4AQJA

Structure of human s100a7 d24g bound to zinc and calcium
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDGKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords PROTEIN S100-A7
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqjA00
1XFYO 1CLMA 2RGIA 1J55A 1CDPA 1EJ3A 3D0YB 3M0WA 2EGDA 3JTDB 1S5GZ 3VROA 2L2EA 1OE9B 2ZNEA 2L4HA 1RFJA 2AUCA 2BBMA 2I94A 1Y1XA 2JWWA 2SCPA 1NX2A 1DJXA 2SASA 1PVBA 2KGRA 4MRXA 5CSNA 3WHTB 2LHIA 1IJ6A 4USLA 2F3ZA 2LMTA 1W7JB 1XK4C 3PFVA 3WHUB 5HLVA 2LHLA 3NSKA 1KSOA 1QVIY 2KFFA 3OB2B 3SG2A 2OTGC 4PHNA 4DUQA 1OMDA 3ZNIA 4MVFA 4CFQA 4XJKB 3SIBA 1QLKA 1SL7A 1SMGA 1Y0VH 2EHBA 4YI9A 4HREE 1SY9A 1JF2A 2F8PA 3LL8B 1B7TY 3WXAA 4OCIA 1F8HA 1IJ5A 3BUOB 2KI6C 1SW8A 2WORA 3CS1A 1U5IA 1TNQA 3LCPC 5JJGA 1R6PA 1JFKA 4AQJA 4DS7A 2KSPA 1AJ4A 1IRJA 2MRDA 1LKJA 2GGMA 2KQ6A 3A4UB 1L2OC 4I5JA 5FYXA 4ETOA 1HT9A 1QJTA 1AHRA 2PMYA 2JT3A 2LLTA 1ZOTB 2L4IA 1B4CA 4OR9B 1UURA 4ZCVA 2TN4A 1AVSA 4PE4A 2LE9B 2LCPA 3AKAA 4CIDA 5JOLA 4PE7A 1CLLA 5KU1A 3OX5A 1CFDA 4DCKA 1XFVO 2L0PA 3HCMA 1XYDA 3PM8A 3IQOA 1SCMC 2HQWA 1TCOB 2K7DA 1CLBA 3JTDC 1QVIZ 1UUSA 2CTNA 1S36A 2H2KA 4PE1A 3I5HB 1YRTB 4ICBA 3TS5C 4YGEB 2BCBA 3HX4A 5CSFA 5TNCA 2R2IA 1XVJA 1K95A 5DKQA 2LLUA 3O2PA 1B7TZ 4QJ4B 5CSJA 1AUIB 2MAZA 2PRUA 3D0YA 3ICBA 1SRAA 4U8DA 2NLNA 3SG5A 1KSMA 1MR8A 2JT8A 3SJSA 2K7BA 2LP3A 3SG3A 4ORBB 1BR4B 2FCDA 1KFUL 3I5IC 1M39A 4HSZA 1DJGA 1SR6C 1SYMA 3IQQA 1DJZA 2CXJA 3MSEB 5G08A 4A4BA 1EXRA 3KPXA 4YGBB 4D1EA 2JTZA 1IGVA 3BXKA 3TUYC 3GK2A 1NIWA 3CLNA 1OZSA 2PSRA 4ORAB 1SCVA 1DT7B 2M0RA 2OS8C 5KSZA 1UHJA 1FBVA 4M2PA 1IH0A 1BLQA 1CB1A 2BL0C 3I5IB 2BE4A 1B8LA 2E6WA 2JPTA 3JVTC 5BPJA 2HQ8A 1L7ZA 3CR4X 4BY4A 1RROA 4GNKB 1YUUA 3BOWB 1TNWA 3AAKA 1S26D 1QLSA 1YUSA 1PRWA 2KYCA 1AJ5A 2GGZA 1PSRA 1NYAA 5CSIA 3GK1A 4WQ2A 1SL8A 1CNPA 1KQMB 1YX7A 1EG4A 2I2RE 4JWQA 1K9PA 1WRLA 3EVUA 4M2OA 4MSPA 2L51A 4TNCA 1HQVA 1K94A 1KQVA 3BOWA 3I5HC 1QV1A 1SR6B 4JPZB 1OOJA 2L5XB 1RWYA 4YGCB 4C0LA 5F6TA 1YRUB 1KFXL 3BQ3A 3D10A 4MRYA 2ZNDA 2O60A 2E30A 2CCMA 2BE6A 2BKIB 1VRKA 2WC8A 1A29A 1G8IA 3O4YA 2MJWB 1Q80A 1A2XA 2VRGA 1EL4A 4PHJA 4ZCUA 2M49B 1A03A 1QX5B 1LA3A 1YTZC 4GGFA 1B47A 1M45A 1SKTA 1K9KA 2M8UA 4OV2A 2BL0B 1Y1UA 1KK8C 2JZIA 2BKHB 2KI4C 3E3RA 5AEQA 2Q91A 3CTNA 2KBMA 1NX3A 2H61A 2PASA 2KAYA 1NUBA 1CDLA 2MLEC 4JQ0D 1CMGA 2MA2A 1KWOC 4GGFC 1QX2A 1XFWO 2LVVA 1WLZA 3BUNB 4PDZA 3BUMB 3EKHA 1A75A 1V1FA 1YURA 3WNXB 2F2OA 2AAOA 3JVTB 2NXQA 2M97A 3LK0A 1D1OA 1DF0A 2LV7A 2KI4B 4L9MA 5KTYA 2K61A 1CTRA 1BJFA 1W7IB 2NCOA 1CFCA 1FF1A 1F4OA 4NDBA 1DJIA 2ZKMX 1K96A 1GGWA 1IG5A 3QRXA 4FQOA 3AKBA 1FI6A 4E68A 4C0KA 2PALA 3VGOA 1WY9A 2LMVA 2A4JA 5D69A 2LANA 1BU3A 1FI5A 2LLSA 3H4SE 5I8NA 2LAPA 4QJ5B 3BUWB 3CZTX 1PALA 1Y6WA 1XO5A 3F45A 4GFTA 5ER5A 5HKZA 3LLEA 2KAXA 3VRRA 5HYDA 1WLMA 1IQ5A 4GGNA 1C7WA 1DVIA 1QXPA 1DJWA 2BCXA 1K90D 3PATA 1WRKA 4P2YB 1B8CA 1DF0B 1IWQA 1SBJA 1Y1AA 1XA5A 1UHNA 2JNFA 1KQMC 4YBHB 1MF8B 2GV5A 4GAOA 2MHHA 3DF0A 1AK8A 1QIWA 1CFFA 3TS5B 4N5XA 1AP4A 4MZLA 3SG7A 1KK7Y 4CLNA 1JUOA 2JXCA 2ZRSA 1PK0D 2ZFDA 3NSIA 2WOSA 2JULA 3TDUA 2L50A 1S6JA 3DF0B 1KFXS 2M7NA 1ALVA 1S3PA 2JC2A 1TNPA 3LK1A 2NZ0A 4YGDB 4PALA 3DVJA 4OKHA 4PE0A 4QJ3B 4NDDA 1FW4A 3DVMA 4AOMA 2LVKA 1J7RA 1YX8A 3I5FB 2WCBA 2COLB 4UPGA 3RM1A 2KBIA 2K7CA 1CM4A 4PHKA 1E8AA 1TNXA 1KK8B 2EC6C 1DJHA 3C1VA 1GQMA 1RJVA 5I2OA 1DTLA 1QASA 2BBNA 3RLZA 3NSLA 4HRGA 1C7VA 3BYAA 1UHKA 1LINA 2CBLA 3BUXB 4N1GA 3OX6A 5HKWA 4HRHA 2K0JA 1JBAA 1JWDA 1EG3A 1IQ3A 1PVAA 1KWOB 3CR5X 1CMFA 4IL1A 1DGVA 2JOJA 3KO0A 2LUXA 1K2HA 1QTXA 1ZMZA 1JFJA 1JF0A 2F3YA 1NCXA 3EK4A 3NSOA 1MWNA 2OS8B 5HKYA 2H61C 2JNXA 2NCPA 1QV0A 2BECA 1BT6A 1MXEA 2LC5A 3FIAA 4MBEA 1KFUS 1L2OB 4I5LB 1J7PA 3GOFA 4XJKA 5GQQC 1J7QA 3VRNA 3VRPA 1TN4A 3NXAA 5CPVA 4P5OE 1F55A 3AAJA 3SG6A 4MZJA 3OP0A 4GBAA 1S5GY 3O6BA 1TOPA 1U5IB 5K89A 3FWCA 1BMOA 2EC6B 2M29A 2HETA 4R1EA 1V1GA 1F4QA 1LXFC 1NCZA 2Y1MA 3PLFB 4MN0A 4F0ZB 4MEWA 1BF5A 2Y1NA 1S1EA 1EH2A 2FCEA 3EKJA 3EK8A 1JC2A 1M46A 1UP5A 1PULA 3PALA 1KCYA 4NDCA 1BOCA 4GPLB 1X02A 1ODBA 1J1EA 1XK4A 1XFUO 2LUCA 4NQGA 1QIVA 1OZOA 2D8NA 1DGUA 4A4CA 2KFHA 3DVKA 2ZN8A 2O5GA 1SCMB 2KFGA 3PSRA 4YRUA 4CPVA 1DMOA 2LM5A 1GJYA 2KI6D 2LVJA 2FOTA 4BY5A 2B1UA 1NX1A 2KNEA 1XFZO 1TRFA 1CDMA 1GGZA 5ER4X 3TZ1A 1YUTA 3CWGA 1B9AA 1J7OA 2F2PA 3DD4A 5D7FA 2I7AA 2JTTA 1F54A 1BG1A 1YVLA 1N0YA 2M1UA 1PSBA 2JU0A 1C07A 1CFPA 1N2DA 3A8RA 1K9UA 2MBXA 1NX0A 5AANA 1M31A 1QATA 1WRZA 2LP2A 1M63B 2OPOA 5DKRA 2LVIA 2I18A 1ALWA 1OMRA 4N1FA 5B8IB 4MZKA 4DIRA 1SNLA 2LNKA 3PN7B 4M2QA 3EVRA 4MLWA 2F33A 5J3XA 4DRWA 1NP8A 2P6BB 2KDHA 4XYNA 1DJYA 2K7OA 4I5KA 2M1KB 1WDCB 2WCEA 1K8UA 3I5FC 4YI8A 2Y5IA 2WCFA 5AERA 3GK4X 1S6IA 3EK7A 1H8BA 1B8RA 1YVHA 3KF9A 2CNPA 3TDIA 1K93D 1SL9A 1FPWA 4WQ3A 2Q4UA 1NCYA 2DOQA 1KK7Z 4FTGA 1ZUZA 1MUXA 2QACA 2K2FA 3FWBA 1SK6D 1MHOA 5DKNA 1J1DA 2KQYA 1NPQA 1OMVA 2V53A 2K2AA 1RECA 1G4YR 1RK9A 1CM1A 3K21A 3OHMB 1CDNA 1XFXO 2JQ6A 1MXLC 1QS7A 3EVVA 5AFPA 1JSAA 4PCWA 1NWDA 2BCAA 4Q04A 5IBWA 2M9GA 2KGBC 2JRFA 1WDCC 5HLOA 1G33A 2IS9A 1TCFA 2CT9A 5I2LA 2HPSA 4PHMA 4YGAA 1UHHA 3SG4A 2OTGB 5AXIA 5I2QA 1N65A 3KHEA 3KEVA 2G2BA 3I5GB 1BODA 1BR1B 2FJUB 1IKUA 1A4PA 3I5GC 4C0JA 1F71A 4CFRA 1ZACA 2JXLA 2ISDA 1H4BA 2M7LA 2ZN9A 1R2UA 2WNDA 3DVEA 1ZFSA 2G9BA 3IF7A 2HF5A 1SPYA 2PVBA 1OQPA 1B1GA 2KOTA 2KAVA 1QX7A 1OSAA 2KYFA 3CR2A 4WRIA 2LMUA 1F70A 1S6CA 1UHIA 2M3WA 3VRQA 2K8MB 3FS7A 4I5NB 1LA0A 4OVNF 1CKKA 4GUKA 3SIAA 1LVCD 2JT0A 3TDZA 3PN7C 1MQ1A 2MLFC 4AQIA 1UWOA 3OB1B 1RTP1 2KHNA 2Y4QA 4ORCB 2QPTA 1NSHA 5PALA 1A75B 2AMIA 3O78A 3ZWHA 2ZRTA 1TTXA 3TUYB 1YR5A 1TIZA 2L98A 3CGAA
