4AQJA

Structure of human s100a7 d24g bound to zinc and calcium
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDGKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN S100-A7
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqjA00
1F70A 1QV1A 2BBNA 3NXAA 1YVHA 1NYAA 2MJWB 5KU1A 2JZIA 3LLEA 1XYDA 3WNXB 1AP4A 1JSAA 2K7CA 3SG7A 5KSZA 2LMUA 1D1OA 1IKUA 3SG6A 1OE9B 1K95A 2BCAA 2I18A 1U5IB 2KFFA 4ORBB 2LP3A 4UPGA 1OSAA 1QX7A 3VRPA 1B8RA 1KWOB 1CFPA 1KQMC 3D0YB 1LINA 1AJ5A 3O6BA 2M9GA 3EKJA 3EVVA 1IJ5A 1XFYO 1XK4C 2M49B 1UHIA 1PVAA 4M2QA 1NX3A 1BF5A 1M31A 5PALA 2L5XB 1CFCA 2GV5A 4PE4A 2LP2A 1RROA 2ZN8A 3BQ3A 1XFZO 3DD4A 5CPVA 4DRWA 1NCZA 3VRQA 1Y1AA 1J1DA 1DJZA 3TZ1A 1S3PA 1UWOA 4IL1A 2ZFDA 2CNPA 1RK9A 5I2OA 4GBAA 2TN4A 4MBEA 1KFUS 1QIWA 1R6PA 3LK0A 2ISDA 2WORA 4XYNA 1KQVA 2KI4C 1DVIA 2JWWA 1TRFA 1YVLA 3IF7A 4XJKB 4DCKA 4JPZB 1NX0A 5D7FA 4WQ2A 4CFRA 2KGBC 4CFQA 2EC6B 1PULA 1G8IA 4E68A 3TUYB 1S1EA 3I5FB 2LANA 1B8CA 2HPSA 1IQ3A 3I5IB 5JJGA 3WHTB 1S6IA 2M0RA 1L2OB 3OHMB 4ZCVA 2MBXA 1NP8A 3KF9A 4P2YB 1AHRA 1TIZA 2M29A 1WDCB 1HT9A 2JXCA 3D10A 2JRFA 1IG5A 1CDMA 1NPQA 1YURA 3BUMB 1DF0A 3O78A 1SBJA 3BYAA 4OVNF 5B8IB 5I8NA 1CFFA 1KSOA 1MHOA 2BL0B 2GGZA 3ICBA 2SASA 3BUWB 4PALA 1EXRA 2CTNA 1TNPA 2FJUB 1CTRA 3PN7C 2LUCA 2Y1MA 3KPXA 4DS7A 4GPLB 1F71A 3HX4A 3RLZA 3SG3A 1IH0A 1QVIZ 3DVMA 4JQ0D 1OZSA 4YGBB 1AK8A 3JVTB 1H4BA 1EG4A 1GGZA 1S5GZ 2H61A 1ZACA 2H61C 4YGCB 1U5IA 3ZNIA 3EK7A 2JNFA 3GK1A 1EJ3A 1V1FA 3D0YA 5HKWA 1QTXA 2JC2A 1F54A 5JOLA 5BPJA 1NX1A 4M2OA 2KYFA 4ORCB 2LCPA 2KFHA 3TDUA 4OKHA 2P6BB 2OS8B 2MA2A 2HQWA 4YBHB 3SIBA 1SL8A 1K9KA 3EK4A 4GGNA 2JULA 3A8RA 1XFWO 2I94A 3TS5B 1PRWA 1YX8A 2F2PA 1MUXA 3DVJA 1SNLA 2CBLA 3TDZA 1KFUL 2WCBA 4MVFA 1ZMZA 2LHLA 1AUIB 1UHKA 1XO5A 2COLB 1TCOB 2M7LA 1K9PA 3PALA 1DT7B 4L9MA 1WRLA 2JQ6A 4MEWA 2A4JA 1X02A 3NSIA 1MR8A 3HCMA 4HREE 3KO0A 3BOWA 2L4IA 2KSPA 2PVBA 3WXAA 1DGUA 2EC6C 1TN4A 2NCPA 4ORAB 3IQQA 3I5FC 2F33A 1J7OA 2CT9A 1E8AA 3I5IC 1MXEA 4HSZA 3RM1A 3FS7A 1F4OA 2ZRTA 5CSNA 4AOMA 1L2OC 3F45A 4NDBA 4QJ4B 2LVVA 1M45A 4FTGA 1BG1A 2KBIA 1G33A 5HLOA 3AAKA 1WDCC 1K93D 1M63B 2Y5IA 4PE7A 1B7TY 2AAOA 1MXLC 2Q91A 3BUXB 5DKQA 1WLZA 1KK8B 4R1EA 2ZKMX 1SR6B 2WC8A 4CLNA 4ICBA 5I2QA 3CLNA 2BL0C 2M3WA 1QX5B 2LV7A 4MRYA 3JTDB 2M8UA 2FCEA 1NWDA 1LXFC 1YRUB 3CTNA 1IRJA 1C7VA 4MZJA 5KTYA 3CGAA 1FI6A 1FBVA 2BKIB 2FOTA 1A75B 2LNKA 1QVIY 3JVTC 4NQGA 3CWGA 4GNKB 1UHHA 1BJFA 1S5GY 1BOCA 3OB2B 1QLSA 1SW8A 4M2PA 3MSEB 1RFJA 4PCWA 4NDCA 2WNDA 1AVSA 2KI6C 2K0JA 3H4SE 1SL7A 1Q80A 2KAVA 2LE9B 2MHHA 2Y4QA 1FW4A 2VRGA 5K89A 2AUCA 2EHBA 1B1GA 3DVEA 2K7OA 2WCFA 1ODBA 5DKNA 2JU0A 2JPTA 3PM8A 4GGFC 4GGFA 3SG5A 1NUBA 2KNEA 3WHUB 1DJXA 1F55A 2I7AA 4MSPA 4PHMA 2L51A 4GFTA 1CDNA 1IQ5A 1B7TZ 5CSFA 5AFPA 5HLVA 3SIAA 2OTGC 2LAPA 1NCYA 4I5NB 1H8BA 2NXQA 4OCIA 1Y1UA 2L0PA 1A4PA 1UURA 2KFGA 1SPYA 3M0WA 1YR5A 5FYXA 1CKKA 2LVIA 2O5GA 4D1EA 1M39A 1CDLA 3OB1B 4I5KA 5CSIA 3CS1A 1KSMA 2PSRA 2CCMA 1XFVO 1CMFA 3FWBA 2NCOA 2L4HA 3PLFB 2LMVA 5ER5A 1ALWA 3PFVA 1TNQA 2BBMA 5F6TA 2M1KB 1WRKA 1GGWA 1F4QA 1BU3A 4MRXA 4JWQA 2E30A 3CR5X 1A29A 3NSOA 1OZOA 1KK8C 3EVRA 2I2RE 4BY4A 1SR6C 1KWOC 4C0JA 1LKJA 5J3XA 1K2HA 2Q4UA 2KDHA 4TNCA 4PDZA 2HF5A 1EH2A 4C0KA 3IQOA 2LLTA 4OR9B 3OX6A 1YRTB 4ZCUA 1G4YR 1NX2A 1W7IB 1CDPA 1C07A 2JTZA 1JC2A 1B4CA 2LC5A 3DVKA 1A75A 2K7DA 5AERA 4WQ3A 2LVKA 3OP0A 1B47A 1EG3A 2L2EA 4I5LB 1ZUZA 1OMVA 1SMGA 2JXLA 2R2IA 3K21A 4MN0A 1BR1B 4N5XA 4NDDA 2KI4B 2KI6D 2QPTA 4QJ5B 2BCBA 2KQYA 4XJKA 3O4YA 2K61A 3AAJA 4DUQA 1DTLA 1EL4A 4I5JA 1RECA 4PHKA 3TUYC 1CLLA 1Y1XA 1JUOA 1DJGA 2ZNEA 1QJTA 3LCPC 1XVJA 1TNWA 4CPVA 1PK0D 2WOSA 1PSBA 2JT8A 4YRUA 1B8LA 4A4BA 1J7RA 3VROA 3AKAA 1B9AA 1IJ6A 1CLBA 4YGAA 1SY9A 4PHJA 1CLMA 1PALA 2HETA 2GGMA 3VRRA 2D8NA 1SCMB 1QXPA 2MRDA 3BXKA 1CFDA 2CXJA 5I2LA 1MF8B 2BE6A 2MAZA 3VRNA 1QS7A 2L50A 4YI9A 4PE1A 2O60A 4AQIA 1BR4B 4U8DA 1NIWA 1JWDA 2F3YA 1DJIA 1KK7Y 4WRIA 1FPWA 2AMIA 1MWNA 2K2AA 1J1EA 2JOJA 1J7PA 1LVCD 1TTXA 2BECA 2NZ0A 2DOQA 1SKTA 1QASA 1QV0A 1JFKA 1K94A 3KHEA 2LLUA 1KCYA 1SRAA 2BCXA 3CR4X 1XK4A 2OS8C 2JT3A 2E6WA 1OOJA 1Y0VH 1KFXL 2KBMA 5HYDA 1S36A 3TS5C 4PHNA 4MZKA 4C0LA 1N65A 4YGEB 1BLQA 2G2BA 1A03A 2PALA 1K9UA 2F2OA 2LUXA 3BUOB 1LA0A 2LM5A 3I5HB 1RWYA 1J7QA 2K2FA 1UHNA 1W7JB 1YUUA 5G08A 1BODA 2Y1NA 4ETOA 3GK2A 2K8MB 1SL9A 1OMDA 2PRUA 1JFJA 4QJ3B 1JF0A 3NSKA 1N2DA 3EK8A 1GQMA 2B1UA 4F0ZB 1CM4A 2PASA 2IS9A 3BOWB 3C1VA 5DKRA 4CIDA 2LVJA 5AXIA 2L98A 2MLEC 1IGVA 2V53A 3I5GB 2KQ6A 3DF0B 2RGIA 1AJ4A 2BE4A 3BUNB 5AEQA 1ALVA 1YX7A 1WRZA 4MZLA 2MLFC 2KAYA 4HRHA 1NCXA 3PATA 1ZFSA 4N1FA 1DMOA 2KAXA 2KYCA 4FQOA 1KK7Z 4Q04A 3VGOA 4YI8A 1YUTA 3AKBA 1IWQA 1PVBA 3TDIA 1GJYA 1DGVA 1ZOTB 1XFXO 1QATA 1K90D 1RTP1 1R2UA 1SK6D 1SCMC 5D69A 1V1GA 2HQ8A 1BT6A 2M97A 1NSHA 3JTDC 3NSLA 1KQMB 1DJWA 2LLSA 2NLNA 4MLWA 1PSRA 1WY9A 1J55A 1C7WA 2EGDA 1SYMA 1FI5A 1QX2A 1CMGA 1L7ZA 2BKHB 1A2XA 3A4UB 1QLKA 4GAOA 1KFXS 3LK1A 2QACA 4USLA 4YGDB 5AANA 3EVUA 5IBWA 4DIRA 2LMTA 1UUSA 2LHIA 1M46A 5ER4X 4A4CA 2M1UA 1YUSA 2KOTA 1CNPA 1HQVA 1JBAA 3QRXA 1K8UA 1OMRA 4AQJA 3SG4A 2JTTA 3SJSA 1MQ1A 1S26D 1UHJA 2F3ZA 3O2PA 1CM1A 1UP5A 1VRKA 5TNCA 2KGRA 1JF2A 4GUKA 1Y6WA 3CR2A 3GK4X 1LA3A 1XFUO 3ZWHA 2ZN9A 2M7NA 1YTZC 4OV2A 3SG2A 5HKYA 4N1GA 2ZNDA 3I5HC 2SCPA 1N0YA 1DJHA 1RJVA 1S6CA 3LL8B 1OQPA 2JT0A 1WLMA 4P5OE 1CB1A 2H2KA 2OPOA 1FF1A 1SCVA 2PMYA 1BMOA 1TNXA 2WCEA 2JNXA 1QIVA 3CZTX 4PE0A 3PSRA 1K96A 2F8PA 5GQQC 3GOFA 2G9BA 1DJYA 2OTGB 3I5GC 2KHNA 5HKZA 1DF0B 1S6JA 1XA5A 3DF0A 3FIAA 3E3RA 3EKHA 3FWCA 1TOPA 2ZRSA 4HRGA 3KEVA 5CSJA 1F8HA 2FCDA 3OX5A 3PN7B 4BY5A 1TCFA 2K7BA
