1JBAA

Unmyristoylated gcap-2 with three calcium ions bound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
GQQFSWEEAEENGAVGAADAAQLQEWYKKFLEECPSGTLFMHEFKRFFKVPDNEEATQYVEAMFRAFDTNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRQELLDIVESIYKLKKACSVEVEAEQQGKLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GUANYLATE CYCLASE ACTIVATING PROTEIN 2)
publication title Three-dimensional structure of guanylyl cyclase activating protein-2, a calcium-sensitive modulator of photoreceptor guanylyl cyclases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Lyase
total genus 41
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 1999-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jbaA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jbaA01
2BCBA 1TNXA 2IS9A 4GGFA 1TCOB 1A29A 2HQWA 2JU0A 1IKUA 4ZCVA 1V1GA 5F6TA 3DVJA 3TDIA 1IH0A 4DUQA 2PSRA 1OOJA 1WRZA 3BUWB 3EK4A 3PATA 2M7LA 2MA2A 1Y6WA 1OZSA 2KBIA 2KFFA 4GPLB 2Q4UA 3GOFA 1YRTB 2M0RA 2PALA 1SCMB 2K7OA 1FW4A 1TTXA 3I5GC 2NZ0A 1QIWA 4MRXA 1YURA 4E68A 2R2IA 1J55A 2JXCA 1U5IB 3EK7A 5CSIA 3LK1A 1NUBA 3D10A 1KFUS 4HRHA 1XFYO 2KI4B 4GBAA 3EKJA 4MZKA 4AOMA 2I94A 1SRAA 4D1EA 1EL4A 2KDHA 1BODA 1AUIB 4I5NB 3O78A 2MLEC 1ZMZA 2MBXA 4JWQA 1BOCA 3OX5A 1A2XA 1FI5A 1N65A 1DF0A 4PE4A 4PE1A 1KK8B 2KI6C 3HCMA 4NQGA 1B8RA 1SMGA 2KHNA 3AAKA 1B4CA 1GGZA 2BBNA 2BL0B 3QRXA 1AHRA 1PSBA 4CIDA 1WLZA 4N5XA 3BOWB 4MZLA 2QACA 3WHUB 3SJSA 1AP4A 2LAPA 1QASA 1TCFA 2EGDA 2BECA 3NSIA 5PALA 1RK9A 4MEWA 1IWQA 2CXJA 4XJKA 4CLNA 1XFXO 2K7BA 4YGBB 1LA3A 5JOLA 4I5LB 1SCVA 3RM1A 3OB2B 2F8PA 4YRUA 1QXPA 2LMTA 2AUCA 1NX1A 1NX0A 1F71A 3EVUA 4DS7A 1F70A 5IBWA 4NDCA 1LINA 1RFJA 3BQ3A 5D69A 1KFXS 1NCYA 1LXFC 1MXEA 1UHNA 3FIAA 1JF2A 2KQ6A 2KSPA 2BBMA 5KU1A 3NXAA 4GAOA 2NCPA 4I5JA 1FBVA 3IQQA 4IL1A 5CSNA 4U8DA 4HREE 1SNLA 4WQ3A 4XYNA 1DJGA 4DCKA 2KI6D 2MRDA 2KAVA 1B9AA 1YX7A 5BPJA 3NSOA 1JF0A 1J7OA 1JFJA 1OMVA 2LE9B 1PSRA 2LLTA 4PHKA 2BCAA 2KQYA 4PHJA 2K0JA 1CDNA 1OZOA 3ZWHA 1UHJA 2LVIA 1N2DA 3I5FC 3TDUA 1UHHA 3BYAA 1BR4B 2FOTA 3HX4A 3K21A 5DKNA 1YR5A 1Y1AA 1B47A 1S6IA 2BKHB 1KK7Y 1S6JA 1M46A 1TOPA 3DVEA 1G4YR 1BMOA 1VRKA 4ZCUA 1QJTA 3CR5X 3DVMA 2FJUB 1SL7A 2F3YA 2I18A 3OX6A 2JTTA 4MZJA 1C07A 1XFWO 1M45A 2M7NA 3I5IC 1C7WA 1IQ3A 1QX2A 1QLKA 4PHMA 1UWOA 2GGZA 2O5GA 2Y5IA 5AERA 1XVJA 1KK7Z 1SL9A 2OS8C 4GFTA 1XYDA 1A75B 4GNKB 1J7QA 1CFFA 1DGUA 1CM4A 1M63B 2KAYA 4BY5A 4ORAB 1J7RA 1EJ3A 1OQPA 3EVVA 1K9KA 1TN4A 2BKIB 4USLA 4GGNA 1E8AA 4DIRA 1S1EA 4GGFC 1NIWA 1WY9A 2L0PA 3PFVA 2WCBA 5I2LA 2HPSA 1KWOB 2RGIA 1PVAA 1RTP1 1K93D 3CWGA 1CDMA 5KTYA 1WRKA 4QJ5B 3SG4A 2LLSA 3IF7A 3KEVA 3O6BA 1B1GA 1WDCC 2KNEA 4MN0A 1BJFA 1KQMC 2FCEA 2MHHA 1K90D 1JC2A 2K2AA 5DKRA 1YX8A 4MVFA 1AK8A 2JTZA 2K2FA 1CLBA 1KQMB 1QV0A 1SR6C 2MLFC 3KHEA 1YVHA 4HSZA 2G2BA 2ZFDA 1R2UA 4CPVA 4YI8A 3C1VA 1AJ5A 5AANA 2H61A 3I5GB 1QX5B 4N1GA 5ER4X 2D8NA 5HKZA 1Y1XA 2ZN9A 1KSOA 1SL8A 1BR1B 1L2OC 1NCZA 1XFVO 1B8CA 1UHKA 4OV2A 2QPTA 1TIZA 3DF0A 5TNCA 1H8BA 2JULA 1QS7A 3GK1A 2L51A 3BXKA 4TNCA 1L7ZA 3WNXB 3D0YB 3GK2A 2JWWA 1IJ5A 2AAOA 1MHOA 1S26D 1SY9A 2TN4A 3BUNB 1GJYA 3CZTX 1J7PA 2F33A 2F2OA 2O60A 5I2OA 1M31A 1QVIY 4YI9A 1B7TY 1DJYA 2NLNA 2WORA 3DD4A 3OHMB 1CLLA 2M29A 1U5IA 3VRNA 1CB1A 3JTDC 1ZOTB 2WC8A 1MXLC 5I2QA 4WRIA 2M9GA 2ZRTA 1YUTA 4MLWA 3NSKA 1EXRA 2LV7A 5HLOA 1PALA 1QVIZ 4AQIA 1BF5A 4CFRA 1XA5A 1KFUL 1B7TZ 1XO5A 1PULA 2HF5A 2LM5A 4YGEB 3MSEB 1XK4A 1XFZO 2PASA 2Y4QA 2LUCA 3KO0A 4JPZB 3A8RA 3CLNA 2LC5A 1YRUB 3BUXB 1S3PA 3ICBA 2WNDA 2OTGC 2JC2A 5CSFA 5D7FA 3BOWA 3AAJA 2WCFA 1SW8A 2JT3A 3TS5C 2GV5A 5JJGA 3AKAA 1TNPA 3EKHA 2I7AA 2LMUA 1LA0A 2BCXA 1SK6D 1CFCA 4NDBA 2B1UA 2K7DA 3PSRA 3CTNA 1DMOA 1NX2A 1CLMA 1KSMA 3LK0A 4ICBA 4AQJA 3JVTC 3TDZA 3KPXA 1DT7B 1Y0VH 1GQMA 1NSHA 1AVSA 3KF9A 2CBLA 2JXLA 4C0LA 1CNPA 2WOSA 1K8UA 4Q04A 1UP5A 3LLEA 4OR9B 1HQVA 1W7JB 1YUUA 2Y1NA 3I5FB 4M2OA 4ORCB 2L2EA 1ALVA 2E30A 2HQ8A 2VRGA 3SG3A 4N1FA 5G08A 2I2RE 2NXQA 5DKQA 1A03A 3EVRA 3VRPA 1S6CA 1KFXL 2LP3A 2PMYA 4MRYA 2L4HA 3I5IB 4C0JA 1X02A 1CFDA 1JFKA 1NP8A 2KYCA 2KBMA 4A4CA 1QIVA 1DGVA 1CM1A 2OS8B 2EC6C 1UUSA 4BY4A 3VROA 1QV1A 2PRUA 3O4YA 1ALWA 2L5XB 1IRJA 3I5HC 2CT9A 3ZNIA 1AJ4A 1EG3A 2L4IA 5HKWA 2LHIA 2Y1MA 1MQ1A 2KFHA 2E6WA 5I8NA 5AXIA 2P6BB 1HT9A 2F3ZA 1G8IA 1LVCD 1K9UA 2EHBA 3OB1B 4M2QA 2LLUA 3PM8A 1OSAA 1DVIA 2KYFA 5HKYA 1R6PA 1A75A 1WDCB 4PDZA 2H61C 5J3XA 1BG1A 2CTNA 1SYMA 4C0KA 2LCPA 3O2PA 1DJXA 1F54A 1K95A 2H2KA 2ZRSA 4PE0A 2ISDA 2LP2A 1IJ6A 1SR6B 4CFQA 1NWDA 2M1UA 3AKBA 2KGBC 2L98A 3DF0B 2LMVA 2JNXA 4PALA 1TRFA 3M0WA 3CGAA 3CR2A 1D1OA 1H4BA 4OCIA 4YBHB 1L2OB 1SCMC 3FWBA 2JT0A 3E3RA 1YTZC 1DF0B 2K7CA 1GGWA 1CMFA 1A4PA 2BE4A 1OMDA 1RJVA 1Y1UA 1JSAA 1QATA 3DVKA 3PN7C 1DJHA 3CR4X 1DJZA 5K89A 1JBAA 1K9PA 3WXAA 1C7VA 1S5GY 2KI4C 4HRGA 5B8IB 2HETA 3PN7B 4P5OE 3SG2A 4ORBB 1EG4A 1MUXA 1J1DA 1F4QA 1SPYA 2LVKA 4WQ2A 1ZACA 2L50A 1IG5A 3BUMB 2LHLA 4XJKB 2JOJA 2MAZA 4PCWA 4YGCB 1XK4C 2COLB 1LKJA 3JTDB 2LVJA 2ZNDA 4QJ3B 1QTXA 1KK8C 5AEQA 1S5GZ 2BE6A 2BL0C 2JQ6A 3H4SE 1OE9B 1N0YA 1V1FA 3D0YA 1RECA 4UPGA 1BLQA 3SG7A 3LCPC 1IGVA 1ZFSA 1PVBA 3VRRA 2K8MB 1G33A 1YUSA 1PK0D 1IQ5A 4A4BA 4QJ4B 1B8LA 1J1EA 1QLSA 2CNPA 2JT8A 2M3WA 2PVBA 2A4JA 1JUOA 1NYAA 1CDLA 2DOQA 2MJWB 1FPWA 1WLMA 3LL8B 3TUYC 4YGAA 2OTGB 5KSZA 1MF8B 4M2PA 1ZUZA 4P2YB 2LVVA 3VGOA 5HLVA 3RLZA 3TS5B 5GQQC 3TUYB 2M49B 1UURA 1DJIA 4NDDA 1SBJA 3SIBA 1W7IB 4GUKA 1BU3A 2CCMA 3OP0A 1KCYA 1DJWA 2K61A 4MSPA 1M39A 2M1KB 4DRWA 2SCPA 3JVTB 2JRFA 2G9BA 1NX3A 3FS7A 1MR8A 4PHNA 1SKTA 2F2PA 1K2HA 4JQ0D 4L9MA 3WHTB 5ER5A 3EK8A 4FTGA 1YVLA 1UHIA 2LUXA 3BUOB 1NCXA 4R1EA 1MWNA 1BT6A 3SG6A 2KGRA 4PE7A 2KOTA 3SIAA 1FI6A 5FYXA 4ETOA 1OMRA 5CPVA 1K96A 1S36A 2JPTA 3IQOA 3TZ1A 1Q80A 1KQVA 3CS1A 3PLFB 3VRQA 1PRWA 3GK4X 2ZN8A 1K94A 1F8HA 2WCEA 1QX7A 2JNFA 3NSLA 1WRLA 1RROA 3A4UB 1CDPA 2OPOA 2M97A 1RWYA 2EC6B 2KFGA 4YGDB 1DTLA 2KAXA 1XFUO 5HYDA 1CTRA 2LNKA 3I5HB 1NPQA 2GGMA 2ZKMX 5AFPA 4OKHA 2NCOA 2FCDA 2Q91A 4FQOA 3SG5A 4I5KA 1ODBA 5CSJA 4F0ZB 1CFPA 1F4OA 1TNQA 3FWCA 1CMGA 3F45A 1FF1A 1CKKA 1KWOC 2SASA 1TNWA 4MBEA 4OVNF 1EH2A 2JZIA 2M8UA 3PALA 1JWDA 1F55A 2V53A 2AMIA 2ZNEA 2LANA
