4AQJA

Structure of human s100a7 d24g bound to zinc and calcium
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDGKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A7
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqjA00
1ALWA 3PLFB 4GBAA 1SCMB 2OS8B 1KWOC 1PSRA 4L9MA 1CLBA 4PHMA 2K61A 2MHHA 4GUKA 2KFHA 1KFUL 3BUMB 5CPVA 1KSMA 5CSJA 2HF5A 1MXEA 2BL0C 2JT0A 2M7LA 4OR9B 3DF0B 4OKHA 1B47A 2JTZA 1CNPA 1TOPA 2I2RE 1FI5A 1UHNA 2KOTA 4MVFA 2P6BB 1CFCA 2L98A 3A8RA 1NWDA 2QPTA 3VRQA 1OZSA 3BUXB 1JFKA 3PFVA 3FS7A 1KQVA 1CFPA 2KI6C 1JC2A 2ZN8A 5DKRA 5KU1A 3TDZA 1JWDA 1A75B 5DKQA 1QLKA 4MN0A 1QX5B 1J55A 1KK8B 3CLNA 1JUOA 1A03A 4CPVA 3O6BA 2HETA 1V1GA 3TDIA 1F54A 3CTNA 3HCMA 4NQGA 2SASA 1NSHA 1KFXL 2Q4UA 3SG6A 4YGDB 3ZNIA 2V53A 3KO0A 1OMVA 1YX7A 1G8IA 1MF8B 2HQWA 2LUCA 2LP2A 1NP8A 1NX0A 2CNPA 2KBMA 3PN7B 1M39A 3I5IC 1N2DA 4BY4A 4XJKA 1SR6B 4PE1A 1IQ3A 2M9GA 2SCPA 2WCEA 4YI9A 3LL8B 2OTGB 1GGZA 2M7NA 4MEWA 1MR8A 3RLZA 3BUOB 1RK9A 3OHMB 2KI4B 3JTDC 4D1EA 1F70A 3EK7A 3PSRA 1TN4A 2LLUA 3TUYB 3WHUB 2LLSA 4CFQA 1YX8A 2NLNA 1WDCC 1IJ5A 1ZFSA 2I94A 2LMUA 1JSAA 2M1UA 2FCEA 3SG5A 3PATA 1BT6A 1SL9A 1N65A 1YUSA 3SJSA 3OX6A 3CR4X 1AUIB 1YR5A 2KYFA 3D0YA 2JPTA 1QS7A 3I5FC 2AMIA 4TNCA 1UP5A 4DIRA 1J1EA 1J7QA 4I5JA 1DF0B 2K2AA 1D1OA 1ALVA 2LMTA 5ER5A 5G08A 4CLNA 2KGRA 3NSKA 4YBHB 1RECA 3DD4A 1UHHA 2BBMA 1XFYO 3DVJA 1BG1A 3SG3A 2L51A 1CLLA 2KI6D 2BBNA 1SPYA 1IRJA 2COLB 3BYAA 1CDNA 2PSRA 1IQ5A 1OMRA 2LM5A 1U5IB 5CSIA 1XFXO 3I5HC 2M97A 1RWYA 3SG2A 1FBVA 2D8NA 5AXIA 2M8UA 5AFPA 1J7PA 2L4HA 3LCPC 2I7AA 1L2OB 2CBLA 1GQMA 2JNFA 2CCMA 3JVTB 4N1FA 3TDUA 4AQIA 2ZKMX 1F4QA 1DGUA 4PHJA 2M1KB 1IWQA 3C1VA 3NSLA 1TIZA 1MWNA 1LKJA 2TN4A 1OMDA 1QIWA 3EK8A 1DMOA 1MHOA 1QV1A 2HPSA 4YI8A 1SK6D 1Y0VH 1S3PA 2ZNEA 4DCKA 5I8NA 1KWOB 2BCBA 3WXAA 2K0JA 2LAPA 1CM1A 3A4UB 2K8MB 3VGOA 3ZWHA 3WHTB 2GGMA 2BECA 5IBWA 4N5XA 2LNKA 2LVJA 2MLEC 2BL0B 1NPQA 1QXPA 3CR2A 4PHNA 1TTXA 2ZN9A 3AKBA 4QJ5B 2F8PA 1NX1A 4N1GA 1R6PA 1V1FA 3H4SE 4NDDA 5BPJA 1F71A 2WNDA 1JF0A 1PK0D 1WRKA 1NX3A 3NSIA 1EXRA 4ORCB 1BODA 1JF2A 1S6JA 1C07A 2F33A 1HQVA 4JPZB 2KFFA 4MRXA 1W7JB 2PASA 1CFFA 2BE6A 2ZFDA 1M31A 2ZRTA 2E30A 1K94A 1YVLA 2NCOA 2VRGA 3NXAA 1OOJA 4OVNF 5AANA 1PVBA 5J3XA 3ICBA 4JWQA 1OE9B 2JRFA 4PE7A 1S1EA 4CFRA 2JULA 3CGAA 1CTRA 2JTTA 1XFVO 1JFJA 2OS8C 4GGNA 1K9UA 4WQ2A 4P5OE 1CMGA 2LHLA 2MRDA 3SIBA 2GGZA 3O2PA 1IJ6A 2JWWA 1OZOA 3KPXA 2R2IA 1B7TZ 2JOJA 1ZMZA 4WQ3A 3TS5C 1AP4A 3EVVA 4U8DA 2MAZA 3RM1A 1UURA 1S26D 1XFWO 4USLA 1B7TY 2Y4QA 3DVMA 3AKAA 4I5LB 1ZOTB 4NDBA 1NX2A 1OQPA 4MRYA 3JTDB 3I5GC 2ZRSA 1WLZA 2FCDA 1CDMA 1DTLA 1GJYA 4MBEA 1CLMA 1WDCB 2MLFC 1YRTB 3EKHA 1K9KA 3E3RA 3GK1A 1A29A 1BR1B 1KQMC 2K7DA 2O60A 3EVUA 4OCIA 1U5IA 3AAJA 2Y1MA 1C7VA 2K2FA 1KFUS 1AHRA 1LA0A 2KAXA 2FJUB 5DKNA 2Q91A 1DJXA 3DVEA 1EG3A 4Q04A 2WC8A 4PHKA 3I5FB 1DJIA 2KSPA 1CFDA 1YRUB 5HKYA 2HQ8A 3OB1B 1PVAA 2KQ6A 1TNPA 3PN7C 3WNXB 2B1UA 3VRRA 1YUUA 2LANA 4I5NB 2WOSA 1DJYA 1GGWA 1XK4A 4C0LA 5B8IB 5CSFA 1AK8A 1MUXA 1M63B 1SMGA 2PMYA 2Y1NA 4MLWA 1QIVA 2KBIA 1XVJA 1Y6WA 3I5HB 1LVCD 1RFJA 2JU0A 2M49B 2LVIA 1NCYA 1C7WA 3SIAA 1S36A 1CKKA 3K21A 2JT3A 1K8UA 3FIAA 4GNKB 1TCOB 1QVIZ 1BF5A 1UHJA 2LV7A 1BOCA 2BKHB 4PE4A 1QVIY 3CWGA 3FWCA 4HSZA 1M45A 1K2HA 2KQYA 1WLMA 3HX4A 5I2QA 5FYXA 4XJKB 2FOTA 2JNXA 3DF0A 1RJVA 1J7OA 1DT7B 2Y5IA 4C0KA 3VROA 3LLEA 1R2UA 2JXCA 2JQ6A 3VRNA 4C0JA 2H61A 5HYDA 1SL8A 4HREE 1HT9A 1SKTA 1Y1UA 1BU3A 1EJ3A 4YRUA 1NCZA 2OPOA 1B9AA 1NUBA 2EHBA 2LLTA 1S6CA 3GK4X 3M0WA 2MBXA 3EKJA 1A75A 1B8LA 1N0YA 4MZLA 2DOQA 5CSNA 1DJHA 1K9PA 1QASA 1AVSA 1F8HA 1CDLA 2KDHA 2M0RA 2WCFA 1AJ4A 3IF7A 1Y1XA 1CM4A 4YGBB 2EC6C 3EK4A 3TZ1A 3D0YB 1E8AA 4ZCVA 2JC2A 3BOWB 3CZTX 2KNEA 2GV5A 1NIWA 1WRZA 2LVVA 2PVBA 1IG5A 3GK2A 2F2OA 3DVKA 3CS1A 3LK1A 4ETOA 4PE0A 2CTNA 1H4BA 1K96A 1WY9A 1MXLC 1XK4C 2CT9A 3D10A 3FWBA 2QACA 4MSPA 1DJGA 3PM8A 4PCWA 1XFZO 1QV0A 4A4BA 4FQOA 4GGFA 3CR5X 2G9BA 1PALA 1WRLA 3TS5B 1SY9A 2NZ0A 1QX2A 1YURA 1SCMC 1UWOA 4PALA 4DUQA 1MQ1A 1QX7A 3BUWB 3SG7A 1IKUA 4M2OA 3BUNB 2AAOA 3I5IB 1OSAA 3I5GB 3IQOA 4ORAB 5HKWA 4MZJA 2BE4A 1VRKA 4AOMA 2NXQA 1FW4A 4M2QA 1IH0A 1A2XA 1SRAA 4NDCA 1KQMB 1KK7Z 1PULA 2KHNA 3O78A 4PDZA 1FF1A 1DF0A 2LVKA 1BLQA 2KFGA 1CDPA 2ZNDA 4AQJA 2L50A 1KK7Y 1Q80A 4QJ4B 4ICBA 5PALA 4MZKA 1J1DA 2H61C 1XYDA 1K90D 3BQ3A 5JJGA 1DGVA 3OP0A 1TNXA 2F2PA 1CB1A 2G2BA 1SBJA 3MSEB 2F3YA 1LA3A 1LINA 1QLSA 1S6IA 1RTP1 3OX5A 1KK8C 4HRGA 4BY5A 2L4IA 1EG4A 5HKZA 3EVRA 2LE9B 1LXFC 1M46A 2EGDA 1BR4B 4XYNA 2KAYA 1K93D 2E6WA 2K7CA 1G33A 4HRHA 3AAKA 3NSOA 3KEVA 1KSOA 2WORA 2PALA 2MA2A 3QRXA 4CIDA 3PALA 5D69A 1UUSA 4JQ0D 2RGIA 3SG4A 1QJTA 4GFTA 3IQQA 1AJ5A 5HLOA 1XO5A 1SR6C 2BCXA 3BXKA 1EH2A 1UHIA 1X02A 2OTGC 5F6TA 2PRUA 4GPLB 