chains in the Genus database with same CATH superfamily
1XFYO 1CLMA 2RGIA 1J55A 1CDPA 1EJ3A 3D0YB 3M0WA 2EGDA 3JTDB 1S5GZ 3VROA 2L2EA 1OE9B 2ZNEA 2L4HA 1RFJA 2AUCA 2BBMA 2I94A 1Y1XA 2JWWA 2SCPA 1NX2A 1DJXA 2FJYA 1PVBA 2KGRA 2SASA 4MRXA 5CSNA 3WHTB 4JKTA 3IVTA 2LHIA 1IJ6A 4USLA 2F3ZA 2LMTA 1DQEA 1W7JB 1XK4C 3PFVA 3WHUB 2QEOA 5HLVA 2LHLA 3NSKA 1KSOA 1QVIY 2KFFA 3OB2B 3SG2A 2OTGC 4PHNA 4DUQA 2KLDA 1OMDA 3ZNIA 4MVFA 4CFQA 4XJKB 2WCJA 3NHIA 3SIBA 1QLKA 1SL7A 1SMGA 1Y0VH 2EHBA 3K1EA 3Q8IA 4HREE 1SY9A 3FE9A 4YI9A 1JF2A 2F8PA 3LL8B 1B7TY 3WXAA 4OCIA 2YGUA 1F8HA 1IJ5A 3BUOB 2KI6C 4F7FA 1SW8A 2WORA 3PJIA 3R1PA 3CS1A 1U5IA 1TNQA 3LCPC 5JJGA 1C3ZA 1JFKA 1R6PA 4AQJA 4DS7A 2KSPA 1AJ4A 1IRJA 2MRDA 1LKJA 2GGMA 2KQ6A 2PQLA 3A4UB 1L2OC 3B87A 4I5JA 5FYXA 4ETOA 1HT9A 1QJTA 1AHRA 2PMYA 2JT3A 2LLTA 1ZOTB 2L4IA 1B4CA 4OR9B 1UURA 4ZCVA 2TN4A 1AVSA 4PE4A 3D73A 2LE9B 2LCPA 3AKAA 4CIDA 5JOLA 4PE7A 1CLLA 5KU1A 3OX5A 1CFDA 4DCKA 1XFVO 2L0PA 3HCMA 1XYDA 3PM8A 2QEBA 3IQOA 3R1OA 1SCMC 1TWOA 2HQWA 1TCOB 2K7DA 1CLBA 3JTDC 1QVIZ 1UUSA 2CTNA 1S36A 2H2KA 4PE1A 3S0FA 3I5HB 1YRTB 4ICBA 3TS5C 4YGEB 2BCBA 3HX4A 4KYNA 5CSFA 5TNCA 2R2IA 1XVJA 1K95A 5DKQA 2LLUA 3O2PA 1B7TZ 4QJ4B 1P28A 1OOIX 5CSJA 1AUIB 2MAZA 2PRUA 3D0YA 3ICBA 1SRAA 4U8DA 2NLNA 3SG5A 1KSMA 1MR8A 2JT8A 5D3OA 2K7BA 3OBVA 3SJSA 2LP3A 3SG3A 3BFBA 4ORBB 1BR4B 2FCDA 1KFUL 3CYZA 3I5IC 1M39A 4HSZA 1DJGA 1SR6C 1SYMA 3IQQA 1DJZA 2CXJA 3MSEB 5G08A 4A4BA 1EXRA 3KPXA 4OZDA 4YGBB 2JTZA 4D1EA 1IGVA 3BXKA 3TUYC 3GK2A 1NIWA 3CLNA 1OZSA 2PSRA 4ORAB 1SCVA 1DT7B 2M0RA 2OS8C 5KSZA 1UHJA 1FBVA 4M2PA 1IH0A 1BLQA 5I94A 1CB1A 3R1VA 4INWA 2BL0C 3I5IB 2BE4A 1B8LA 2E6WA 2JPTA 3D77A 3FE8A 3JVTC 5BPJA 2HQ8A 1L7ZA 3CR4X 4BY4A 1RROA 4GNKB 1YUUA 3BOWB 1TNWA 3AAKA 1S26D 1QLSA 1YUSA 1PRWA 2KYCA 3D78A 1AJ5A 2GGZA 1PSRA 1NYAA 5CSIA 3GK1A 4WQ2A 1SL8A 3BJHA 1KQMB 1YX7A 1EG4A 2I2RE 4JWQA 1K9PA 1WRLA 3EVUA 4M2OA 4MSPA 2L51A 4TNCA 1HQVA 1K94A 1DEKA 1KQVA 3BOWA 3I5HC 1QV1A 1LS8A 1SR6B 1OOJA 4JPZB 2L5XB 1RWYA 4YGCB 4C0LA 5F6TA 1YRUB 3V2LA 1KFXL 3BQ3A 3D10A 4MRYA 2ZNDA 2O60A 2E30A 2CCMA 2BE6A 2BKIB 1VRKA 2WC8A 1A29A 1G8IA 2ERBA 3O4YA 2MJWB 1Q80A 3SS3A 3RZSA 1A2XA 2VRGA 1EL4A 4PHJA 4ZCUA 2M49B 3SS5A 2H8VA 1QX5B 1LA3A 1YTZC 4GGFA 1B47A 1M45A 1SKTA 1A03A 1K9KA 2M8UA 4OV2A 1DC1A 2BL0B 3L4LA 3B6XA 1Y1UA 1KK8C 2JZIA 2BKHB 2KI4C 3E3RA 5AEQA 2Q91A 3VB1A 1Z2CB 3CTNA 3CDNA 2KBMA 1NX3A 2H61A 2PASA 2KAYA 1NUBA 1CDLA 2MLEC 4JQ0D 1GM0A 1CMGA 3L4AA 2MA2A 1KWOC 4GGFC 1QX2A 1XFWO 2LVVA 1WLZA 3BUNB 4PDZA 3BUMB 3EKHA 1A75A 1V1FA 1YURA 3WNXB 2F2OA 2AAOA 3JVTB 2NXQA 2M97A 3LK0A 1D1OA 1DF0A 2LV7A 2KI4B 4L9MA 5KTYA 2K61A 1CTRA 1BJFA 1OW4A 1T14A 1W7IB 2NCOA 2PYQA 1CFCA 3DXLA 1FF1A 1F4OA 4NDBA 1DJIA 2ZKMX 1K96A 1GGWA 1IG5A 3QRXA 4FQOA 3AKBA 1FI6A 4E68A 4C0KA 2PALA 3VGOA 1WY9A 2LMVA 2A4JA 5D69A 2LANA 1BU3A 1FI5A 2LLSA 3H4SE 5I8NA 2LAPA 4QJ5B 3BUWB 2WC6A 1PALA 1Y6WA 1XO5A 3CZTX 3F45A 4GFTA 5ER5A 3LLEA 5HKZA 2KAXA 3VRRA 5HYDA 1WLMA 1IQ5A 4GGNA 1C7WA 1DVIA 1QXPA 1DJWA 2BCXA 1DELA 1K90D 3PATA 1WRKA 4P2YB 1B8CA 1DF0B 1IWQA 1SBJA 1Y1AA 2JPOA 1XA5A 1UHNA 2JNFA 1KQMC 4YBHB 1MF8B 2GV5A 4GAOA 2MHHA 3DF0A 1AK8A 1QIWA 1CFFA 3TS5B 4N5XA 1AP4A 4MZLA 3SG7A 1KK7Y 4CLNA 1JUOA 2JXCA 2ZRSA 1PK0D 2ZFDA 3NSIA 2WOSA 4R1EA 3O4XA 2JULA 3TDUA 2L50A 1S6JA 3DF0B 1KFXS 2M7NA 1ALVA 1S3PA 2JC2A 1TNPA 3B88A 3LK1A 2NZ0A 4YGDB 4PALA 3DVJA 4OKHA 4PE0A 4QJ3B 3N7HA 4NDDA 1FW4A 3DVMA 2WCMA 4AOMA 2WCKA 2LVKA 1J7RA 1YX8A 3FE6A 3I5FB 2WCBA 2COLB 4UPGA 3UNWA 3RM1A 2KBIA 2K7CA 1CM4A 4PHKA 1E8AA 1TNXA 1KK8B 2EC6C 1DJHA 3C1VA 1GQMA 1RJVA 5I2OA 1DTLA 1QASA 2BBNA 2L5YA 2QEHA 3D75A 3RLZA 3NSLA 4HRGA 3S0EA 3CABA 1C7VA 3BYAA 1UHKA 1LINA 2CBLA 3BUXB 4N1GA 3OX6A 5HKWA 4HRHA 2K0JA 1JBAA 1JWDA 1EG3A 1IQ3A 1PVAA 1KWOB 2GTEA 3CR5X 1CMFA 4IL1A 1DGVA 2JOJA 3KO0A 2LUXA 1K2HA 1QTXA 3EG5B 1ZMZA 3D74A 1JFJA 1JF0A 2F3YA 1NCXA 3EK4A 3NSOA 1MWNA 2OS8B 5HKYA 2H61C 2JNXA 2NCPA 1QV0A 2BECA 2WCLA 1BT6A 1MXEA 2L2CA 2LC5A 3FIAA 4MBEA 1KFUS 1L2OB 4I5LB 2P70A 1J7PA 3GOFA 4XJKA 3NGVA 5GQQC 1J7QA 3VRNA 3VRPA 2BAPA 1TN4A 3NXAA 5CPVA 4P5OE 1F55A 3AAJA 3SG6A 4MZJA 3OP0A 4GBAA 4PT1A 1S5GY 3O6BA 1TOPA 1U5IB 5K89A 3FWCA 1BMOA 2EC6B 2KLEA 2HETA 2M29A 1V1GA 1F4QA 1LXFC 1NCZA 2Y1MA 3PLFB 4MN0A 4F0ZB 4MEWA 1BF5A 2Y1NA 1S1EA 1EH2A 2FCEA 3DZTA 3DYEA 3EKJA 3EK8A 1JC2A 1M46A 1UP5A 1PULA 3PALA 1KCYA 4NDCA 1BOCA 4GPLB 1X02A 1ODBA 1J1EA 1ORGA 1XK4A 1XFUO 4INXA 2LUCA 4NQGA 1QIVA 1OZOA 2D8NA 3BFHA 4FQTA 1DGUA 4A4CA 2KFHA 3DVKA 5FI6A 2ZN8A 3B7AA 2O5GA 3S0GA 1SCMB 2KFGA 3CZ1A 3PSRA 4YRUA 4CPVA 1DMOA 1C3YA 1SSEB 2LM5A 1GJYA 2KI6D 2LVJA 3SS4A 2FOTA 4BY5A 2QDIA 3UO9A 2B1UA 1NX1A 2KNEA 5EL2A 1XFZO 1TRFA 1CDMA 1GGZA 2KPHA 5ER4X 5HL1A 3TZ1A 1YUTA 3CWGA 1B9AA 1J7OA 2F2PA 3DD4A 5D7FA 2I7AA 2BNXA 2JTTA 1F54A 1BG1A 1YVLA 1N0YA 2M1UA 1PSBA 2JU0A 1C07A 1CFPA 1N2DA 3A8RA 1K9UA 2MBXA 1NX0A 5AANA 1M31A 1QATA 1WRZA 3S0AA 2LP2A 1M63B 2OPOA 5DKRA 2LVIA 2I18A 3OGNA 1Z4HA 1ALWA 1OMRA 4N1FA 5B8IB 4MZKA 4DIRA 1SNLA 2LNKA 3PN7B 1TUZA 4M2QA 3EVRA 4MLWA 2F33A 5J3XA 4DRWA 1XFRA 1NP8A 2P6BB 2KDHA 4XYNA 1DJYA 2K7OA 4I5KA 2M1KB 1WDCB 1OOGA 