chains in the Genus database with same CATH superfamily
2BCBA 1TNXA 2IS9A 4GGFA 1TCOB 1A29A 2HQWA 2JU0A 4PT1A 1OW4A 4ZCVA 3IVTA 1V1GA 1IKUA 2H8VA 5F6TA 3CZ1A 3DVJA 3TDIA 1IH0A 4DUQA 2PSRA 1OOJA 1WRZA 3BUWB 3EK4A 3PATA 2M7LA 2MA2A 1Y6WA 1OZSA 2KBIA 3QMEA 2KFFA 1LS8A 2Q4UA 4GPLB 3GOFA 1YRTB 2M0RA 2PALA 1SCMB 2K7OA 1FW4A 1TTXA 3I5GC 2NZ0A 1QIWA 4MRXA 1YURA 4E68A 3DY9A 2R2IA 4OZDA 1J55A 2JXCA 1U5IB 3S0BA 3EK7A 5CSIA 3LK1A 1NUBA 3D10A 1OOHA 3D77A 1KFUS 4HRHA 1XFYO 2KI4B 4GBAA 3EKJA 4MZKA 2WCKA 4AOMA 2I94A 1SRAA 4D1EA 1EL4A 2KDHA 1BODA 1AUIB 5D3OA 4I5NB 2P70A 3O78A 4KYNA 2MLEC 1ZMZA 2MBXA 4JWQA 1BOCA 3OX5A 1A2XA 1FI5A 1N65A 4INXA 5FI2A 1DF0A 2KPHA 1DELA 3O4XA 4PE4A 1KK8B 2KI6C 3HCMA 4NQGA 4PE1A 1B8RA 1SMGA 2KHNA 3AAKA 1B4CA 1GGZA 2BBNA 2BL0B 3B86A 3QRXA 1AHRA 1PSBA 4CIDA 1WLZA 4N5XA 3BOWB 4MZLA 2QACA 3WHUB 4JKTA 3SJSA 1AP4A 2LAPA 1QASA 1TCFA 2EGDA 1C3ZA 3FE8A 2BECA 3NSIA 5PALA 1RK9A 4MEWA 1IWQA 2CXJA 4XJKA 4CLNA 5I94A 1XFXO 2K7BA 4YGBB 1LA3A 5JOLA 4I5LB 2QDIA 1SCVA 3RM1A 3OB2B 2F8PA 3D78A 4YRUA 5HL1A 1QXPA 2LMTA 2AUCA 1NX1A 3K1EA 1NX0A 1F71A 3EVUA 4DS7A 1F70A 5IBWA 4NDCA 1LINA 1RFJA 2QEBA 3BQ3A 5D69A 1KFXS 1NCYA 1LXFC 1MXEA 1UHNA 3FIAA 1JF2A 2KQ6A 2KSPA 2BBMA 5KU1A 3NXAA 4GAOA 2NCPA 4I5JA 1FBVA 3IQQA 4IL1A 5CSNA 4U8DA 4HREE 1SNLA 4WQ3A 4XYNA 1DJGA 4DCKA 2KI6D 2MRDA 2KAVA 1B9AA 1YX7A 5BPJA 3NSOA 3L4AA 1JF0A 3R72A 1J7OA 1OOFA 1OMVA 2LE9B 1PSRA 2LLTA 4PHKA 2BCAA 1JFJA 2KQYA 2L5YA 4PHJA 2K0JA 1CDNA 1OZOA 3ZWHA 1UHJA 2LVIA 1N2DA 3I5FC 3TDUA 1UHHA 3BYAA 1BR4B 2FOTA 3HX4A 2YGUA 3K21A 5DKNA 1YR5A 1Y1AA 1B47A 1S6IA 2BKHB 1KK7Y 1S6JA 1M46A 1TOPA 3DVEA 1G4YR 1BMOA 1VRKA 4ZCUA 1QJTA 3CR5X 3DVMA 2FJUB 1SL7A 2F3YA 3D75A 2I18A 3OX6A 2JTTA 1DQEA 4MZJA 1C07A 1XFWO 1M45A 2M7NA 3FE9A 3I5IC 1C7WA 1IQ3A 1QX2A 3B7AA 1QLKA 4PHMA 1UWOA 2GGZA 2O5GA 2Y5IA 5AERA 1XVJA 1KK7Z 1SL9A 2OS8C 4GFTA 1XYDA 1A75B 4GNKB 1J7QA 1CFFA 1DGUA 1CM4A 1M63B 2KAYA 2PQLA 2K60A 3Q8IA 4ORAB 4BY5A 1J7RA 1EJ3A 1OQPA 3EVVA 1K9KA 1TN4A 2BKIB 3D74A 4USLA 4GGNA 1E8AA 3S0AA 4DIRA 1S1EA 2KLEA 4GGFC 3OGNA 1NIWA 1OOGA 1WY9A 2L0PA 2WCBA 3PFVA 5I2LA 2HPSA 1KWOB 2RGIA 1PVAA 1RTP1 3EG5B 1K93D 3CWGA 1CDMA 5KTYA 1WRKA 3SS3A 4QJ5B 3SG4A 2LLSA 3IF7A 3BFBA 3KEVA 3O6BA 1B1GA 1WDCC 2KNEA 4MN0A 1BJFA 1KQMC 2FCEA 2MHHA 1Z2CB 1K90D 1JC2A 2K2AA 5DKRA 1YX8A 4MVFA 1AK8A 2JTZA 2K2FA 2QEHA 1CLBA 1KQMB 1QV0A 1SR6C 2MLFC 3KHEA 1YVHA 4HSZA 2G2BA 2ZFDA 3L4LA 1R2UA 4CPVA 4YI8A 3C1VA 1AJ5A 5AANA 3CABA 3OBVA 2H61A 3I5GB 1QX5B 4N1GA 5ER4X 2D8NA 5HKZA 1Y1XA 2ZN9A 3CYZA 1KSOA 1SL8A 1BR1B 1L2OC 1NCZA 1XFVO 1B8CA 1UHKA 4OV2A 2QPTA 1TIZA 3DF0A 5TNCA 1DC1A 2JULA 1H8BA 5DICA 1QS7A 3GK1A 2L51A 3BXKA 4TNCA 4INWA 1L7ZA 3WNXB 2WCLA 3D0YB 3GK2A 2JWWA 1IJ5A 2AAOA 1MHOA 1S26D 1SY9A 2QEVA 2TN4A 3BJHA 3BUNB 3NGVA 1GJYA 3CZTX 1J7PA 2F33A 2F2OA 2O60A 5I2OA 1M31A 1QVIY 1TUZA 4YI9A 1B7TY 3S0EA 3CDNA 1DJYA 2NLNA 2WORA 3DD4A 3OHMB 3R1VA 1CLLA 2M29A 1U5IA 3VRNA 1CB1A 3JTDC 3RZSA 1ZOTB 2WC8A 1MXLC 5I2QA 4WRIA 2M9GA 2ZRTA 1YUTA 4MLWA 3PM2A 3NSKA 1EXRA 2LV7A 5HLOA 1PALA 5FI7A 3PJIA 1QVIZ 4AQIA 1BF5A 4CFRA 1XA5A 1KFUL 1B7TZ 1XO5A 1PULA 2HF5A 2LM5A 4YGEB 3MSEB 1XK4A 2WC5A 1XFZO 2PASA 2Y4QA 2LUCA 3KO0A 1QWVA 4JPZB 3A8RA 3CLNA 2LC5A 1YRUB 3B88A 3BUXB 1S3PA 3ICBA 2WNDA 2OTGC 2BAPA 2JC2A 5CSFA 5D7FA 3BOWA 3AAJA 2WCFA 1SW8A 2JT3A 3TS5C 2GV5A 5JJGA 3AKAA 1TNPA 3EKHA 2I7AA 2LMUA 1LA0A 2BCXA 1SK6D 1CFCA 4NDBA 2B1UA 2K7DA 3PSRA 3CTNA 4IJ7A 1DMOA 3CZ0A 1NX2A 1CLMA 1KSMA 3LK0A 4ICBA 4AQJA 3JVTC 3TDZA 3KPXA 4F7FA 1DT7B 1Y0VH 1GQMA 1NSHA 1AVSA 3KF9A 2CBLA 2JXLA 4C0LA 2P71A 1CNPA 2WOSA 2FJYA 1K8UA 4Q04A 1UP5A 3LLEA 4OR9B 1HQVA 1W7JB 1YUUA 2Y1NA 3I5FB 4M2OA 4ORCB 1DEKA 2L2EA 1ALVA 2E30A 2HQ8A 2VRGA 3SG3A 4N1FA 5G08A 3S0DA 2I2RE 2NXQA 5DKQA 1A03A 3EVRA 3VRPA 1S6CA 5EL2A 1KFXL 2LP3A 2PMYA 3V2LA 4MRYA 2L4HA 3I5IB 4C0JA 1X02A 1CFDA 3L47A 1JFKA 1NP8A 2KYCA 2KBMA 4A4CA 1QIVA 1DGVA 1CM1A 2OS8B 2EC6C 1UUSA 4BY4A 3VROA 1QV1A 2WCHA 2PRUA 3O4YA 1ALWA 2L5XB 1IRJA 3I5HC 2CT9A 3ZNIA 3UNWA 1C3YA 1AJ4A 1EG3A 2L4IA 3VB1A 5HKWA 2LHIA 2Y1MA 1MQ1A 2KFHA 3CZ2A 4FQTA 2E6WA 5I8NA 5AXIA 2P6BB 1HT9A 2F3ZA 3S0GA 1G8IA 1LVCD 1K9UA 2EHBA 3OB1B 4M2QA 2LLUA 3PM8A 1OSAA 1SSEB 1DVIA 2KYFA 5HKYA 1R6PA 1A75A 1WDCB 4PDZA 2H61C 2QEOA 5J3XA 1BG1A 2CTNA 1SYMA 4C0KA 2LCPA 3O2PA 1DJXA 1F54A 1K95A 2H2KA 2ZRSA 4PE0A 2ISDA 2LP2A 1IJ6A 1SR6B 4CFQA 1NWDA 2BNXA 2M1UA 3AKBA 2KGBC 2L98A 3DF0B 2LMVA 2JNXA 3BFHA 4PALA 1TRFA 1W9ZA 2WC6A 3M0WA 3CGAA 3CR2A 1D1OA 1H4BA 4OCIA 4YBHB 1L2OB 1SCMC 3FWBA 2JT0A 3E3RA 1YTZC 1DF0B 2L2CA 3FE6A 2K7CA 1GGWA 3DYEA 1A4PA 2BE4A 1OMDA 1RJVA 1Y1UA 1CMFA 1QATA 1JSAA 2JPOA 3DVKA 3PN7C 1DJHA 3CR4X 1DJZA 5K89A 1JBAA 1K9PA 3DXLA 3WXAA 1C7VA 1S5GY 2KI4C 