3VRPA 2WCBA 1BJFA 1TRFA 1KCYA 1YTZC 5GQQC 1TNQA 5K89A 1TCFA 2JXLA 2KI4C 5KTYA 2JT8A 1FPWA 1KFXS 1ODBA 2I18A 4FTGA 4GGFC 5I2LA 4DS7A 4ORBB 3TUYC 2A4JA 4P2YB 4M2PA 1J7RA 1PRWA 1IGVA 1L7ZA 4DRWA 1B8RA 2F3ZA 1SYMA 3BOWA 1QTXA 3GOFA 2AUCA 5JOLA 2KAVA 1H8BA 1TNWA 1YVHA 2LP3A 4OV2A 2KGBC 4E68A 2NCPA 2H2KA 4ZCUA 1B8CA 1DJZA 5I2OA 5AERA 4R1EA 2LUXA 1SL7A 2ISDA 5ER4X 2O5GA 1ZACA 4QJ3B 4YGCB 1A4PA 1NCXA 2MJWB 4I5KA 1NYAA 3O4YA 2L5XB 2LCPA 2L2EA 2EC6B 4GAOA 4IL1A 1ZUZA 1K95A 1SW8A 2CXJA 4F0ZB 1Y1AA 4WRIA 5TNCA 2M29A 1B1GA 2KYCA 3F45A 1QATA 1F55A 1DVIA 2LMVA 2M3WA 1UHKA 2BCAA 1XFUO 3KF9A 2K7BA 1YUTA 2LC5A 1BMOA 1B4CA 1L2OC 1EL4A 1SNLA 3LK0A 5D7FA 2IS9A 3JVTC 5HLVA 2BKIB 2L0PA 2LHIA 1JBAA 1FI6A 1S5GZ 1PSBA 1W7IB 3KHEA 3OB2B 2JZIA 1CMFA 1SCVA 5KSZA 4YGAA 1F4OA 5AEQA 2K7OA 1S5GY 4UPGA 4YGEB 1RROA 1G4YR 1DJWA 4A4CA 1XA5A
chains in the Genus database with same CATH superfamily
1ALWA 3PLFB 4GBAA 1SCMB 2OS8B 3O4XA 1KWOC 1PSRA 2PQLA 4L9MA 1CLBA 3RZSA 4PHMA 2K61A 2MHHA 4GUKA 2KFHA 1KFUL 3BUMB 5CPVA 1KSMA 5CSJA 2HF5A 1MXEA 2BL0C 2JT0A 2M7LA 3UO9A 3BFBA 4OR9B 1SSEB 3DF0B 5FI2A 3D78A 4OKHA 1B47A 2JTZA 3B87A 3FE8A 1CNPA 5EL2A 4IJ7A 1TOPA 2I2RE 1FI5A 1UHNA 2KOTA 4MVFA 2P6BB 3SS5A 1CFCA 2L98A 2QEHA 3A8RA 1NWDA 2QPTA 3VRQA 1OZSA 3BUXB 1JFKA 3PFVA 3FS7A 2ERBA 1CFPA 2KI6C 1KQVA 1JC2A 2ZN8A 5DKRA 5KU1A 1OW4A 3S0FA 3TDZA 1JWDA 1A75B 5DKQA 1QLKA 4MN0A 1QX5B 1J55A 1KK8B 3CLNA 1JUOA 1A03A 4CPVA 3O6BA 2HETA 1V1GA 3TDIA 1F54A 3CTNA 3HCMA 4NQGA 2SASA 3CZ2A 3R1PA 1NSHA 1KFXL 2Q4UA 3SG6A 4YGDB 3ZNIA 2V53A 3KO0A 1OMVA 1YX7A 1TUZA 1G8IA 1MF8B 2HQWA 2LUCA 2LP2A 1NP8A 1NX0A 2CNPA 2KBMA 3PN7B 1M39A 3IVTA 3I5IC 1N2DA 4BY4A 4XJKA 1SR6B 4PE1A 1IQ3A 2M9GA 2SCPA 2WCEA 4YI9A 2GTEA 4INXA 3LL8B 2OTGB 1GGZA 2M7NA 3D73A 4MEWA 1MR8A 3RLZA 3BUOB 1RK9A 3OHMB 2KI4B 3JTDC 3QMEA 4D1EA 1F70A 2KPHA 3EK7A 3PSRA 1TWOA 1TN4A 2LLUA 3TUYB 3WHUB 2LLSA 4CFQA 1YX8A 2NLNA 2QDIA 1WDCC 1IJ5A 1ZFSA 2I94A 2LMUA 1JSAA 2M1UA 2FCEA 3SG5A 3PATA 1BT6A 1SL9A 1N65A 1T14A 1YUSA 3SJSA 3Q8IA 3OX6A 3CR4X 1AUIB 1YR5A 2KYFA 3D0YA 3OGNA 2JPTA 1QS7A 2WCMA 2AMIA 3I5FC 1UP5A 4TNCA 1J1EA 4DIRA 1J7QA 4I5JA 1DF0B 2K2AA 1D1OA 1ALVA 2LMTA 5ER5A 5G08A 4CLNA 2KGRA 3NSKA 4YBHB 1IIOA 1RECA 3DD4A 1UHHA 2BBMA 1XFYO 3DVJA 1BG1A 3B88A 3SG3A 2L51A 1CLLA 2KI6D 2BBNA 1SPYA 1IRJA 2COLB 3BYAA 1CDNA 2PSRA 1IQ5A 1OMRA 2LM5A 1U5IB 3NHIA 5CSIA 1XFXO 3I5HC 2L2CA 2M97A 3R1VA 1RWYA 3SG2A 1FBVA 2D8NA 5AXIA 2M8UA 1DELA 5AFPA 1J7PA 2L4HA 3LCPC 2I7AA 1L2OB 2CBLA 1GQMA 2JNFA 2CCMA 3JVTB 5I94A 4N1FA 3TDUA 3DYEA 4AQIA 2ZKMX 1F4QA 1DGUA 4PHJA 2M1KB 1IWQA 3C1VA 3NSLA 1TIZA 2WCHA 1MWNA 1LKJA 2TN4A 1OMDA 1QIWA 1P28A 3EK8A 1MHOA 1DMOA 1QV1A 2HPSA 4YI8A 1SK6D 1Y0VH 1S3PA 2ZNEA 4DCKA 5I8NA 1KWOB 2BCBA 3WXAA 2K0JA 2LAPA 1CM1A 3A4UB 2K8MB 3VGOA 3ZWHA 3WHTB 2GGMA 2BECA 5IBWA 4N5XA 2LNKA 2LVJA 2MLEC 2BL0B 3CZ0A 1NPQA 1QXPA 3PJIA 3CR2A 4PHNA 1TTXA 2ZN9A 3AKBA 3BFAA 4QJ5B 2F8PA 1NX1A 4N1GA 1R6PA 1V1FA 3H4SE 4NDDA 5BPJA 2P71A 2WNDA 1JF0A 1F71A 1PK0D 1WRKA 1NX3A 3NSIA 1EXRA 4ORCB 1BODA 1JF2A 1S6JA 4JD9A 1DC1A 1C07A 1ORGA 2F33A 1HQVA 4JPZB 2KFFA 4MRXA 4PT1A 1W7JB 2WC6A 2PASA 3BJHA 1CFFA 2BE6A 2ZFDA 1M31A 2ZRTA 2E30A 1K94A 1YVLA 2NCOA 2VRGA 3NXAA 1OOJA 4OVNF 5AANA 2BAPA 1PVBA 5J3XA 3ICBA 4JWQA 1OE9B 2JRFA 4PE7A 1S1EA 4CFRA 2JULA 3B6XA 3CGAA 1CTRA 4JKTA 2JTTA 1XFVO 1JFJA 2OS8C 4GGNA 1K9UA 2WCKA 4WQ2A 4P5OE 3SS4A 1CMGA 2LHLA 2MRDA 3SIBA 2GGZA 3O2PA 1IJ6A 2JWWA 1OZOA 3KPXA 2R2IA 1B7TZ 2JOJA 3DZTA 1ZMZA 4WQ3A 3TS5C 4FQTA 1AP4A 3EVVA 4U8DA 2MAZA 3RM1A 1UURA 1S26D 1XFWO 4USLA 1B7TY 2Y4QA 3DVMA 3AKAA 4I5LB 1ZOTB 4NDBA 1NX2A 1OQPA 4MRYA 3JTDB 3I5GC 2ZRSA 1WLZA 2FCDA 3PM2A 1CDMA 1DTLA 1GJYA 3DY9A 4MBEA 1CLMA 1WDCB 2MLFC 1YRTB 3EKHA 4KYNA 1K9KA 3E3RA 5FI7A 3GK1A 1A29A 1BR1B 1KQMC 2K7DA 2O60A 3EVUA 4OCIA 1U5IA 3AAJA 2Y1MA 1C7VA 2K2FA 4F7FA 1KFUS 1AHRA 2P70A 5HL1A 1LA0A 3L47A 2KAXA 2FJUB 5DKNA 2Q91A 1DJXA 3DVEA 1EG3A 4Q04A 2WC8A 2KLEA 4PHKA 3D76A 3I5FB 1DJIA 2KSPA 1CFDA 2QEBA 1YRUB 5HKYA 2HQ8A 3OB1B 1PVAA 2KQ6A 3S0GA 3D74A 1TNPA 3PN7C 3WNXB 2B1UA 3VRRA 1YUUA 2LANA 4I5NB 2WOSA 1DJYA 1GGWA 1XK4A 4C0LA 5B8IB 3NGVA 5CSFA 1AK8A 1MUXA 1M63B 1SMGA 2PMYA 2Y1NA 4MLWA 1QIVA 2KBIA 1XVJA 1Y6WA 3I5HB 3V2LA 1LVCD 1RFJA 3B7AA 2JU0A 2M49B 2LVIA 1NCYA 1C7WA 3SIAA 1S36A 1CKKA 3K21A 2JT3A 2L5YA 1K8UA 3FIAA 1C3YA 4GNKB 1TCOB 1QVIZ 2PYQA 1UHJA 2LV7A 1BF5A 2BKHB 1OOGA 1BOCA 4PE4A 1QVIY 3CWGA 3FWCA 4HSZA 1M45A 1K2HA 2KQYA 1XFRA 1WLMA 3HX4A 4INWA 5I2QA 5FYXA 4XJKB 2FOTA 2JNXA 3CYZA 1RJVA 3DF0A 1J7OA 1DT7B 2Y5IA 5FI6A 4C0KA 3VROA 3EG5B 3LLEA 2JPOA 1R2UA 2JXCA 1OOHA 3N7HA 2JQ6A 3VRNA 4C0JA 2H61A 5HYDA 1SL8A 4HREE 1HT9A 1SKTA 1Y1UA 1BU3A 1EJ3A 4YRUA 1NCZA 3S0DA 2OPOA 1B9AA 1NUBA 2EHBA 2LLTA 1S6CA 3GK4X 3M0WA 