5G A;  1BR4 B;  1DF0 A;  1BOD A;  2KNE A;  1Y1U A;  2FOT A;  2GV5 A;  3WHT B;  1XK4 A;  2L51 A;  4GPL B;  1NX1 A;  2OTG B;  3VRQ A;  1KSM A;  2JT8 A;  2BE6 A;  1W7I B;  3EK4 A;  4GAO A;  4M2O A;  3OHM B;  3SJS A;  2M49 B;  2KBI A;  4JWQ A;  2KGR A;  4OCI A;  1UUS A;  1LIN A;  1TOP A;  2LMT A;  2EC6 C;  3SG5 A;  1XK4 C;  2JT3 A;  3LK0 A;  3DD4 A;  4JQ0 D;  1OMV A;  2LMV A;  4D1E A;  5I8N A;  1WRZ A;  1BG1 A;  1QVI Z;  3JTD C;  1JC2 A;  2K0J A;  1B7T Z;  1XYD A;  4OVN F;  3F45 A;  2ZNE A;  1FPW A;  4C0L A;  2L0P A;  2LP2 A;  2ZRS A;  1PK0 D;  1CFC A;  2BEC A;  1DJH A;  1TCF A;  1YTZ C;  1Y1A A;  1NSH A;  1XFW O;  4F0Z B;  4ZCU A;  3SG4 A;  1YUT A;  1VRK A;  1CB1 A;  2I7A A;  1S6C A;  2A4J A;  4HRG A;  2ZND A;  5CSF A;  2F3Z A;  1B1G A;  2OTG C;  1SKT A;  2BCB A;  1B47 A;  1A4P A;  1GGZ A;  1UHN A;  1HQV A;  2KI6 D;  4PAL A;  4DRW A;  1KQV A;  1MUX A;  2CTN A;  3GOF A;  2LLS A;  4PE4 A;  4MVF A;  1N0Y A;  1BJF A;  2ZN9 A;  2HQW A;  1QV1 A;  4I5K A;  1PRW A;  1XO5 A;  2HPS A;  3BUM B;  1CMG A;  2OS8 B;  1QX2 A;  4DCK A;  3NSO A;  5TNC A;  4PE0 A;  2KI4 B;  3CTN A;  2HF5 A;  3H4S E;  1EG4 A;  4PCW A;  3BYA A;  1SCV A;  1KK7 Y;  2JT0 A;  2PMY A;  5F6T A;  4AQI A;  1NCY A;  2COL B;  5DKR A;  1FI6 A;  3LK1 A;  1SL7 A;  1RRO A;  4C0K A;  5AER A;  3SG7 A;  4N5X A;  5AAN A;  1ZMZ A;  1EXR A;  2JRF A;  2NZ0 A;  1XA5 A;  3BOW B;  3WHU B;  1IWQ A;  4YGE B;  2BL0 B;  1MF8 B;  1RK9 A;  2I94 A;  2LLU A;  1Y1X A;  2FCE A;  4MSP A;  1W7J B;  3I5H B;  4FQO A;  1XFU O;  1JBA A;  1SY9 A;  1NCZ A;  2ZRT A;  2O60 A;  2F3Y A;  3I5G B;  3NXA A;  1J55 A;  1TCO B;  1IQ3 A;  1K95 A;  1DJZ A;  1M46 A;  1OQP A;  2KI4 C;  3DVK A;  1QXP A;  3EVV A;  1X02 A;  5I2O A;  1J7Q A;  3ZWH A;  1K9U A;  1UHJ A;  2H61 A;  1SYM A;  4PHM A;  5HLO A;  2V53 A;  4I5J A;  1OZO A;  1BU3 A;  2HQ8 A;  2KBM A;  1DJX A;  2LLT A;  2ZN8 A;  2B1U A;  2JZI A;  3NSI A;  2MRD A;  1A2X A;  3PAT A;  2PRU A;  4PE1 A;  5HLV A;  4PHN A;  4ZCV A;  3OX5 A;  1AJ4 A;  4NQG A;  1JFJ A;  1KFX S;  2FCD A;  2H61 C;  3VRO A;  1G8I A;  1ZOT B;  1UHH A;  2L50 A;  4A4C A;  2K7B A;  2LV7 A;  3TDU A;  1DJY A;  3I5G C;  2M3W A;  2MBX A;  3OP0 A;  2WCF A;  2K2A A;  5CSN A;  1ZAC A;  2Y5I A;  2LNK A;  2K7C A;  2Q4U A;  2BCA A;  1UUR A;  3KO0 A;  1DF0 B;  2VRG A;  4GGF A;  2M0R A;  4NDC A;  2EC6 B;  3CR4 X;  2CCM A;  2G9B A;  1PVA