1K8UA 2WCEA 3I5FC 4YI8A 2Y5IA 2WCFA 3S0BA 5AERA 3R72A 3GK4X 4JD9A 1S6IA 3EK7A 1H8BA 1B8RA 1YVHA 3KF9A 2CNPA 3TDIA 1K93D 1SL9A 3CZ0A 1FPWA 4WQ3A 2Q4UA 5FI2A 5FI7A 1NCYA 2DOQA 1KK7Z 4FTGA 1ZUZA 1MUXA 1QWVA 2QACA 2K2FA 3FWBA 1SK6D 5DICA 1MHOA 5DKNA 1J1DA 3L47A 2KQYA 1NPQA 1OMVA 2V53A 2K2AA 4IJ7A 1RECA 1G4YR 1RK9A 1CM1A 3K21A 3OHMB 1TUJA 1XFXO 2JQ6A 1CDNA 1MXLC 3PM2A 1QS7A 3EVVA 5AFPA 3D76A 1JSAA 4PCWA 1NWDA 2BCAA 4Q04A 5IBWA 2M9GA 2KGBC 2JRFA 3S0DA 1WDCC 5HLOA 1G33A 2IS9A 1TCFA 2CT9A 5I2LA 3QMEA 2HPSA 4PHMA 4YGAA 1UHHA 3SG4A 2OTGB 2K60A 5AXIA 1OOFA 1W9ZA 5I2QA 1N65A 3KHEA 3KEVA 2G2BA 3I5GB 1BODA 1BR1B 2FJUB 1IKUA 1A4PA 3I5GC 4C0JA 1F71A 4CFRA 1ZACA 2JXLA 2ISDA 1CNPA 2M7LA 2ZN9A 1R2UA 2WNDA 3DVEA 1H4BA 1IIOA 1ZFSA 3B86A 2G9BA 3IF7A 2HF5A 1SPYA 2PVBA 1OQPA 2P71A 1B1GA 2KOTA 2KAVA 1QX7A 3NHTA 1OSAA 2KYFA 3CR2A 4WRIA 2LMUA 1OOHA 1F70A 1S6CA 3DY9A 1UHIA 2M3WA 3VRQA 2K8MB 3FS7A 4I5NB 1LA0A 4OVNF 1CKKA 4GUKA 3SIAA 1LVCD 3BFAA 2JT0A 2WC5A 3CZ2A 3PN7C 3TDZA 1MQ1A 2MLFC 4AQIA 1UWOA 3OB1B 1RTP1 2KHNA 2Y4QA 4ORCB 2QPTA 1NSHA 5PALA 1A75B 2AMIA 2QEVA 2WCHA 3O78A 3ZWHA 2ZRTA 1TTXA 3TUYB 1YR5A 1TIZA 2L98A 3CGAA
chains in the Genus database with same CATH topology
1XFYO 1CLMA 2RGIA 1J55A 1CDPA 1EJ3A 3D0YB 3M0WA 2EGDA 3JTDB 1S5GZ 3VROA 2L2EA 1OE9B 2ZNEA 2L4HA 1RFJA 2AUCA 2BBMA 2I94A 1Y1XA 2JWWA 2SCPA 1NX2A 1DJXA 2SASA 1PVBA 2KGRA 4MRXA 5CSNA 3WHTB 2LHIA 1IJ6A 4USLA 2F3ZA 2LMTA 1W7JB 1XK4C 3PFVA 3WHUB 5HLVA 2LHLA 3NSKA 1KSOA 1QVIY 2KFFA 3OB2B 3SG2A 2OTGC 4PHNA 4DUQA 1OMDA 3ZNIA 4MVFA 4CFQA 4XJKB 3SIBA 1QLKA 1SL7A 1SMGA 1Y0VH 2EHBA 4YI9A 4HREE 1SY9A 1JF2A 2F8PA 3LL8B 1B7TY 3WXAA 4OCIA 1F8HA 1IJ5A 3BUOB 2KI6C 1SW8A 2WORA 3CS1A 1U5IA 1TNQA 3LCPC 5JJGA 1R6PA 1JFKA 4AQJA 4DS7A 2KSPA 1AJ4A 1IRJA 2MRDA 1LKJA 2GGMA 2KQ6A 3A4UB 1L2OC 4I5JA 5FYXA 4ETOA 1HT9A 1QJTA 1AHRA 2PMYA 2JT3A 2LLTA 1ZOTB 2L4IA 1B4CA 4OR9B 1UURA 4ZCVA 2TN4A 1AVSA 4PE4A 2LE9B 2LCPA 3AKAA 4CIDA 5JOLA 4PE7A 1CLLA 5KU1A 3OX5A 1CFDA 4DCKA 1XFVO 2L0PA 3HCMA 1XYDA 3PM8A 3IQOA 1SCMC 2HQWA 1TCOB 2K7DA 1CLBA 3JTDC 1QVIZ 1UUSA 2CTNA 1S36A 2H2KA 4PE1A 3I5HB 1YRTB 4ICBA 3TS5C 4YGEB 2BCBA 3HX4A 5CSFA 5TNCA 2R2IA 1XVJA 1K95A 5DKQA 2LLUA 3O2PA 1B7TZ 4QJ4B 5CSJA 1AUIB 2MAZA 2PRUA 3D0YA 3ICBA 1SRAA 4U8DA 2NLNA 3SG5A 1KSMA 1MR8A 2JT8A 3SJSA 2K7BA 2LP3A 3SG3A 4ORBB 1BR4B 2FCDA 1KFUL 3I5IC 1M39A 4HSZA 1DJGA 1SR6C 1SYMA 3IQQA 1DJZA 2CXJA 3MSEB 5G08A 4A4BA 1EXRA 3KPXA 4YGBB 4D1EA 2JTZA 1IGVA 3BXKA 3TUYC 3GK2A 1NIWA 3CLNA 1OZSA 2PSRA 4ORAB 1SCVA 1DT7B 2M0RA 2OS8C 5KSZA 1UHJA 1FBVA 4M2PA 1IH0A 1BLQA 1CB1A 2BL0C 3I5IB 2BE4A 1B8LA 2E6WA 2JPTA 3JVTC 5BPJA 2HQ8A 1L7ZA 3CR4X 4BY4A 1RROA 4GNKB 1YUUA 3BOWB 1TNWA 3AAKA 1S26D 1QLSA 1YUSA 1PRWA 2KYCA 1AJ5A 2GGZA 1PSRA 1NYAA 5CSIA 3GK1A 4WQ2A 1SL8A 1CNPA 1KQMB 1YX7A 1EG4A 2I2RE 4JWQA 1K9PA 1WRLA 3EVUA 4M2OA 4MSPA 2L51A 4TNCA 1HQVA 1K94A 1KQVA 3BOWA 3I5HC 1QV1A 1SR6B 4JPZB 1OOJA 2L5XB 1RWYA 4YGCB 4C0LA 5F6TA 1YRUB 1KFXL 3BQ3A 3D10A 4MRYA 2ZNDA 2O60A 2E30A 2CCMA 2BE6A 2BKIB 1VRKA 2WC8A 1A29A 1G8IA 3O4YA 2MJWB 1Q80A 1A2XA 2VRGA 1EL4A 4PHJA 4ZCUA 2M49B 1A03A 1QX5B 1LA3A 1YTZC 4GGFA 1B47A 1M45A 1SKTA 1K9KA 2M8UA 4OV2A 2BL0B 1Y1UA 1KK8C 2JZIA 2BKHB 2KI4C 3E3RA 5AEQA 2Q91A 3CTNA 2KBMA 1NX3A 2H61A 2PASA 2KAYA 1NUBA 1CDLA 2MLEC 4JQ0D 1CMGA 2MA2A 1KWOC 4GGFC 1QX2A 1XFWO 2LVVA 1WLZA 3BUNB 4PDZA 3BUMB 3EKHA 1A75A 1V1FA 1YURA 3WNXB 2F2OA 2AAOA 3JVTB 2NXQA 2M97A 3LK0A 1D1OA 1DF0A 2LV7A 2KI4B 4L9MA 5KTYA 2K61A 1CTRA 1BJFA 1W7IB 2NCOA 1CFCA 1FF1A 1F4OA 4NDBA 1DJIA 2ZKMX 1K96A 1GGWA 1IG5A 3QRXA 4FQOA 3AKBA 1FI6A 4E68A 4C0KA 2PALA 3VGOA 1WY9A 2LMVA 2A4JA 5D69A 2LANA 1BU3A 1FI5A 2LLSA 3H4SE 5I8NA 2LAPA 4QJ5B 3BUWB 3CZTX 1PALA 1Y6WA 1XO5A 3F45A 4GFTA 5ER5A 5HKZA 3LLEA 2KAXA 3VRRA 5HYDA 1WLMA 1IQ5A 4GGNA 1C7WA 1DVIA 1QXPA 1DJWA 2BCXA 1K90D 3PATA 1WRKA 4P2YB 1B8CA 1DF0B 1IWQA 1SBJA 1Y1AA 1XA5A 1UHNA 2JNFA 1KQMC 4YBHB 1MF8B 2GV5A 4GAOA 2MHHA 3DF0A 1AK8A 1QIWA 1CFFA 3TS5B 4N5XA 1AP4A 4MZLA 3SG7A 1KK7Y 4CLNA 1JUOA 2JXCA 2ZRSA 1PK0D 2ZFDA 3NSIA 2WOSA 2JULA 3TDUA 2L50A 1S6JA 3DF0B 1KFXS 2M7NA 1ALVA 1S3PA 2JC2A 1TNPA 3LK1A 2NZ0A 4YGDB 4PALA 3DVJA 4OKHA 4PE0A 4QJ3B 4NDDA 1FW4A 3DVMA 4AOMA 2LVKA 1J7RA 1YX8A 3I5FB 2WCBA 2COLB 4UPGA 3RM1A 2KBIA 2K7CA 1CM4A 4PHKA 1E8AA 1TNXA 1KK8B 2EC6C 1DJHA 3C1VA 1GQMA 1RJVA 5I2OA 1DTLA 1QASA 2BBNA 3RLZA 3NSLA 4HRGA 1C7VA 3BYAA 1UHKA 1LINA 2CBLA 3BUXB 4N1GA 3OX6A 5HKWA 4HRHA 2K0JA 1JBAA 1JWDA 1EG3A 1IQ3A 1PVAA 1KWOB 3CR5X 1CMFA 4IL1A 1DGVA 2JOJA 3KO0A 2LUXA 1K2HA 1QTXA 1ZMZA 1JFJA 1JF0A 2F3YA 1NCXA 3EK4A 3NSOA 1MWNA 2OS8B 5HKYA 2H61C 2JNXA 2NCPA 1QV0A 2BECA 1BT6A 1MXEA 2LC5A 3FIAA 4MBEA 1KFUS 1L2OB 4I5LB 1J7PA 3GOFA 4XJKA 5GQQC 1J7QA 3VRNA 3VRPA 1TN4A 3NXAA 5CPVA 4P5OE 1F55A 3AAJA 3SG6A 4MZJA 3OP0A 4GBAA 1S5GY 3O6BA 1TOPA 1U5IB 5K89A 3FWCA 1BMOA 2EC6B 2M29A 2HETA 4R1EA 1V1GA 1F4QA 1LXFC 1NCZA 2Y1MA 3PLFB 4MN0A 4F0ZB 4MEWA 1BF5A 2Y1NA 1S1EA 1EH2A 2FCEA 3EKJA 3EK8A 1JC2A 1M46A 1UP5A 1PULA 3PALA 1KCYA 4NDCA 1BOCA 4GPLB 1X02A 1ODBA 1J1EA 1XK4A 1XFUO 2LUCA 4NQGA 1QIVA 1OZOA 2D8NA 1DGUA 4A4CA 2KFHA 3DVKA 2ZN8A 2O5GA 1SCMB 2KFGA 3PSRA 4YRUA 4CPVA 1DMOA 2LM5A 1GJYA 2KI6D 2LVJA 2FOTA 4BY5A 2B1UA 1NX1A 2KNEA 1XFZO 1TRFA 1CDMA 1GGZA 5ER4X 3TZ1A 1YUTA 3CWGA 1B9AA 1J7OA 2F2PA 3DD4A 5D7FA 2I7AA 2JTTA 1F54A 1BG1A 1YVLA 1N0YA 2M1UA 1PSBA 2JU0A 1C07A 1CFPA 1N2DA 3A8RA 