2MBXA 3EKJA 1A75A 1B8LA 1N0YA 4MZLA 2DOQA 1TUJA 4OZDA 5CSNA 3SS3A 1DJHA 1K9PA 1QASA 1AVSA 3VB1A 1F8HA 3B86A 1GM0A 1CDLA 2KDHA 2M0RA 2WCFA 3D77A 1AJ4A 3IF7A 1Y1XA 1CM4A 4YGBB 2EC6C 3EK4A 3TZ1A 3D0YB 1DQEA 1E8AA 4ZCVA 2JC2A 3BOWB 3CZTX 2KNEA 2GV5A 3S0AA 1NIWA 1OOIX 1WRZA 2LVVA 2PVBA 1IG5A 3GK2A 2F2OA 1W9ZA 3DVKA 3CS1A 3LK1A 4ETOA 4PE0A 2CTNA 1H4BA 1K96A 1WY9A 3NHTA 1MXLC 1XK4C 2CT9A 3D10A 3D75A 3FWBA 2QACA 1C3ZA 4MSPA 1DJGA 3PM8A 4PCWA 1XFZO 1QV0A 4A4BA 3R72A 4FQOA 4GGFA 3CR5X 2G9BA 2FJYA 1PALA 1WRLA 3TS5B 1SY9A 2NZ0A 1QX2A 1YURA 1Z2CB 1SCMC 1UWOA 4PALA 4DUQA 1MQ1A 1QX7A 3BUWB 3SG7A 1IKUA 4M2OA 3BUNB 2AAOA 3I5IB 1OSAA 3I5GB 3IQOA 4ORAB 5HKWA 4MZJA 2BE4A 1VRKA 4AOMA 5D3OA 3DXLA 2NXQA 1FW4A 4M2QA 1IH0A 1A2XA 2H8VA 1SRAA 4NDCA 1KQMB 1KK7Z 1PULA 2KHNA 3O78A 4PDZA 1FF1A 1DF0A 2LVKA 3R1OA 1BLQA 2KFGA 1CDPA 2ZNDA 4AQJA 2L50A 1KK7Y 1Q80A 4QJ4B 3L4LA 4ICBA 5PALA 4MZKA 1J1DA 2H61C 1XYDA 3L4AA 1K90D 4A4CA 3BQ3A 2QEVA 3UNWA 5JJGA 1DGVA 3OP0A 1TNXA 2F2PA 1CB1A 2G2BA 1SBJA 3MSEB 2F3YA 1LA3A 1LINA 1QLSA 1S6IA 1RTP1 3OX5A 1KK8C 4HRGA 2QEOA 2L4IA 4BY5A 1EG4A 5HKZA 3EVRA 2LE9B 1LXFC 1M46A 2EGDA 3CABA 1BR4B 4XYNA 2KAYA 1K93D 2E6WA 2K7CA 1G33A 4HRHA 3AAKA 3NSOA 3KEVA 1KSOA 2WORA 2YGUA 2PALA 2MA2A 3QRXA 2K60A 4CIDA 3PALA 5D69A 1UUSA 4JQ0D 2RGIA 3SG4A 1QJTA 1QWVA 4GFTA 3IQQA 1AJ5A 5HLOA 1XO5A 1SR6C 2BCXA 3BXKA 1EH2A 1UHIA 1X02A 2OTGC 5F6TA 2PRUA 3S0BA 4GPLB 3VRPA 2WCBA 1BJFA 1TRFA 1KCYA 1YTZC 5DICA 5GQQC 1TNQA 5K89A 1TCFA 2JXLA 3OBVA 2KI4C 5KTYA 2JT8A 1FPWA 1KFXS 1ODBA 2I18A 4FTGA 4GGFC 5I2LA 4DS7A 4ORBB 3TUYC 2A4JA 2BNXA 1OOFA 4P2YB 4M2PA 1J7RA 1PRWA 1IGVA 1L7ZA 4DRWA 1B8RA 2F3ZA 1SYMA 3BOWA 1QTXA 3GOFA 2AUCA 5JOLA 2KAVA 1H8BA 1TNWA 3CZ1A 1YVHA 2LP3A 4OV2A 2KGBC 4E68A 1DEKA 2NCPA 2H2KA 4ZCUA 1B8CA 2WC5A 1DJZA 5I2OA 3FE9A 4R1EA 5AERA 3K1EA 2LUXA 1LS8A 1SL7A 2ISDA 5ER4X 2O5GA 1ZACA 4QJ3B 4YGCB 1A4PA 1NCXA 2MJWB 4I5KA 1NYAA 3O4YA 2L5XB 2LCPA 2L2EA 1Z4HA 3CDNA 2EC6B 4GAOA 4IL1A 1ZUZA 3BFHA 3S0EA 1K95A 1SW8A 2CXJA 3FE6A 4F0ZB 1Y1AA 2WCLA 4WRIA 5TNCA 2M29A 1B1GA 2KYCA 3F45A 1QATA 1F55A 1DVIA 2LMVA 2M3WA 1UHKA 2BCAA 1XFUO 3KF9A 2K7BA 1YUTA 2LC5A 1BMOA 1B4CA 1L2OC 1EL4A 1SNLA 3LK0A 5D7FA 2KLDA 2IS9A 3JVTC 5HLVA 2BKIB 2L0PA 2LHIA 1JBAA 1FI6A 1S5GZ 1PSBA 1W7IB 3KHEA 3OB2B 2JZIA 1CMFA 1SCVA 5KSZA 4YGAA 1F4OA 5AEQA 2K7OA 1S5GY 4UPGA 4YGEB 1RROA 1G4YR 1DJWA 2WCJA 1XA5A
chains in the Genus database with same CATH topology
1ALWA 3PLFB 4GBAA 1SCMB 2OS8B 1KWOC 1PSRA 4L9MA 1CLBA 4PHMA 2K61A 2MHHA 4GUKA 2KFHA 1KFUL 3BUMB 5CPVA 1KSMA 5CSJA 2HF5A 1MXEA 2BL0C 2JT0A 2M7LA 4OR9B 3DF0B 4OKHA 1B47A 2JTZA 1CNPA 1TOPA 2I2RE 1FI5A 1UHNA 2KOTA 4MVFA 2P6BB 1CFCA 2L98A 3A8RA 1NWDA 2QPTA 3VRQA 1OZSA 3BUXB 1JFKA 3PFVA 3FS7A 1KQVA 1CFPA 2KI6C 1JC2A 2ZN8A 5DKRA 5KU1A 3TDZA 1JWDA 1A75B 5DKQA 1QLKA 4MN0A 1QX5B 1J55A 1KK8B 3CLNA 1JUOA 1A03A 4CPVA 3O6BA 2HETA 1V1GA 3TDIA 1F54A 3CTNA 3HCMA 4NQGA 2SASA 1NSHA 1KFXL 2Q4UA 3SG6A 4YGDB 3ZNIA 2V53A 3KO0A 1OMVA 1YX7A 1G8IA 1MF8B 2HQWA 2LUCA 2LP2A 1NP8A 1NX0A 2CNPA 2KBMA 3PN7B 1M39A 3I5IC 1N2DA 4BY4A 4XJKA 1SR6B 4PE1A 1IQ3A 2M9GA 2SCPA 2WCEA 4YI9A 3LL8B 2OTGB 1GGZA 2M7NA 4MEWA 1MR8A 3RLZA 3BUOB 1RK9A 3OHMB 2KI4B 3JTDC 4D1EA 1F70A 3EK7A 3PSRA 1TN4A 2LLUA 3TUYB 3WHUB 2LLSA 4CFQA 1YX8A 2NLNA 1WDCC 1IJ5A 1ZFSA 2I94A 2LMUA 1JSAA 2M1UA 2FCEA 3SG5A 3PATA 1BT6A 1SL9A 1N65A 1YUSA 3SJSA 3OX6A 3CR4X 1AUIB 1YR5A 2KYFA 3D0YA 2JPTA 1QS7A 3I5FC 2AMIA 4TNCA 1UP5A 4DIRA 1J1EA 1J7QA 4I5JA 1DF0B 2K2AA 1D1OA 1ALVA 2LMTA 5ER5A 5G08A 4CLNA 2KGRA 3NSKA 4YBHB 1RECA 3DD4A 1UHHA 2BBMA 1XFYO 3DVJA 1BG1A 3SG3A 2L51A 1CLLA 2KI6D 2BBNA 1SPYA 1IRJA 2COLB 3BYAA 1CDNA 2PSRA 1IQ5A 1OMRA 2LM5A 1U5IB 5CSIA 1XFXO 3I5HC 2M97A 1RWYA 3SG2A 1FBVA 2D8NA 5AXIA 2M8UA 5AFPA 1J7PA 2L4HA 3LCPC 2I7AA 1L2OB 2CBLA 1GQMA 2JNFA 2CCMA 3JVTB 4N1FA 3TDUA 4AQIA 2ZKMX 1F4QA 1DGUA 4PHJA 2M1KB 1IWQA 3C1VA 3NSLA 1TIZA 1MWNA 1LKJA 2TN4A 1OMDA 1QIWA 3EK8A 1DMOA 1MHOA 1QV1A 2HPSA 4YI8A 1SK6D 1Y0VH 1S3PA 2ZNEA 4DCKA 5I8NA 1KWOB 2BCBA 3WXAA 2K0JA 2LAPA 1CM1A 3A4UB 2K8MB 3VGOA 3ZWHA 3WHTB 2GGMA 2BECA 5IBWA 4N5XA 2LNKA 2LVJA 2MLEC 2BL0B 1NPQA 1QXPA 3CR2A 4PHNA 1TTXA 2ZN9A 3AKBA 4QJ5B 2F8PA 1NX1A 4N1GA 1R6PA 1V1FA 3H4SE 4NDDA 5BPJA 1F71A 2WNDA 1JF0A 1PK0D 1WRKA 1NX3A 3NSIA 1EXRA 4ORCB 1BODA 1JF2A 1S6JA 1C07A 2F33A 1HQVA 4JPZB 2KFFA 4MRXA 1W7JB 2PASA 1CFFA 2BE6A 2ZFDA 1M31A 2ZRTA 2E30A 1K94A 1YVLA 2NCOA 2VRGA 3NXAA 1OOJA 4OVNF 5AANA 1PVBA 5J3XA 3ICBA 4JWQA 1OE9B 2JRFA 4PE7A 1S1EA 4CFRA 2JULA 3CGAA 1CTRA 2JTTA 1XFVO 1JFJA 2OS8C 4GGNA 1K9UA 4WQ2A 4P5OE 1CMGA 2LHLA 2MRDA 3SIBA 2GGZA 3O2PA 1IJ6A 2JWWA 1OZOA 3KPXA 2R2IA 1B7TZ 2JOJA 1ZMZA 4WQ3A 3TS5C 1AP4A 3EVVA 4U8DA 2MAZA 3RM1A 1UURA 1S26D 1XFWO 4USLA 1B7TY 2Y4QA 3DVMA 