4HRGA 5B8IB 2HETA 3PN7B 4P5OE 3SG2A 4ORBB 1Z4HA 1EG4A 1MUXA 1J1DA 1F4QA 1SPYA 2LVKA 3BFAA 4WQ2A 1ZACA 2L50A 1IG5A 3BUMB 2LHLA 4XJKB 2JOJA 2MAZA 4PCWA 4YGCB 1XK4C 2COLB 1LKJA 3JTDB 2LVJA 2ZNDA 4QJ3B 1QTXA 1KK8C 5AEQA 1S5GZ 2BE6A 2BL0C 2JQ6A 3H4SE 1OE9B 1N0YA 1V1FA 3DZTA 3D73A 3R1OA 3D0YA 1RECA 4UPGA 1BLQA 2WCMA 3SG7A 3LCPC 1IGVA 1ZFSA 1PVBA 3UO9A 2K8MB 3VRRA 1G33A 1YUSA 1PK0D 1IQ5A 4A4BA 4QJ4B 1B8LA 1J1EA 1QLSA 2CNPA 2JT8A 2M3WA 2PVBA 2A4JA 1JUOA 1NYAA 1CDLA 2DOQA 2WCJA 2MJWB 1FPWA 3NHTA 1WLMA 3LL8B 3TUYC 4YGAA 2OTGB 5KSZA 1MF8B 4M2PA 1ZUZA 4P2YB 2LVVA 3VGOA 5HLVA 3RLZA 3TS5B 5GQQC 3TUYB 2M49B 1UURA 1DJIA 4NDDA 1SBJA 3SIBA 1W7IB 4GUKA 1BU3A 2CCMA 3OP0A 1KCYA 1DJWA 2K61A 4MSPA 1M39A 2PYQA 2M1KB 4DRWA 2SCPA 3JVTB 2JRFA 1T14A 1NX3A 2G9BA 1MR8A 3FS7A 1OOIX 4PHNA 1SKTA 2F2PA 1K2HA 4JQ0D 4L9MA 3WHTB 5ER5A 3EK8A 4FTGA 1YVLA 1UHIA 2LUXA 3BUOB 1NCXA 4R1EA 1MWNA 1BT6A 1ORGA 2KGRA 4PE7A 3SG6A 3SS5A 2KOTA 3SIAA 1P28A 1FI6A 5FYXA 4ETOA 2KLDA 1OMRA 5CPVA 1K96A 1S36A 2JPTA 2ERBA 3IQOA 3TZ1A 5FI6A 1Q80A 1KQVA 3CS1A 3PLFB 3VRQA 1PRWA 3GK4X 2ZN8A 1K94A 1F8HA 2WCEA 1IIOA 1QX7A 2JNFA 3S0FA 3NSLA 1WRLA 1RROA 3A4UB 1CDPA 2OPOA 2M97A 3B6XA 1RWYA 2EC6B 2KFGA 4YGDB 1DTLA 2KAXA 4JD9A 1XFUO 5HYDA 1TUJA 3SS4A 1CTRA 2LNKA 3I5HB 1NPQA 2GGMA 3NHIA 2ZKMX 5AFPA 4OKHA 2NCOA 2FCDA 2Q91A 4FQOA 3SG5A 2GTEA 4I5KA 1ODBA 5CSJA 4F0ZB 1CFPA 1F4OA 1TNQA 3FWCA 1CMGA 3F45A 1FF1A 1CKKA 1KWOC 2SASA 3D76A 1TNWA 4MBEA 4OVNF 1EH2A 3B87A 3N7HA 1GM0A 3R1PA 2JZIA 2M8UA 3PALA 1JWDA 1TWOA 1F55A 2V53A 1XFRA 2AMIA 2ZNEA 2LANA
chains in the Genus database with same CATH topology
2BCBA 1TNXA 2IS9A 4GGFA 1TCOB 1A29A 2HQWA 2JU0A 1IKUA 4ZCVA 1V1GA 5F6TA 3DVJA 3TDIA 1IH0A 4DUQA 2PSRA 1OOJA 1WRZA 3BUWB 3EK4A 3PATA 2M7LA 2MA2A 1Y6WA 1OZSA 2KBIA 2KFFA 4GPLB 2Q4UA 3GOFA 1YRTB 2M0RA 2PALA 1SCMB 2K7OA 1FW4A 1TTXA 3I5GC 2NZ0A 1QIWA 4MRXA 1YURA 4E68A 2R2IA 1J55A 2JXCA 1U5IB 3EK7A 5CSIA 3LK1A 1NUBA 3D10A 1KFUS 4HRHA 1XFYO 2KI4B 4GBAA 3EKJA 4MZKA 4AOMA 2I94A 1SRAA 4D1EA 1EL4A 2KDHA 1BODA 1AUIB 4I5NB 3O78A 2MLEC 1ZMZA 2MBXA 4JWQA 1BOCA 3OX5A 1A2XA 1FI5A 1N65A 1DF0A 4PE4A 4PE1A 1KK8B 2KI6C 3HCMA 4NQGA 1B8RA 1SMGA 2KHNA 3AAKA 1B4CA 1GGZA 2BBNA 2BL0B 3QRXA 1AHRA 1PSBA 4CIDA 1WLZA 4N5XA 3BOWB 4MZLA 2QACA 3WHUB 3SJSA 1AP4A 2LAPA 1QASA 1TCFA 2EGDA 2BECA 3NSIA 5PALA 1RK9A 4MEWA 1IWQA 2CXJA 4XJKA 4CLNA 1XFXO 2K7BA 4YGBB 1LA3A 5JOLA 4I5LB 1SCVA 3RM1A 3OB2B 2F8PA 4YRUA 1QXPA 2LMTA 2AUCA 1NX1A 1NX0A 1F71A 3EVUA 4DS7A 1F70A 5IBWA 4NDCA 1LINA 1RFJA 3BQ3A 5D69A 1KFXS 1NCYA 1LXFC 1MXEA 1UHNA 3FIAA 1JF2A 2KQ6A 2KSPA 2BBMA 5KU1A 3NXAA 4GAOA 2NCPA 4I5JA 1FBVA 3IQQA 4IL1A 5CSNA 4U8DA 4HREE 1SNLA 4WQ3A 4XYNA 1DJGA 4DCKA 2KI6D 2MRDA 2KAVA 1B9AA 1YX7A 5BPJA 3NSOA 1JF0A 1J7OA 1JFJA 1OMVA 2LE9B 1PSRA 2LLTA 4PHKA 2BCAA 2KQYA 4PHJA 2K0JA 1CDNA 1OZOA 3ZWHA 1UHJA 2LVIA 1N2DA 3I5FC 3TDUA 1UHHA 3BYAA 1BR4B 2FOTA 3HX4A 3K21A 5DKNA 1YR5A 1Y1AA 1B47A 1S6IA 2BKHB 1KK7Y 1S6JA 1M46A 1TOPA 3DVEA 1G4YR 1BMOA 1VRKA 4ZCUA 1QJTA 3CR5X 3DVMA 2FJUB 1SL7A 2F3YA 2I18A 3OX6A 2JTTA 4MZJA 1C07A 1XFWO 1M45A 2M7NA 3I5IC 1C7WA 1IQ3A 1QX2A 1QLKA 4PHMA 1UWOA 2GGZA 2O5GA 2Y5IA 5AERA 1XVJA 1KK7Z 1SL9A 2OS8C 4GFTA 1XYDA 1A75B 4GNKB 1J7QA 1CFFA 1DGUA 1CM4A 1M63B 2KAYA 4BY5A 4ORAB 1J7RA 1EJ3A 1OQPA 3EVVA 1K9KA 1TN4A 2BKIB 4USLA 4GGNA 1E8AA 4DIRA 1S1EA 4GGFC 1NIWA 1WY9A 2L0PA 3PFVA 2WCBA 5I2LA 2HPSA 1KWOB 2RGIA 1PVAA 1RTP1 1K93D 3CWGA 1CDMA 5KTYA 1WRKA 4QJ5B 3SG4A 2LLSA 3IF7A 3KEVA 3O6BA 1B1GA 1WDCC 2KNEA 4MN0A 1BJFA 1KQMC 2FCEA 2MHHA 1K90D 1JC2A 2K2AA 5DKRA 1YX8A 4MVFA 1AK8A 2JTZA 2K2FA 1CLBA 1KQMB 1QV0A 1SR6C 2MLFC 3KHEA 1YVHA 4HSZA 2G2BA 2ZFDA 1R2UA 4CPVA 4YI8A 3C1VA 1AJ5A 5AANA 2H61A 3I5GB 1QX5B 4N1GA 5ER4X 2D8NA 5HKZA 1Y1XA 2ZN9A 1KSOA 1SL8A 1BR1B 1L2OC 1NCZA 1XFVO 1B8CA 1UHKA 4OV2A 2QPTA 1TIZA 3DF0A 5TNCA 1H8BA 2JULA 1QS7A 3GK1A 2L51A 3BXKA 4TNCA 1L7ZA 3WNXB 3D0YB 3GK2A 2JWWA 1IJ5A 2AAOA 1MHOA 1S26D 1SY9A 2TN4A 3BUNB 1GJYA 3CZTX 1J7PA 2F33A 2F2OA 2O60A 5I2OA 1M31A 1QVIY 4YI9A 1B7TY 1DJYA 2NLNA 2WORA 3DD4A 3OHMB 1CLLA 2M29A 1U5IA 3VRNA 1CB1A 3JTDC 1ZOTB 2WC8A 1MXLC 5I2QA 4WRIA 2M9GA 2ZRTA 1YUTA 4MLWA 3NSKA 1EXRA 2LV7A 5HLOA 1PALA 1QVIZ 4AQIA 1BF5A 4CFRA 1XA5A 1KFUL 1B7TZ 1XO5A 1PULA 2HF5A 2LM5A 4YGEB 3MSEB 1XK4A 1XFZO 2PASA 2Y4QA 2LUCA 3KO0A 4JPZB 3A8RA 3CLNA 2LC5A 1YRUB 3BUXB 1S3PA 3ICBA 2WNDA 2OTGC 2JC2A 5CSFA 5D7FA 3BOWA 3AAJA 2WCFA 1SW8A 2JT3A 3TS5C 2GV5A 5JJGA 3AKAA 1TNPA 3EKHA 2I7AA 2LMUA 1LA0A 2BCXA 1SK6D 1CFCA 4NDBA 2B1UA 2K7DA 3PSRA 3CTNA 1DMOA 1NX2A 1CLMA 1KSMA 3LK0A 4ICBA 4AQJA 3JVTC 3TDZA 3KPXA 1DT7B 1Y0VH 1GQMA 1NSHA 1AVSA 3KF9A 2CBLA 2JXLA 4C0LA 1CNPA 2WOSA 1K8UA 4Q04A 1UP5A 3LLEA 4OR9B 1HQVA 1W7JB 1YUUA 2Y1NA 3I5FB 4M2OA 4ORCB 2L2EA 1ALVA 2E30A 2HQ8A 2VRGA 3SG3A 4N1FA 5G08A 2I2RE 2NXQA 5DKQA 1A03A 3EVRA 3VRPA 1S6CA 1KFXL 2LP3A 2PMYA 4MRYA 2L4HA 3I5IB 4C0JA 1X02A 1CFDA 1JFKA 1NP8A 2KYCA 2KBMA 4A4CA 1QIVA 1DGVA 1CM1A 2OS8B 2EC6C 1UUSA 4BY4A 3VROA 1QV1A 2PRUA 3O4YA 1ALWA 2L5XB 1IRJA 3I5HC 2CT9A 3ZNIA 1AJ4A 1EG3A 2L4IA 5HKWA 2LHIA 2Y1MA 1MQ1A 2KFHA 2E6WA 5I8NA 5AXIA 2P6BB 1HT9A 2F3ZA 1G8IA 1LVCD 1K9UA 2EHBA 3OB1B 4M2QA 2LLUA 3PM8A 1OSAA 1DVIA 2KYFA 5HKYA 1R6PA 1A75A 1WDCB 4PDZA 2H61C 5J3XA 1BG1A 2CTNA 1SYMA 4C0KA 2LCPA 3O2PA 1DJXA 1F54A 1K95A 2H2KA 2ZRSA 4PE0A 2ISDA 2LP2A 1IJ6A 1SR6B 4CFQA 1NWDA 2M1UA 3AKBA 2KGBC 2L98A 3DF0B 2LMVA 2JNXA 4PALA 1TRFA 3M0WA 3CGAA 3CR2A 1D1OA 1H4BA 4OCIA 4YBHB 