chains in the Genus database with same CATH superfamily
2WCMA 1F70A 1QV1A 2BBNA 3NXAA 1YVHA 1NYAA 2KPHA 2MJWB 5KU1A 1SSEB 2JZIA 1XYDA 3LLEA 3WNXB 1AP4A 5FI6A 2K7CA 3SG7A 5KSZA 1JSAA 2LMUA 2WCLA 1D1OA 1IKUA 3SG6A 1OE9B 1K95A 2BCAA 2I18A 1U5IB 2KFFA 4ORBB 2LP3A 4UPGA 1OSAA 1QX7A 3VRPA 1B8RA 1KWOB 1CFPA 1KQMC 4JKTA 3D0YB 1LINA 1AJ5A 3O6BA 2M9GA 3EKJA 3EVVA 1IJ5A 1XFYO 1XK4C 2M49B 1UHIA 3S0EA 1PVAA 4M2QA 1NX3A 1BF5A 1M31A 3DYEA 5PALA 2L5XB 1CFCA 2GV5A 5FI2A 4PE4A 2LP2A 1RROA 2ZN8A 3BQ3A 1XFZO 3DD4A 5CPVA 3IVTA 1NCZA 4DRWA 3VRQA 1Y1AA 1J1DA 1DJZA 3TZ1A 1S3PA 1UWOA 4IL1A 5DICA 2ZFDA 2CNPA 1RK9A 5I2OA 4GBAA 1QWVA 2TN4A 4MBEA 1KFUS 1QIWA 1R6PA 3LK0A 2ISDA 2WORA 4XYNA 1KQVA 2KI4C 1DVIA 2JWWA 2ERBA 1TRFA 1YVLA 3IF7A 4XJKB 1T14A 4JPZB 4DCKA 1NX0A 5D7FA 4WQ2A 4CFRA 2KGBC 4CFQA 2EC6B 1PULA 1G8IA 4E68A 3TUYB 1S1EA 3I5FB 2LANA 1B8CA 2HPSA 1IQ3A 3I5IB 5JJGA 3WHTB 1S6IA 2M0RA 1L2OB 3OHMB 3D74A 4ZCVA 2MBXA 1NP8A 3KF9A 4P2YB 1AHRA 1TIZA 2M29A 1WDCB 3L4LA 1HT9A 2JXCA 3D10A 2JRFA 1IG5A 1CDMA 1NPQA 1YURA 3BUMB 1DF0A 3O78A 1SBJA 4OZDA 3BYAA 4OVNF 5B8IB 5I8NA 1IIOA 1CFFA 1KSOA 1MHOA 2BL0B 2GGZA 3ICBA 2SASA 3BUWB 4PALA 1EXRA 2CTNA 1TNPA 2FJUB 1CTRA 3PN7C 2LUCA 2Y1MA 3KPXA 4DS7A 3VB1A 3V2LA 3S0FA 4GPLB 1F71A 3HX4A 3RLZA 3SG3A 1IH0A 1QVIZ 3DVMA 4JQ0D 1OZSA 1P28A 4YGBB 3JVTB 1AK8A 1Z2CB 1H4BA 1EG4A 1GGZA 1S5GZ 2H61A 1ZACA 2H61C 1OOHA 3CZ0A 4YGCB 1U5IA 3ZNIA 3L4AA 3EK7A 2JNFA 3GK1A 1EJ3A 1V1FA 3D0YA 5HKWA 3OBVA 4INXA 1QTXA 2JC2A 1F54A 5JOLA 5BPJA 1NX1A 4M2OA 2KYFA 4ORCB 2LCPA 2KFHA 3TDUA 4OKHA 2P6BB 3K1EA 2OS8B 2MA2A 2HQWA 4YBHB 3SIBA 1SL8A 3DY9A 3Q8IA 1K9KA 3EK4A 4GGNA 2JULA 3A8RA 1XFWO 2I94A 3TS5B 1PRWA 1YX8A 2F2PA 1MUXA 3UNWA 3DVJA 1SNLA 2CBLA 3TDZA 1KFUL 2WCBA 1Z4HA 4MVFA 1ZMZA 3D78A 2LHLA 1AUIB 1UHKA 1XO5A 2COLB 1TCOB 2M7LA 1K9PA 3PALA 1DT7B 4L9MA 1WRLA 2JQ6A 4MEWA 2QEHA 2A4JA 1X02A 1LS8A 3NSIA 1MR8A 3HCMA 4HREE 3KO0A 3BOWA 2L4IA 2KSPA 2PVBA 3NGVA 3WXAA 3O4XA 1DGUA 1OW4A 2EC6C 1TN4A 2NCPA 4ORAB 2PQLA 3S0AA 3IQQA 3I5FC 2F33A 3CYZA 1J7OA 2CT9A 1E8AA 3I5IC 1MXEA 4HSZA 3RM1A 3FS7A 1F4OA 1DQEA 2ZRTA 5CSNA 4AOMA 1L2OC 3F45A 4NDBA 4QJ4B 2LVVA 1M45A 4FTGA 1BG1A 2KBIA 1G33A 3D77A 5HLOA 3AAKA 3PJIA 1WDCC 1K93D 1M63B 2Y5IA 3B7AA 1B7TY 2AAOA 1MXLC 3BJHA 4PE7A 2Q91A 3BUXB 3D75A 5DKQA 1WLZA 1KK8B 4R1EA 2ZKMX 1SR6B 2WC8A 3D73A 4ICBA 1TUZA 4CLNA 5I2QA 3CLNA 2BL0C 2M3WA 3R72A 1QX5B 2LV7A 4MRYA 3JTDB 2M8UA 4OCIA 5I94A 1ORGA 2FCEA 1NWDA 3BFAA 1LXFC 1YRUB 3DXLA 3CTNA 1IRJA 1C7VA 4MZJA 5KTYA 3CGAA 1FI6A 1FBVA 1TWOA 2BKIB 2FOTA 2PYQA 1A75B 2LNKA 1QVIY 3JVTC 4NQGA 3CWGA 4GNKB 1UHHA 1BJFA 1S5GY 1BOCA 3OB2B 1QLSA 1SW8A 2QEVA 4M2PA 2WC5A 3MSEB 1RFJA 4PCWA 4NDCA 3R1PA 2WNDA 1AVSA 2KI6C 2K0JA 3H4SE 1SL7A 1Q80A 2KAVA 2LE9B 2MHHA 2P71A 2Y4QA 1FW4A 3CZ2A 3N7HA 2VRGA 5K89A 2AUCA 2KLEA 2QDIA 2EHBA 3FE9A 2FJYA 1B1GA 3DVEA 2K7OA 2WCFA 1ODBA 5DKNA 2JU0A 2JPTA 3PM8A 4GGFC 4GGFA 3SG5A 3SS5A 1NUBA 2KNEA 3WHUB 1DJXA 3B6XA 2I7AA 2WC6A 1F55A 4MSPA 3S0GA 4PHMA 3B87A 2L51A 4GFTA 1CDNA 1IQ5A 1B7TZ 5CSFA 5AFPA 5HLVA 3SIAA 1DC1A 2OTGC 2LAPA 1NCYA 4I5NB 1TUJA 2NXQA 1C3ZA 1Y1UA 2L0PA 1A4PA 1UURA 2KFGA 3FE6A 1SPYA 3M0WA 1C3YA 1YR5A 5FYXA 1CKKA 2LVIA 2O5GA 4D1EA 1M39A 3CDNA 1CDLA 3OB1B 4I5KA 5CSIA 3CS1A 3PM2A 1KSMA 2PSRA 1XFVO 2CCMA 3B86A 1CMFA 2WCJA 3FWBA 2NCOA 2L4HA 3PLFB 2LMVA 1XFRA 4FQTA 5ER5A 1ALWA 3PFVA 1TNQA 2BBMA 5F6TA 5FI7A 2M1KB 1WRKA 2L2CA 1F4QA 1GGWA 1BU3A 4MRXA 4JWQA 2E30A 3CR5X 1A29A 3NSOA 1OZOA 1KK8C 3EVRA 2I2RE 4BY4A 1SR6C 1KWOC 4C0JA 1LKJA 5J3XA 1K2HA 2Q4UA 2KDHA 3SS3A 4TNCA 4PDZA 2HF5A 1EH2A 4C0KA 3IQOA 2LLTA 4OR9B 3OX6A 1YRTB 4ZCUA 1G4YR 1NX2A 1W7IB 3CZ1A 1CDPA 1C07A 2JTZA 1JC2A 1B4CA 2LC5A 3DVKA 1A75A 2WCHA 2K7DA 5AERA 4WQ3A 2LVKA 2P70A 3OP0A 1B47A 1EG3A 2QEOA 2L2EA 4I5LB 1ZUZA 1OMVA 1SMGA 2JXLA 2R2IA 3K21A 4MN0A 1BR1B 3R1VA 4N5XA 4NDDA 2KI4B 2KI6D 2QPTA 4QJ5B 2BCBA 2KQYA 4XJKA 3O4YA 2H8VA 2K61A 4JD9A 2L5YA 3AAJA 4DUQA 1DTLA 1EL4A 4I5JA 1RECA 4PHKA 4KYNA 3TUYC 1CLLA 1Y1XA 1JUOA 1DJGA 2ZNEA 5D3OA 1QJTA 1OOGA 3LCPC 1XVJA 1TNWA 4CPVA 1PK0D 2WOSA 1PSBA 1GM0A 2JT8A 4YRUA 1B8LA 4A4BA 3RZSA 1J7RA 3VROA 3AKAA 1B9AA 1IJ6A 3BFHA 1CLBA 4YGAA 1SY9A 3DZTA 1CLMA 1PALA 2HETA 4PHJA 2GGMA 3VRRA 2D8NA 1SCMB 2YGUA 1QXPA 2MRDA 3BXKA 1CFDA 2CXJA 5I2LA 1MF8B 2BE6A 2MAZA 3VRNA 1QS7A 2L50A 3OGNA 4PE1A 4YI9A 2O60A 3B88A 4AQIA 1BR4B 4U8DA 1NIWA 1JWDA 2F3YA 1DJIA 1KK7Y 4WRIA 1FPWA 2AMIA 1MWNA 2K2AA 1J1EA 2JOJA 1J7PA 1LVCD 1TTXA 2BECA 2NZ0A 2DOQA 1SKTA 1QASA 1QV0A 1JFKA 2BAPA 1K94A 1OOIX 3KHEA 2LLUA 1KCYA 1SRAA 2BCXA 3CABA 4PT1A 3CR4X 1XK4A 1W9ZA 2OS8C 2JT3A 2E6WA 1OOJA 1Y0VH 1KFXL 2KBMA 5HYDA 1S36A 3TS5C 4PHNA 4MZKA 4C0LA 1N65A 4YGEB 1BLQA 2G2BA 2K60A 1A03A 2PALA 1K9UA 2F2OA 2LUXA 3BUOB 1LA0A 3S0BA 2LM5A 3I5HB 1RWYA 1J7QA 2K2FA 1UHNA 1W7JB 1YUUA 5G08A 1BODA 2Y1NA 4ETOA 3GK2A 2K8MB 1SL9A 1OMDA 2PRUA 1JFJA 4QJ3B 1JF0A 3NSKA 1N2DA 3EK8A 2QEBA 1GQMA 2B1UA 4F0ZB 1CM4A 2PASA 2IS9A 3BOWB 3C1VA 5DKRA 4CIDA 2LVJA 1OOFA 5AXIA 2L98A 2MLEC 1IGVA 2V53A 3EG5B 3I5GB 3NHIA 2KQ6A 3DF0B 2RGIA 1AJ4A 2BE4A 3BUNB 5AEQA 1ALVA 1YX7A 1WRZA 4MZLA 4INWA 2MLFC 2KAYA 4HRHA 1NCXA 3PATA 