3AKAA 4I5LB 1ZOTB 4NDBA 1NX2A 1OQPA 4MRYA 3JTDB 3I5GC 2ZRSA 1WLZA 2FCDA 1CDMA 1DTLA 1GJYA 4MBEA 1CLMA 1WDCB 2MLFC 1YRTB 3EKHA 1K9KA 3E3RA 3GK1A 1A29A 1BR1B 1KQMC 2K7DA 2O60A 3EVUA 4OCIA 1U5IA 3AAJA 2Y1MA 1C7VA 2K2FA 1KFUS 1AHRA 1LA0A 2KAXA 2FJUB 5DKNA 2Q91A 1DJXA 3DVEA 1EG3A 4Q04A 2WC8A 4PHKA 3I5FB 1DJIA 2KSPA 1CFDA 1YRUB 5HKYA 2HQ8A 3OB1B 1PVAA 2KQ6A 1TNPA 3PN7C 3WNXB 2B1UA 3VRRA 1YUUA 2LANA 4I5NB 2WOSA 1DJYA 1GGWA 1XK4A 4C0LA 5B8IB 5CSFA 1AK8A 1MUXA 1M63B 1SMGA 2PMYA 2Y1NA 4MLWA 1QIVA 2KBIA 1XVJA 1Y6WA 3I5HB 1LVCD 1RFJA 2JU0A 2M49B 2LVIA 1NCYA 1C7WA 3SIAA 1S36A 1CKKA 3K21A 2JT3A 1K8UA 3FIAA 4GNKB 1TCOB 1QVIZ 1BF5A 1UHJA 2LV7A 1BOCA 2BKHB 4PE4A 1QVIY 3CWGA 3FWCA 4HSZA 1M45A 1K2HA 2KQYA 1WLMA 3HX4A 5I2QA 5FYXA 4XJKB 2FOTA 2JNXA 3DF0A 1RJVA 1J7OA 1DT7B 2Y5IA 4C0KA 3VROA 3LLEA 1R2UA 2JXCA 2JQ6A 3VRNA 4C0JA 2H61A 5HYDA 1SL8A 4HREE 1HT9A 1SKTA 1Y1UA 1BU3A 1EJ3A 4YRUA 1NCZA 2OPOA 1B9AA 1NUBA 2EHBA 2LLTA 1S6CA 3GK4X 3M0WA 2MBXA 3EKJA 1A75A 1B8LA 1N0YA 4MZLA 2DOQA 5CSNA 1DJHA 1K9PA 1QASA 1AVSA 1F8HA 1CDLA 2KDHA 2M0RA 2WCFA 1AJ4A 3IF7A 1Y1XA 1CM4A 4YGBB 2EC6C 3EK4A 3TZ1A 3D0YB 1E8AA 4ZCVA 2JC2A 3BOWB 3CZTX 2KNEA 2GV5A 1NIWA 1WRZA 2LVVA 2PVBA 1IG5A 3GK2A 2F2OA 3DVKA 3CS1A 3LK1A 4ETOA 4PE0A 2CTNA 1H4BA 1K96A 1WY9A 1MXLC 1XK4C 2CT9A 3D10A 3FWBA 2QACA 4MSPA 1DJGA 3PM8A 4PCWA 1XFZO 1QV0A 4A4BA 4FQOA 4GGFA 3CR5X 2G9BA 1PALA 1WRLA 3TS5B 1SY9A 2NZ0A 1QX2A 1YURA 1SCMC 1UWOA 4PALA 4DUQA 1MQ1A 1QX7A 3BUWB 3SG7A 1IKUA 4M2OA 3BUNB 2AAOA 3I5IB 1OSAA 3I5GB 3IQOA 4ORAB 5HKWA 4MZJA 2BE4A 1VRKA 4AOMA 2NXQA 1FW4A 4M2QA 1IH0A 1A2XA 1SRAA 4NDCA 1KQMB 1KK7Z 1PULA 2KHNA 3O78A 4PDZA 1FF1A 1DF0A 2LVKA 1BLQA 2KFGA 1CDPA 2ZNDA 4AQJA 2L50A 1KK7Y 1Q80A 4QJ4B 4ICBA 5PALA 4MZKA 1J1DA 2H61C 1XYDA 1K90D 3BQ3A 5JJGA 1DGVA 3OP0A 1TNXA 2F2PA 1CB1A 2G2BA 1SBJA 3MSEB 2F3YA 1LA3A 1LINA 1QLSA 1S6IA 1RTP1 3OX5A 1KK8C 4HRGA 4BY5A 2L4IA 1EG4A 5HKZA 3EVRA 2LE9B 1LXFC 1M46A 2EGDA 1BR4B 4XYNA 2KAYA 1K93D 2E6WA 2K7CA 1G33A 4HRHA 3AAKA 3NSOA 3KEVA 1KSOA 2WORA 2PALA 2MA2A 3QRXA 4CIDA 3PALA 5D69A 1UUSA 4JQ0D 2RGIA 3SG4A 1QJTA 4GFTA 3IQQA 1AJ5A 5HLOA 1XO5A 1SR6C 2BCXA 3BXKA 1EH2A 1UHIA 1X02A 2OTGC 5F6TA 2PRUA 4GPLB 3VRPA 2WCBA 1BJFA 1TRFA 1KCYA 1YTZC 5GQQC 1TNQA 5K89A 1TCFA 2JXLA 2KI4C 5KTYA 2JT8A 1FPWA 1KFXS 1ODBA 2I18A 4FTGA 4GGFC 5I2LA 4DS7A 4ORBB 3TUYC 2A4JA 4P2YB 4M2PA 1J7RA 1PRWA 1IGVA 1L7ZA 4DRWA 1B8RA 2F3ZA 1SYMA 3BOWA 1QTXA 3GOFA 2AUCA 5JOLA 2KAVA 1H8BA 1TNWA 1YVHA 2LP3A 4OV2A 2KGBC 4E68A 2NCPA 2H2KA 4ZCUA 1B8CA 1DJZA 5I2OA 5AERA 4R1EA 2LUXA 1SL7A 2ISDA 5ER4X 2O5GA 1ZACA 4QJ3B 4YGCB 1A4PA 1NCXA 2MJWB 4I5KA 1NYAA 3O4YA 2L5XB 2LCPA 2L2EA 2EC6B 4GAOA 4IL1A 1ZUZA 1K95A 1SW8A 2CXJA 4F0ZB 1Y1AA 4WRIA 5TNCA 2M29A 1B1GA 2KYCA 3F45A 1QATA 1F55A 1DVIA 2LMVA 2M3WA 1UHKA 2BCAA 1XFUO 3KF9A 2K7BA 1YUTA 2LC5A 1BMOA 1B4CA 1L2OC 1EL4A 1SNLA 3LK0A 5D7FA 2IS9A 3JVTC 5HLVA 2BKIB 2L0PA 2LHIA 1JBAA 1FI6A 1S5GZ 1PSBA 1W7IB 3KHEA 3OB2B 2JZIA 1CMFA 1SCVA 5KSZA 4YGAA 1F4OA 5AEQA 2K7OA 1S5GY 4UPGA 4YGEB 1RROA 1G4YR 1DJWA 4A4CA 1XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALW A;  3PLF B;  4GBA A;  1SCM B;  2OS8 B;  1KWO C;  1PSR A;  4L9M A;  1CLB A;  4PHM A;  2K61 A;  2MHH A;  4GUK A;  2KFH A;  1KFU L;  3BUM B;  5CPV A;  1KSM A;  5CSJ A;  2HF5 A;  1MXE A;  2BL0 C;  2JT0 A;  2M7L A;  4OR9 B;  3DF0 B;  4OKH A;  1B47 A;  2JTZ A;  1CNP A;  1TOP A;  2I2R E;  1FI5 A;  1UHN A;  2KOT A;  4MVF A;  2P6B B;  1CFC A;  2L98 A;  3A8R A;  1NWD A;  2QPT A;  3VRQ A;  1OZS A;  3BUX B;  1JFK A;  3PFV A;  3FS7 A;  1KQV A;  1CFP A;  2KI6 C;  1JC2 A;  2ZN8 A;  5DKR A;  5KU1 A;  3TDZ A;  1JWD A;  1A75 B;  5DKQ A;  1QLK A;  4MN0 A;  1QX5 B;  1J55 A;  1KK8 B;  3CLN A;  1JUO A;  1A03 A;  4CPV A;  3O6B A;  2HET A;  1V1G A;  3TDI A;  1F54 A;  3CTN A;  3HCM A;  4NQG A;  2SAS A;  1NSH A;  1KFX L;  2Q4U A;  3SG6 A;  4YGD B;  3ZNI A;  2V53 A;  3KO0 A;  1OMV A;  1YX7 A;  1G8I A;  1MF8 B;  2HQW A;  2LUC A;  2LP2 A;  1NP8 A;  1NX0 A;  2CNP A;  2KBM A;  3PN7 B;  1M39 A;  3I5I C;  1N2D A;  4BY4 A;  4XJK A;  1SR6 B;  4PE1 A;  1IQ3 A;  2M9G A;  2SCP A;  2WCE A;  4YI9 A;  3LL8 B;  2OTG B;  1GGZ A;  2M7N A;  4MEW A;  1MR8 A;  3RLZ A;  3BUO B;  1RK9 A;  3OHM B;  2KI4 B;  3JTD C;  4D1E A;  1F70 A;  3EK7 A;  3PSR A;  1TN4 A;  2LLU A;  3TUY B;  3WHU B;  2LLS A;  4CFQ A;  1YX8 A;  2NLN A;  1WDC C;  1IJ5 A;  1ZFS A;  2I94 A;  2LMU A;  1JSA A;  2M1U A;  2FCE A;  3SG5 A;  3PAT A;  1BT6 A;  1SL9 A;  1N65 A;  1YUS A;  3SJS A;  3OX6 A;  3CR4 X;  1AUI B;  1YR5 A;  2KYF A;  3D0Y A;  2JPT A;  1QS7 A;  3I5F C;  2AMI A;  4TNC A;  1UP5 A;  4DIR A;  1J1E A;  1J7Q A;  4I5J A;  1DF0 B;  2K2A A;  1D1O A;  1ALV A;  2LMT A;  5ER5 A;  5G08 A;  4CLN A;  2KGR A;  