1L2OB 1SCMC 3FWBA 2JT0A 3E3RA 1YTZC 1DF0B 2K7CA 1GGWA 1CMFA 1A4PA 2BE4A 1OMDA 1RJVA 1Y1UA 1JSAA 1QATA 3DVKA 3PN7C 1DJHA 3CR4X 1DJZA 5K89A 1JBAA 1K9PA 3WXAA 1C7VA 1S5GY 2KI4C 4HRGA 5B8IB 2HETA 3PN7B 4P5OE 3SG2A 4ORBB 1EG4A 1MUXA 1J1DA 1F4QA 1SPYA 2LVKA 4WQ2A 1ZACA 2L50A 1IG5A 3BUMB 2LHLA 4XJKB 2JOJA 2MAZA 4PCWA 4YGCB 1XK4C 2COLB 1LKJA 3JTDB 2LVJA 2ZNDA 4QJ3B 1QTXA 1KK8C 5AEQA 1S5GZ 2BE6A 2BL0C 2JQ6A 3H4SE 1OE9B 1N0YA 1V1FA 3D0YA 1RECA 4UPGA 1BLQA 3SG7A 3LCPC 1IGVA 1ZFSA 1PVBA 3VRRA 2K8MB 1G33A 1YUSA 1PK0D 1IQ5A 4A4BA 4QJ4B 1B8LA 1J1EA 1QLSA 2CNPA 2JT8A 2M3WA 2PVBA 2A4JA 1JUOA 1NYAA 1CDLA 2DOQA 2MJWB 1FPWA 1WLMA 3LL8B 3TUYC 4YGAA 2OTGB 5KSZA 1MF8B 4M2PA 1ZUZA 4P2YB 2LVVA 3VGOA 5HLVA 3RLZA 3TS5B 5GQQC 3TUYB 2M49B 1UURA 1DJIA 4NDDA 1SBJA 3SIBA 1W7IB 4GUKA 1BU3A 2CCMA 3OP0A 1KCYA 1DJWA 2K61A 4MSPA 1M39A 2M1KB 4DRWA 2SCPA 3JVTB 2JRFA 2G9BA 1NX3A 3FS7A 1MR8A 4PHNA 1SKTA 2F2PA 1K2HA 4JQ0D 4L9MA 3WHTB 5ER5A 3EK8A 4FTGA 1YVLA 1UHIA 2LUXA 3BUOB 1NCXA 4R1EA 1MWNA 1BT6A 3SG6A 2KGRA 4PE7A 2KOTA 3SIAA 1FI6A 5FYXA 4ETOA 1OMRA 5CPVA 1K96A 1S36A 2JPTA 3IQOA 3TZ1A 1Q80A 1KQVA 3CS1A 3PLFB 3VRQA 1PRWA 3GK4X 2ZN8A 1K94A 1F8HA 2WCEA 1QX7A 2JNFA 3NSLA 1WRLA 1RROA 3A4UB 1CDPA 2OPOA 2M97A 1RWYA 2EC6B 2KFGA 4YGDB 1DTLA 2KAXA 1XFUO 5HYDA 1CTRA 2LNKA 3I5HB 1NPQA 2GGMA 2ZKMX 5AFPA 4OKHA 2NCOA 2FCDA 2Q91A 4FQOA 3SG5A 4I5KA 1ODBA 5CSJA 4F0ZB 1CFPA 1F4OA 1TNQA 3FWCA 1CMGA 3F45A 1FF1A 1CKKA 1KWOC 2SASA 1TNWA 4MBEA 4OVNF 1EH2A 2JZIA 2M8UA 3PALA 1JWDA 1F55A 2V53A 2AMIA 2ZNEA 2LANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCB A;  1TNX A;  2IS9 A;  4GGF A;  1TCO B;  1A29 A;  2HQW A;  2JU0 A;  1IKU A;  4ZCV A;  1V1G A;  5F6T A;  3DVJ A;  3TDI A;  1IH0 A;  4DUQ A;  2PSR A;  1OOJ A;  1WRZ A;  3BUW B;  3EK4 A;  3PAT A;  2M7L A;  2MA2 A;  1Y6W A;  1OZS A;  2KBI A;  2KFF A;  4GPL B;  2Q4U A;  3GOF A;  1YRT B;  2M0R A;  2PAL A;  1SCM B;  2K7O A;  1FW4 A;  1TTX A;  3I5G C;  2NZ0 A;  1QIW A;  4MRX A;  1YUR A;  4E68 A;  2R2I A;  1J55 A;  2JXC A;  1U5I B;  3EK7 A;  5CSI A;  3LK1 A;  1NUB A;  3D10 A;  1KFU S;  4HRH A;  1XFY O;  2KI4 B;  4GBA A;  3EKJ A;  4MZK A;  4AOM A;  2I94 A;  1SRA A;  4D1E A;  1EL4 A;  2KDH A;  1BOD A;  1AUI B;  4I5N B;  3O78 A;  2MLE C;  1ZMZ A;  2MBX A;  4JWQ A;  1BOC A;  3OX5 A;  1A2X A;  1FI5 A;  1N65 A;  1DF0 A;  4PE4 A;  4PE1 A;  1KK8 B;  2KI6 C;  3HCM A;  4NQG A;  1B8R A;  1SMG A;  2KHN A;  3AAK A;  1B4C A;  1GGZ A;  2BBN A;  2BL0 B;  3QRX A;  1AHR A;  1PSB A;  4CID A;  1WLZ A;  4N5X A;  3BOW B;  4MZL A;  2QAC A;  3WHU B;  3SJS A;  1AP4 A;  2LAP A;  1QAS A;  1TCF A;  2EGD A;  2BEC A;  3NSI A;  5PAL A;  1RK9 A;  4MEW A;  1IWQ A;  2CXJ A;  4XJK A;  4CLN A;  1XFX O;  2K7B A;  4YGB B;  1LA3 A;  5JOL A;  4I5L B;  1SCV A;  3RM1 A;  3OB2 B;  2F8P A;  4YRU A;  1QXP A;  2LMT A;  2AUC A;  1NX1 A;  1NX0 A;  1F71 A;  3EVU A;  4DS7 A;  1F70 A;  5IBW A;  4NDC A;  1LIN A;  1RFJ A;  3BQ3 A;  5D69 A;  1KFX S;  1NCY A;  1LXF C;  1MXE A;  1UHN A;  3FIA A;  1JF2 A;  2KQ6 A;  2KSP A;  2BBM A;  5KU1 A;  3NXA A;  4GAO A;  2NCP A;  4I5J A;  1FBV A;  3IQQ A;  4IL1 A;  5CSN A;  4U8D A;  4HRE E;  1SNL A;  4WQ3 A;  4XYN A;  1DJG A;  4DCK A;  2KI6 D;  2MRD A;  2KAV A;  1B9A A;  1YX7 A;  5BPJ A;  3NSO A;  1JF0 A;  1J7O A;  1JFJ A;  1OMV A;  2LE9 B;  1PSR A;  2LLT A;  4PHK A;  2BCA A;  2KQY A;  4PHJ A;  2K0J A;  1CDN A;  1OZO A;  3ZWH A;  1UHJ A;  2LVI A;  1N2D A;  3I5F C;  3TDU A;  1UHH A;  3BYA A;  1BR4 B;  2FOT A;  3HX4 A;  3K21 A;  5DKN A;  1YR5 A;  1Y1A A;  1B47 A;  1S6I A;  2BKH B;  1KK7 Y;  1S6J A;  1M46 A;  1TOP A;  3DVE A;  1G4Y R;  1BMO A;  1VRK A;  4ZCU A;  1QJT A;  3CR5 X;  3DVM A;  2FJU B;  1SL7 A;  2F3Y A;  2I18 A;  3OX6 A;  2JTT A;  4MZJ A;  1C07 A;  1XFW O;  1M45 A;  2M7N A;  3I5I C;  1C7W A;  1IQ3 A;  1QX2 A;  1QLK A;  4PHM A;  1UWO A;  2GGZ A;  2O5G A;  2Y5I A;  5AER A;  1XVJ A;  1KK7 Z;  1SL9 A;  2OS8 C;  4GFT A;  1XYD A;  1A75 B;  4GNK B;  1J7Q A;  1CFF A;  1DGU A;  1CM4 A;  1M63 B;  2KAY A;  4BY5 A;  4ORA B;  1J7R A;  1EJ3 A;  1OQP A;  3EVV A;  1K9K A;  1TN4 A;  2BKI B;  4USL A;  4GGN A;  1E8A A;  4DIR A;  1S1E A;  4GGF C;  1NIW A;  1WY9 A;  2L0P A;  3PFV A;  2WCB A;  5I2L A;  2HPS A;  1KWO B;  2RGI A;  1PVA A;  1RTP 1;  1K93 D;  3CWG A;  1CDM A;  5KTY A;  1WRK A;  4QJ5 B;  3SG4 A;  2LLS A;  3IF7 A;  3KEV A;  3O6B A;  1B1G A;  1WDC C;  2KNE A;  4MN0 A;  1BJF A;  1KQM C;  2FCE A;  2MHH A;  1K90 D;  1JC2 A;  2K2A A;  5DKR A;  1YX8 A;  4MVF A;  1AK8 A;  2JTZ A;  2K2F A;  1CLB A;  1KQM B;  1QV0 A;  1SR6 C;  2MLF C;  3KHE A;  1YVH A;  4HSZ A;  2G2B A;  2ZFD A;  1R2U A;  4CPV A;  4YI8 A;  3C1V A;  1AJ5 A;  5AAN A;  2H61 A;  3I5G B;  1QX5 B;  4N1G A;  5ER4 X;  2D8N A;  5HKZ A;  1Y1X A;  2ZN9 A;  1KSO A;  1SL8 A;  1BR1 B;  1L2O C;  1NCZ A;  1XFV O;  1B8C A;  1UHK A;  4OV2 A;  2QPT A;  1TIZ A;  3DF0 A;  5TNC A;  1H8B A;  2JUL A;  1QS7 A;  3GK1 A;  2L51 A;  3BXK A;  4TNC A;  1L7Z A;  3WNX B;  3D0Y B;  3GK2 A;  2JWW A;  1IJ5 A;  2AAO A;  1MHO A;  1S26 D;  1SY9 A;  2TN4 A;  3BUN B;  1GJY A;  3CZT X;  1J7P A;  2F33 A;  2F2O A;  2O60 A;  5I2O A;  1M31 A;  1QVI Y;  4YI9 A;  1B7T Y;  1DJY A;  2NLN A;  2WOR A;  3DD4 A;  3OHM B;  1CLL A;  2M29 A;  1U5I A;  3VRN A;  1CB1 A;  3JTD C;  1ZOT B;  2WC8 A;  1MXL C;  5I2Q A;  4WRI A;  2M9G A;  2ZRT A;  1YUT A;  4MLW A;  3NSK A;  1EXR A;  2LV7 A;  5HLO A;  1PAL A;  