1K9UA 2MBXA 1NX0A 5AANA 1M31A 1QATA 1WRZA 2LP2A 1M63B 2OPOA 5DKRA 2LVIA 2I18A 1ALWA 1OMRA 4N1FA 5B8IB 4MZKA 4DIRA 1SNLA 2LNKA 3PN7B 4M2QA 3EVRA 4MLWA 2F33A 5J3XA 4DRWA 1NP8A 2P6BB 2KDHA 4XYNA 1DJYA 2K7OA 4I5KA 2M1KB 1WDCB 2WCEA 1K8UA 3I5FC 4YI8A 2Y5IA 2WCFA 5AERA 3GK4X 1S6IA 3EK7A 1H8BA 1B8RA 1YVHA 3KF9A 2CNPA 3TDIA 1K93D 1SL9A 1FPWA 4WQ3A 2Q4UA 1NCYA 2DOQA 1KK7Z 4FTGA 1ZUZA 1MUXA 2QACA 2K2FA 3FWBA 1SK6D 1MHOA 5DKNA 1J1DA 2KQYA 1NPQA 1OMVA 2V53A 2K2AA 1RECA 1G4YR 1RK9A 1CM1A 3K21A 3OHMB 1CDNA 1XFXO 2JQ6A 1MXLC 1QS7A 3EVVA 5AFPA 1JSAA 4PCWA 1NWDA 2BCAA 4Q04A 5IBWA 2M9GA 2KGBC 2JRFA 1WDCC 5HLOA 1G33A 2IS9A 1TCFA 2CT9A 5I2LA 2HPSA 4PHMA 4YGAA 1UHHA 3SG4A 2OTGB 5AXIA 5I2QA 1N65A 3KHEA 3KEVA 2G2BA 3I5GB 1BODA 1BR1B 2FJUB 1IKUA 1A4PA 3I5GC 4C0JA 1F71A 4CFRA 1ZACA 2JXLA 2ISDA 1H4BA 2M7LA 2ZN9A 1R2UA 2WNDA 3DVEA 1ZFSA 2G9BA 3IF7A 2HF5A 1SPYA 2PVBA 1OQPA 1B1GA 2KOTA 2KAVA 1QX7A 1OSAA 2KYFA 3CR2A 4WRIA 2LMUA 1F70A 1S6CA 1UHIA 2M3WA 3VRQA 2K8MB 3FS7A 4I5NB 1LA0A 4OVNF 1CKKA 4GUKA 3SIAA 1LVCD 2JT0A 3TDZA 3PN7C 1MQ1A 2MLFC 4AQIA 1UWOA 3OB1B 1RTP1 2KHNA 2Y4QA 4ORCB 2QPTA 1NSHA 5PALA 1A75B 2AMIA 3O78A 3ZWHA 2ZRTA 1TTXA 3TUYB 1YR5A 1TIZA 2L98A 3CGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFY O;  1CLM A;  2RGI A;  1J55 A;  1CDP A;  1EJ3 A;  3D0Y B;  3M0W A;  2EGD A;  3JTD B;  1S5G Z;  3VRO A;  2L2E A;  1OE9 B;  2ZNE A;  2L4H A;  1RFJ A;  2AUC A;  2BBM A;  2I94 A;  1Y1X A;  2JWW A;  2SCP A;  1NX2 A;  1DJX A;  2SAS A;  1PVB A;  2KGR A;  4MRX A;  5CSN A;  3WHT B;  2LHI A;  1IJ6 A;  4USL A;  2F3Z A;  2LMT A;  1W7J B;  1XK4 C;  3PFV A;  3WHU B;  5HLV A;  2LHL A;  3NSK A;  1KSO A;  1QVI Y;  2KFF A;  3OB2 B;  3SG2 A;  2OTG C;  4PHN A;  4DUQ A;  1OMD A;  3ZNI A;  4MVF A;  4CFQ A;  4XJK B;  3SIB A;  1QLK A;  1SL7 A;  1SMG A;  1Y0V H;  2EHB A;  4YI9 A;  4HRE E;  1SY9 A;  1JF2 A;  2F8P A;  3LL8 B;  1B7T Y;  3WXA A;  4OCI A;  1F8H A;  1IJ5 A;  3BUO B;  2KI6 C;  1SW8 A;  2WOR A;  3CS1 A;  1U5I A;  1TNQ A;  3LCP C;  5JJG A;  1R6P A;  1JFK A;  4AQJ A;  4DS7 A;  2KSP A;  1AJ4 A;  1IRJ A;  2MRD A;  1LKJ A;  2GGM A;  2KQ6 A;  3A4U B;  1L2O C;  4I5J A;  5FYX A;  4ETO A;  1HT9 A;  1QJT A;  1AHR A;  2PMY A;  2JT3 A;  2LLT A;  1ZOT B;  2L4I A;  1B4C A;  4OR9 B;  1UUR A;  4ZCV A;  2TN4 A;  1AVS A;  4PE4 A;  2LE9 B;  2LCP A;  3AKA A;  4CID A;  5JOL A;  4PE7 A;  1CLL A;  5KU1 A;  3OX5 A;  1CFD A;  4DCK A;  1XFV O;  2L0P A;  3HCM A;  1XYD A;  3PM8 A;  3IQO A;  1SCM C;  2HQW A;  1TCO B;  2K7D A;  1CLB A;  3JTD C;  1QVI Z;  1UUS A;  2CTN A;  1S36 A;  2H2K A;  4PE1 A;  3I5H B;  1YRT B;  4ICB A;  3TS5 C;  4YGE B;  2BCB A;  3HX4 A;  5CSF A;  5TNC A;  2R2I A;  1XVJ A;  1K95 A;  5DKQ A;  2LLU A;  3O2P A;  1B7T Z;  4QJ4 B;  5CSJ A;  1AUI B;  2MAZ A;  2PRU A;  3D0Y A;  3ICB A;  1SRA A;  4U8D A;  2NLN A;  3SG5 A;  1KSM A;  1MR8 A;  2JT8 A;  3SJS A;  2K7B A;  2LP3 A;  3SG3 A;  4ORB B;  1BR4 B;  2FCD A;  1KFU L;  3I5I C;  1M39 A;  4HSZ A;  1DJG A;  1SR6 C;  1SYM A;  3IQQ A;  1DJZ A;  2CXJ A;  3MSE B;  5G08 A;  4A4B A;  1EXR A;  3KPX A;  4YGB B;  4D1E A;  2JTZ A;  1IGV A;  3BXK A;  3TUY C;  3GK2 A;  1NIW A;  3CLN A;  1OZS A;  2PSR A;  4ORA B;  1SCV A;  1DT7 B;  2M0R A;  2OS8 C;  5KSZ A;  1UHJ A;  1FBV A;  4M2P A;  1IH0 A;  1BLQ A;  1CB1 A;  2BL0 C;  3I5I B;  2BE4 A;  1B8L A;  2E6W A;  2JPT A;  3JVT C;  5BPJ A;  2HQ8 A;  1L7Z A;  3CR4 X;  4BY4 A;  1RRO A;  4GNK B;  1YUU A;  3BOW B;  1TNW A;  3AAK A;  1S26 D;  1QLS A;  1YUS A;  1PRW A;  2KYC A;  1AJ5 A;  2GGZ A;  1PSR A;  1NYA A;  5CSI A;  3GK1 A;  4WQ2 A;  1SL8 A;  1CNP A;  1KQM B;  1YX7 A;  1EG4 A;  2I2R E;  4JWQ A;  1K9P A;  1WRL A;  3EVU A;  4M2O A;  4MSP A;  2L51 A;  4TNC A;  1HQV A;  1K94 A;  1KQV A;  3BOW A;  3I5H C;  1QV1 A;  1SR6 B;  4JPZ B;  1OOJ A;  2L5X B;  1RWY A;  4YGC B;  4C0L A;  5F6T A;  1YRU B;  1KFX L;  3BQ3 A;  3D10 A;  4MRY A;  2ZND A;  2O60 A;  2E30 A;  2CCM A;  2BE6 A;  2BKI B;  1VRK A;  2WC8 A;  1A29 A;  1G8I A;  3O4Y A;  2MJW B;  1Q80 A;  1A2X A;  2VRG A;  1EL4 A;  4PHJ A;  4ZCU A;  2M49 B;  1A03 A;  1QX5 B;  1LA3 A;  1YTZ C;  4GGF A;  1B47 A;  1M45 A;  1SKT A;  1K9K A;  2M8U A;  4OV2 A;  2BL0 B;  1Y1U A;  1KK8 C;  2JZI A;  2BKH B;  2KI4 C;  3E3R A;  5AEQ A;  2Q91 A;  3CTN A;  2KBM A;  1NX3 A;  2H61 A;  2PAS A;  2KAY A;  1NUB A;  1CDL A;  2MLE C;  4JQ0 D;  1CMG A;  2MA2 A;  1KWO C;  4GGF C;  1QX2 A;  1XFW O;  2LVV A;  1WLZ A;  3BUN B;  4PDZ A;  3BUM B;  3EKH A;  1A75 A;  1V1F A;  1YUR A;  3WNX B;  2F2O A;  2AAO A;  3JVT B;  2NXQ A;  2M97 A;  3LK0 A;  1D1O A;  1DF0 A;  2LV7 A;  2KI4 B;  4L9M A;  5KTY A;  2K61 A;  1CTR A;  1BJF A;  1W7I B;  2NCO A;  1CFC A;  1FF1 A;  1F4O A;  4NDB A;  1DJI A;  2ZKM X;  1K96 A;  1GGW A;  1IG5 A;  3QRX A;  4FQO A;  3AKB A;  1FI6 A;  4E68 A;  4C0K A;  2PAL A;  3VGO A;  1WY9 A;  2LMV A;  2A4J A;  5D69 A;  2LAN A;  1BU3 A;  1FI5 A;  2LLS A;  3H4S E;  5I8N A;  2LAP A;  4QJ5 B;  3BUW B;  3CZT X;  1PAL A;  1Y6W A;  1XO5 A;  3F45 A;  4GFT A;  5ER5 A;  5HKZ A;  3LLE A;  2KAX A;  3VRR A;  5HYD A;  1WLM A;  1IQ5 A;  4GGN A;  1C7W A;  1DVI A;  1QXP A;  1DJW A;  2BCX A;  1K90 D;  3PAT A;  1WRK A;  4P2Y B;  1B8C A;  1DF0 B;  1IWQ A;  1SBJ A;  1Y1A A;  1XA5 A;  1UHN A;  2JNF A;  1KQM C;  4YBH B;  1MF8 B;  2GV5 A;  4GAO A;  2MHH A;  3DF0 A;  1AK8 A;  1QIW A;  1CFF