3NSK A;  4YBH B;  1REC A;  3DD4 A;  1UHH A;  2BBM A;  1XFY O;  3DVJ A;  1BG1 A;  3SG3 A;  2L51 A;  1CLL A;  2KI6 D;  2BBN A;  1SPY A;  1IRJ A;  2COL B;  3BYA A;  1CDN A;  2PSR A;  1IQ5 A;  1OMR A;  2LM5 A;  1U5I B;  5CSI A;  1XFX O;  3I5H C;  2M97 A;  1RWY A;  3SG2 A;  1FBV A;  2D8N A;  5AXI A;  2M8U A;  5AFP A;  1J7P A;  2L4H A;  3LCP C;  2I7A A;  1L2O B;  2CBL A;  1GQM A;  2JNF A;  2CCM A;  3JVT B;  4N1F A;  3TDU A;  4AQI A;  2ZKM X;  1F4Q A;  1DGU A;  4PHJ A;  2M1K B;  1IWQ A;  3C1V A;  3NSL A;  1TIZ A;  1MWN A;  1LKJ A;  2TN4 A;  1OMD A;  1QIW A;  3EK8 A;  1DMO A;  1MHO A;  1QV1 A;  2HPS A;  4YI8 A;  1SK6 D;  1Y0V H;  1S3P A;  2ZNE A;  4DCK A;  5I8N A;  1KWO B;  2BCB A;  3WXA A;  2K0J A;  2LAP A;  1CM1 A;  3A4U B;  2K8M B;  3VGO A;  3ZWH A;  3WHT B;  2GGM A;  2BEC A;  5IBW A;  4N5X A;  2LNK A;  2LVJ A;  2MLE C;  2BL0 B;  1NPQ A;  1QXP A;  3CR2 A;  4PHN A;  1TTX A;  2ZN9 A;  3AKB A;  4QJ5 B;  2F8P A;  1NX1 A;  4N1G A;  1R6P A;  1V1F A;  3H4S E;  4NDD A;  5BPJ A;  1F71 A;  2WND A;  1JF0 A;  1PK0 D;  1WRK A;  1NX3 A;  3NSI A;  1EXR A;  4ORC B;  1BOD A;  1JF2 A;  1S6J A;  1C07 A;  2F33 A;  1HQV A;  4JPZ B;  2KFF A;  4MRX A;  1W7J B;  2PAS A;  1CFF A;  2BE6 A;  2ZFD A;  1M31 A;  2ZRT A;  2E30 A;  1K94 A;  1YVL A;  2NCO A;  2VRG A;  3NXA A;  1OOJ A;  4OVN F;  5AAN A;  1PVB A;  5J3X A;  3ICB A;  4JWQ A;  1OE9 B;  2JRF A;  4PE7 A;  1S1E A;  4CFR A;  2JUL A;  3CGA A;  1CTR A;  2JTT A;  1XFV O;  1JFJ A;  2OS8 C;  4GGN A;  1K9U A;  4WQ2 A;  4P5O E;  1CMG A;  2LHL A;  2MRD A;  3SIB A;  2GGZ A;  3O2P A;  1IJ6 A;  2JWW A;  1OZO A;  3KPX A;  2R2I A;  1B7T Z;  2JOJ A;  1ZMZ A;  4WQ3 A;  3TS5 C;  1AP4 A;  3EVV A;  4U8D A;  2MAZ A;  3RM1 A;  1UUR A;  1S26 D;  1XFW O;  4USL A;  1B7T Y;  2Y4Q A;  3DVM A;  3AKA A;  4I5L B;  1ZOT B;  4NDB A;  1NX2 A;  1OQP A;  4MRY A;  3JTD B;  3I5G C;  2ZRS A;  1WLZ A;  2FCD A;  1CDM A;  1DTL A;  1GJY A;  4MBE A;  1CLM A;  1WDC B;  2MLF C;  1YRT B;  3EKH A;  1K9K A;  3E3R A;  3GK1 A;  1A29 A;  1BR1 B;  1KQM C;  2K7D A;  2O60 A;  3EVU A;  4OCI A;  1U5I A;  3AAJ A;  2Y1M A;  1C7V A;  2K2F A;  1KFU S;  1AHR A;  1LA0 A;  2KAX A;  2FJU B;  5DKN A;  2Q91 A;  1DJX A;  3DVE A;  1EG3 A;  4Q04 A;  2WC8 A;  4PHK A;  3I5F B;  1DJI A;  2KSP A;  1CFD A;  1YRU B;  5HKY A;  2HQ8 A;  3OB1 B;  1PVA A;  2KQ6 A;  1TNP A;  3PN7 C;  3WNX B;  2B1U A;  3VRR A;  1YUU A;  2LAN A;  4I5N B;  2WOS A;  1DJY A;  1GGW A;  1XK4 A;  4C0L A;  5B8I B;  5CSF A;  1AK8 A;  1MUX A;  1M63 B;  1SMG A;  2PMY A;  2Y1N A;  4MLW A;  1QIV A;  2KBI A;  1XVJ A;  1Y6W A;  3I5H B;  1LVC D;  1RFJ A;  2JU0 A;  2M49 B;  2LVI A;  1NCY A;  1C7W A;  3SIA A;  1S36 A;  1CKK A;  3K21 A;  2JT3 A;  1K8U A;  3FIA A;  4GNK B;  1TCO B;  1QVI Z;  1BF5 A;  1UHJ A;  2LV7 A;  1BOC A;  2BKH B;  4PE4 A;  1QVI Y;  3CWG A;  3FWC A;  4HSZ A;  1M45 A;  1K2H A;  2KQY A;  1WLM A;  3HX4 A;  5I2Q A;  5FYX A;  4XJK B;  2FOT A;  2JNX A;  3DF0 A;  1RJV A;  1J7O A;  1DT7 B;  2Y5I A;  4C0K A;  3VRO A;  3LLE A;  1R2U A;  2JXC A;  2JQ6 A;  3VRN A;  4C0J A;  2H61 A;  5HYD A;  1SL8 A;  4HRE E;  1HT9 A;  1SKT A;  1Y1U A;  1BU3 A;  1EJ3 A;  4YRU A;  1NCZ A;  2OPO A;  1B9A A;  1NUB A;  2EHB A;  2LLT A;  1S6C A;  3GK4 X;  3M0W A;  2MBX A;  3EKJ A;  1A75 A;  1B8L A;  1N0Y A;  4MZL A;  2DOQ A;  5CSN A;  1DJH A;  1K9P A;  1QAS A;  1AVS A;  1F8H A;  1CDL A;  2KDH A;  2M0R A;  2WCF A;  1AJ4 A;  3IF7 A;  1Y1X A;  1CM4 A;  4YGB B;  2EC6 C;  3EK4 A;  3TZ1 A;  3D0Y B;  1E8A A;  4ZCV A;  2JC2 A;  3BOW B;  3CZT X;  2KNE A;  2GV5 A;  1NIW A;  1WRZ A;  2LVV A;  2PVB A;  1IG5 A;  3GK2 A;  2F2O A;  3DVK A;  3CS1 A;  3LK1 A;  4ETO A;  4PE0 A;  2CTN A;  1H4B A;  1K96 A;  1WY9 A;  1MXL C;  1XK4 C;  2CT9 A;  3D10 A;  3FWB A;  2QAC A;  4MSP A;  1DJG A;  3PM8 A;  4PCW A;  1XFZ O;  1QV0 A;  4A4B A;  4FQO A;  4GGF A;  3CR5 X;  2G9B A;  1PAL A;  1WRL A;  3TS5 B;  1SY9 A;  2NZ0 A;  1QX2 A;  1YUR A;  1SCM C;  1UWO A;  4PAL A;  4DUQ A;  1MQ1 A;  1QX7 A;  3BUW B;  3SG7 A;  1IKU A;  4M2O A;  3BUN B;  2AAO A;  3I5I B;  1OSA A;  3I5G B;  3IQO A;  4ORA B;  5HKW A;  4MZJ A;  2BE4 A;  1VRK A;  4AOM A;  2NXQ A;  1FW4 A;  4M2Q A;  1IH0 A;  1A2X A;  1SRA A;  4NDC A;  1KQM B;  1KK7 Z;  1PUL A;  2KHN A;  3O78 A;  4PDZ A;  1FF1 A;  1DF0 A;  2LVK A;  1BLQ A;  2KFG A;  1CDP A;  2ZND A;  4AQJ A;  2L50 A;  1KK7 Y;  1Q80 A;  4QJ4 B;  4ICB A;  5PAL A;  4MZK A;  1J1D A;  2H61 C;  1XYD A;  1K90 D;  3BQ3 A;  5JJG A;  1DGV A;  3OP0 A;  1TNX A;  2F2P A;  1CB1 A;  2G2B A;  1SBJ A;  3MSE B;  2F3Y A;  1LA3 A;  1LIN A;  1QLS A;  1S6I A;  1RTP 1;  3OX5 A;  1KK8 C;  4HRG A;  4BY5 A;  2L4I A;  1EG4 A;  5HKZ A;  3EVR A;  2LE9 B;  1LXF C;  1M46 A;  2EGD A;  1BR4 