1QVI Z;  4AQI A;  1BF5 A;  4CFR A;  1XA5 A;  1KFU L;  1B7T Z;  1XO5 A;  1PUL A;  2HF5 A;  2LM5 A;  4YGE B;  3MSE B;  1XK4 A;  1XFZ O;  2PAS A;  2Y4Q A;  2LUC A;  3KO0 A;  4JPZ B;  3A8R A;  3CLN A;  2LC5 A;  1YRU B;  3BUX B;  1S3P A;  3ICB A;  2WND A;  2OTG C;  2JC2 A;  5CSF A;  5D7F A;  3BOW A;  3AAJ A;  2WCF A;  1SW8 A;  2JT3 A;  3TS5 C;  2GV5 A;  5JJG A;  3AKA A;  1TNP A;  3EKH A;  2I7A A;  2LMU A;  1LA0 A;  2BCX A;  1SK6 D;  1CFC A;  4NDB A;  2B1U A;  2K7D A;  3PSR A;  3CTN A;  1DMO A;  1NX2 A;  1CLM A;  1KSM A;  3LK0 A;  4ICB A;  4AQJ A;  3JVT C;  3TDZ A;  3KPX A;  1DT7 B;  1Y0V H;  1GQM A;  1NSH A;  1AVS A;  3KF9 A;  2CBL A;  2JXL A;  4C0L A;  1CNP A;  2WOS A;  1K8U A;  4Q04 A;  1UP5 A;  3LLE A;  4OR9 B;  1HQV A;  1W7J B;  1YUU A;  2Y1N A;  3I5F B;  4M2O A;  4ORC B;  2L2E A;  1ALV A;  2E30 A;  2HQ8 A;  2VRG A;  3SG3 A;  4N1F A;  5G08 A;  2I2R E;  2NXQ A;  5DKQ A;  1A03 A;  3EVR A;  3VRP A;  1S6C A;  1KFX L;  2LP3 A;  2PMY A;  4MRY A;  2L4H A;  3I5I B;  4C0J A;  1X02 A;  1CFD A;  1JFK A;  1NP8 A;  2KYC A;  2KBM A;  4A4C A;  1QIV A;  1DGV A;  1CM1 A;  2OS8 B;  2EC6 C;  1UUS A;  4BY4 A;  3VRO A;  1QV1 A;  2PRU A;  3O4Y A;  1ALW A;  2L5X B;  1IRJ A;  3I5H C;  2CT9 A;  3ZNI A;  1AJ4 A;  1EG3 A;  2L4I A;  5HKW A;  2LHI A;  2Y1M A;  1MQ1 A;  2KFH A;  2E6W A;  5I8N A;  5AXI A;  2P6B B;  1HT9 A;  2F3Z A;  1G8I A;  1LVC D;  1K9U A;  2EHB A;  3OB1 B;  4M2Q A;  2LLU A;  3PM8 A;  1OSA A;  1DVI A;  2KYF A;  5HKY A;  1R6P A;  1A75 A;  1WDC B;  4PDZ A;  2H61 C;  5J3X A;  1BG1 A;  2CTN A;  1SYM A;  4C0K A;  2LCP A;  3O2P A;  1DJX A;  1F54 A;  1K95 A;  2H2K A;  2ZRS A;  4PE0 A;  2ISD A;  2LP2 A;  1IJ6 A;  1SR6 B;  4CFQ A;  1NWD A;  2M1U A;  3AKB A;  2KGB C;  2L98 A;  3DF0 B;  2LMV A;  2JNX A;  4PAL A;  1TRF A;  3M0W A;  3CGA A;  3CR2 A;  1D1O A;  1H4B A;  4OCI A;  4YBH B;  1L2O B;  1SCM C;  3FWB A;  2JT0 A;  3E3R A;  1YTZ C;  1DF0 B;  2K7C A;  1GGW A;  1CMF A;  1A4P A;  2BE4 A;  1OMD A;  1RJV A;  1Y1U A;  1JSA A;  1QAT A;  3DVK A;  3PN7 C;  1DJH A;  3CR4 X;  1DJZ A;  5K89 A;  1JBA A;  1K9P A;  3WXA A;  1C7V A;  1S5G Y;  2KI4 C;  4HRG A;  5B8I B;  2HET A;  3PN7 B;  4P5O E;  3SG2 A;  4ORB B;  1EG4 A;  1MUX A;  1J1D A;  1F4Q A;  1SPY A;  2LVK A;  4WQ2 A;  1ZAC A;  2L50 A;  1IG5 A;  3BUM B;  2LHL A;  4XJK B;  2JOJ A;  2MAZ A;  4PCW A;  4YGC B;  1XK4 C;  2COL B;  1LKJ A;  3JTD B;  2LVJ A;  2ZND A;  4QJ3 B;  1QTX A;  1KK8 C;  5AEQ A;  1S5G Z;  2BE6 A;  2BL0 C;  2JQ6 A;  3H4S E;  1OE9 B;  1N0Y A;  1V1F A;  3D0Y A;  1REC A;  4UPG A;  1BLQ A;  3SG7 A;  3LCP C;  1IGV A;  1ZFS A;  1PVB A;  3VRR A;  2K8M B;  1G33 A;  1YUS A;  1PK0 D;  1IQ5 A;  4A4B A;  4QJ4 B;  1B8L A;  1J1E A;  1QLS A;  2CNP A;  2JT8 A;  2M3W A;  2PVB A;  2A4J A;  1JUO A;  1NYA A;  1CDL A;  2DOQ A;  2MJW B;  1FPW A;  1WLM A;  3LL8 B;  3TUY C;  4YGA A;  2OTG B;  5KSZ A;  1MF8 B;  4M2P A;  1ZUZ A;  4P2Y B;  2LVV A;  3VGO A;  5HLV A;  3RLZ A;  3TS5 B;  5GQQ C;  3TUY B;  2M49 B;  1UUR A;  1DJI A;  4NDD A;  1SBJ A;  3SIB A;  1W7I B;  4GUK A;  1BU3 A;  2CCM A;  3OP0 A;  1KCY A;  1DJW A;  2K61 A;  4MSP A;  1M39 A;  2M1K B;  4DRW A;  2SCP A;  3JVT B;  2JRF A;  2G9B A;  1NX3 A;  3FS7 A;  1MR8 A;  4PHN A;  1SKT A;  2F2P A;  1K2H A;  4JQ0 D;  4L9M A;  3WHT B;  5ER5 A;  3EK8 A;  4FTG A;  1YVL A;  1UHI A;  2LUX A;  3BUO B;  1NCX A;  4R1E A;  1MWN A;  1BT6 A;  3SG6 A;  2KGR A;  4PE7 A;  2KOT A;  3SIA A;  1FI6 A;  5FYX A;  4ETO A;  1OMR A;  5CPV A;  1K96 A;  1S36 A;  2JPT A;  3IQO A;  3TZ1 A;  1Q80 A;  1KQV A;  3CS1 A;  3PLF B;  3VRQ A;  1PRW A;  3GK4 X;  2ZN8 A;  1K94 A;  1F8H A;  2WCE A;  1QX7 A;  2JNF A;  3NSL A;  1WRL A;  1RRO A;  3A4U B;  1CDP A;  2OPO A;  2M97 A;  1RWY A;  2EC6 B;  2KFG A;  4YGD B;  1DTL A;  2KAX A;  1XFU O;  5HYD A;  1CTR A;  2LNK A;  3I5H B;  1NPQ A;  2GGM A;  2ZKM X;  5AFP A;  4OKH A;  2NCO A;  2FCD A;  2Q91 A;  4FQO A;  3SG5 A;  4I5K A;  1ODB A;  5CSJ A;  4F0Z B;  1CFP A;  1F4O A;  1TNQ A;  3FWC A;  1CMG A;  3F45 A;  1FF1 A;  1CKK A;  1KWO C;  2SAS A;  1TNW A;  4MBE A;  4OVN F;  1EH2 A;  2JZI A;  2M8U A;  3PAL A;  1JWD A;  1F55 A;  2V53 A;  2AMI A;  2ZNE A;  2LAN A; 
#chains in the Genus database with same CATH topology
 2BCB A;  1TNX A;  2IS9 A;  4GGF A;  1TCO B;  1A29 A;  2HQW A;  2JU0 A;  4PT1 A;  1OW4 A;  4ZCV A;  3IVT A;  1V1G A;  1IKU A;  2H8V A;  5F6T A;  3CZ1 A;  3DVJ A;  3TDI A;  1IH0 A;  4DUQ A;  2PSR A;  1OOJ A;  1WRZ A;  3BUW B;  3EK4 A;  3PAT A;  2M7L A;  2MA2 A;  1Y6W A;  1OZS A;  2KBI A;  3QME A;  2KFF A;  1LS8 A;  2Q4U A;  4GPL B;  3GOF A;  1YRT B;  2M0R A;  2PAL A;  1SCM B;  2K7O A;  1FW4 A;  1TTX A;  3I5G C;  2NZ0 A;  1QIW A;  4MRX A;  1YUR A;  4E68 A;  3DY9 A;  2R2I A;  4OZD A;  1J55 A;  2JXC A;  1U5I B;  3S0B A;  3EK7 A;  5CSI A;  3LK1 A;  1NUB A;  3D10 A;  1OOH A;  3D77 A;  1KFU S;  4HRH A;  1XFY O;  2KI4 B;  4GBA A;  3EKJ A;  4MZK A;  2WCK A;  4AOM A;  2I94 A;  1SRA A;  4D1E A;  1EL4 A;  2KDH A;  1BOD A;  1AUI B;  5D3O A;  4I5N B;  2P70 A;  3O78 A;  4KYN A;  2MLE C;  1ZMZ A;  2MBX A;  4JWQ A;  1BOC A;  3OX5 A;  1A2X A;  1FI5 A;  1N65 A;  4INX A;  5FI2 A;  1DF0 A;  2KPH A;  1DEL A;  3O4X A;  4PE4 A;  1KK8 B;  2KI6 C;  3HCM A;  4NQG A;  4PE1 A;  1B8R A;  1SMG A;  2KHN A;  3AAK A;  1B4C A;  1GGZ A;  2BBN A;  2BL0 B;  3B86 A;  3QRX A;  1AHR A;  1PSB A;  4CID A;  1WLZ A;  4N5X A;  3BOW B;  4MZL A;  