A;  1XFX O;  1S3P A;  1C7V A;  4TNC A;  4ICB A;  1PVB A;  2AMI A;  3CWG A;  1QS7 A;  3AAJ A;  3LCP C;  1DMO A;  3EVR A;  4GGF C;  2FJU B;  2BKH B;  3CR2 A;  1J7O A;  5CSJ A;  1S5G Y;  2JXL A;  3TDI A;  1KCY A;  1H4B A;  2LVJ A;  2MLF C;  2BBN A;  4MZJ A;  1Y6W A;  4QJ3 B;  4OV2 A;  1WRK A;  1QLS A;  4CID A;  2PVB A;  1J7P A;  1K9K A;  2Y1N A;  1YX8 A;  4WQ3 A;  3ZNI A;  2WCE A;  4GGN A;  5JOL A;  3TDZ A;  3OB1 B;  3AKB A;  2F2O A;  1SRA A;  1BT6 A;  4ORC B;  3A8R A;  3BUX B;  4AOM A;  1XVJ A;  1NX3 A;  2ZKM X;  3CZT X;  2G2B A;  3VRP A;  2WCB A;  2NCO A;  1QVI Y;  1NP8 A;  4N1F A;  1B7T Y;  1S6I A;  2LP3 A;  5AFP A;  1RFJ A;  3O78 A;  1WLM A;  2NXQ A;  1TNW A;  2OPO A;  3JVT B;  4L9M A;  3AAK A;  1IJ6 A;  5CSI A;  2KFF A;  1FBV A;  1IKU A;  1YUR A;  1NX0 A;  2QAC A;  1WRL A;  2DOQ A;  5FYX A;  1F70 A;  1BMO A;  1RTP 1;  3KHE A;  4BY5 A;  5PAL A;  1BOC A;  1E8A A;  2WOS A;  3HX4 A;  5G08 A;  2BKI B;  1PSB A;  4FTG A;  1UWO A;  1C07 A;  3EKJ A;  1B9A A;  1QIV A;  5BPJ A;  1PUL A;  1B8C A;  2KHN A;  1EH2 A;  1KQM C;  3WNX B;  2I18 A;  5I2L A;  1JF2 A;  1K9P A;  2LCP A;  3M0W A;  2JPT A;  3BUW B;  1RJV A;  2KQY A;  1F8H A;  3PN7 B;  1KFU S;  2QPT A;  3CGA A;  1J7R A;  1YRT B;  5HKZ A;  4MZK A;  3WXA A;  1WY9 A;  1AVS A;  4MN0 A;  2AUC A;  1OOJ A;  2KDH A;  1CDN A;  1V1F A;  1QIW A;  3OX6 A;  1SW8 A;  1TRF A;  2KAY A;  1CLL A;  1MXE A;  1JFK A;  2E30 A;  3JVT C;  1DGU A;  1QAS A;  1IGV A;  3D10 A;  4MRY A;  4YRU A;  3MSE B;  1CMF A;  1DGV A;  3O2P A;  1Y0V H;  1DVI A;  1OSA A;  3SG6 A;  3GK1 A;  1LVC D;  4E68 A;  1KWO B;  4GNK B;  2K7O A;  5KTY A;  3PM8 A;  2NLN A;  2CXJ A;  5KU1 A;  2SCP A;  3CLN A;  4YGB B;  2M7N A;  4HRH A;  4CFR A;  1FW4 A;  4YGA A;  1SK6 D;  3DVM A;  3FWC A;  1WLZ A;  3EKH A;  2K2F A;  3KF9 A;  2LAP A;  3PN7 C;  1F4Q A;  1AUI B;  3VRN A;  1F54 A;  4MZL A;  1J1D A;  1LXF C;  2MHH A;  1YUU A;  4AQJ A;  1ODB A;  2ZFD A;  3PSR A;  1YVH A;  1M31 A;  1XFV O;  4HSZ A;  4WQ2 A;  4C0J A;  1M63 B;  1J1E A;  2LAN A;  3LLE A;  2M97 A;  1OMR A;  3O6B A;  3HCM A;  3GK2 A;  2KYC A;  1KWO C;  1S1E A;  5ER5 A;  1GQM A;  3ICB A;  4NDB A;  4QJ5 B;  2L2E A;  1QLK A;  1SR6 B;  4NDD A;  2H2K A;  1UHK A;  1UHI A;  5ER4 X;  1QTX A;  1NUB A;  2JTT A;  1N65 A;  2GGZ A;  3FWB A;  5CPV A;  2M1U A;  1BLQ A;  1CDL A;  1EG3 A;  5IBW A;  4CPV A;  2JTZ A;  1OZS A;  