1ZFSA 4N1FA 1DMOA 2KAXA 2KYCA 4FQOA 5EL2A 1KK7Z 4Q04A 3VGOA 3FE8A 4YI8A 1YUTA 3AKBA 1IWQA 1PVBA 3TDIA 1GJYA 1DGVA 1ZOTB 1XFXO 1QATA 1K90D 1RTP1 1R2UA 3UO9A 1SK6D 1SCMC 5D69A 1V1GA 2HQ8A 1BT6A 2M97A 1NSHA 3JTDC 3NSLA 1DELA 1KQMB 3BFBA 2KLDA 1DJWA 3NHTA 2LLSA 2NLNA 4MLWA 1PSRA 1WY9A 1J55A 1C7WA 2EGDA 1SYMA 1FI5A 1QX2A 1CMGA 1L7ZA 2BKHB 1A2XA 3A4UB 1QLKA 4GAOA 1KFXS 3LK1A 2QACA 4USLA 4YGDB 5AANA 3EVUA 5IBWA 4DIRA 2LMTA 1UUSA 2LHIA 1M46A 2WCKA 5ER4X 2M1UA 4A4CA 1YUSA 2KOTA 5HL1A 1CNPA 1HQVA 1JBAA 3QRXA 1K8UA 2BNXA 1OMRA 4AQJA 3SG4A 2JTTA 3SJSA 1H8BA 1MQ1A 1S26D 1UHJA 2F3ZA 3L47A 3O2PA 1CM1A 1UP5A 1VRKA 5TNCA 2KGRA 1JF2A 4GUKA 1Y6WA 2JPOA 3CR2A 3GK4X 1LA3A 3SS4A 1XFUO 3ZWHA 2ZN9A 2M7NA 1YTZC 4OV2A 4F7FA 3SG2A 3S0DA 5HKYA 4N1GA 2ZNDA 3I5HC 2SCPA 1N0YA 1DJHA 1RJVA 1S6CA 3LL8B 1OQPA 2JT0A 1WLMA 4P5OE 1CB1A 2H2KA 2OPOA 1FF1A 1SCVA 2PMYA 1BMOA 1TNXA 2GTEA 2WCEA 2JNXA 1QIVA 3CZTX 4PE0A 3R1OA 1DEKA 3PSRA 1K96A 2F8PA 3QMEA 3GOFA 2G9BA 4IJ7A 5GQQC 1DJYA 2OTGB 3I5GC 2KHNA 5HKZA 1DF0B 1S6JA 3D76A 1XA5A 3DF0A 3FIAA 3E3RA 3EKHA 3FWCA 1TOPA 2ZRSA 4HRGA 3KEVA 5CSJA 1F8HA 2FCDA 3OX5A 3PN7B 4BY5A 1TCFA 2K7BA
chains in the Genus database with same CATH topology
1F70A 1QV1A 2BBNA 3NXAA 1YVHA 1NYAA 2MJWB 5KU1A 2JZIA 3LLEA 1XYDA 3WNXB 1AP4A 1JSAA 2K7CA 3SG7A 5KSZA 2LMUA 1D1OA 1IKUA 3SG6A 1OE9B 1K95A 2BCAA 2I18A 1U5IB 2KFFA 4ORBB 2LP3A 4UPGA 1OSAA 1QX7A 3VRPA 1B8RA 1KWOB 1CFPA 1KQMC 3D0YB 1LINA 1AJ5A 3O6BA 2M9GA 3EKJA 3EVVA 1IJ5A 1XFYO 1XK4C 2M49B 1UHIA 1PVAA 4M2QA 1NX3A 1BF5A 1M31A 5PALA 2L5XB 1CFCA 2GV5A 4PE4A 2LP2A 1RROA 2ZN8A 3BQ3A 1XFZO 3DD4A 5CPVA 4DRWA 1NCZA 3VRQA 1Y1AA 1J1DA 1DJZA 3TZ1A 1S3PA 1UWOA 4IL1A 2ZFDA 2CNPA 1RK9A 5I2OA 4GBAA 2TN4A 4MBEA 1KFUS 1QIWA 1R6PA 3LK0A 2ISDA 2WORA 4XYNA 1KQVA 2KI4C 1DVIA 2JWWA 1TRFA 1YVLA 3IF7A 4XJKB 4DCKA 4JPZB 1NX0A 5D7FA 4WQ2A 4CFRA 2KGBC 4CFQA 2EC6B 1PULA 1G8IA 4E68A 3TUYB 1S1EA 3I5FB 2LANA 1B8CA 2HPSA 1IQ3A 3I5IB 5JJGA 3WHTB 1S6IA 2M0RA 1L2OB 3OHMB 4ZCVA 2MBXA 1NP8A 3KF9A 4P2YB 1AHRA 1TIZA 2M29A 1WDCB 1HT9A 2JXCA 3D10A 2JRFA 1IG5A 1CDMA 1NPQA 1YURA 3BUMB 1DF0A 3O78A 1SBJA 3BYAA 4OVNF 5B8IB 5I8NA 1CFFA 1KSOA 1MHOA 2BL0B 2GGZA 3ICBA 2SASA 3BUWB 4PALA 1EXRA 2CTNA 1TNPA 2FJUB 1CTRA 3PN7C 2LUCA 2Y1MA 3KPXA 4DS7A 4GPLB 1F71A 3HX4A 3RLZA 3SG3A 1IH0A 1QVIZ 3DVMA 4JQ0D 1OZSA 4YGBB 1AK8A 3JVTB 1H4BA 1EG4A 1GGZA 1S5GZ 2H61A 1ZACA 2H61C 4YGCB 1U5IA 3ZNIA 3EK7A 2JNFA 3GK1A 1EJ3A 1V1FA 3D0YA 5HKWA 1QTXA 2JC2A 1F54A 5JOLA 5BPJA 1NX1A 4M2OA 2KYFA 4ORCB 2LCPA 2KFHA 3TDUA 4OKHA 2P6BB 2OS8B 2MA2A 2HQWA 4YBHB 3SIBA 1SL8A 1K9KA 3EK4A 4GGNA 2JULA 3A8RA 1XFWO 2I94A 3TS5B 1PRWA 1YX8A 2F2PA 1MUXA 3DVJA 1SNLA 2CBLA 3TDZA 1KFUL 2WCBA 4MVFA 1ZMZA 2LHLA 1AUIB 1UHKA 1XO5A 2COLB 1TCOB 2M7LA 1K9PA 3PALA 1DT7B 4L9MA 1WRLA 2JQ6A 4MEWA 2A4JA 1X02A 3NSIA 1MR8A 3HCMA 4HREE 3KO0A 3BOWA 2L4IA 2KSPA 2PVBA 3WXAA 1DGUA 2EC6C 1TN4A 2NCPA 4ORAB 3IQQA 3I5FC 2F33A 1J7OA 2CT9A 1E8AA 3I5IC 1MXEA 4HSZA 3RM1A 3FS7A 1F4OA 2ZRTA 5CSNA 4AOMA 1L2OC 3F45A 4NDBA 4QJ4B 2LVVA 1M45A 4FTGA 1BG1A 2KBIA 1G33A 5HLOA 3AAKA 1WDCC 1K93D 1M63B 2Y5IA 4PE7A 1B7TY 2AAOA 1MXLC 2Q91A 3BUXB 5DKQA 1WLZA 1KK8B 4R1EA 2ZKMX 1SR6B 2WC8A 4CLNA 4ICBA 5I2QA 3CLNA 2BL0C 2M3WA 1QX5B 2LV7A 4MRYA 3JTDB 2M8UA 2FCEA 1NWDA 1LXFC 1YRUB 3CTNA 1IRJA 1C7VA 4MZJA 5KTYA 3CGAA 1FI6A 1FBVA 2BKIB 2FOTA 1A75B 2LNKA 1QVIY 3JVTC 4NQGA 3CWGA 4GNKB 1UHHA 1BJFA 1S5GY 1BOCA 3OB2B 1QLSA 1SW8A 4M2PA 3MSEB 1RFJA 4PCWA 4NDCA 2WNDA 1AVSA 2KI6C 2K0JA 3H4SE 1SL7A 1Q80A 2KAVA 2LE9B 2MHHA 2Y4QA 1FW4A 2VRGA 5K89A 2AUCA 2EHBA 1B1GA 3DVEA 2K7OA 2WCFA 1ODBA 5DKNA 2JU0A 2JPTA 3PM8A 4GGFC 4GGFA 3SG5A 1NUBA 2KNEA 3WHUB 1DJXA 1F55A 2I7AA 4MSPA 4PHMA 2L51A 4GFTA 1CDNA 1IQ5A 1B7TZ 5CSFA 5AFPA 5HLVA 3SIAA 2OTGC 2LAPA 1NCYA 4I5NB 1H8BA 2NXQA 4OCIA 1Y1UA 2L0PA 1A4PA 1UURA 2KFGA 1SPYA 3M0WA 1YR5A 5FYXA 1CKKA 2LVIA 2O5GA 4D1EA 1M39A 1CDLA 3OB1B 4I5KA 5CSIA 3CS1A 1KSMA 2PSRA 2CCMA 1XFVO 1CMFA 3FWBA 2NCOA 2L4HA 3PLFB 2LMVA 5ER5A 1ALWA 3PFVA 1TNQA 2BBMA 5F6TA 2M1KB 1WRKA 1GGWA 1F4QA 1BU3A 4MRXA 4JWQA 2E30A 3CR5X 1A29A 3NSOA 1OZOA 1KK8C 3EVRA 2I2RE 4BY4A 1SR6C 1KWOC 4C0JA 1LKJA 5J3XA 1K2HA 2Q4UA 2KDHA 4TNCA 4PDZA 2HF5A 1EH2A 4C0KA 3IQOA 2LLTA 4OR9B 3OX6A 1YRTB 4ZCUA 1G4YR 1NX2A 1W7IB 1CDPA 1C07A 2JTZA 1JC2A 1B4CA 2LC5A 3DVKA 1A75A 2K7DA 5AERA 4WQ3A 2LVKA 3OP0A 1B47A 1EG3A 2L2EA 4I5LB 1ZUZA 1OMVA 1SMGA 2JXLA 2R2IA 3K21A 4MN0A 1BR1B 4N5XA 4NDDA 2KI4B 2KI6D 2QPTA 4QJ5B 2BCBA 2KQYA 4XJKA 3O4YA 2K61A 3AAJA 4DUQA 1DTLA 1EL4A 4I5JA 1RECA 4PHKA 3TUYC 1CLLA 1Y1XA 1JUOA 1DJGA 2ZNEA 1QJTA 3LCPC 1XVJA 1TNWA 4CPVA 1PK0D 2WOSA 1PSBA 2JT8A 4YRUA 1B8LA 4A4BA 1J7RA 3VROA 3AKAA 1B9AA 1IJ6A 1CLBA 4YGAA 1SY9A 4PHJA 1CLMA 1PALA 2HETA 2GGMA 3VRRA 2D8NA 1SCMB 1QXPA 2MRDA 3BXKA 1CFDA 2CXJA 5I2LA 1MF8B 2BE6A 2MAZA 3VRNA 1QS7A 2L50A 4YI9A 4PE1A 2O60A 4AQIA 1BR4B 4U8DA 1NIWA 1JWDA 2F3YA 1DJIA 1KK7Y 4WRIA 1FPWA 2AMIA 1MWNA 2K2AA 1J1EA 2JOJA 1J7PA 1LVCD 1TTXA 2BECA 2NZ0A 2DOQA 1SKTA 1QASA 1QV0A 1JFKA 1K94A 3KHEA 2LLUA 1KCYA 1SRAA 2BCXA 3CR4X 1XK4A 2OS8C 2JT3A 2E6WA 1OOJA 1Y0VH 1KFXL 2KBMA 5HYDA 1S36A 3TS5C 4PHNA 4MZKA 4C0LA 1N65A 4YGEB 1BLQA 2G2BA 1A03A 2PALA 1K9UA 2F2OA 2LUXA 3BUOB 1LA0A 2LM5A 3I5HB 1RWYA 1J7QA 2K2FA 1UHNA 1W7JB 1YUUA 5G08A 1BODA 2Y1NA 4ETOA 3GK2A 2K8MB 1SL9A 1OMDA 2PRUA 1JFJA 4QJ3B 1JF0A 3NSKA 1N2DA 3EK8A 1GQMA 2B1UA 4F0ZB 1CM4A 