2QAC A;  3WHU B;  4JKT A;  3SJS A;  1AP4 A;  2LAP A;  1QAS A;  1TCF A;  2EGD A;  1C3Z A;  3FE8 A;  2BEC A;  3NSI A;  5PAL A;  1RK9 A;  4MEW A;  1IWQ A;  2CXJ A;  4XJK A;  4CLN A;  5I94 A;  1XFX O;  2K7B A;  4YGB B;  1LA3 A;  5JOL A;  4I5L B;  2QDI A;  1SCV A;  3RM1 A;  3OB2 B;  2F8P A;  3D78 A;  4YRU A;  5HL1 A;  1QXP A;  2LMT A;  2AUC A;  1NX1 A;  3K1E A;  1NX0 A;  1F71 A;  3EVU A;  4DS7 A;  1F70 A;  5IBW A;  4NDC A;  1LIN A;  1RFJ A;  2QEB A;  3BQ3 A;  5D69 A;  1KFX S;  1NCY A;  1LXF C;  1MXE A;  1UHN A;  3FIA A;  1JF2 A;  2KQ6 A;  2KSP A;  2BBM A;  5KU1 A;  3NXA A;  4GAO A;  2NCP A;  4I5J A;  1FBV A;  3IQQ A;  4IL1 A;  5CSN A;  4U8D A;  4HRE E;  1SNL A;  4WQ3 A;  4XYN A;  1DJG A;  4DCK A;  2KI6 D;  2MRD A;  2KAV A;  1B9A A;  1YX7 A;  5BPJ A;  3NSO A;  3L4A A;  1JF0 A;  3R72 A;  1J7O A;  1OOF A;  1OMV A;  2LE9 B;  1PSR A;  2LLT A;  4PHK A;  2BCA A;  1JFJ A;  2KQY A;  2L5Y A;  4PHJ A;  2K0J A;  1CDN A;  1OZO A;  3ZWH A;  1UHJ A;  2LVI A;  1N2D A;  3I5F C;  3TDU A;  1UHH A;  3BYA A;  1BR4 B;  2FOT A;  3HX4 A;  2YGU A;  3K21 A;  5DKN A;  1YR5 A;  1Y1A A;  1B47 A;  1S6I A;  2BKH B;  1KK7 Y;  1S6J A;  1M46 A;  1TOP A;  3DVE A;  1G4Y R;  1BMO A;  1VRK A;  4ZCU A;  1QJT A;  3CR5 X;  3DVM A;  2FJU B;  1SL7 A;  2F3Y A;  3D75 A;  2I18 A;  3OX6 A;  2JTT A;  1DQE A;  4MZJ A;  1C07 A;  1XFW O;  1M45 A;  2M7N A;  3FE9 A;  3I5I C;  1C7W A;  1IQ3 A;  1QX2 A;  3B7A A;  1QLK A;  4PHM A;  1UWO A;  2GGZ A;  2O5G A;  2Y5I A;  5AER A;  1XVJ A;  1KK7 Z;  1SL9 A;  2OS8 C;  4GFT A;  1XYD A;  1A75 B;  4GNK B;  1J7Q A;  1CFF A;  1DGU A;  1CM4 A;  1M63 B;  2KAY A;  2PQL A;  2K60 A;  3Q8I A;  4ORA B;  4BY5 A;  1J7R A;  1EJ3 A;  1OQP A;  3EVV A;  1K9K A;  1TN4 A;  2BKI B;  3D74 A;  4USL A;  4GGN A;  1E8A A;  3S0A A;  4DIR A;  1S1E A;  2KLE A;  4GGF C;  3OGN A;  1NIW A;  1OOG A;  1WY9 A;  2L0P A;  2WCB A;  3PFV A;  5I2L A;  2HPS A;  1KWO B;  2RGI A;  1PVA A;  1RTP 1;  3EG5 B;  1K93 D;  3CWG A;  1CDM A;  5KTY A;  1WRK A;  3SS3 A;  4QJ5 B;  3SG4 A;  2LLS A;  3IF7 A;  3BFB A;  3KEV A;  3O6B A;  1B1G A;  1WDC C;  2KNE A;  4MN0 A;  1BJF A;  1KQM C;  2FCE A;  2MHH A;  1Z2C B;  1K90 D;  1JC2 A;  2K2A A;  5DKR A;  1YX8 A;  4MVF A;  1AK8 A;  2JTZ A;  2K2F A;  2QEH A;  1CLB A;  1KQM B;  1QV0 A;  1SR6 C;  2MLF C;  3KHE A;  1YVH A;  4HSZ A;  2G2B A;  2ZFD A;  3L4L A;  1R2U A;  4CPV A;  4YI8 A;  3C1V A;  1AJ5 A;  5AAN A;  3CAB A;  3OBV A;  2H61 A;  3I5G B;  1QX5 B;  4N1G A;  5ER4 X;  2D8N A;  5HKZ A;  1Y1X A;  2ZN9 A;  3CYZ A;  1KSO A;  1SL8 A;  1BR1 B;  1L2O C;  1NCZ A;  1XFV O;  1B8C A;  1UHK A;  4OV2 A;  2QPT A;  1TIZ A;  3DF0 A;  5TNC A;  1DC1 A;  2JUL A;  1H8B A;  5DIC A;  1QS7 A;  3GK1 A;  2L51 A;  3BXK A;  4TNC A;  4INW A;  1L7Z A;  3WNX B;  2WCL A;  3D0Y B;  3GK2 A;  2JWW A;  1IJ5 A;  2AAO A;  1MHO A;  1S26 D;  1SY9 A;  2QEV A;  2TN4 A;  3BJH A;  3BUN B;  3NGV A;  1GJY A;  3CZT X;  1J7P A;  2F33 A;  2F2O A;  2O60 A;  5I2O A;  1M31 A;  1QVI Y;  1TUZ A;  4YI9 A;  1B7T Y;  3S0E A;  3CDN A;  1DJY A;  2NLN A;  2WOR A;  3DD4 A;  3OHM B;  3R1V A;  1CLL A;  2M29 A;  1U5I A;  3VRN A;  1CB1 A;  3JTD C;  3RZS A;  1ZOT B;  2WC8 A;  1MXL C;  5I2Q A;  4WRI A;  2M9G A;  2ZRT A;  1YUT A;  4MLW A;  3PM2 A;  3NSK A;  1EXR A;  2LV7 A;  5HLO A;  1PAL A;  5FI7 A;  3PJI A;  1QVI Z;  4AQI A;  1BF5 A;  4CFR A;  1XA5 A;  1KFU L;  1B7T Z;  1XO5 A;  1PUL A;  2HF5 A;  2LM5 A;  4YGE B;  3MSE B;  1XK4 A;  2WC5 A;  1XFZ O;  2PAS A;  2Y4Q A;  2LUC A;  3KO0 A;  1QWV A;  4JPZ B;  3A8R A;  3CLN A;  2LC5 A;  1YRU B;  3B88 A;  3BUX B;  1S3P A;  3ICB A;  2WND A;  2OTG C;  2BAP A;  2JC2 A;  5CSF A;  5D7F A;  3BOW A;  3AAJ A;  2WCF A;  1SW8 A;  2JT3 A;  3TS5 C;  2GV5 A;  5JJG A;  3AKA A;  1TNP A;  3EKH A;  2I7A A;  2LMU A;  1LA0 A;  2BCX A;  1SK6 D;  1CFC A;  4NDB A;  2B1U A;  2K7D A;  3PSR A;  3CTN A;  4IJ7 A;  1DMO A;  3CZ0 A;  1NX2 A;  1CLM A;  1KSM A;  3LK0 A;  4ICB A;  4AQJ A;  3JVT C;  3TDZ A;  3KPX A;  4F7F A;  1DT7 B;  1Y0V H;  1GQM A;  1NSH A;  1AVS A;  3KF9 A;  2CBL A;  2JXL A;  4C0L A;  2P71 A;  1CNP A;  2WOS A;  2FJY A;  1K8U A;  4Q04 A;  1UP5 A;  3LLE A;  4OR9 B;  1HQV A;  1W7J B;  1YUU A;  2Y1N A;  3I5F B;  4M2O A;  4ORC B;  1DEK A;  2L2E A;  1ALV A;  2E30 A;  2HQ8 A;  2VRG A;  3SG3 A;  4N1F A;  5G08 A;  3S0D A;  2I2R E;  2NXQ A;  5DKQ A;  1A03 A;  3EVR A;  3VRP A;  1S6C A;  5EL2 A;  1KFX L;  2LP3 A;  2PMY A;  3V2L A;  4MRY A;  2L4H A;  3I5I B;  4C0J A;  1X02 A;  1CFD A;  3L47 A;  1JFK A;  1NP8 A;  2KYC A;  2KBM A;  4A4C A;  1QIV A;  1DGV A;  1CM1 A;  2OS8 B;  2EC6 C;  1UUS A;  4BY4 A;  3VRO A;  1QV1 A;  2WCH A;  2PRU A;  3O4Y A;  1ALW A;  2L5X B;  1IRJ A;  3I5H C;  2CT9 A;  3ZNI A;  3UNW A;  1C3Y A;  1AJ4 A;  1EG3 A;  2L4I A;  3VB1 A;  5HKW A;  2LHI A;  2Y1M A;  1MQ1 A;  2KFH A;  3CZ2 A;  4FQT A;  2E6W A;  5I8N A;  5AXI A;  2P6B B;  1HT9 A;  2F3Z A;  3S0G A;  1G8I A;  1LVC D;  1K9U A;  2EHB A;  3OB1 B;  4M2Q A;  2LLU A;  3PM8 A;  1OSA A;  1SSE B;  1DVI A;  2KYF A;  5HKY A;  1R6P A;  1A75 A;  1WDC B;  4PDZ A;  2H61 C;  2QEO A;  5J3X A;  1BG1 A;  2CTN A;  1SYM A;  4C0K A;  2LCP A;  3O2P A;  1DJX A;  1F54 A;  1K95 A;  2H2K A;  2ZRS A;  4PE0 A;  2ISD A;  2LP2 A;  1IJ6 A;  1SR6 B;  4CFQ A;  1NWD A;  2BNX A;  2M1U A;  3AKB A;  2KGB C;  2L98 A;  3DF0 B;  2LMV A;  2JNX A;  3BFH A;  4PAL A;  1TRF A;  1W9Z A;  2WC6 A;  3M0W A;  3CGA A;  3CR2 