3PLF B;  1HT9 A;  2KAX A;  1CDP A;  1B8L A;  1U5I A;  2BBM A;  1L7Z A;  1V1G A;  1YVL A;  1ALV A;  2LM5 A;  5GQQ C;  5HKY A;  1CFF A;  2L4I A;  3I5F C;  4N1G A;  3AKA A;  1KFU L;  1Q80 A;  1SPY A;  2M29 A;  4ORB B;  5D7F A;  1AP4 A;  2HET A;  1GGW A;  2R2I A;  2CT9 A;  3LL8 B;  3NSK A;  2KFH A;  2JC2 A;  1DJW A;  4HRE E;  1QX5 B;  3CR5 X;  1MWN A;  2M1K B;  2PSR A;  1NCX A;  1SR6 C;  1XFZ O;  1YX7 A;  4I5N B;  4QJ4 B;  1CTR A;  1RWY A;  1EL4 A;  1YRU B;  2JU0 A;  4I5L B;  3TS5 B;  2JUL A;  3O4Y A;  3VGO A;  4BY4 A;  4PE7 A;  3TZ1 A;  1AHR A;  1NYA A;  1KSO A;  3FS7 A;  2LVI A;  3D0Y A;  1BR1 B;  1KQM B;  1MXL C;  2F33 A;  1EJ3 A;  1S26 D;  2F2P A;  2M8U A;  3SIB A;  4OKH A;  1ZFS A;  2EGD A;  2GGM A;  3SG2 A;  1TNQ A;  3SG3 A;  1SCM C;  1SL8 A;  5AEQ A;  3CS1 A;  3OB2 B;  1SL9 A;  3EK8 A;  2MAZ A;  3KPX A;  2JNF A;  1CFP A;  1C7W A;  3BXK A;  4USL A;  1JWD A;  1K93 D;  1CDM A;  1R2U A;  1UP5 A;  2MLE C;  1TIZ A;  3TS5 C;  1A75 B;  1TTX A;  2KGB C;  1XFY O;  1PAL A;  1OE9 B;  4MLW A;  2JXC A;  1CM4 A;  4XJK B;  2ISD A;  1F71 A;  1R6P A;  1NX2 A;  4R1E A;  3I5I B;  2LHI A;  2PAL A;  4Q04 A;  1CNP A;  1A29 A;  3QRX A;  1KFX L;  4MBE A;  2PAS A;  1CLM A;  1OMD A;  4JPZ B;  4MRX A;  1DJG A;  1TNP A;  2LVV A;  4UPG A;  1KK8 B;  1MQ1 A;  2CBL A;  1NIW A;  4GBA A;  4A4B A;  1FI5 A;  1A75 A;  1JUO A;  2JWW A;  4PHK A;  1SNL A;  3GK4 X;  4CFQ A;  1L2O B;  2JNX A;  2E6W A;  4XJK A;  4ETO A;  1NWD A;  2KOT A;  1LA3 A;  2EHB A;  3EK7 A;  1MHO A;  5J3X A;  4YGD B;  3NSL A;  4IL1 A;  2LHL A;  2TN4 A;  4YBH B;  1WDC B;  4M2Q A;  5HKW A;  2JQ6 A;  3VRR A;  1LKJ A;  1DTL A;  1QAT A;  1F55 A;  3I5I C;  2WC8 A;  5AXI A;  1PSR A;  1QX7 A;  1S6J A;  1SBJ A;  2L98 A;  1ALW A;  2Q91 A;  3BUO B;  1N2D A;  3K21 A;  3RLZ A;  5JJG A;  1KK7 Z;  4ORA B;  1KK8 C;  1CM1 A;  2IS9 A;  1YUS A;  4PDZ A;  4YI9 A;  1CFD A;  2KFG A;  1L2O C;  1MR8 A;  2BCX A;  1LA0 A;  1K94 A;  3E3R A;  1IQ5 A;  4WRI A;  1A03 A;  3PFV A;  3I5F B;  3TUY B;  5I2Q A;  1F4O A;  4CLN A;  2M7L A;  4DS7 A;  1WDC C;  1K2H A;  5B8I B;  2RGI A;  2CNP A;  2M9G A;  4GFT A;  1U5I B;  2LUC A;  2I2R E;  3DF0 B;  1JF0 A;  1QJT A;  2OS8 C;  3FIA A;  3EVU A;  3PAL A;  4YGC B;  2BE4 A;  3BOW A;  1G4Y R;  2KI6 C;  1G33 A;  1TNX A;  4M2P A;  5DKN A;  1SMG A;  1JSA A;  1IRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...