2PASA 2IS9A 3BOWB 3C1VA 5DKRA 4CIDA 2LVJA 5AXIA 2L98A 2MLEC 1IGVA 2V53A 3I5GB 2KQ6A 3DF0B 2RGIA 1AJ4A 2BE4A 3BUNB 5AEQA 1ALVA 1YX7A 1WRZA 4MZLA 2MLFC 2KAYA 4HRHA 1NCXA 3PATA 1ZFSA 4N1FA 1DMOA 2KAXA 2KYCA 4FQOA 1KK7Z 4Q04A 3VGOA 4YI8A 1YUTA 3AKBA 1IWQA 1PVBA 3TDIA 1GJYA 1DGVA 1ZOTB 1XFXO 1QATA 1K90D 1RTP1 1R2UA 1SK6D 1SCMC 5D69A 1V1GA 2HQ8A 1BT6A 2M97A 1NSHA 3JTDC 3NSLA 1KQMB 1DJWA 2LLSA 2NLNA 4MLWA 1PSRA 1WY9A 1J55A 1C7WA 2EGDA 1SYMA 1FI5A 1QX2A 1CMGA 1L7ZA 2BKHB 1A2XA 3A4UB 1QLKA 4GAOA 1KFXS 3LK1A 2QACA 4USLA 4YGDB 5AANA 3EVUA 5IBWA 4DIRA 2LMTA 1UUSA 2LHIA 1M46A 5ER4X 4A4CA 2M1UA 1YUSA 2KOTA 1CNPA 1HQVA 1JBAA 3QRXA 1K8UA 1OMRA 4AQJA 3SG4A 2JTTA 3SJSA 1MQ1A 1S26D 1UHJA 2F3ZA 3O2PA 1CM1A 1UP5A 1VRKA 5TNCA 2KGRA 1JF2A 4GUKA 1Y6WA 3CR2A 3GK4X 1LA3A 1XFUO 3ZWHA 2ZN9A 2M7NA 1YTZC 4OV2A 3SG2A 5HKYA 4N1GA 2ZNDA 3I5HC 2SCPA 1N0YA 1DJHA 1RJVA 1S6CA 3LL8B 1OQPA 2JT0A 1WLMA 4P5OE 1CB1A 2H2KA 2OPOA 1FF1A 1SCVA 2PMYA 1BMOA 1TNXA 2WCEA 2JNXA 1QIVA 3CZTX 4PE0A 3PSRA 1K96A 2F8PA 5GQQC 3GOFA 2G9BA 1DJYA 2OTGB 3I5GC 2KHNA 5HKZA 1DF0B 1S6JA 1XA5A 3DF0A 3FIAA 3E3RA 3EKHA 3FWCA 1TOPA 2ZRSA 4HRGA 3KEVA 5CSJA 1F8HA 2FCDA 3OX5A 3PN7B 4BY5A 1TCFA 2K7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F70 A;  1QV1 A;  2BBN A;  3NXA A;  1YVH A;  1NYA A;  2MJW B;  5KU1 A;  2JZI A;  3LLE A;  1XYD A;  3WNX B;  1AP4 A;  1JSA A;  2K7C A;  3SG7 A;  5KSZ A;  2LMU A;  1D1O A;  1IKU A;  3SG6 A;  1OE9 B;  1K95 A;  2BCA A;  2I18 A;  1U5I B;  2KFF A;  4ORB B;  2LP3 A;  4UPG A;  1OSA A;  1QX7 A;  3VRP A;  1B8R A;  1KWO B;  1CFP A;  1KQM C;  3D0Y B;  1LIN A;  1AJ5 A;  3O6B A;  2M9G A;  3EKJ A;  3EVV A;  1IJ5 A;  1XFY O;  1XK4 C;  2M49 B;  1UHI A;  1PVA A;  4M2Q A;  1NX3 A;  1BF5 A;  1M31 A;  5PAL A;  2L5X B;  1CFC A;  2GV5 A;  4PE4 A;  2LP2 A;  1RRO A;  2ZN8 A;  3BQ3 A;  1XFZ O;  3DD4 A;  5CPV A;  4DRW A;  1NCZ A;  3VRQ A;  1Y1A A;  1J1D A;  1DJZ A;  3TZ1 A;  1S3P A;  1UWO A;  4IL1 A;  2ZFD A;  2CNP A;  1RK9 A;  5I2O A;  4GBA A;  2TN4 A;  4MBE A;  1KFU S;  1QIW A;  1R6P A;  3LK0 A;  2ISD A;  2WOR A;  4XYN A;  1KQV A;  2KI4 C;  1DVI A;  2JWW A;  1TRF A;  1YVL A;  3IF7 A;  4XJK B;  4DCK A;  4JPZ B;  1NX0 A;  5D7F A;  4WQ2 A;  4CFR A;  2KGB C;  4CFQ A;  2EC6 B;  1PUL A;  1G8I A;  4E68 A;  3TUY B;  1S1E A;  3I5F B;  2LAN A;  1B8C A;  2HPS A;  1IQ3 A;  3I5I B;  5JJG A;  3WHT B;  1S6I A;  2M0R A;  1L2O B;  3OHM B;  4ZCV A;  2MBX A;  1NP8 A;  3KF9 A;  4P2Y B;  1AHR A;  1TIZ A;  2M29 A;  1WDC B;  1HT9 A;  2JXC A;  3D10 A;  2JRF A;  1IG5 A;  1CDM A;  1NPQ A;  1YUR A;  3BUM B;  1DF0 A;  3O78 A;  1SBJ A;  3BYA A;  4OVN F;  5B8I B;  5I8N A;  1CFF A;  1KSO A;  1MHO A;  2BL0 B;  2GGZ A;  3ICB A;  2SAS A;  3BUW B;  4PAL A;  1EXR A;  2CTN A;  1TNP A;  2FJU B;  1CTR A;  3PN7 C;  2LUC A;  2Y1M A;  3KPX A;  4DS7 A;  4GPL B;  1F71 A;  3HX4 A;  3RLZ A;  3SG3 A;  1IH0 A;  1QVI Z;  3DVM A;  4JQ0 D;  1OZS A;  4YGB B;  1AK8 A;  3JVT B;  1H4B A;  1EG4 A;  1GGZ A;  1S5G Z;  2H61 A;  1ZAC A;  2H61 C;  4YGC B;  1U5I A;  3ZNI A;  3EK7 A;  2JNF A;  3GK1 A;  1EJ3 A;  1V1F A;  3D0Y A;  5HKW A;  1QTX A;  2JC2 A;  1F54 A;  5JOL A;  5BPJ A;  1NX1 A;  4M2O A;  2KYF A;  4ORC B;  2LCP A;  2KFH A;  3TDU A;  4OKH A;  2P6B B;  2OS8 B;  2MA2 A;  2HQW A;  4YBH B;  3SIB A;  1SL8 A;  1K9K A;  3EK4 A;  4GGN A;  2JUL A;  3A8R A;  1XFW O;  2I94 A;  3TS5 B;  1PRW A;  1YX8 A;  2F2P A;  1MUX A;  3DVJ A;  1SNL A;  2CBL A;  3TDZ A;  1KFU L;  2WCB A;  4MVF A;  1ZMZ A;  2LHL A;  1AUI B;  1UHK A;  1XO5 A;  2COL B;  1TCO B;  2M7L A;  1K9P A;  3PAL A;  1DT7 B;  4L9M A;  1WRL A;  2JQ6 A;  4MEW A;  2A4J A;  1X02 A;  3NSI A;  1MR8 A;  3HCM A;  4HRE E;  3KO0 A;  3BOW A;  2L4I A;  2KSP A;  2PVB A;  3WXA A;  1DGU A;  2EC6 C;  1TN4 A;  2NCP A;  4ORA B;  3IQQ A;  3I5F C;  2F33 A;  1J7O A;  2CT9 A;  1E8A A;  3I5I C;  1MXE A;  4HSZ A;  3RM1 A;  3FS7 A;  1F4O A;  2ZRT A;  5CSN A;  4AOM A;  1L2O C;  3F45 A;  4NDB A;  4QJ4 B;  2LVV A;  1M45 A;  4FTG A;  1BG1 A;  2KBI A;  1G33 A;  5HLO A;  3AAK A;  1WDC C;  1K93 D;  1M63 B;  2Y5I A;  4PE7 A;  1B7T Y;  2AAO A;  1MXL C;  2Q91 A;  3BUX B;  5DKQ A;  1WLZ A;  1KK8 B;  4R1E A;  2ZKM X;  1SR6 B;  2WC8 A;  4CLN A;  4ICB A;  5I2Q A;  3CLN A;  2BL0 C;  2M3W A;  1QX5 B;  2LV7 A;  4MRY A;  3JTD B;  2M8U A;  2FCE A;  1NWD A;  1LXF C;  1YRU B;  3CTN A;  1IRJ A;  1C7V A;  4MZJ A;  5KTY A;  3CGA A;  1FI6 A;  1FBV A;  2BKI B;  2FOT A;  1A75 B;  2LNK A;  1QVI Y;  3JVT C;  4NQG A;  3CWG A;  4GNK B;  1UHH A;  1BJF A;  1S5G Y;  1BOC A;  3OB2 B;  1QLS A;  1SW8 A;  4M2P A;  3MSE B;  1RFJ A;  4PCW A;  4NDC A;  2WND A;  1AVS A;  2KI6 C;  2K0J A;  3H4S E;  1SL7 A;  1Q80 A;  2KAV A;  2LE9 B;  2MHH A;  2Y4Q A;  1FW4 A;  2VRG A;  5K89 A;  2AUC A;  2EHB A;  1B1G A;  3DVE A;  2K7O A;  2WCF A;  1ODB A;  5DKN A;  2JU0 A;  2JPT A;  3PM8 A;  4GGF C;  4GGF A;  3SG5 A;  1NUB A;  2KNE A;  3WHU B;  1DJX A;  1F55 A;  2I7A A;  4MSP A;  4PHM A;  2L51 A;  4GFT A;  1CDN A;  1IQ5 A;  1B7T Z;  5CSF A;  5AFP A;  5HLV A;  3SIA A;  2OTG C;  2LAP A;  1NCY A;  4I5N B;  1H8B A;  2NXQ A;  4OCI A;  1Y1U A;  2L0P A;  1A4P A;  1UUR A;  2KFG A;  1SPY A;  3M0W A;  1YR5 A;  5FYX A;  1CKK A;  2LVI A;  2O5G A;  4D1E A;  1M39 A;  1CDL A;  3OB1 B;  4I5K A;  5CSI A;  3CS1 A;  1KSM A;  2PSR A;  2CCM A;  1XFV O;  1CMF A;  3FWB A;  