B;  4XYN A;  2KAY A;  1K93 D;  2E6W A;  2K7C A;  1G33 A;  4HRH A;  3AAK A;  3NSO A;  3KEV A;  1KSO A;  2WOR A;  2PAL A;  2MA2 A;  3QRX A;  4CID A;  3PAL A;  5D69 A;  1UUS A;  4JQ0 D;  2RGI A;  3SG4 A;  1QJT A;  4GFT A;  3IQQ A;  1AJ5 A;  5HLO A;  1XO5 A;  1SR6 C;  2BCX A;  3BXK A;  1EH2 A;  1UHI A;  1X02 A;  2OTG C;  5F6T A;  2PRU A;  4GPL B;  3VRP A;  2WCB A;  1BJF A;  1TRF A;  1KCY A;  1YTZ C;  5GQQ C;  1TNQ A;  5K89 A;  1TCF A;  2JXL A;  2KI4 C;  5KTY A;  2JT8 A;  1FPW A;  1KFX S;  1ODB A;  2I18 A;  4FTG A;  4GGF C;  5I2L A;  4DS7 A;  4ORB B;  3TUY C;  2A4J A;  4P2Y B;  4M2P A;  1J7R A;  1PRW A;  1IGV A;  1L7Z A;  4DRW A;  1B8R A;  2F3Z A;  1SYM A;  3BOW A;  1QTX A;  3GOF A;  2AUC A;  5JOL A;  2KAV A;  1H8B A;  1TNW A;  1YVH A;  2LP3 A;  4OV2 A;  2KGB C;  4E68 A;  2NCP A;  2H2K A;  4ZCU A;  1B8C A;  1DJZ A;  5I2O A;  5AER A;  4R1E A;  2LUX A;  1SL7 A;  2ISD A;  5ER4 X;  2O5G A;  1ZAC A;  4QJ3 B;  4YGC B;  1A4P A;  1NCX A;  2MJW B;  4I5K A;  1NYA A;  3O4Y A;  2L5X B;  2LCP A;  2L2E A;  2EC6 B;  4GAO A;  4IL1 A;  1ZUZ A;  1K95 A;  1SW8 A;  2CXJ A;  4F0Z B;  1Y1A A;  4WRI A;  5TNC A;  2M29 A;  1B1G A;  2KYC A;  3F45 A;  1QAT A;  1F55 A;  1DVI A;  2LMV A;  2M3W A;  1UHK A;  2BCA A;  1XFU O;  3KF9 A;  2K7B A;  1YUT A;  2LC5 A;  1BMO A;  1B4C A;  1L2O C;  1EL4 A;  1SNL A;  3LK0 A;  5D7F A;  2IS9 A;  3JVT C;  5HLV A;  2BKI B;  2L0P A;  2LHI A;  1JBA A;  1FI6 A;  1S5G Z;  1PSB A;  1W7I B;  3KHE A;  3OB2 B;  2JZI A;  1CMF A;  1SCV A;  5KSZ A;  4YGA A;  1F4O A;  5AEQ A;  2K7O A;  1S5G Y;  4UPG A;  4YGE B;  1RRO A;  1G4Y R;  1DJW A;  4A4C A;  1XA5 A; 
#chains in the Genus database with same CATH topology
 1ALW A;  3PLF B;  4GBA A;  1SCM B;  2OS8 B;  3O4X A;  1KWO C;  1PSR A;  2PQL A;  4L9M A;  1CLB A;  3RZS A;  4PHM A;  2K61 A;  2MHH A;  4GUK A;  2KFH A;  1KFU L;  3BUM B;  5CPV A;  1KSM A;  5CSJ A;  2HF5 A;  1MXE A;  2BL0 C;  2JT0 A;  2M7L A;  3UO9 A;  3BFB A;  4OR9 B;  1SSE B;  3DF0 B;  5FI2 A;  3D78 A;  4OKH A;  1B47 A;  2JTZ A;  3B87 A;  3FE8 A;  1CNP A;  5EL2 A;  4IJ7 A;  1TOP A;  2I2R E;  1FI5 A;  1UHN A;  2KOT A;  4MVF A;  2P6B B;  3SS5 A;  1CFC A;  2L98 A;  2QEH A;  3A8R A;  1NWD A;  2QPT A;  3VRQ A;  1OZS A;  3BUX B;  1JFK A;  3PFV A;  3FS7 A;  2ERB A;  1CFP A;  2KI6 C;  1KQV A;  1JC2 A;  2ZN8 A;  5DKR A;  5KU1 A;  1OW4 A;  3S0F A;  3TDZ A;  1JWD A;  1A75 B;  5DKQ A;  1QLK A;  4MN0 A;  1QX5 B;  1J55 A;  1KK8 B;  3CLN A;  1JUO A;  1A03 A;  4CPV A;  3O6B A;  2HET A;  1V1G A;  3TDI A;  1F54 A;  3CTN A;  3HCM A;  4NQG A;  2SAS A;  3CZ2 A;  3R1P A;  1NSH A;  1KFX L;  2Q4U A;  3SG6 A;  4YGD B;  3ZNI A;  2V53 A;  3KO0 A;  1OMV A;  1YX7 A;  1TUZ A;  1G8I A;  1MF8 B;  2HQW A;  2LUC A;  2LP2 A;  1NP8 A;  1NX0 A;  2CNP A;  2KBM A;  3PN7 B;  1M39 A;  3IVT A;  3I5I C;  1N2D A;  4BY4 A;  4XJK A;  1SR6 B;  4PE1 A;  1IQ3 A;  2M9G A;  2SCP A;  2WCE A;  4YI9 A;  2GTE A;  4INX A;  3LL8 B;  2OTG B;  1GGZ A;  2M7N A;  3D73 A;  4MEW A;  1MR8 A;  3RLZ A;  3BUO B;  1RK9 A;  3OHM B;  2KI4 B;  3JTD C;  3QME A;  4D1E A;  1F70 A;  2KPH A;  3EK7 A;  3PSR A;  1TWO A;  1TN4 A;  2LLU A;  3TUY B;  3WHU B;  2LLS A;  4CFQ A;  1YX8 A;  2NLN A;  2QDI A;  1WDC C;  1IJ5 A;  1ZFS A;  2I94 A;  2LMU A;  1JSA A;  2M1U A;  2FCE A;  3SG5 A;  3PAT A;  1BT6 A;  1SL9 A;  1N65 A;  1T14 A;  1YUS A;  3SJS A;  3Q8I A;  3OX6 A;  3CR4 X;  1AUI B;  1YR5 A;  2KYF A;  3D0Y A;  3OGN A;  2JPT A;  1QS7 A;  2WCM A;  2AMI A;  3I5F C;  1UP5 A;  4TNC A;  1J1E A;  4DIR A;  1J7Q A;  4I5J A;  1DF0 B;  2K2A A;  1D1O A;  1ALV A;  2LMT A;  5ER5 A;  5G08 A;  4CLN A;  2KGR A;  3NSK A;  4YBH B;  1IIO A;  1REC A;  3DD4 A;  1UHH A;  2BBM A;  1XFY O;  3DVJ A;  1BG1 A;  3B88 A;  3SG3 A;  2L51 A;  1CLL A;  2KI6 D;  2BBN A;  1SPY A;  1IRJ A;  2COL B;  3BYA A;  1CDN A;  2PSR A;  1IQ5 A;  1OMR A;  2LM5 A;  1U5I B;  3NHI A;  5CSI A;  1XFX O;  3I5H C;  2L2C A;  2M97 A;  3R1V A;  1RWY A;  3SG2 A;  1FBV A;  2D8N A;  5AXI A;  2M8U A;  1DEL A;  5AFP A;  1J7P A;  2L4H A;  3LCP C;  2I7A A;  1L2O B;  2CBL A;  1GQM A;  2JNF A;  2CCM A;  3JVT B;  5I94 A;  4N1F A;  3TDU A;  3DYE A;  4AQI A;  2ZKM X;  1F4Q A;  1DGU A;  4PHJ A;  2M1K B;  1IWQ A;  3C1V A;  3NSL A;  1TIZ A;  2WCH A;  1MWN A;  1LKJ A;  2TN4 A;  1OMD A;  1QIW A;  1P28 A;  3EK8 A;  1MHO A;  1DMO A;  1QV1 A;  2HPS A;  4YI8 A;  1SK6 D;  1Y0V H;  1S3P A;  2ZNE A;  4DCK A;  5I8N A;  1KWO B;  2BCB A;  3WXA A;  2K0J A;  2LAP A;  1CM1 A;  3A4U B;  2K8M B;  3VGO A;  3ZWH A;  3WHT B;  2GGM A;  2BEC A;  5IBW A;  4N5X A;  2LNK A;  2LVJ A;  2MLE C;  2BL0 B;  3CZ0 A;  1NPQ A;  1QXP A;  3PJI A;  3CR2 A;  4PHN A;  1TTX A;  2ZN9 A;  3AKB A;  3BFA A;  4QJ5 B;  2F8P A;  1NX1 A;  