A;  1D1O A;  1H4B A;  4OCI A;  4YBH B;  1L2O B;  1SCM C;  3FWB A;  2JT0 A;  3E3R A;  1YTZ C;  1DF0 B;  2L2C A;  3FE6 A;  2K7C A;  1GGW A;  3DYE A;  1A4P A;  2BE4 A;  1OMD A;  1RJV A;  1Y1U A;  1CMF A;  1QAT A;  1JSA A;  2JPO A;  3DVK A;  3PN7 C;  1DJH A;  3CR4 X;  1DJZ A;  5K89 A;  1JBA A;  1K9P A;  3DXL A;  3WXA A;  1C7V A;  1S5G Y;  2KI4 C;  4HRG A;  5B8I B;  2HET A;  3PN7 B;  4P5O E;  3SG2 A;  4ORB B;  1Z4H A;  1EG4 A;  1MUX A;  1J1D A;  1F4Q A;  1SPY A;  2LVK A;  3BFA A;  4WQ2 A;  1ZAC A;  2L50 A;  1IG5 A;  3BUM B;  2LHL A;  4XJK B;  2JOJ A;  2MAZ A;  4PCW A;  4YGC B;  1XK4 C;  2COL B;  1LKJ A;  3JTD B;  2LVJ A;  2ZND A;  4QJ3 B;  1QTX A;  1KK8 C;  5AEQ A;  1S5G Z;  2BE6 A;  2BL0 C;  2JQ6 A;  3H4S E;  1OE9 B;  1N0Y A;  1V1F A;  3DZT A;  3D73 A;  3R1O A;  3D0Y A;  1REC A;  4UPG A;  1BLQ A;  2WCM A;  3SG7 A;  3LCP C;  1IGV A;  1ZFS A;  1PVB A;  3UO9 A;  2K8M B;  3VRR A;  1G33 A;  1YUS A;  1PK0 D;  1IQ5 A;  4A4B A;  4QJ4 B;  1B8L A;  1J1E A;  1QLS A;  2CNP A;  2JT8 A;  2M3W A;  2PVB A;  2A4J A;  1JUO A;  1NYA A;  1CDL A;  2DOQ A;  2WCJ A;  2MJW B;  1FPW A;  3NHT A;  1WLM A;  3LL8 B;  3TUY C;  4YGA A;  2OTG B;  5KSZ A;  1MF8 B;  4M2P A;  1ZUZ A;  4P2Y B;  2LVV A;  3VGO A;  5HLV A;  3RLZ A;  3TS5 B;  5GQQ C;  3TUY B;  2M49 B;  1UUR A;  1DJI A;  4NDD A;  1SBJ A;  3SIB A;  1W7I B;  4GUK A;  1BU3 A;  2CCM A;  3OP0 A;  1KCY A;  1DJW A;  2K61 A;  4MSP A;  1M39 A;  2PYQ A;  2M1K B;  4DRW A;  2SCP A;  3JVT B;  2JRF A;  1T14 A;  1NX3 A;  2G9B A;  1MR8 A;  3FS7 A;  1OOI X;  4PHN A;  1SKT A;  2F2P A;  1K2H A;  4JQ0 D;  4L9M A;  3WHT B;  5ER5 A;  3EK8 A;  4FTG A;  1YVL A;  1UHI A;  2LUX A;  3BUO B;  1NCX A;  4R1E A;  1MWN A;  1BT6 A;  1ORG A;  2KGR A;  4PE7 A;  3SG6 A;  3SS5 A;  2KOT A;  3SIA A;  1P28 A;  1FI6 A;  5FYX A;  4ETO A;  2KLD A;  1OMR A;  5CPV A;  1K96 A;  1S36 A;  2JPT A;  2ERB A;  3IQO A;  3TZ1 A;  5FI6 A;  1Q80 A;  1KQV A;  3CS1 A;  3PLF B;  3VRQ A;  1PRW A;  3GK4 X;  2ZN8 A;  1K94 A;  1F8H A;  2WCE A;  1IIO A;  1QX7 A;  2JNF A;  3S0F A;  3NSL A;  1WRL A;  1RRO A;  3A4U B;  1CDP A;  2OPO A;  2M97 A;  3B6X A;  1RWY A;  2EC6 B;  2KFG A;  4YGD B;  1DTL A;  2KAX A;  4JD9 A;  1XFU O;  5HYD A;  1TUJ A;  3SS4 A;  1CTR A;  2LNK A;  3I5H B;  1NPQ A;  2GGM A;  3NHI A;  2ZKM X;  5AFP A;  4OKH A;  2NCO A;  2FCD A;  2Q91 A;  4FQO A;  3SG5 A;  2GTE A;  4I5K A;  1ODB A;  5CSJ A;  4F0Z B;  1CFP A;  1F4O A;  1TNQ A;  3FWC A;  1CMG A;  3F45 A;  1FF1 A;  1CKK A;  1KWO C;  2SAS A;  3D76 A;  1TNW A;  4MBE A;  4OVN F;  1EH2 A;  3B87 A;  3N7H A;  1GM0 A;  3R1P A;  2JZI A;  2M8U A;  3PAL A;  1JWD A;  1TWO A;  1F55 A;  2V53 A;  1XFR A;  2AMI A;  2ZNE A;  2LAN A; 
#chains in the Genus database with same CATH homology
 2BCB A;  1TNX A;  2IS9 A;  4GGF A;  1TCO B;  1A29 A;  2HQW A;  2JU0 A;  1IKU A;  4ZCV A;  1V1G A;  5F6T A;  3DVJ A;  3TDI A;  1IH0 A;  4DUQ A;  2PSR A;  1OOJ A;  1WRZ A;  3BUW B;  3EK4 A;  3PAT A;  2M7L A;  2MA2 A;  1Y6W A;  1OZS A;  2KBI A;  2KFF A;  4GPL B;  2Q4U A;  3GOF A;  1YRT B;  2M0R A;  2PAL A;  1SCM B;  2K7O A;  1FW4 A;  1TTX A;  3I5G C;  2NZ0 A;  1QIW A;  4MRX A;  1YUR A;  4E68 A;  2R2I A;  1J55 A;  2JXC A;  1U5I B;  3EK7 A;  5CSI A;  3LK1 A;  1NUB A;  3D10 A;  1KFU S;  4HRH A;  1XFY O;  2KI4 B;  4GBA A;  3EKJ A;  4MZK A;  4AOM A;  2I94 A;  1SRA A;  4D1E A;  1EL4 A;  2KDH A;  1BOD A;  1AUI B;  4I5N B;  3O78 A;  2MLE C;  1ZMZ A;  2MBX A;  4JWQ A;  1BOC A;  3OX5 A;  1A2X A;  1FI5 A;  1N65 A;  1DF0 A;  4PE4 A;  4PE1 A;  1KK8 B;  2KI6 C;  3HCM A;  4NQG A;  1B8R A;  1SMG A;  2KHN A;  3AAK A;  1B4C A;  1GGZ A;  2BBN A;  2BL0 B;  3QRX A;  1AHR A;  1PSB A;  4CID A;  1WLZ A;  4N5X A;  3BOW B;  4MZL A;  2QAC A;  3WHU B;  3SJS A;  1AP4 A;  2LAP A;  1QAS A;  1TCF A;  2EGD A;  2BEC A;  3NSI A;  5PAL A;  1RK9 A;  4MEW A;  1IWQ A;  2CXJ A;  4XJK A;  4CLN A;  1XFX O;  2K7B A;  4YGB B;  1LA3 A;  5JOL A;  4I5L B;  1SCV A;  3RM1 A;  3OB2 B;  2F8P A;  4YRU A;  1QXP A;  2LMT A;  2AUC A;  1NX1 A;  1NX0 A;  1F71 A;  3EVU A;  4DS7 A;  1F70 A;  5IBW A;  4NDC A;  1LIN A;  1RFJ A;  3BQ3 A;  5D69 A;  1KFX S;  1NCY A;  1LXF C;  1MXE A;  1UHN A;  3FIA A;  1JF2 A;  2KQ6 A;  2KSP A;  2BBM A;  5KU1 A;  3NXA A;  4GAO A;  2NCP A;  4I5J A;  1FBV A;  3IQQ A;  4IL1 A;  5CSN A;  4U8D A;  4HRE E;  1SNL A;  4WQ3 A;  4XYN A;  1DJG A;  4DCK A;  2KI6 D;  2MRD A;  2KAV A;  1B9A A;  1YX7 A;  5BPJ A;  3NSO A;  1JF0 A;  1J7O A;  1JFJ A;  1OMV A;  2LE9 B;  1PSR A;  2LLT A;  4PHK A;  2BCA A;  2KQY A;  4PHJ A;  2K0J A;  1CDN A;  1OZO A;  3ZWH A;  1UHJ A;  2LVI A;  1N2D A;  3I5F C;  3TDU A;  1UHH A;  3BYA A;  1BR4 B;  2FOT A;  3HX4 A;  3K21 A;  5DKN A;  1YR5 A;  1Y1A A;  1B47 A;  1S6I A;  2BKH B;  1KK7 Y;  1S6J A;  1M46 A;  1TOP A;  3DVE A;  1G4Y R;  1BMO A;  1VRK A;  4ZCU A;  1QJT A;  3CR5 X;  3DVM A;  2FJU B;  1SL7 A;  2F3Y A;  2I18 A;  3OX6 A;  2JTT A;  4MZJ A;  1C07 A;  1XFW O;  1M45 A;  2M7N A;  3I5I C;  1C7W A;  1IQ3 A;  1QX2 A;  1QLK A;  4PHM A;  1UWO A;  2GGZ A;  2O5G A;  2Y5I A;  5AER A;  1XVJ A;  1KK7 Z;  1SL9 A;  2OS8 C;  4GFT A;  1XYD A;  1A75 B;  4GNK B;  1J7Q A;  1CFF A;  1DGU A;  1CM4 A;  1M63 B;  2KAY A;  4BY5 A;  4ORA B;  1J7R A;  1EJ3 A;  1OQP A;  3EVV A;  1K9K A;  1TN4 A;  2BKI B;  4USL A;  4GGN A;  1E8A A;  4DIR A;  1S1E A;  4GGF C;  1NIW A;  1WY9 A;  2L0P A;  3PFV A;  2WCB A;  5I2L A;  2HPS A;  1KWO