2NCO A;  2L4H A;  3PLF B;  2LMV A;  5ER5 A;  1ALW A;  3PFV A;  1TNQ A;  2BBM A;  5F6T A;  2M1K B;  1WRK A;  1GGW A;  1F4Q A;  1BU3 A;  4MRX A;  4JWQ A;  2E30 A;  3CR5 X;  1A29 A;  3NSO A;  1OZO A;  1KK8 C;  3EVR A;  2I2R E;  4BY4 A;  1SR6 C;  1KWO C;  4C0J A;  1LKJ A;  5J3X A;  1K2H A;  2Q4U A;  2KDH A;  4TNC A;  4PDZ A;  2HF5 A;  1EH2 A;  4C0K A;  3IQO A;  2LLT A;  4OR9 B;  3OX6 A;  1YRT B;  4ZCU A;  1G4Y R;  1NX2 A;  1W7I B;  1CDP A;  1C07 A;  2JTZ A;  1JC2 A;  1B4C A;  2LC5 A;  3DVK A;  1A75 A;  2K7D A;  5AER A;  4WQ3 A;  2LVK A;  3OP0 A;  1B47 A;  1EG3 A;  2L2E A;  4I5L B;  1ZUZ A;  1OMV A;  1SMG A;  2JXL A;  2R2I A;  3K21 A;  4MN0 A;  1BR1 B;  4N5X A;  4NDD A;  2KI4 B;  2KI6 D;  2QPT A;  4QJ5 B;  2BCB A;  2KQY A;  4XJK A;  3O4Y A;  2K61 A;  3AAJ A;  4DUQ A;  1DTL A;  1EL4 A;  4I5J A;  1REC A;  4PHK A;  3TUY C;  1CLL A;  1Y1X A;  1JUO A;  1DJG A;  2ZNE A;  1QJT A;  3LCP C;  1XVJ A;  1TNW A;  4CPV A;  1PK0 D;  2WOS A;  1PSB A;  2JT8 A;  4YRU A;  1B8L A;  4A4B A;  1J7R A;  3VRO A;  3AKA A;  1B9A A;  1IJ6 A;  1CLB A;  4YGA A;  1SY9 A;  4PHJ A;  1CLM A;  1PAL A;  2HET A;  2GGM A;  3VRR A;  2D8N A;  1SCM B;  1QXP A;  2MRD A;  3BXK A;  1CFD A;  2CXJ A;  5I2L A;  1MF8 B;  2BE6 A;  2MAZ A;  3VRN A;  1QS7 A;  2L50 A;  4YI9 A;  4PE1 A;  2O60 A;  4AQI A;  1BR4 B;  4U8D A;  1NIW A;  1JWD A;  2F3Y A;  1DJI A;  1KK7 Y;  4WRI A;  1FPW A;  2AMI A;  1MWN A;  2K2A A;  1J1E A;  2JOJ A;  1J7P A;  1LVC D;  1TTX A;  2BEC A;  2NZ0 A;  2DOQ A;  1SKT A;  1QAS A;  1QV0 A;  1JFK A;  1K94 A;  3KHE A;  2LLU A;  1KCY A;  1SRA A;  2BCX A;  3CR4 X;  1XK4 A;  2OS8 C;  2JT3 A;  2E6W A;  1OOJ A;  1Y0V H;  1KFX L;  2KBM A;  5HYD A;  1S36 A;  3TS5 C;  4PHN A;  4MZK A;  4C0L A;  1N65 A;  4YGE B;  1BLQ A;  2G2B A;  1A03 A;  2PAL A;  1K9U A;  2F2O A;  2LUX A;  3BUO B;  1LA0 A;  2LM5 A;  3I5H B;  1RWY A;  1J7Q A;  2K2F A;  1UHN A;  1W7J B;  1YUU A;  5G08 A;  1BOD A;  2Y1N A;  4ETO A;  3GK2 A;  2K8M B;  1SL9 A;  1OMD A;  2PRU A;  1JFJ A;  4QJ3 B;  1JF0 A;  3NSK A;  1N2D A;  3EK8 A;  1GQM A;  2B1U A;  4F0Z B;  1CM4 A;  2PAS A;  2IS9 A;  3BOW B;  3C1V A;  5DKR A;  4CID A;  2LVJ A;  5AXI A;  2L98 A;  2MLE C;  1IGV A;  2V53 A;  3I5G B;  2KQ6 A;  3DF0 B;  2RGI A;  1AJ4 A;  2BE4 A;  3BUN B;  5AEQ A;  1ALV A;  1YX7 A;  1WRZ A;  4MZL A;  2MLF C;  2KAY A;  4HRH A;  1NCX A;  3PAT A;  1ZFS A;  4N1F A;  1DMO A;  2KAX A;  2KYC A;  4FQO A;  1KK7 Z;  4Q04 A;  3VGO A;  4YI8 A;  1YUT A;  3AKB A;  1IWQ A;  1PVB A;  3TDI A;  1GJY A;  1DGV A;  1ZOT B;  1XFX O;  1QAT A;  1K90 D;  1RTP 1;  1R2U A;  1SK6 D;  1SCM C;  5D69 A;  1V1G A;  2HQ8 A;  1BT6 A;  2M97 A;  1NSH A;  3JTD C;  3NSL A;  1KQM B;  1DJW A;  2LLS A;  2NLN A;  4MLW A;  1PSR A;  1WY9 A;  1J55 A;  1C7W A;  2EGD A;  1SYM A;  1FI5 A;  1QX2 A;  1CMG A;  1L7Z A;  2BKH B;  1A2X A;  3A4U B;  1QLK A;  4GAO A;  1KFX S;  3LK1 A;  2QAC A;  4USL A;  4YGD B;  5AAN A;  3EVU A;  5IBW A;  4DIR A;  2LMT A;  1UUS A;  2LHI A;  1M46 A;  5ER4 X;  4A4C A;  2M1U A;  1YUS A;  2KOT A;  1CNP A;  1HQV A;  1JBA A;  3QRX A;  1K8U A;  1OMR A;  4AQJ A;  3SG4 A;  2JTT A;  3SJS A;  1MQ1 A;  1S26 D;  1UHJ A;  2F3Z A;  3O2P A;  1CM1 A;  1UP5 A;  1VRK A;  5TNC A;  2KGR A;  1JF2 A;  4GUK A;  1Y6W A;  3CR2 A;  3GK4 X;  1LA3 A;  1XFU O;  3ZWH A;  2ZN9 A;  2M7N A;  1YTZ C;  4OV2 A;  3SG2 A;  5HKY A;  4N1G A;  2ZND A;  3I5H C;  2SCP A;  1N0Y A;  1DJH A;  1RJV A;  1S6C A;  3LL8 B;  1OQP A;  2JT0 A;  1WLM A;  4P5O E;  1CB1 A;  2H2K A;  2OPO A;  1FF1 A;  1SCV A;  2PMY A;  1BMO A;  1TNX A;  2WCE A;  2JNX A;  1QIV A;  3CZT X;  4PE0 A;  3PSR A;  1K96 A;  2F8P A;  5GQQ C;  3GOF A;  2G9B A;  1DJY A;  2OTG B;  3I5G C;  2KHN A;  5HKZ A;  1DF0 B;  1S6J A;  1XA5 A;  3DF0 A;  3FIA A;  3E3R A;  3EKH A;  3FWC A;  1TOP A;  2ZRS A;  4HRG A;  3KEV A;  5CSJ A;  1F8H A;  2FCD A;  3OX5 A;  3PN7 B;  4BY5 A;  1TCF A;  2K7B A; 
#chains in the Genus database with same CATH topology
 2WCM A;  1F70 A;  1QV1 A;  2BBN A;  3NXA A;  1YVH A;  1NYA A;  2KPH A;  2MJW B;  5KU1 A;  1SSE B;  2JZI A;  1XYD A;  3LLE A;  3WNX B;  1AP4 A;  5FI6 A;  2K7C A;  3SG7 A;  5KSZ A;  1JSA A;  2LMU A;  2WCL A;  1D1O A;  1IKU A;  3SG6 A;  1OE9 B;  1K95 A;  2BCA A;  2I18 A;  1U5I B;  2KFF A;  4ORB B;  2LP3 A;  4UPG A;  1OSA A;  1QX7 A;  3VRP A;  1B8R A;  1KWO B;  1CFP A;  1KQM C;  4JKT A;  3D0Y B;  1LIN A;  1AJ5 A;  3O6B A;  2M9G A;  3EKJ A;  3EVV A;  1IJ5 A;  1XFY O;  1XK4 C;  2M49 B;  1UHI A;  3S0E A;  1PVA A;  4M2Q A;  1NX3 A;  1BF5 A;  1M31 A;  3DYE A;  5PAL A;  2L5X B;  1CFC A;  2GV5 A;  5FI2 A;  4PE4 A;  2LP2 A;  1RRO A;  2ZN8 A;  3BQ3 A;  1XFZ O;  3DD4 A;  5CPV A;  3IVT A;  1NCZ A;  4DRW A;  3VRQ A;  1Y1A A;  1J1D A;  1DJZ A;  3TZ1 A;  1S3P A;  1UWO A;  4IL1 A;  5DIC A;  2ZFD A;  2CNP A;  1RK9 A;  5I2O A;  4GBA A;  1QWV A;  2TN4 A;  4MBE A;  1KFU S;  1QIW A;  1R6P A;  3LK0 A;  2ISD A;  2WOR A;  4XYN A;  1KQV A;  2KI4 C;  1DVI A;  2JWW A;  2ERB A;  1TRF A;  1YVL A;  3IF7 A;  4XJK B;  1T14 A;  4JPZ B;  4DCK A;  1NX0 A;  5D7F A;  4WQ2 A;  4CFR A;  2KGB C;  4CFQ A;  2EC6 B;  1PUL A;  1G8I A;  4E68 A;  3TUY B;  1S1E A;  3I5F B;  2LAN A;  1B8C A;  2HPS A;  1IQ3 A;  3I5I B;  5JJG A;  3WHT B;  1S6I A;  2M0R A;  1L2O B;  3OHM B;  3D74 A;  4ZCV A;  2MBX A;  1NP8 A;  3KF9 A;  4P2Y B;  1AHR A;  1TIZ A;  