A;  3TS5 B;  4N5X A;  1AP4 A;  4MZL A;  3SG7 A;  1KK7 Y;  4CLN A;  1JUO A;  2JXC A;  2ZRS A;  1PK0 D;  2ZFD A;  3NSI A;  2WOS A;  2JUL A;  3TDU A;  2L50 A;  1S6J A;  3DF0 B;  1KFX S;  2M7N A;  1ALV A;  1S3P A;  2JC2 A;  1TNP A;  3LK1 A;  2NZ0 A;  4YGD B;  4PAL A;  3DVJ A;  4OKH A;  4PE0 A;  4QJ3 B;  4NDD A;  1FW4 A;  3DVM A;  4AOM A;  2LVK A;  1J7R A;  1YX8 A;  3I5F B;  2WCB A;  2COL B;  4UPG A;  3RM1 A;  2KBI A;  2K7C A;  1CM4 A;  4PHK A;  1E8A A;  1TNX A;  1KK8 B;  2EC6 C;  1DJH A;  3C1V A;  1GQM A;  1RJV A;  5I2O A;  1DTL A;  1QAS A;  2BBN A;  3RLZ A;  3NSL A;  4HRG A;  1C7V A;  3BYA A;  1UHK A;  1LIN A;  2CBL A;  3BUX B;  4N1G A;  3OX6 A;  5HKW A;  4HRH A;  2K0J A;  1JBA A;  1JWD A;  1EG3 A;  1IQ3 A;  1PVA A;  1KWO B;  3CR5 X;  1CMF A;  4IL1 A;  1DGV A;  2JOJ A;  3KO0 A;  2LUX A;  1K2H A;  1QTX A;  1ZMZ A;  1JFJ A;  1JF0 A;  2F3Y A;  1NCX A;  3EK4 A;  3NSO A;  1MWN A;  2OS8 B;  5HKY A;  2H61 C;  2JNX A;  2NCP A;  1QV0 A;  2BEC A;  1BT6 A;  1MXE A;  2LC5 A;  3FIA A;  4MBE A;  1KFU S;  1L2O B;  4I5L B;  1J7P A;  3GOF A;  4XJK A;  5GQQ C;  1J7Q A;  3VRN A;  3VRP A;  1TN4 A;  3NXA A;  5CPV A;  4P5O E;  1F55 A;  3AAJ A;  3SG6 A;  4MZJ A;  3OP0 A;  4GBA A;  1S5G Y;  3O6B A;  1TOP A;  1U5I B;  5K89 A;  3FWC A;  1BMO A;  2EC6 B;  2M29 A;  2HET A;  4R1E A;  1V1G A;  1F4Q A;  1LXF C;  1NCZ A;  2Y1M A;  3PLF B;  4MN0 A;  4F0Z B;  4MEW A;  1BF5 A;  2Y1N A;  1S1E A;  1EH2 A;  2FCE A;  3EKJ A;  3EK8 A;  1JC2 A;  1M46 A;  1UP5 A;  1PUL A;  3PAL A;  1KCY A;  4NDC A;  1BOC A;  4GPL B;  1X02 A;  1ODB A;  1J1E A;  1XK4 A;  1XFU O;  2LUC A;  4NQG A;  1QIV A;  1OZO A;  2D8N A;  1DGU A;  4A4C A;  2KFH A;  3DVK A;  2ZN8 A;  2O5G A;  1SCM B;  2KFG A;  3PSR A;  4YRU A;  4CPV A;  1DMO A;  2LM5 A;  1GJY A;  2KI6 D;  2LVJ A;  2FOT A;  4BY5 A;  2B1U A;  1NX1 A;  2KNE A;  1XFZ O;  1TRF A;  1CDM A;  1GGZ A;  5ER4 X;  3TZ1 A;  1YUT A;  3CWG A;  1B9A A;  1J7O A;  2F2P A;  3DD4 A;  5D7F A;  2I7A A;  2JTT A;  1F54 A;  1BG1 A;  1YVL A;  1N0Y A;  2M1U A;  1PSB A;  2JU0 A;  1C07 A;  1CFP A;  1N2D A;  3A8R A;  1K9U A;  2MBX A;  1NX0 A;  5AAN A;  1M31 A;  1QAT A;  1WRZ A;  2LP2 A;  1M63 B;  2OPO A;  5DKR A;  2LVI A;  2I18 A;  1ALW A;  1OMR A;  4N1F A;  5B8I B;  4MZK A;  4DIR A;  1SNL A;  2LNK A;  3PN7 B;  4M2Q A;  3EVR A;  4MLW A;  2F33 A;  5J3X A;  4DRW A;  1NP8 A;  2P6B B;  2KDH A;  4XYN A;  1DJY A;  2K7O A;  4I5K A;  2M1K B;  1WDC B;  2WCE A;  1K8U A;  3I5F C;  4YI8 A;  2Y5I A;  2WCF A;  5AER A;  3GK4 X;  1S6I A;  3EK7 A;  1H8B A;  1B8R A;  1YVH A;  3KF9 A;  2CNP A;  3TDI A;  1K93 D;  1SL9 A;  1FPW A;  4WQ3 A;  2Q4U A;  1NCY A;  2DOQ A;  1KK7 Z;  4FTG A;  1ZUZ A;  1MUX A;  2QAC A;  2K2F A;  3FWB A;  1SK6 D;  1MHO A;  5DKN A;  1J1D A;  2KQY A;  1NPQ A;  1OMV A;  2V53 A;  2K2A A;  1REC A;  1G4Y R;  1RK9 A;  1CM1 A;  3K21 A;  3OHM B;  1CDN A;  1XFX O;  2JQ6 A;  1MXL C;  1QS7 A;  3EVV A;  5AFP A;  1JSA A;  4PCW A;  1NWD A;  2BCA A;  4Q04 A;  5IBW A;  2M9G A;  2KGB C;  2JRF A;  1WDC C;  5HLO A;  1G33 A;  2IS9 A;  1TCF A;  2CT9 A;  5I2L A;  2HPS A;  4PHM A;  4YGA A;  1UHH A;  3SG4 A;  2OTG B;  5AXI A;  5I2Q A;  1N65 A;  3KHE A;  3KEV A;  2G2B A;  3I5G B;  1BOD A;  1BR1 B;  2FJU B;  1IKU A;  1A4P A;  3I5G C;  4C0J A;  1F71 A;  4CFR A;  1ZAC A;  2JXL A;  2ISD A;  1H4B A;  2M7L A;  2ZN9 A;  1R2U A;  2WND A;  3DVE A;  1ZFS A;  2G9B A;  3IF7 A;  2HF5 A;  1SPY A;  2PVB A;  1OQP A;  1B1G A;  2KOT A;  2KAV A;  1QX7 A;  1OSA A;  2KYF A;  3CR2 A;  4WRI A;  2LMU A;  1F70 A;  1S6C A;  1UHI A;  2M3W A;  3VRQ A;  2K8M B;  3FS7 A;  4I5N B;  1LA0 A;  4OVN F;  1CKK A;  4GUK A;  3SIA A;  1LVC D;  2JT0 A;  3TDZ A;  3PN7 C;  1MQ1 A;  2MLF C;  4AQI A;  1UWO A;  3OB1 B;  1RTP 1;  2KHN A;  2Y4Q A;  4ORC B;  2QPT A;  1NSH A;  5PAL A;  1A75 B;  2AMI A;  3O78 A;  3ZWH A;  2ZRT A;  1TTX A;  3TUY B;  1YR5 A;  1TIZ A;  2L98 A;  3CGA A; 
#chains in the Genus database with same CATH topology
 1XFY O;  1CLM A;  2RGI A;  1J55 A;  1CDP A;  1EJ3 A;  3D0Y B;  3M0W A;  2EGD A;  3JTD B;  1S5G Z;  3VRO A;  2L2E A;  1OE9 B;  2ZNE A;  2L4H A;  1RFJ A;  2AUC A;  2BBM A;  2I94 A;  1Y1X A;  2JWW A;  2SCP A;  1NX2 A;  1DJX A;  2FJY A;  1PVB A;  2KGR A;  2SAS A;  4MRX A;  5CSN A;  3WHT B;  4JKT A;  3IVT A;  2LHI A;  1IJ6 A;  4USL A;  2F3Z A;  2LMT A;  1DQE A;  1W7J B;  1XK4 C;  3PFV A;  3WHU B;  2QEO A;  5HLV A;  2LHL A;  3NSK A;  1KSO A;  1QVI Y;  2KFF A;  3OB2 B;  3SG2 A;  2OTG C;  4PHN A;  4DUQ A;  2KLD A;  1OMD A;  3ZNI A;  4MVF A;  4CFQ A;  4XJK B;  2WCJ A;  3NHI A;  3SIB A;  1QLK A;  1SL7 A;  1SMG A;  1Y0V H;  2EHB A;  3K1E A;  3Q8I A;  4HRE E;  1SY9 A;  3FE9 A;  4YI9 A;  1JF2 A;  2F8P A;  3LL8 B;  1B7T Y;  3WXA A;  4OCI A;  2YGU A;  1F8H A;  1IJ5 A;  3BUO B;  2KI6 C;  4F7F A;  1SW8 A;  2WOR A;  3PJI A;  3R1P A;  3CS1 A;  1U5I A;  1TNQ A;  3LCP C;  5JJG A;  1C3Z A;  1JFK A;  1R6P A;  4AQJ A;  4DS7 A;  2KSP A;  1AJ4 A;  1IRJ A;  2MRD A;  1LKJ A;  2GGM A;  2KQ6 A;  2PQL A;  3A4U B;  1L2O C;  3B87 A;  4I5J A;  5FYX A;  4ETO A;  1HT9 A;  1QJT A;  1AHR A;  2PMY A;  2JT3 A;  2LLT A;  1ZOT B;  2L4I A;  1B4C A;  4OR9 B;  1UUR A;  4ZCV A;  2TN4 A;  1AVS A;  4PE4 A;  3D73 A;  2LE9 B;  2LCP A;  3AKA A;  4CID A;  5JOL A;  4PE7 A;  1CLL A;  5KU1 A;  3OX5 A;  1CFD A;  4DCK A;  1XFV O;  2L0P A;  3HCM