B;  2RGI A;  1PVA A;  1RTP 1;  1K93 D;  3CWG A;  1CDM A;  5KTY A;  1WRK A;  4QJ5 B;  3SG4 A;  2LLS A;  3IF7 A;  3KEV A;  3O6B A;  1B1G A;  1WDC C;  2KNE A;  4MN0 A;  1BJF A;  1KQM C;  2FCE A;  2MHH A;  1K90 D;  1JC2 A;  2K2A A;  5DKR A;  1YX8 A;  4MVF A;  1AK8 A;  2JTZ A;  2K2F A;  1CLB A;  1KQM B;  1QV0 A;  1SR6 C;  2MLF C;  3KHE A;  1YVH A;  4HSZ A;  2G2B A;  2ZFD A;  1R2U A;  4CPV A;  4YI8 A;  3C1V A;  1AJ5 A;  5AAN A;  2H61 A;  3I5G B;  1QX5 B;  4N1G A;  5ER4 X;  2D8N A;  5HKZ A;  1Y1X A;  2ZN9 A;  1KSO A;  1SL8 A;  1BR1 B;  1L2O C;  1NCZ A;  1XFV O;  1B8C A;  1UHK A;  4OV2 A;  2QPT A;  1TIZ A;  3DF0 A;  5TNC A;  1H8B A;  2JUL A;  1QS7 A;  3GK1 A;  2L51 A;  3BXK A;  4TNC A;  1L7Z A;  3WNX B;  3D0Y B;  3GK2 A;  2JWW A;  1IJ5 A;  2AAO A;  1MHO A;  1S26 D;  1SY9 A;  2TN4 A;  3BUN B;  1GJY A;  3CZT X;  1J7P A;  2F33 A;  2F2O A;  2O60 A;  5I2O A;  1M31 A;  1QVI Y;  4YI9 A;  1B7T Y;  1DJY A;  2NLN A;  2WOR A;  3DD4 A;  3OHM B;  1CLL A;  2M29 A;  1U5I A;  3VRN A;  1CB1 A;  3JTD C;  1ZOT B;  2WC8 A;  1MXL C;  5I2Q A;  4WRI A;  2M9G A;  2ZRT A;  1YUT A;  4MLW A;  3NSK A;  1EXR A;  2LV7 A;  5HLO A;  1PAL A;  1QVI Z;  4AQI A;  1BF5 A;  4CFR A;  1XA5 A;  1KFU L;  1B7T Z;  1XO5 A;  1PUL A;  2HF5 A;  2LM5 A;  4YGE B;  3MSE B;  1XK4 A;  1XFZ O;  2PAS A;  2Y4Q A;  2LUC A;  3KO0 A;  4JPZ B;  3A8R A;  3CLN A;  2LC5 A;  1YRU B;  3BUX B;  1S3P A;  3ICB A;  2WND A;  2OTG C;  2JC2 A;  5CSF A;  5D7F A;  3BOW A;  3AAJ A;  2WCF A;  1SW8 A;  2JT3 A;  3TS5 C;  2GV5 A;  5JJG A;  3AKA A;  1TNP A;  3EKH A;  2I7A A;  2LMU A;  1LA0 A;  2BCX A;  1SK6 D;  1CFC A;  4NDB A;  2B1U A;  2K7D A;  3PSR A;  3CTN A;  1DMO A;  1NX2 A;  1CLM A;  1KSM A;  3LK0 A;  4ICB A;  4AQJ A;  3JVT C;  3TDZ A;  3KPX A;  1DT7 B;  1Y0V H;  1GQM A;  1NSH A;  1AVS A;  3KF9 A;  2CBL A;  2JXL A;  4C0L A;  1CNP A;  2WOS A;  1K8U A;  4Q04 A;  1UP5 A;  3LLE A;  4OR9 B;  1HQV A;  1W7J B;  1YUU A;  2Y1N A;  3I5F B;  4M2O A;  4ORC B;  2L2E A;  1ALV A;  2E30 A;  2HQ8 A;  2VRG A;  3SG3 A;  4N1F A;  5G08 A;  2I2R E;  2NXQ A;  5DKQ A;  1A03 A;  3EVR A;  3VRP A;  1S6C A;  1KFX L;  2LP3 A;  2PMY A;  4MRY A;  2L4H A;  3I5I B;  4C0J A;  1X02 A;  1CFD A;  1JFK A;  1NP8 A;  2KYC A;  2KBM A;  4A4C A;  1QIV A;  1DGV A;  1CM1 A;  2OS8 B;  2EC6 C;  1UUS A;  4BY4 A;  3VRO A;  1QV1 A;  2PRU A;  3O4Y A;  1ALW A;  2L5X B;  1IRJ A;  3I5H C;  2CT9 A;  3ZNI A;  1AJ4 A;  1EG3 A;  2L4I A;  5HKW A;  2LHI A;  2Y1M A;  1MQ1 A;  2KFH A;  2E6W A;  5I8N A;  5AXI A;  2P6B B;  1HT9 A;  2F3Z A;  1G8I A;  1LVC D;  1K9U A;  2EHB A;  3OB1 B;  4M2Q A;  2LLU A;  3PM8 A;  1OSA A;  1DVI A;  2KYF A;  5HKY A;  1R6P A;  1A75 A;  1WDC B;  4PDZ A;  2H61 C;  5J3X A;  1BG1 A;  2CTN A;  1SYM A;  4C0K A;  2LCP A;  3O2P A;  1DJX A;  1F54 A;  1K95 A;  2H2K A;  2ZRS A;  4PE0 A;  2ISD A;  2LP2 A;  1IJ6 A;  1SR6 B;  4CFQ A;  1NWD A;  2M1U A;  3AKB A;  2KGB C;  2L98 A;  3DF0 B;  2LMV A;  2JNX A;  4PAL A;  1TRF A;  3M0W A;  3CGA A;  3CR2 A;  1D1O A;  1H4B A;  4OCI A;  4YBH B;  1L2O B;  1SCM C;  3FWB A;  2JT0 A;  3E3R A;  1YTZ C;  1DF0 B;  2K7C A;  1GGW A;  1CMF A;  1A4P A;  2BE4 A;  1OMD A;  1RJV A;  1Y1U A;  1JSA A;  1QAT A;  3DVK A;  3PN7 C;  1DJH A;  3CR4 X;  1DJZ A;  5K89 A;  1JBA A;  1K9P A;  3WXA A;  1C7V A;  1S5G Y;  2KI4 C;  4HRG A;  5B8I B;  2HET A;  3PN7 B;  4P5O E;  3SG2 A;  4ORB B;  1EG4 A;  1MUX A;  1J1D A;  1F4Q A;  1SPY A;  2LVK A;  4WQ2 A;  1ZAC A;  2L50 A;  1IG5 A;  3BUM B;  2LHL A;  4XJK B;  2JOJ A;  2MAZ A;  4PCW A;  4YGC B;  1XK4 C;  2COL B;  1LKJ A;  3JTD B;  2LVJ A;  2ZND A;  4QJ3 B;  1QTX A;  1KK8 C;  5AEQ A;  1S5G Z;  2BE6 A;  2BL0 C;  2JQ6 A;  3H4S E;  1OE9 B;  1N0Y A;  1V1F A;  3D0Y A;  1REC A;  4UPG A;  1BLQ A;  3SG7 A;  3LCP C;  1IGV A;  1ZFS A;  1PVB A;  3VRR A;  2K8M B;  1G33 A;  1YUS A;  1PK0 D;  1IQ5 A;  4A4B A;  4QJ4 B;  1B8L A;  1J1E A;  1QLS A;  2CNP A;  2JT8 A;  2M3W A;  2PVB A;  2A4J A;  1JUO A;  1NYA A;  1CDL A;  2DOQ A;  2MJW B;  1FPW A;  1WLM A;  3LL8 B;  3TUY C;  4YGA A;  2OTG B;  5KSZ A;  1MF8 B;  4M2P A;  1ZUZ A;  4P2Y B;  2LVV A;  3VGO A;  5HLV A;  3RLZ A;  3TS5 B;  5GQQ C;  3TUY B;  2M49 B;  1UUR A;  1DJI A;  4NDD A;  1SBJ A;  3SIB A;  1W7I B;  4GUK A;  1BU3 A;  2CCM A;  3OP0 A;  1KCY A;  1DJW A;  2K61 A;  4MSP A;  1M39 A;  2M1K B;  4DRW A;  2SCP A;  3JVT B;  2JRF A;  2G9B A;  1NX3 A;  3FS7 A;  1MR8 A;  4PHN A;  1SKT A;  2F2P A;  1K2H A;  4JQ0 D;  4L9M A;  3WHT B;  5ER5 A;  3EK8 A;  4FTG A;  1YVL A;  1UHI A;  2LUX A;  3BUO B;  1NCX A;  4R1E A;  1MWN A;  1BT6 A;  3SG6 A;  2KGR A;  4PE7 A;  2KOT A;  3SIA A;  1FI6 A;  5FYX A;  4ETO A;  1OMR A;  5CPV A;  1K96 A;  1S36 A;  2JPT A;  3IQO A;  3TZ1 A;  1Q80 A;  1KQV A;  3CS1 A;  3PLF B;  3VRQ A;  1PRW A;  3GK4 X;  2ZN8 A;  1K94 A;  1F8H A;  2WCE A;  1QX7 A;  2JNF A;  3NSL A;  1WRL A;  1RRO A;  3A4U B;  1CDP A;  2OPO A;  2M97 A;  1RWY A;  2EC6 B;  2KFG A;  4YGD B;  1DTL A;  2KAX A;  1XFU O;  5HYD A;  1CTR A;  2LNK A;  3I5H B;  1NPQ A;  2GGM A;  2ZKM X;  5AFP A;  4OKH A;  2NCO A;  2FCD A;  2Q91 A;  4FQO A;  3SG5 A;  4I5K A;  1ODB A;  5CSJ A;  4F0Z B;  1CFP A;  1F4O A;  1TNQ A;  3FWC A;  1CMG A;  3F45 A;  1FF1 A;  1CKK A;  1KWO C;  2SAS A;  1TNW A;  4MBE A;  4OVN F;  1EH2 A;  2JZI A;  2M8U A;  3PAL A;  1JWD A;  1F55 A;  2V53 A;  2AMI A;  2ZNE A;  2LAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...