2M29 A;  1WDC B;  3L4L A;  1HT9 A;  2JXC A;  3D10 A;  2JRF A;  1IG5 A;  1CDM A;  1NPQ A;  1YUR A;  3BUM B;  1DF0 A;  3O78 A;  1SBJ A;  4OZD A;  3BYA A;  4OVN F;  5B8I B;  5I8N A;  1IIO A;  1CFF A;  1KSO A;  1MHO A;  2BL0 B;  2GGZ A;  3ICB A;  2SAS A;  3BUW B;  4PAL A;  1EXR A;  2CTN A;  1TNP A;  2FJU B;  1CTR A;  3PN7 C;  2LUC A;  2Y1M A;  3KPX A;  4DS7 A;  3VB1 A;  3V2L A;  3S0F A;  4GPL B;  1F71 A;  3HX4 A;  3RLZ A;  3SG3 A;  1IH0 A;  1QVI Z;  3DVM A;  4JQ0 D;  1OZS A;  1P28 A;  4YGB B;  3JVT B;  1AK8 A;  1Z2C B;  1H4B A;  1EG4 A;  1GGZ A;  1S5G Z;  2H61 A;  1ZAC A;  2H61 C;  1OOH A;  3CZ0 A;  4YGC B;  1U5I A;  3ZNI A;  3L4A A;  3EK7 A;  2JNF A;  3GK1 A;  1EJ3 A;  1V1F A;  3D0Y A;  5HKW A;  3OBV A;  4INX A;  1QTX A;  2JC2 A;  1F54 A;  5JOL A;  5BPJ A;  1NX1 A;  4M2O A;  2KYF A;  4ORC B;  2LCP A;  2KFH A;  3TDU A;  4OKH A;  2P6B B;  3K1E A;  2OS8 B;  2MA2 A;  2HQW A;  4YBH B;  3SIB A;  1SL8 A;  3DY9 A;  3Q8I A;  1K9K A;  3EK4 A;  4GGN A;  2JUL A;  3A8R A;  1XFW O;  2I94 A;  3TS5 B;  1PRW A;  1YX8 A;  2F2P A;  1MUX A;  3UNW A;  3DVJ A;  1SNL A;  2CBL A;  3TDZ A;  1KFU L;  2WCB A;  1Z4H A;  4MVF A;  1ZMZ A;  3D78 A;  2LHL A;  1AUI B;  1UHK A;  1XO5 A;  2COL B;  1TCO B;  2M7L A;  1K9P A;  3PAL A;  1DT7 B;  4L9M A;  1WRL A;  2JQ6 A;  4MEW A;  2QEH A;  2A4J A;  1X02 A;  1LS8 A;  3NSI A;  1MR8 A;  3HCM A;  4HRE E;  3KO0 A;  3BOW A;  2L4I A;  2KSP A;  2PVB A;  3NGV A;  3WXA A;  3O4X A;  1DGU A;  1OW4 A;  2EC6 C;  1TN4 A;  2NCP A;  4ORA B;  2PQL A;  3S0A A;  3IQQ A;  3I5F C;  2F33 A;  3CYZ A;  1J7O A;  2CT9 A;  1E8A A;  3I5I C;  1MXE A;  4HSZ A;  3RM1 A;  3FS7 A;  1F4O A;  1DQE A;  2ZRT A;  5CSN A;  4AOM A;  1L2O C;  3F45 A;  4NDB A;  4QJ4 B;  2LVV A;  1M45 A;  4FTG A;  1BG1 A;  2KBI A;  1G33 A;  3D77 A;  5HLO A;  3AAK A;  3PJI A;  1WDC C;  1K93 D;  1M63 B;  2Y5I A;  3B7A A;  1B7T Y;  2AAO A;  1MXL C;  3BJH A;  4PE7 A;  2Q91 A;  3BUX B;  3D75 A;  5DKQ A;  1WLZ A;  1KK8 B;  4R1E A;  2ZKM X;  1SR6 B;  2WC8 A;  3D73 A;  4ICB A;  1TUZ A;  4CLN A;  5I2Q A;  3CLN A;  2BL0 C;  2M3W A;  3R72 A;  1QX5 B;  2LV7 A;  4MRY A;  3JTD B;  2M8U A;  4OCI A;  5I94 A;  1ORG A;  2FCE A;  1NWD A;  3BFA A;  1LXF C;  1YRU B;  3DXL A;  3CTN A;  1IRJ A;  1C7V A;  4MZJ A;  5KTY A;  3CGA A;  1FI6 A;  1FBV A;  1TWO A;  2BKI B;  2FOT A;  2PYQ A;  1A75 B;  2LNK A;  1QVI Y;  3JVT C;  4NQG A;  3CWG A;  4GNK B;  1UHH A;  1BJF A;  1S5G Y;  1BOC A;  3OB2 B;  1QLS A;  1SW8 A;  2QEV A;  4M2P A;  2WC5 A;  3MSE B;  1RFJ A;  4PCW A;  4NDC A;  3R1P A;  2WND A;  1AVS A;  2KI6 C;  2K0J A;  3H4S E;  1SL7 A;  1Q80 A;  2KAV A;  2LE9 B;  2MHH A;  2P71 A;  2Y4Q A;  1FW4 A;  3CZ2 A;  3N7H A;  2VRG A;  5K89 A;  2AUC A;  2KLE A;  2QDI A;  2EHB A;  3FE9 A;  2FJY A;  1B1G A;  3DVE A;  2K7O A;  2WCF A;  1ODB A;  5DKN A;  2JU0 A;  2JPT A;  3PM8 A;  4GGF C;  4GGF A;  3SG5 A;  3SS5 A;  1NUB A;  2KNE A;  3WHU B;  1DJX A;  3B6X A;  2I7A A;  2WC6 A;  1F55 A;  4MSP A;  3S0G A;  4PHM A;  3B87 A;  2L51 A;  4GFT A;  1CDN A;  1IQ5 A;  1B7T Z;  5CSF A;  5AFP A;  5HLV A;  3SIA A;  1DC1 A;  2OTG C;  2LAP A;  1NCY A;  4I5N B;  1TUJ A;  2NXQ A;  1C3Z A;  1Y1U A;  2L0P A;  1A4P A;  1UUR A;  2KFG A;  3FE6 A;  1SPY A;  3M0W A;  1C3Y A;  1YR5 A;  5FYX A;  1CKK A;  2LVI A;  2O5G A;  4D1E A;  1M39 A;  3CDN A;  1CDL A;  3OB1 B;  4I5K A;  5CSI A;  3CS1 A;  3PM2 A;  1KSM A;  2PSR A;  1XFV O;  2CCM A;  3B86 A;  1CMF A;  2WCJ A;  3FWB A;  2NCO A;  2L4H A;  3PLF B;  2LMV A;  1XFR A;  4FQT A;  5ER5 A;  1ALW A;  3PFV A;  1TNQ A;  2BBM A;  5F6T A;  5FI7 A;  2M1K B;  1WRK A;  2L2C A;  1F4Q A;  1GGW A;  1BU3 A;  4MRX A;  4JWQ A;  2E30 A;  3CR5 X;  1A29 A;  3NSO A;  1OZO A;  1KK8 C;  3EVR A;  2I2R E;  4BY4 A;  1SR6 C;  1KWO C;  4C0J A;  1LKJ A;  5J3X A;  1K2H A;  2Q4U A;  2KDH A;  3SS3 A;  4TNC A;  4PDZ A;  2HF5 A;  1EH2 A;  4C0K A;  3IQO A;  2LLT A;  4OR9 B;  3OX6 A;  1YRT B;  4ZCU A;  1G4Y R;  1NX2 A;  1W7I B;  3CZ1 A;  1CDP A;  1C07 A;  2JTZ A;  1JC2 A;  1B4C A;  2LC5 A;  3DVK A;  1A75 A;  2WCH A;  2K7D A;  5AER A;  4WQ3 A;  2LVK A;  2P70 A;  3OP0 A;  1B47 A;  1EG3 A;  2QEO A;  2L2E A;  4I5L B;  1ZUZ A;  1OMV A;  1SMG A;  2JXL A;  2R2I A;  3K21 A;  4MN0 A;  1BR1 B;  3R1V A;  4N5X A;  4NDD A;  2KI4 B;  2KI6 D;  2QPT A;  4QJ5 B;  2BCB A;  2KQY A;  4XJK A;  3O4Y A;  2H8V A;  2K61 A;  4JD9 A;  2L5Y A;  3AAJ A;  4DUQ A;  1DTL A;  1EL4 A;  4I5J A;  1REC A;  4PHK A;  4KYN A;  3TUY C;  1CLL A;  1Y1X A;  1JUO A;  1DJG A;  2ZNE A;  5D3O A;  1QJT A;  1OOG A;  3LCP C;  1XVJ A;  1TNW A;  4CPV A;  1PK0 D;  2WOS A;  1PSB A;  1GM0 A;  2JT8 A;  4YRU A;  1B8L A;  4A4B A;  3RZS A;  1J7R A;  3VRO A;  3AKA A;  1B9A A;  1IJ6 A;  3BFH A;  1CLB A;  4YGA A;  1SY9 A;  3DZT A;  1CLM A;  1PAL A;  2HET A;  4PHJ A;  2GGM A;  3VRR A;  2D8N A;  1SCM B;  2YGU A;  1QXP A;  2MRD A;  3BXK A;  1CFD A;  2CXJ A;  5I2L A;  1MF8 B;  2BE6 A;  2MAZ A;  3VRN A;  1QS7 A;  2L50 A;  3OGN A;  4PE1 A;  4YI9 A;  2O60 A;  3B88 A;  4AQI A;  1BR4 B;  4U8D A;  1NIW A;  1JWD A;  2F3Y A;  1DJI A;  1KK7 Y;  4WRI A;  1FPW A;  2AMI A;  1MWN A;  2K2A A;  1J1E A;  2JOJ A;  1J7P A;  1LVC D;  1TTX A;  2BEC A;  2NZ0 A;  2DOQ A;  1SKT A;  1QAS A;  1QV0 A;  1JFK A;  2BAP A;  1K94 A;  1OOI X;  3KHE A;  2LLU A;  1KCY A;  1SRA A;  2BCX A;  3CAB A;  4PT1 A;  3CR4 