A;  1XYD A;  3PM8 A;  2QEB A;  3IQO A;  3R1O A;  1SCM C;  1TWO A;  2HQW A;  1TCO B;  2K7D A;  1CLB A;  3JTD C;  1QVI Z;  1UUS A;  2CTN A;  1S36 A;  2H2K A;  4PE1 A;  3S0F A;  3I5H B;  1YRT B;  4ICB A;  3TS5 C;  4YGE B;  2BCB A;  3HX4 A;  4KYN A;  5CSF A;  5TNC A;  2R2I A;  1XVJ A;  1K95 A;  5DKQ A;  2LLU A;  3O2P A;  1B7T Z;  4QJ4 B;  1P28 A;  1OOI X;  5CSJ A;  1AUI B;  2MAZ A;  2PRU A;  3D0Y A;  3ICB A;  1SRA A;  4U8D A;  2NLN A;  3SG5 A;  1KSM A;  1MR8 A;  2JT8 A;  5D3O A;  2K7B A;  3OBV A;  3SJS A;  2LP3 A;  3SG3 A;  3BFB A;  4ORB B;  1BR4 B;  2FCD A;  1KFU L;  3CYZ A;  3I5I C;  1M39 A;  4HSZ A;  1DJG A;  1SR6 C;  1SYM A;  3IQQ A;  1DJZ A;  2CXJ A;  3MSE B;  5G08 A;  4A4B A;  1EXR A;  3KPX A;  4OZD A;  4YGB B;  2JTZ A;  4D1E A;  1IGV A;  3BXK A;  3TUY C;  3GK2 A;  1NIW A;  3CLN A;  1OZS A;  2PSR A;  4ORA B;  1SCV A;  1DT7 B;  2M0R A;  2OS8 C;  5KSZ A;  1UHJ A;  1FBV A;  4M2P A;  1IH0 A;  1BLQ A;  5I94 A;  1CB1 A;  3R1V A;  4INW A;  2BL0 C;  3I5I B;  2BE4 A;  1B8L A;  2E6W A;  2JPT A;  3D77 A;  3FE8 A;  3JVT C;  5BPJ A;  2HQ8 A;  1L7Z A;  3CR4 X;  4BY4 A;  1RRO A;  4GNK B;  1YUU A;  3BOW B;  1TNW A;  3AAK A;  1S26 D;  1QLS A;  1YUS A;  1PRW A;  2KYC A;  3D78 A;  1AJ5 A;  2GGZ A;  1PSR A;  1NYA A;  5CSI A;  3GK1 A;  4WQ2 A;  1SL8 A;  3BJH A;  1KQM B;  1YX7 A;  1EG4 A;  2I2R E;  4JWQ A;  1K9P A;  1WRL A;  3EVU A;  4M2O A;  4MSP A;  2L51 A;  4TNC A;  1HQV A;  1K94 A;  1DEK A;  1KQV A;  3BOW A;  3I5H C;  1QV1 A;  1LS8 A;  1SR6 B;  1OOJ A;  4JPZ B;  2L5X B;  1RWY A;  4YGC B;  4C0L A;  5F6T A;  1YRU B;  3V2L A;  1KFX L;  3BQ3 A;  3D10 A;  4MRY A;  2ZND A;  2O60 A;  2E30 A;  2CCM A;  2BE6 A;  2BKI B;  1VRK A;  2WC8 A;  1A29 A;  1G8I A;  2ERB A;  3O4Y A;  2MJW B;  1Q80 A;  3SS3 A;  3RZS A;  1A2X A;  2VRG A;  1EL4 A;  4PHJ A;  4ZCU A;  2M49 B;  3SS5 A;  2H8V A;  1QX5 B;  1LA3 A;  1YTZ C;  4GGF A;  1B47 A;  1M45 A;  1SKT A;  1A03 A;  1K9K A;  2M8U A;  4OV2 A;  1DC1 A;  2BL0 B;  3L4L A;  3B6X A;  1Y1U A;  1KK8 C;  2JZI A;  2BKH B;  2KI4 C;  3E3R A;  5AEQ A;  2Q91 A;  3VB1 A;  1Z2C B;  3CTN A;  3CDN A;  2KBM A;  1NX3 A;  2H61 A;  2PAS A;  2KAY A;  1NUB A;  1CDL A;  2MLE C;  4JQ0 D;  1GM0 A;  1CMG A;  3L4A A;  2MA2 A;  1KWO C;  4GGF C;  1QX2 A;  1XFW O;  2LVV A;  1WLZ A;  3BUN B;  4PDZ A;  3BUM B;  3EKH A;  1A75 A;  1V1F A;  1YUR A;  3WNX B;  2F2O A;  2AAO A;  3JVT B;  2NXQ A;  2M97 A;  3LK0 A;  1D1O A;  1DF0 A;  2LV7 A;  2KI4 B;  4L9M A;  5KTY A;  2K61 A;  1CTR A;  1BJF A;  1OW4 A;  1T14 A;  1W7I B;  2NCO A;  2PYQ A;  1CFC A;  3DXL A;  1FF1 A;  1F4O A;  4NDB A;  1DJI A;  2ZKM X;  1K96 A;  1GGW A;  1IG5 A;  3QRX A;  4FQO A;  3AKB A;  1FI6 A;  4E68 A;  4C0K A;  2PAL A;  3VGO A;  1WY9 A;  2LMV A;  2A4J A;  5D69 A;  2LAN A;  1BU3 A;  1FI5 A;  2LLS A;  3H4S E;  5I8N A;  2LAP A;  4QJ5 B;  3BUW B;  2WC6 A;  1PAL A;  1Y6W A;  1XO5 A;  3CZT X;  3F45 A;  4GFT A;  5ER5 A;  3LLE A;  5HKZ A;  2KAX A;  3VRR A;  5HYD A;  1WLM A;  1IQ5 A;  4GGN A;  1C7W A;  1DVI A;  1QXP A;  1DJW A;  2BCX A;  1DEL A;  1K90 D;  3PAT A;  1WRK A;  4P2Y B;  1B8C A;  1DF0 B;  1IWQ A;  1SBJ A;  1Y1A A;  2JPO A;  1XA5 A;  1UHN A;  2JNF A;  1KQM C;  4YBH B;  1MF8 B;  2GV5 A;  4GAO A;  2MHH A;  3DF0 A;  1AK8 A;  1QIW A;  1CFF A;  3TS5 B;  4N5X A;  1AP4 A;  4MZL A;  3SG7 A;  1KK7 Y;  4CLN A;  1JUO A;  2JXC A;  2ZRS A;  1PK0 D;  2ZFD A;  3NSI A;  2WOS A;  4R1E A;  3O4X A;  2JUL A;  3TDU A;  2L50 A;  1S6J A;  3DF0 B;  1KFX S;  2M7N A;  1ALV A;  1S3P A;  2JC2 A;  1TNP A;  3B88 A;  3LK1 A;  2NZ0 A;  4YGD B;  4PAL A;  3DVJ A;  4OKH A;  4PE0 A;  4QJ3 B;  3N7H A;  4NDD A;  1FW4 A;  3DVM A;  2WCM A;  4AOM A;  2WCK A;  2LVK A;  1J7R A;  1YX8 A;  3FE6 A;  3I5F B;  2WCB A;  2COL B;  4UPG A;  3UNW A;  3RM1 A;  2KBI A;  2K7C A;  1CM4 A;  4PHK A;  1E8A A;  1TNX A;  1KK8 B;  2EC6 C;  1DJH A;  3C1V A;  1GQM A;  1RJV A;  5I2O A;  1DTL A;  1QAS A;  2BBN A;  2L5Y A;  2QEH A;  3D75 A;  3RLZ A;  3NSL A;  4HRG A;  3S0E A;  3CAB A;  1C7V A;  3BYA A;  1UHK A;  1LIN A;  2CBL A;  3BUX B;  4N1G A;  3OX6 A;  5HKW A;  4HRH A;  2K0J A;  1JBA A;  1JWD A;  1EG3 A;  1IQ3 A;  1PVA A;  1KWO B;  2GTE A;  3CR5 X;  1CMF A;  4IL1 A;  1DGV A;  2JOJ A;  3KO0 A;  2LUX A;  1K2H A;  1QTX A;  3EG5 B;  1ZMZ A;  3D74 A;  1JFJ A;  1JF0 A;  2F3Y A;  1NCX A;  3EK4 A;  3NSO A;  1MWN A;  2OS8 B;  5HKY A;  2H61 C;  2JNX A;  2NCP A;  1QV0 A;  2BEC A;  2WCL A;  1BT6 A;  1MXE A;  2L2C A;  2LC5 A;  3FIA A;  4MBE A;  1KFU S;  1L2O B;  4I5L B;  2P70 A;  1J7P A;  3GOF A;  4XJK A;  3NGV A;  5GQQ C;  1J7Q A;  3VRN A;  3VRP A;  2BAP A;  1TN4 A;  3NXA A;  5CPV A;  4P5O E;  1F55 A;  3AAJ A;  3SG6 A;  4MZJ A;  3OP0 A;  4GBA A;  4PT1 A;  1S5G Y;  3O6B A;  1TOP A;  1U5I B;  5K89 A;  3FWC A;  1BMO A;  2EC6 B;  2KLE A;  2HET A;  2M29 A;  1V1G A;  1F4Q A;  1LXF C;  1NCZ A;  2Y1M A;  3PLF B;  4MN0 A;  4F0Z B;  4MEW A;  1BF5 A;  2Y1N A;  1S1E A;  1EH2 A;  2FCE A;  3DZT A;  3DYE A;  3EKJ A;  3EK8 A;  1JC2 A;  1M46 A;  1UP5 A;  1PUL A;  3PAL A;  1KCY A;  4NDC A;  1BOC A;  4GPL B;  1X02 A;  1ODB A;  1J1E A;  1ORG A;  1XK4 A;  1XFU O;  4INX A;  2LUC A;  4NQG A;  1QIV A;  1OZO A;  2D8N A;  3BFH A;  4FQT A;  1DGU A;  4A4C A;  2KFH A;  3DVK A;  5FI6 A;  2ZN8 A;  3B7A A;  2O5G A;  3S0G A;  1SCM B;  2KFG A;  3CZ1 A;  3PSR A;  4YRU A;  4CPV