4N1G A;  1R6P A;  1V1F A;  3H4S E;  4NDD A;  5BPJ A;  2P71 A;  2WND A;  1JF0 A;  1F71 A;  1PK0 D;  1WRK A;  1NX3 A;  3NSI A;  1EXR A;  4ORC B;  1BOD A;  1JF2 A;  1S6J A;  4JD9 A;  1DC1 A;  1C07 A;  1ORG A;  2F33 A;  1HQV A;  4JPZ B;  2KFF A;  4MRX A;  4PT1 A;  1W7J B;  2WC6 A;  2PAS A;  3BJH A;  1CFF A;  2BE6 A;  2ZFD A;  1M31 A;  2ZRT A;  2E30 A;  1K94 A;  1YVL A;  2NCO A;  2VRG A;  3NXA A;  1OOJ A;  4OVN F;  5AAN A;  2BAP A;  1PVB A;  5J3X A;  3ICB A;  4JWQ A;  1OE9 B;  2JRF A;  4PE7 A;  1S1E A;  4CFR A;  2JUL A;  3B6X A;  3CGA A;  1CTR A;  4JKT A;  2JTT A;  1XFV O;  1JFJ A;  2OS8 C;  4GGN A;  1K9U A;  2WCK A;  4WQ2 A;  4P5O E;  3SS4 A;  1CMG A;  2LHL A;  2MRD A;  3SIB A;  2GGZ A;  3O2P A;  1IJ6 A;  2JWW A;  1OZO A;  3KPX A;  2R2I A;  1B7T Z;  2JOJ A;  3DZT A;  1ZMZ A;  4WQ3 A;  3TS5 C;  4FQT A;  1AP4 A;  3EVV A;  4U8D A;  2MAZ A;  3RM1 A;  1UUR A;  1S26 D;  1XFW O;  4USL A;  1B7T Y;  2Y4Q A;  3DVM A;  3AKA A;  4I5L B;  1ZOT B;  4NDB A;  1NX2 A;  1OQP A;  4MRY A;  3JTD B;  3I5G C;  2ZRS A;  1WLZ A;  2FCD A;  3PM2 A;  1CDM A;  1DTL A;  1GJY A;  3DY9 A;  4MBE A;  1CLM A;  1WDC B;  2MLF C;  1YRT B;  3EKH A;  4KYN A;  1K9K A;  3E3R A;  5FI7 A;  3GK1 A;  1A29 A;  1BR1 B;  1KQM C;  2K7D A;  2O60 A;  3EVU A;  4OCI A;  1U5I A;  3AAJ A;  2Y1M A;  1C7V A;  2K2F A;  4F7F A;  1KFU S;  1AHR A;  2P70 A;  5HL1 A;  1LA0 A;  3L47 A;  2KAX A;  2FJU B;  5DKN A;  2Q91 A;  1DJX A;  3DVE A;  1EG3 A;  4Q04 A;  2WC8 A;  2KLE A;  4PHK A;  3D76 A;  3I5F B;  1DJI A;  2KSP A;  1CFD A;  2QEB A;  1YRU B;  5HKY A;  2HQ8 A;  3OB1 B;  1PVA A;  2KQ6 A;  3S0G A;  3D74 A;  1TNP A;  3PN7 C;  3WNX B;  2B1U A;  3VRR A;  1YUU A;  2LAN A;  4I5N B;  2WOS A;  1DJY A;  1GGW A;  1XK4 A;  4C0L A;  5B8I B;  3NGV A;  5CSF A;  1AK8 A;  1MUX A;  1M63 B;  1SMG A;  2PMY A;  2Y1N A;  4MLW A;  1QIV A;  2KBI A;  1XVJ A;  1Y6W A;  3I5H B;  3V2L A;  1LVC D;  1RFJ A;  3B7A A;  2JU0 A;  2M49 B;  2LVI A;  1NCY A;  1C7W A;  3SIA A;  1S36 A;  1CKK A;  3K21 A;  2JT3 A;  2L5Y A;  1K8U A;  3FIA A;  1C3Y A;  4GNK B;  1TCO B;  1QVI Z;  2PYQ A;  1UHJ A;  2LV7 A;  1BF5 A;  2BKH B;  1OOG A;  1BOC A;  4PE4 A;  1QVI Y;  3CWG A;  3FWC A;  4HSZ A;  1M45 A;  1K2H A;  2KQY A;  1XFR A;  1WLM A;  3HX4 A;  4INW A;  5I2Q A;  5FYX A;  4XJK B;  2FOT A;  2JNX A;  3CYZ A;  1RJV A;  3DF0 A;  1J7O A;  1DT7 B;  2Y5I A;  5FI6 A;  4C0K A;  3VRO A;  3EG5 B;  3LLE A;  2JPO A;  1R2U A;  2JXC A;  1OOH A;  3N7H A;  2JQ6 A;  3VRN A;  4C0J A;  2H61 A;  5HYD A;  1SL8 A;  4HRE E;  1HT9 A;  1SKT A;  1Y1U A;  1BU3 A;  1EJ3 A;  4YRU A;  1NCZ A;  3S0D A;  2OPO A;  1B9A A;  1NUB A;  2EHB A;  2LLT A;  1S6C A;  3GK4 X;  3M0W A;  2MBX A;  3EKJ A;  1A75 A;  1B8L A;  1N0Y A;  4MZL A;  2DOQ A;  1TUJ A;  4OZD A;  5CSN A;  3SS3 A;  1DJH A;  1K9P A;  1QAS A;  1AVS A;  3VB1 A;  1F8H A;  3B86 A;  1GM0 A;  1CDL A;  2KDH A;  2M0R A;  2WCF A;  3D77 A;  1AJ4 A;  3IF7 A;  1Y1X A;  1CM4 A;  4YGB B;  2EC6 C;  3EK4 A;  3TZ1 A;  3D0Y B;  1DQE A;  1E8A A;  4ZCV A;  2JC2 A;  3BOW B;  3CZT X;  2KNE A;  2GV5 A;  3S0A A;  1NIW A;  1OOI X;  1WRZ A;  2LVV A;  2PVB A;  1IG5 A;  3GK2 A;  2F2O A;  1W9Z A;  3DVK A;  3CS1 A;  3LK1 A;  4ETO A;  4PE0 A;  2CTN A;  1H4B A;  1K96 A;  1WY9 A;  3NHT A;  1MXL C;  1XK4 C;  2CT9 A;  3D10 A;  3D75 A;  3FWB A;  2QAC A;  1C3Z A;  4MSP A;  1DJG A;  3PM8 A;  4PCW A;  1XFZ O;  1QV0 A;  4A4B A;  3R72 A;  4FQO A;  4GGF A;  3CR5 X;  2G9B A;  2FJY A;  1PAL A;  1WRL A;  3TS5 B;  1SY9 A;  2NZ0 A;  1QX2 A;  1YUR A;  1Z2C B;  1SCM C;  1UWO A;  4PAL A;  4DUQ A;  1MQ1 A;  1QX7 A;  3BUW B;  3SG7 A;  1IKU A;  4M2O A;  3BUN B;  2AAO A;  3I5I B;  1OSA A;  3I5G B;  3IQO A;  4ORA B;  5HKW A;  4MZJ A;  2BE4 A;  1VRK A;  4AOM A;  5D3O A;  3DXL A;  2NXQ A;  1FW4 A;  4M2Q A;  1IH0 A;  1A2X A;  2H8V A;  1SRA A;  4NDC A;  1KQM B;  1KK7 Z;  1PUL A;  2KHN A;  3O78 A;  4PDZ A;  1FF1 A;  1DF0 A;  2LVK A;  3R1O A;  1BLQ A;  2KFG A;  1CDP A;  2ZND A;  4AQJ A;  2L50 A;  1KK7 Y;  1Q80 A;  4QJ4 B;  3L4L A;  4ICB A;  5PAL A;  4MZK A;  1J1D A;  2H61 C;  1XYD A;  3L4A A;  1K90 D;  4A4C A;  3BQ3 A;  2QEV A;  3UNW A;  5JJG A;  1DGV A;  3OP0 A;  1TNX A;  2F2P A;  1CB1 A;  2G2B A;  1SBJ A;  3MSE B;  2F3Y A;  1LA3 A;  1LIN A;  1QLS A;  1S6I A;  1RTP 1;  3OX5 A;  1KK8 C;  4HRG A;  2QEO A;  2L4I A;  4BY5 A;  1EG4 A;  5HKZ A;  3EVR A;  2LE9 B;  1LXF C;  1M46 A;  2EGD A;  3CAB A;  1BR4 B;  4XYN A;  2KAY A;  1K93 D;  2E6W A;  2K7C A;  1G33 A;  4HRH A;  3AAK A;  3NSO A;  3KEV A;  1KSO A;  2WOR A;  2YGU A;  2PAL A;  2MA2 A;  3QRX A;  2K60 A;  4CID A;  3PAL A;  5D69 A;  1UUS A;  4JQ0 D;  2RGI A;  3SG4 A;  1QJT A;  1QWV A;  4GFT A;  3IQQ A;  1AJ5 A;  5HLO A;  1XO5 A;  1SR6 