X;  1XK4 A;  1W9Z A;  2OS8 C;  2JT3 A;  2E6W A;  1OOJ A;  1Y0V H;  1KFX L;  2KBM A;  5HYD A;  1S36 A;  3TS5 C;  4PHN A;  4MZK A;  4C0L A;  1N65 A;  4YGE B;  1BLQ A;  2G2B A;  2K60 A;  1A03 A;  2PAL A;  1K9U A;  2F2O A;  2LUX A;  3BUO B;  1LA0 A;  3S0B A;  2LM5 A;  3I5H B;  1RWY A;  1J7Q A;  2K2F A;  1UHN A;  1W7J B;  1YUU A;  5G08 A;  1BOD A;  2Y1N A;  4ETO A;  3GK2 A;  2K8M B;  1SL9 A;  1OMD A;  2PRU A;  1JFJ A;  4QJ3 B;  1JF0 A;  3NSK A;  1N2D A;  3EK8 A;  2QEB A;  1GQM A;  2B1U A;  4F0Z B;  1CM4 A;  2PAS A;  2IS9 A;  3BOW B;  3C1V A;  5DKR A;  4CID A;  2LVJ A;  1OOF A;  5AXI A;  2L98 A;  2MLE C;  1IGV A;  2V53 A;  3EG5 B;  3I5G B;  3NHI A;  2KQ6 A;  3DF0 B;  2RGI A;  1AJ4 A;  2BE4 A;  3BUN B;  5AEQ A;  1ALV A;  1YX7 A;  1WRZ A;  4MZL A;  4INW A;  2MLF C;  2KAY A;  4HRH A;  1NCX A;  3PAT A;  1ZFS A;  4N1F A;  1DMO A;  2KAX A;  2KYC A;  4FQO A;  5EL2 A;  1KK7 Z;  4Q04 A;  3VGO A;  3FE8 A;  4YI8 A;  1YUT A;  3AKB A;  1IWQ A;  1PVB A;  3TDI A;  1GJY A;  1DGV A;  1ZOT B;  1XFX O;  1QAT A;  1K90 D;  1RTP 1;  1R2U A;  3UO9 A;  1SK6 D;  1SCM C;  5D69 A;  1V1G A;  2HQ8 A;  1BT6 A;  2M97 A;  1NSH A;  3JTD C;  3NSL A;  1DEL A;  1KQM B;  3BFB A;  2KLD A;  1DJW A;  3NHT A;  2LLS A;  2NLN A;  4MLW A;  1PSR A;  1WY9 A;  1J55 A;  1C7W A;  2EGD A;  1SYM A;  1FI5 A;  1QX2 A;  1CMG A;  1L7Z A;  2BKH B;  1A2X A;  3A4U B;  1QLK A;  4GAO A;  1KFX S;  3LK1 A;  2QAC A;  4USL A;  4YGD B;  5AAN A;  3EVU A;  5IBW A;  4DIR A;  2LMT A;  1UUS A;  2LHI A;  1M46 A;  2WCK A;  5ER4 X;  2M1U A;  4A4C A;  1YUS A;  2KOT A;  5HL1 A;  1CNP A;  1HQV A;  1JBA A;  3QRX A;  1K8U A;  2BNX A;  1OMR A;  4AQJ A;  3SG4 A;  2JTT A;  3SJS A;  1H8B A;  1MQ1 A;  1S26 D;  1UHJ A;  2F3Z A;  3L47 A;  3O2P A;  1CM1 A;  1UP5 A;  1VRK A;  5TNC A;  2KGR A;  1JF2 A;  4GUK A;  1Y6W A;  2JPO A;  3CR2 A;  3GK4 X;  1LA3 A;  3SS4 A;  1XFU O;  3ZWH A;  2ZN9 A;  2M7N A;  1YTZ C;  4OV2 A;  4F7F A;  3SG2 A;  3S0D A;  5HKY A;  4N1G A;  2ZND A;  3I5H C;  2SCP A;  1N0Y A;  1DJH A;  1RJV A;  1S6C A;  3LL8 B;  1OQP A;  2JT0 A;  1WLM A;  4P5O E;  1CB1 A;  2H2K A;  2OPO A;  1FF1 A;  1SCV A;  2PMY A;  1BMO A;  1TNX A;  2GTE A;  2WCE A;  2JNX A;  1QIV A;  3CZT X;  4PE0 A;  3R1O A;  1DEK A;  3PSR A;  1K96 A;  2F8P A;  3QME A;  3GOF A;  2G9B A;  4IJ7 A;  5GQQ C;  1DJY A;  2OTG B;  3I5G C;  2KHN A;  5HKZ A;  1DF0 B;  1S6J A;  3D76 A;  1XA5 A;  3DF0 A;  3FIA A;  3E3R A;  3EKH A;  3FWC A;  1TOP A;  2ZRS A;  4HRG A;  3KEV A;  5CSJ A;  1F8H A;  2FCD A;  3OX5 A;  3PN7 B;  4BY5 A;  1TCF A;  2K7B A; 
#chains in the Genus database with same CATH homology
 1F70 A;  1QV1 A;  2BBN A;  3NXA A;  1YVH A;  1NYA A;  2MJW B;  5KU1 A;  2JZI A;  3LLE A;  1XYD A;  3WNX B;  1AP4 A;  1JSA A;  2K7C A;  3SG7 A;  5KSZ A;  2LMU A;  1D1O A;  1IKU A;  3SG6 A;  1OE9 B;  1K95 A;  2BCA A;  2I18 A;  1U5I B;  2KFF A;  4ORB B;  2LP3 A;  4UPG A;  1OSA A;  1QX7 A;  3VRP A;  1B8R A;  1KWO B;  1CFP A;  1KQM C;  3D0Y B;  1LIN A;  1AJ5 A;  3O6B A;  2M9G A;  3EKJ A;  3EVV A;  1IJ5 A;  1XFY O;  1XK4 C;  2M49 B;  1UHI A;  1PVA A;  4M2Q A;  1NX3 A;  1BF5 A;  1M31 A;  5PAL A;  2L5X B;  1CFC A;  2GV5 A;  4PE4 A;  2LP2 A;  1RRO A;  2ZN8 A;  3BQ3 A;  1XFZ O;  3DD4 A;  5CPV A;  4DRW A;  1NCZ A;  3VRQ A;  1Y1A A;  1J1D A;  1DJZ A;  3TZ1 A;  1S3P A;  1UWO A;  4IL1 A;  2ZFD A;  2CNP A;  1RK9 A;  5I2O A;  4GBA A;  2TN4 A;  4MBE A;  1KFU S;  1QIW A;  1R6P A;  3LK0 A;  2ISD A;  2WOR A;  4XYN A;  1KQV A;  2KI4 C;  1DVI A;  2JWW A;  1TRF A;  1YVL A;  3IF7 A;  4XJK B;  4DCK A;  4JPZ B;  1NX0 A;  5D7F A;  4WQ2 A;  4CFR A;  2KGB C;  4CFQ A;  2EC6 B;  1PUL A;  1G8I A;  4E68 A;  3TUY B;  1S1E A;  3I5F B;  2LAN A;  1B8C A;  2HPS A;  1IQ3 A;  3I5I B;  5JJG A;  3WHT B;  1S6I A;  2M0R A;  1L2O B;  3OHM B;  4ZCV A;  2MBX A;  1NP8 A;  3KF9 A;  4P2Y B;  1AHR A;  1TIZ A;  2M29 A;  1WDC B;  1HT9 A;  2JXC A;  3D10 A;  2JRF A;  1IG5 A;  1CDM A;  1NPQ A;  1YUR A;  3BUM B;  1DF0 A;  3O78 A;  1SBJ A;  3BYA A;  4OVN F;  5B8I B;  5I8N A;  1CFF A;  1KSO A;  1MHO A;  2BL0 B;  2GGZ A;  3ICB A;  2SAS A;  3BUW B;  4PAL A;  1EXR A;  2CTN A;  1TNP A;  2FJU B;  1CTR A;  3PN7 C;  2LUC A;  2Y1M A;  3KPX A;  4DS7 A;  4GPL B;  1F71 A;  3HX4 A;  3RLZ A;  3SG3 A;  1IH0 A;  1QVI Z;  3DVM A;  4JQ0 D;  1OZS A;  4YGB B;  1AK8 A;  3JVT B;  1H4B A;  1EG4 A;  1GGZ A;  1S5G Z;  2H61 A;  1ZAC A;  2H61 C;  4YGC B;  1U5I A;  3ZNI A;  3EK7 A;  2JNF A;  3GK1 A;  1EJ3 A;  1V1F A;  3D0Y A;  5HKW A;  1QTX A;  2JC2 A;  1F54 A;  5JOL A;  5BPJ A;  1NX1 A;  4M2O A;  2KYF A;  4ORC B;  2LCP A;  2KFH A;  3TDU A;  4OKH A;  2P6B B;  2OS8 B;  2MA2 A;  2HQW A;  4YBH B;  3SIB A;  1SL8 A;  1K9K A;  3EK4 A;  4GGN A;  2JUL A;  3A8R A;  1XFW O;  2I94 A;  3TS5 B;  1PRW A;  1YX8 A;  2F2P A;  1MUX A;  3DVJ A;  1SNL A;  2CBL A;  3TDZ A;  1KFU L;  2WCB A;  4MVF A;  1ZMZ A;  2LHL A;  1AUI B;  1UHK A;  1XO5 A;  2COL B;  1TCO B;  2M7L A;  1K9P A;  3PAL A;  1DT7 B;  4L9M A;  1WRL A;  2JQ6 A;  4MEW A;  2A4J A;  1X02 A;  3NSI A;  1MR8 A;  3HCM A;  4HRE E;  3KO0 A;  3BOW A;  2L4I A;  2KSP A;  2PVB A;  3WXA A;  1DGU A;  2EC6 C;  1TN4 A;  2NCP A;  4ORA B;  3IQQ A;  3I5F C;  2F33 A;  1J7O A;  2CT9 A;  1E8A A;  3I5I C;  1MXE A;  4HSZ A;  3RM1 A;  3FS7 A;  1F4O A;  2ZRT A;  5CSN A;  4AOM A;  1L2O C;  3F45 A;  4NDB A;  4QJ4 