A;  1DMO A;  1C3Y A;  1SSE B;  2LM5 A;  1GJY A;  2KI6 D;  2LVJ A;  3SS4 A;  2FOT A;  4BY5 A;  2QDI A;  3UO9 A;  2B1U A;  1NX1 A;  2KNE A;  5EL2 A;  1XFZ O;  1TRF A;  1CDM A;  1GGZ A;  2KPH A;  5ER4 X;  5HL1 A;  3TZ1 A;  1YUT A;  3CWG A;  1B9A A;  1J7O A;  2F2P A;  3DD4 A;  5D7F A;  2I7A A;  2BNX A;  2JTT A;  1F54 A;  1BG1 A;  1YVL A;  1N0Y A;  2M1U A;  1PSB A;  2JU0 A;  1C07 A;  1CFP A;  1N2D A;  3A8R A;  1K9U A;  2MBX A;  1NX0 A;  5AAN A;  1M31 A;  1QAT A;  1WRZ A;  3S0A A;  2LP2 A;  1M63 B;  2OPO A;  5DKR A;  2LVI A;  2I18 A;  3OGN A;  1Z4H A;  1ALW A;  1OMR A;  4N1F A;  5B8I B;  4MZK A;  4DIR A;  1SNL A;  2LNK A;  3PN7 B;  1TUZ A;  4M2Q A;  3EVR A;  4MLW A;  2F33 A;  5J3X A;  4DRW A;  1XFR A;  1NP8 A;  2P6B B;  2KDH A;  4XYN A;  1DJY A;  2K7O A;  4I5K A;  2M1K B;  1WDC B;  1OOG A;  1K8U A;  2WCE A;  3I5F C;  4YI8 A;  2Y5I A;  2WCF A;  3S0B A;  5AER A;  3R72 A;  3GK4 X;  4JD9 A;  1S6I A;  3EK7 A;  1H8B A;  1B8R A;  1YVH A;  3KF9 A;  2CNP A;  3TDI A;  1K93 D;  1SL9 A;  3CZ0 A;  1FPW A;  4WQ3 A;  2Q4U A;  5FI2 A;  5FI7 A;  1NCY A;  2DOQ A;  1KK7 Z;  4FTG A;  1ZUZ A;  1MUX A;  1QWV A;  2QAC A;  2K2F A;  3FWB A;  1SK6 D;  5DIC A;  1MHO A;  5DKN A;  1J1D A;  3L47 A;  2KQY A;  1NPQ A;  1OMV A;  2V53 A;  2K2A A;  4IJ7 A;  1REC A;  1G4Y R;  1RK9 A;  1CM1 A;  3K21 A;  3OHM B;  1TUJ A;  1XFX O;  2JQ6 A;  1CDN A;  1MXL C;  3PM2 A;  1QS7 A;  3EVV A;  5AFP A;  3D76 A;  1JSA A;  4PCW A;  1NWD A;  2BCA A;  4Q04 A;  5IBW A;  2M9G A;  2KGB C;  2JRF A;  3S0D A;  1WDC C;  5HLO A;  1G33 A;  2IS9 A;  1TCF A;  2CT9 A;  5I2L A;  3QME A;  2HPS A;  4PHM A;  4YGA A;  1UHH A;  3SG4 A;  2OTG B;  2K60 A;  5AXI A;  1OOF A;  1W9Z A;  5I2Q A;  1N65 A;  3KHE A;  3KEV A;  2G2B A;  3I5G B;  1BOD A;  1BR1 B;  2FJU B;  1IKU A;  1A4P A;  3I5G C;  4C0J A;  1F71 A;  4CFR A;  1ZAC A;  2JXL A;  2ISD A;  1CNP A;  2M7L A;  2ZN9 A;  1R2U A;  2WND A;  3DVE A;  1H4B A;  1IIO A;  1ZFS A;  3B86 A;  2G9B A;  3IF7 A;  2HF5 A;  1SPY A;  2PVB A;  1OQP A;  2P71 A;  1B1G A;  2KOT A;  2KAV A;  1QX7 A;  3NHT A;  1OSA A;  2KYF A;  3CR2 A;  4WRI A;  2LMU A;  1OOH A;  1F70 A;  1S6C A;  3DY9 A;  1UHI A;  2M3W A;  3VRQ A;  2K8M B;  3FS7 A;  4I5N B;  1LA0 A;  4OVN F;  1CKK A;  4GUK A;  3SIA A;  1LVC D;  3BFA A;  2JT0 A;  2WC5 A;  3CZ2 A;  3PN7 C;  3TDZ A;  1MQ1 A;  2MLF C;  4AQI A;  1UWO A;  3OB1 B;  1RTP 1;  2KHN A;  2Y4Q A;  4ORC B;  2QPT A;  1NSH A;  5PAL A;  1A75 B;  2AMI A;  2QEV A;  2WCH A;  3O78 A;  3ZWH A;  2ZRT A;  1TTX A;  3TUY B;  1YR5 A;  1TIZ A;  2L98 A;  3CGA A; 
#chains in the Genus database with same CATH homology
 1XFY O;  1CLM A;  2RGI A;  1J55 A;  1CDP A;  1EJ3 A;  3D0Y B;  3M0W A;  2EGD A;  3JTD B;  1S5G Z;  3VRO A;  2L2E A;  1OE9 B;  2ZNE A;  2L4H A;  1RFJ A;  2AUC A;  2BBM A;  2I94 A;  1Y1X A;  2JWW A;  2SCP A;  1NX2 A;  1DJX A;  2SAS A;  1PVB A;  2KGR A;  4MRX A;  5CSN A;  3WHT B;  2LHI A;  1IJ6 A;  4USL A;  2F3Z A;  2LMT A;  1W7J B;  1XK4 C;  3PFV A;  3WHU B;  5HLV A;  2LHL A;  3NSK A;  1KSO A;  1QVI Y;  2KFF A;  3OB2 B;  3SG2 A;  2OTG C;  4PHN A;  4DUQ A;  1OMD A;  3ZNI A;  4MVF A;  4CFQ A;  4XJK B;  3SIB A;  1QLK A;  1SL7 A;  1SMG A;  1Y0V H;  2EHB A;  4YI9 A;  4HRE E;  1SY9 A;  1JF2 A;  2F8P A;  3LL8 B;  1B7T Y;  3WXA A;  4OCI A;  1F8H A;  1IJ5 A;  3BUO B;  2KI6 C;  1SW8 A;  2WOR A;  3CS1 A;  1U5I A;  1TNQ A;  3LCP C;  5JJG A;  1R6P A;  1JFK A;  4AQJ A;  4DS7 A;  2KSP A;  1AJ4 A;  1IRJ A;  2MRD A;  1LKJ A;  2GGM A;  2KQ6 A;  3A4U B;  1L2O C;  4I5J A;  5FYX A;  4ETO A;  1HT9 A;  1QJT A;  1AHR A;  2PMY A;  2JT3 A;  2LLT A;  1ZOT B;  2L4I A;  1B4C A;  4OR9 B;  1UUR A;  4ZCV A;  2TN4 A;  1AVS A;  4PE4 A;  2LE9 B;  2LCP A;  3AKA A;  4CID A;  5JOL A;  4PE7 A;  1CLL A;  5KU1 A;  3OX5 A;  1CFD A;  4DCK A;  1XFV O;  2L0P A;  3HCM A;  1XYD A;  3PM8 A;  3IQO A;  1SCM C;  2HQW A;  1TCO B;  2K7D A;  1CLB A;  3JTD C;  1QVI Z;  1UUS A;  2CTN A;  1S36 A;  2H2K A;  4PE1 A;  3I5H B;  1YRT B;  4ICB A;  3TS5 C;  4YGE B;  2BCB A;  3HX4 A;  5CSF A;  5TNC A;  2R2I A;  1XVJ A;  1K95 A;  5DKQ A;  2LLU A;  3O2P A;  1B7T Z;  4QJ4 B;  5CSJ A;  1AUI B;  2MAZ A;  2PRU A;  3D0Y A;  3ICB A;  1SRA A;  4U8D A;  2NLN A;  3SG5 A;  1KSM A;  1MR8 A;  2JT8 A;  3SJS A;  2K7B A;  2LP3 A;  3SG3 A;  4ORB B;  1BR4 B;  2FCD A;  1KFU L;  3I5I C;  1M39 A;  4HSZ A;  1DJG A;  1SR6 C;  1SYM A;  3IQQ A;  1DJZ A;  2CXJ A;  3MSE B;  5G08 A;  4A4B A;  1EXR A;  3KPX A;  4YGB B;  4D1E A;  2JTZ A;  1IGV A;  3BXK A;  3TUY C;  3GK2 A;  1NIW A;  3CLN A;  1OZS A;  2PSR A;  4ORA B;  1SCV A;  1DT7 B;  2M0R A;  2OS8 C;  5KSZ A;  1UHJ A;  1FBV A;  4M2P A;  1IH0 A;  1BLQ A;  1CB1 A;  2BL0 C;  3I5I B;  2BE4 A;  1B8L A;  2E6W A;  2JPT A;  3JVT C;  5BPJ A;  2HQ8 A;  1L7Z A;  3CR4 X;  4BY4 A;  1RRO A;  4GNK B;  1YUU A;  3BOW B;  1TNW A;  3AAK A;  1S26 D;  1QLS A;  1YUS A;  1PRW A;  2KYC A;  1AJ5 A;  2GGZ A;  1PSR A;  1NYA A;  5CSI A;  3GK1 A;  4WQ2 A;  1SL8 A;  1CNP A;  1KQM B;  1YX7 A;  1EG4 A;  2I2R E;  4JWQ A;  1K9P A;  1WRL A;  3EVU A;  4M2O A;  4MSP A;  2L51 A;  4TNC A;  1HQV A;  1K94 A;  1KQV A;  3BOW A;  3I5H C;  1QV1 A;  1SR6 B;  4JPZ B;  1OOJ A;  2L5X B;  1RWY A;  4YGC B;  4C0L A;  5F6T A;  1YRU B;  1KFX L;  3BQ3 A;  3D10 A;  4MRY A;  2ZND A;  2O60 A;  2E30 A;  2CCM A;  2BE6 A;  2BKI B;  1VRK A;  2WC8 A;  1A29 A;  1G8I A;  3O4Y A;  2MJW B;  1Q80 A;  1A2X A;  2VRG A;  1EL4 A;  4PHJ A;  4ZCU A;  2M49 B;  1A03 A;  1QX5 B;  1LA3 A;  1YTZ C;  4GGF A;  1B47 A;  1M45 A;  1SKT A;  1K9K A;  2M8U A;  4OV2 A;  2BL0 B;  1Y1U A;  1KK8 C;  2JZI A;  2BKH B;  2KI4 C;  3E3R A;  5AEQ A;  2Q91 A;  3CTN A;  2KBM A;  1NX3 A;  2H61 A;  2PAS A;  2KAY A;  1NUB A;  1CDL A;  2MLE C;  4JQ0 D;  1CMG A;  2MA2 A;  1KWO C;  4GGF C;  1QX2 A;  1XFW O;  2LVV A;  1WLZ A;  3BUN B;  4PDZ A;  3BUM B;  3EKH A;  1A75 A;  1V1F A;  1YUR A;  3WNX B;  2F2O A;  2AAO A;  3JVT B;  2NXQ A;  2M97 A;  3LK0 A;  1D1O A;  1DF0 A;  2LV7 A;  2KI4 B;  4L9M A;  5KTY A;  2K61 A;  1CTR A;  1BJF A;  1W7I B;  2NCO A;  1CFC A;  1FF1 A;  1F4O A;  4NDB A;  1DJI A;  2ZKM X;  1K96 A;  1GGW A;  1IG5 A;  3QRX A;  4FQO A;  3AKB A;  1FI6 A;  4E68 A;  4C0K A;  2PAL A;  3VGO A;  1WY9 A;  2LMV A;  2A4J A;  5D69 A;  2LAN A;  1BU3 A;  1FI5 A;  2LLS A;  3H4S E;  5I8N A;  2LAP A;  4QJ5 B;  3BUW B;  3CZT X;  1PAL A;  1Y6W A;  1XO5 A;  3F45 A;  4GFT A;  5ER5 A;  5HKZ A;  3LLE A;  2KAX A;  3VRR A;  5HYD A;  1WLM A;  1IQ5 A;  4GGN A;  1C7W A;  1DVI A;  1QXP A;  1DJW A;  2BCX A;  1K90 D;  3PAT A;  1WRK A;  4P2Y B;  1B8C A;  1DF0 B;  1IWQ A;  1SBJ A;  1Y1A A;  1XA5 A;  1UHN A;  2JNF A;  1KQM C;  4YBH B;  1MF8 B;  2GV5 A;  4GAO A;  2MHH A;  3DF0 A;  1AK8 A;  1QIW A;  1CFF A;  3TS5 B;  4N5X A;  1AP4 A;  4MZL A;  3SG7 A;  1KK7 Y;  4CLN A;  1JUO A;  2JXC A;  2ZRS A;  1PK0 D;  2ZFD A;  3NSI A;  2WOS A;  2JUL A;  3TDU A;  2L50 A;  1S6J A;  3DF0 B;  1KFX S;  2M7N A;  1ALV A;  1S3P A;  2JC2 A;  1TNP A;  3LK1 A;  2NZ0 A;  4YGD B;  4PAL A;  3DVJ A;  4OKH A;  4PE0 A;  4QJ3 B;  4NDD A;  1FW4 A;  3DVM A;  4AOM A;  2LVK A;  1J7R A;  1YX8 A;  3I5F B;  2WCB A;  2COL B;  4UPG A;  3RM1 A;  2KBI A;  2K7C A;  1CM4 A;  4PHK A;  1E8A A;  1TNX A;  1KK8 B;  2EC6 C;  1DJH A;  3C1V A;  1GQM A;  1RJV A;  5I2O A;  1DTL A;  1QAS A;  2BBN A;  3RLZ A;  3NSL A;  4HRG A;  1C7V A;  3BYA A;  1UHK A;  1LIN A;  2CBL A;  3BUX B;  4N1G A;  3OX6 A;  5HKW A;  4HRH A;  2K0J A;  1JBA A;  1JWD A;  1EG3 A;  1IQ3 A;  1PVA A;  1KWO B;  3CR5 X;  1CMF A;  4IL1 A;  1DGV A;  2JOJ A;  3KO0 A;  2LUX A;  1K2H A;  1QTX A;  1ZMZ A;  1JFJ A;  1JF0 A;  2F3Y A;  1NCX A;  3EK4 A;  3NSO A;  1MWN A;  2OS8 B;  5HKY A;  2H61 C;  2JNX A;  2NCP A;  1QV0 A;  2BEC A;  1BT6 A;  1MXE A;  2LC5 A;  3FIA A;  4MBE A;  1KFU S;  1L2O B;  4I5L B;  1J7P A;  3GOF A;  4XJK A;  5GQQ C;  1J7Q A;  3VRN A;  3VRP A;  1TN4 A;  3NXA A;  5CPV A;  4P5O E;  1F55 A;  3AAJ A;  3SG6 A;  4MZJ A;  3OP0 A;  4GBA A;  1S5G Y;  3O6B A;  1TOP A;  1U5I B;  5K89 A;  3FWC A;  1BMO A;  2EC6 B;  2M29 A;  2HET A;  4R1E A;  1V1G A;  1F4Q A;  1LXF C;  1NCZ A;  2Y1M A;  3PLF B;  4MN0 A;  4F0Z B;  4MEW A;  1BF5 A;  2Y1N A;  1S1E A;  1EH2 A;  2FCE A;  3EKJ A;  3EK8 A;  1JC2 A;  1M46 A;  1UP5 A;  1PUL A;  3PAL A;  1KCY A;  4NDC A;  1BOC A;  4GPL B;  1X02 A;  1ODB A;  1J1E A;  1XK4 A;  1XFU O;  2LUC A;  4NQG A;  1QIV A;  1OZO A;  2D8N A;  1DGU A;  4A4C A;  2KFH A;  3DVK A;  2ZN8 A;  2O5G A;  1SCM B;  2KFG A;  3PSR A;  4YRU A;  4CPV A;  1DMO A;  2LM5 A;  1GJY A;  2KI6 D;  2LVJ A;  2FOT A;  4BY5 A;  2B1U A;  1NX1 A;  2KNE A;  1XFZ O;  1TRF A;  1CDM A;  1GGZ A;  5ER4 X;  3TZ1 A;  1YUT A;  3CWG A;  1B9A A;  1J7O A;  2F2P A;  3DD4 A;  5D7F A;  2I7A A;  2JTT A;  1F54 A;  1BG1 A;  1YVL A;  1N0Y A;  2M1U A;  1PSB A;  2JU0 A;  1C07 A;  1CFP A;  1N2D A;  3A8R A;  1K9U A;  2MBX A;  1NX0 A;  5AAN A;  1M31 A;  1QAT A;  1WRZ A;  2LP2 A;  1M63 B;  2OPO A;  5DKR A;  2LVI A;  2I18 A;  1ALW A;  1OMR A;  4N1F A;  5B8I B;  4MZK A;  4DIR A;  1SNL A;  2LNK A;  3PN7 B;  4M2Q A;  3EVR A;  4MLW A;  2F33 A;  5J3X A;  4DRW A;  1NP8 A;  2P6B B;  2KDH A;  4XYN A;  1DJY A;  2K7O A;  4I5K A;  2M1K B;  1WDC B;  2WCE A;  1K8U A;  3I5F C;  4YI8 A;  2Y5I A;  2WCF A;  5AER A;  3GK4 X;  1S6I A;  3EK7 A;  1H8B A;  1B8R A;  1YVH A;  3KF9 A;  2CNP A;  3TDI A;  1K93 D;  1SL9 A;  1FPW A;  4WQ3 A;  2Q4U A;  1NCY A;  2DOQ A;  1KK7 Z;  4FTG A;  1ZUZ A;  1MUX A;  2QAC A;  2K2F A;  3FWB A;  1SK6 D;  1MHO A;  5DKN A;  1J1D A;  2KQY A;  1NPQ A;  1OMV A;  2V53 A;  2K2A A;  1REC A;  1G4Y R;  1RK9 A;  1CM1 A;  3K21 A;  3OHM B;  1CDN A;  1XFX O;  2JQ6 A;  1MXL C;  1QS7 A;  3EVV A;  5AFP A;  1JSA A;  4PCW A;  1NWD A;  2BCA A;  4Q04 A;  5IBW A;  2M9G A;  2KGB C;  2JRF A;  1WDC C;  5HLO A;  1G33 A;  2IS9 A;  1TCF A;  2CT9 A;  5I2L A;  2HPS A;  4PHM A;  4YGA A;  1UHH A;  3SG4 A;  2OTG B;  5AXI A;  5I2Q A;  1N65 A;  3KHE A;  3KEV A;  2G2B A;  3I5G B;  1BOD A;  1BR1 B;  2FJU B;  1IKU A;  1A4P A;  3I5G C;  4C0J A;  1F71 A;  4CFR A;  1ZAC A;  2JXL A;  2ISD A;  1H4B A;  2M7L A;  2ZN9 A;  1R2U A;  2WND A;  3DVE A;  1ZFS A;  2G9B A;  3IF7 A;  2HF5 A;  1SPY A;  2PVB A;  1OQP A;  1B1G A;  2KOT A;  2KAV A;  1QX7 A;  1OSA A;  2KYF A;  3CR2 A;  4WRI A;  2LMU A;  1F70 A;  1S6C A;  1UHI A;  2M3W A;  3VRQ A;  2K8M B;  3FS7 A;  4I5N B;  1LA0 A;  4OVN F;  1CKK A;  4GUK A;  3SIA A;  1LVC D;  2JT0 A;  3TDZ A;  3PN7 C;  1MQ1 A;  2MLF C;  4AQI A;  1UWO A;  3OB1 B;  1RTP 1;  2KHN A;  2Y4Q A;  4ORC B;  2QPT A;  1NSH A;  5PAL A;  1A75 B;  2AMI A;  3O78 A;  3ZWH A;  2ZRT A;  1TTX A;  3TUY B;  1YR5 A;  1TIZ A;  2L98 A;  3CGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...