B;  2LVV A;  1M45 A;  4FTG A;  1BG1 A;  2KBI A;  1G33 A;  5HLO A;  3AAK A;  1WDC C;  1K93 D;  1M63 B;  2Y5I A;  4PE7 A;  1B7T Y;  2AAO A;  1MXL C;  2Q91 A;  3BUX B;  5DKQ A;  1WLZ A;  1KK8 B;  4R1E A;  2ZKM X;  1SR6 B;  2WC8 A;  4CLN A;  4ICB A;  5I2Q A;  3CLN A;  2BL0 C;  2M3W A;  1QX5 B;  2LV7 A;  4MRY A;  3JTD B;  2M8U A;  2FCE A;  1NWD A;  1LXF C;  1YRU B;  3CTN A;  1IRJ A;  1C7V A;  4MZJ A;  5KTY A;  3CGA A;  1FI6 A;  1FBV A;  2BKI B;  2FOT A;  1A75 B;  2LNK A;  1QVI Y;  3JVT C;  4NQG A;  3CWG A;  4GNK B;  1UHH A;  1BJF A;  1S5G Y;  1BOC A;  3OB2 B;  1QLS A;  1SW8 A;  4M2P A;  3MSE B;  1RFJ A;  4PCW A;  4NDC A;  2WND A;  1AVS A;  2KI6 C;  2K0J A;  3H4S E;  1SL7 A;  1Q80 A;  2KAV A;  2LE9 B;  2MHH A;  2Y4Q A;  1FW4 A;  2VRG A;  5K89 A;  2AUC A;  2EHB A;  1B1G A;  3DVE A;  2K7O A;  2WCF A;  1ODB A;  5DKN A;  2JU0 A;  2JPT A;  3PM8 A;  4GGF C;  4GGF A;  3SG5 A;  1NUB A;  2KNE A;  3WHU B;  1DJX A;  1F55 A;  2I7A A;  4MSP A;  4PHM A;  2L51 A;  4GFT A;  1CDN A;  1IQ5 A;  1B7T Z;  5CSF A;  5AFP A;  5HLV A;  3SIA A;  2OTG C;  2LAP A;  1NCY A;  4I5N B;  1H8B A;  2NXQ A;  4OCI A;  1Y1U A;  2L0P A;  1A4P A;  1UUR A;  2KFG A;  1SPY A;  3M0W A;  1YR5 A;  5FYX A;  1CKK A;  2LVI A;  2O5G A;  4D1E A;  1M39 A;  1CDL A;  3OB1 B;  4I5K A;  5CSI A;  3CS1 A;  1KSM A;  2PSR A;  2CCM A;  1XFV O;  1CMF A;  3FWB A;  2NCO A;  2L4H A;  3PLF B;  2LMV A;  5ER5 A;  1ALW A;  3PFV A;  1TNQ A;  2BBM A;  5F6T A;  2M1K B;  1WRK A;  1GGW A;  1F4Q A;  1BU3 A;  4MRX A;  4JWQ A;  2E30 A;  3CR5 X;  1A29 A;  3NSO A;  1OZO A;  1KK8 C;  3EVR A;  2I2R E;  4BY4 A;  1SR6 C;  1KWO C;  4C0J A;  1LKJ A;  5J3X A;  1K2H A;  2Q4U A;  2KDH A;  4TNC A;  4PDZ A;  2HF5 A;  1EH2 A;  4C0K A;  3IQO A;  2LLT A;  4OR9 B;  3OX6 A;  1YRT B;  4ZCU A;  1G4Y R;  1NX2 A;  1W7I B;  1CDP A;  1C07 A;  2JTZ A;  1JC2 A;  1B4C A;  2LC5 A;  3DVK A;  1A75 A;  2K7D A;  5AER A;  4WQ3 A;  2LVK A;  3OP0 A;  1B47 A;  1EG3 A;  2L2E A;  4I5L B;  1ZUZ A;  1OMV A;  1SMG A;  2JXL A;  2R2I A;  3K21 A;  4MN0 A;  1BR1 B;  4N5X A;  4NDD A;  2KI4 B;  2KI6 D;  2QPT A;  4QJ5 B;  2BCB A;  2KQY A;  4XJK A;  3O4Y A;  2K61 A;  3AAJ A;  4DUQ A;  1DTL A;  1EL4 A;  4I5J A;  1REC A;  4PHK A;  3TUY C;  1CLL A;  1Y1X A;  1JUO A;  1DJG A;  2ZNE A;  1QJT A;  3LCP C;  1XVJ A;  1TNW A;  4CPV A;  1PK0 D;  2WOS A;  1PSB A;  2JT8 A;  4YRU A;  1B8L A;  4A4B A;  1J7R A;  3VRO A;  3AKA A;  1B9A A;  1IJ6 A;  1CLB A;  4YGA A;  1SY9 A;  4PHJ A;  1CLM A;  1PAL A;  2HET A;  2GGM A;  3VRR A;  2D8N A;  1SCM B;  1QXP A;  2MRD A;  3BXK A;  1CFD A;  2CXJ A;  5I2L A;  1MF8 B;  2BE6 A;  2MAZ A;  3VRN A;  1QS7 A;  2L50 A;  4YI9 A;  4PE1 A;  2O60 A;  4AQI A;  1BR4 B;  4U8D A;  1NIW A;  1JWD A;  2F3Y A;  1DJI A;  1KK7 Y;  4WRI A;  1FPW A;  2AMI A;  1MWN A;  2K2A A;  1J1E A;  2JOJ A;  1J7P A;  1LVC D;  1TTX A;  2BEC A;  2NZ0 A;  2DOQ A;  1SKT A;  1QAS A;  1QV0 A;  1JFK A;  1K94 A;  3KHE A;  2LLU A;  1KCY A;  1SRA A;  2BCX A;  3CR4 X;  1XK4 A;  2OS8 C;  2JT3 A;  2E6W A;  1OOJ A;  1Y0V H;  1KFX L;  2KBM A;  5HYD A;  1S36 A;  3TS5 C;  4PHN A;  4MZK A;  4C0L A;  1N65 A;  4YGE B;  1BLQ A;  2G2B A;  1A03 A;  2PAL A;  1K9U A;  2F2O A;  2LUX A;  3BUO B;  1LA0 A;  2LM5 A;  3I5H B;  1RWY A;  1J7Q A;  2K2F A;  1UHN A;  1W7J B;  1YUU A;  5G08 A;  1BOD A;  2Y1N A;  4ETO A;  3GK2 A;  2K8M B;  1SL9 A;  1OMD A;  2PRU A;  1JFJ A;  4QJ3 B;  1JF0 A;  3NSK A;  1N2D A;  3EK8 A;  1GQM A;  2B1U A;  4F0Z B;  1CM4 A;  2PAS A;  2IS9 A;  3BOW B;  3C1V A;  5DKR A;  4CID A;  2LVJ A;  5AXI A;  2L98 A;  2MLE C;  1IGV A;  2V53 A;  3I5G B;  2KQ6 A;  3DF0 B;  2RGI A;  1AJ4 A;  2BE4 A;  3BUN B;  5AEQ A;  1ALV A;  1YX7 A;  1WRZ A;  4MZL A;  2MLF C;  2KAY A;  4HRH A;  1NCX A;  3PAT A;  1ZFS A;  4N1F A;  1DMO A;  2KAX A;  2KYC A;  4FQO A;  1KK7 Z;  4Q04 A;  3VGO A;  4YI8 A;  1YUT A;  3AKB A;  1IWQ A;  1PVB A;  3TDI A;  1GJY A;  1DGV A;  1ZOT B;  1XFX O;  1QAT A;  1K90 D;  1RTP 1;  1R2U A;  1SK6 D;  1SCM C;  5D69 A;  1V1G A;  2HQ8 A;  1BT6 A;  2M97 A;  1NSH A;  3JTD C;  3NSL A;  1KQM B;  1DJW A;  2LLS A;  2NLN A;  4MLW A;  1PSR A;  1WY9 A;  1J55 A;  1C7W A;  2EGD A;  1SYM A;  1FI5 A;  1QX2 A;  1CMG A;  1L7Z A;  2BKH B;  1A2X A;  3A4U B;  1QLK A;  4GAO A;  1KFX S;  3LK1 A;  2QAC A;  4USL A;  4YGD B;  5AAN A;  3EVU A;  5IBW A;  4DIR A;  2LMT A;  1UUS A;  2LHI A;  1M46 A;  5ER4 X;  4A4C A;  2M1U A;  1YUS A;  2KOT A;  1CNP A;  1HQV A;  1JBA A;  3QRX A;  1K8U A;  1OMR A;  4AQJ A;  3SG4 A;  2JTT A;  3SJS A;  1MQ1 A;  1S26 D;  1UHJ A;  2F3Z A;  3O2P A;  1CM1 A;  1UP5 A;  1VRK A;  5TNC A;  2KGR A;  1JF2 A;  4GUK A;  1Y6W A;  3CR2 A;  3GK4 X;  1LA3 A;  1XFU O;  3ZWH A;  2ZN9 A;  2M7N A;  1YTZ C;  4OV2 A;  3SG2 A;  5HKY A;  4N1G A;  2ZND A;  3I5H C;  2SCP A;  1N0Y A;  1DJH A;  1RJV A;  1S6C A;  3LL8 B;  1OQP A;  2JT0 A;  1WLM A;  4P5O E;  1CB1 A;  2H2K A;  2OPO A;  1FF1 A;  1SCV A;  2PMY A;  1BMO A;  1TNX A;  2WCE A;  2JNX A;  1QIV A;  3CZT X;  4PE0 A;  3PSR A;  1K96 A;  2F8P A;  5GQQ C;  3GOF A;  2G9B A;  1DJY A;  2OTG B;  3I5G C;  2KHN A;  5HKZ A;  1DF0 B;  1S6J A;  1XA5 A;  3DF0 A;  3FIA A;  3E3R A;  3EKH A;  3FWC A;  1TOP A;  2ZRS A;  4HRG A;  3KEV A;  5CSJ A;  1F8H A;  2FCD A;  3OX5 A;  3PN7 B;  4BY5 A;  1TCF A;  2K7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...