C;  2BCX A;  3BXK A;  1EH2 A;  1UHI A;  1X02 A;  2OTG C;  5F6T A;  2PRU A;  3S0B A;  4GPL B;  3VRP A;  2WCB A;  1BJF A;  1TRF A;  1KCY A;  1YTZ C;  5DIC A;  5GQQ C;  1TNQ A;  5K89 A;  1TCF A;  2JXL A;  3OBV A;  2KI4 C;  5KTY A;  2JT8 A;  1FPW A;  1KFX S;  1ODB A;  2I18 A;  4FTG A;  4GGF C;  5I2L A;  4DS7 A;  4ORB B;  3TUY C;  2A4J A;  2BNX A;  1OOF A;  4P2Y B;  4M2P A;  1J7R A;  1PRW A;  1IGV A;  1L7Z A;  4DRW A;  1B8R A;  2F3Z A;  1SYM A;  3BOW A;  1QTX A;  3GOF A;  2AUC A;  5JOL A;  2KAV A;  1H8B A;  1TNW A;  3CZ1 A;  1YVH A;  2LP3 A;  4OV2 A;  2KGB C;  4E68 A;  1DEK A;  2NCP A;  2H2K A;  4ZCU A;  1B8C A;  2WC5 A;  1DJZ A;  5I2O A;  3FE9 A;  4R1E A;  5AER A;  3K1E A;  2LUX A;  1LS8 A;  1SL7 A;  2ISD A;  5ER4 X;  2O5G A;  1ZAC A;  4QJ3 B;  4YGC B;  1A4P A;  1NCX A;  2MJW B;  4I5K A;  1NYA A;  3O4Y A;  2L5X B;  2LCP A;  2L2E A;  1Z4H A;  3CDN A;  2EC6 B;  4GAO A;  4IL1 A;  1ZUZ A;  3BFH A;  3S0E A;  1K95 A;  1SW8 A;  2CXJ A;  3FE6 A;  4F0Z B;  1Y1A A;  2WCL A;  4WRI A;  5TNC A;  2M29 A;  1B1G A;  2KYC A;  3F45 A;  1QAT A;  1F55 A;  1DVI A;  2LMV A;  2M3W A;  1UHK A;  2BCA A;  1XFU O;  3KF9 A;  2K7B A;  1YUT A;  2LC5 A;  1BMO A;  1B4C A;  1L2O C;  1EL4 A;  1SNL A;  3LK0 A;  5D7F A;  2KLD A;  2IS9 A;  3JVT C;  5HLV A;  2BKI B;  2L0P A;  2LHI A;  1JBA A;  1FI6 A;  1S5G Z;  1PSB A;  1W7I B;  3KHE A;  3OB2 B;  2JZI A;  1CMF A;  1SCV A;  5KSZ A;  4YGA A;  1F4O A;  5AEQ A;  2K7O A;  1S5G Y;  4UPG A;  4YGE B;  1RRO A;  1G4Y R;  1DJW A;  2WCJ A;  1XA5 A; 
#chains in the Genus database with same CATH homology
 1ALW A;  3PLF B;  4GBA A;  1SCM B;  2OS8 B;  1KWO C;  1PSR A;  4L9M A;  1CLB A;  4PHM A;  2K61 A;  2MHH A;  4GUK A;  2KFH A;  1KFU L;  3BUM B;  5CPV A;  1KSM A;  5CSJ A;  2HF5 A;  1MXE A;  2BL0 C;  2JT0 A;  2M7L A;  4OR9 B;  3DF0 B;  4OKH A;  1B47 A;  2JTZ A;  1CNP A;  1TOP A;  2I2R E;  1FI5 A;  1UHN A;  2KOT A;  4MVF A;  2P6B B;  1CFC A;  2L98 A;  3A8R A;  1NWD A;  2QPT A;  3VRQ A;  1OZS A;  3BUX B;  1JFK A;  3PFV A;  3FS7 A;  1KQV A;  1CFP A;  2KI6 C;  1JC2 A;  2ZN8 A;  5DKR A;  5KU1 A;  3TDZ A;  1JWD A;  1A75 B;  5DKQ A;  1QLK A;  4MN0 A;  1QX5 B;  1J55 A;  1KK8 B;  3CLN A;  1JUO A;  1A03 A;  4CPV A;  3O6B A;  2HET A;  1V1G A;  3TDI A;  1F54 A;  3CTN A;  3HCM A;  4NQG A;  2SAS A;  1NSH A;  1KFX L;  2Q4U A;  3SG6 A;  4YGD B;  3ZNI A;  2V53 A;  3KO0 A;  1OMV A;  1YX7 A;  1G8I A;  1MF8 B;  2HQW A;  2LUC A;  2LP2 A;  1NP8 A;  1NX0 A;  2CNP A;  2KBM A;  3PN7 B;  1M39 A;  3I5I C;  1N2D A;  4BY4 A;  4XJK A;  1SR6 B;  4PE1 A;  1IQ3 A;  2M9G A;  2SCP A;  2WCE A;  4YI9 A;  3LL8 B;  2OTG B;  1GGZ A;  2M7N A;  4MEW A;  1MR8 A;  3RLZ A;  3BUO B;  1RK9 A;  3OHM B;  2KI4 B;  3JTD C;  4D1E A;  1F70 A;  3EK7 A;  3PSR A;  1TN4 A;  2LLU A;  3TUY B;  3WHU B;  2LLS A;  4CFQ A;  1YX8 A;  2NLN A;  1WDC C;  1IJ5 A;  1ZFS A;  2I94 A;  2LMU A;  1JSA A;  2M1U A;  2FCE A;  3SG5 A;  3PAT A;  1BT6 A;  1SL9 A;  1N65 A;  1YUS A;  3SJS A;  3OX6 A;  3CR4 X;  1AUI B;  1YR5 A;  2KYF A;  3D0Y A;  2JPT A;  1QS7 A;  3I5F C;  2AMI A;  4TNC A;  1UP5 A;  4DIR A;  1J1E A;  1J7Q A;  4I5J A;  1DF0 B;  2K2A A;  1D1O A;  1ALV A;  2LMT A;  5ER5 A;  5G08 A;  4CLN A;  2KGR A;  3NSK A;  4YBH B;  1REC A;  3DD4 A;  1UHH A;  2BBM A;  1XFY O;  3DVJ A;  1BG1 A;  3SG3 A;  2L51 A;  1CLL A;  2KI6 D;  2BBN A;  1SPY A;  1IRJ A;  2COL B;  3BYA A;  1CDN A;  2PSR A;  1IQ5 A;  1OMR A;  2LM5 A;  1U5I B;  5CSI A;  1XFX O;  3I5H C;  2M97 A;  1RWY A;  3SG2 A;  1FBV A;  2D8N A;  5AXI A;  2M8U A;  5AFP A;  1J7P A;  2L4H A;  3LCP C;  2I7A A;  1L2O B;  2CBL A;  1GQM A;  2JNF A;  2CCM A;  3JVT B;  4N1F A;  3TDU A;  4AQI A;  2ZKM X;  1F4Q A;  1DGU A;  4PHJ A;  2M1K B;  1IWQ A;  3C1V A;  3NSL A;  1TIZ A;  1MWN A;  1LKJ A;  2TN4 A;  1OMD A;  1QIW A;  3EK8 A;  1DMO A;  1MHO A;  1QV1 A;  2HPS A;  4YI8 A;  1SK6 D;  1Y0V H;  1S3P A;  2ZNE A;  4DCK A;  5I8N A;  1KWO B;  2BCB A;  3WXA A;  2K0J A;  2LAP A;  1CM1 A;  3A4U B;  2K8M B;  3VGO A;  3ZWH A;  3WHT B;  2GGM A;  2BEC A;  5IBW A;  4N5X A;  2LNK A;  2LVJ A;  2MLE C;  2BL0 B;  1NPQ A;  1QXP A;  3CR2 A;  4PHN A;  1TTX A;  2ZN9 A;  3AKB A;  4QJ5 B;  2F8P A;  1NX1 A;  4N1G A;  1R6P A;  1V1F A;  3H4S E;  4NDD A;  5BPJ A;  1F71 A;  2WND A;  1JF0 A;  1PK0 D;  1WRK A;  1NX3 A;  3NSI A;  1EXR A;  4ORC B;  1BOD A;  1JF2 A;  1S6J A;  1C07 A;  2F33 A;  1HQV A;  4JPZ B;  2KFF A;  4MRX A;  1W7J B;  2PAS A;  1CFF A;  2BE6 A;  2ZFD A;  1M31 A;  2ZRT A;  2E30 A;  1K94 A;  1YVL A;  2NCO A;  2VRG A;  3NXA A;  1OOJ A;  4OVN F;  5AAN A;  1PVB A;  5J3X A;  3ICB A;  4JWQ A;  1OE9 B;  2JRF A;  4PE7 A;  1S1E A;  4CFR A;  2JUL A;  3CGA A;  1CTR A;  2JTT A;  1XFV O;  1JFJ A;  2OS8 C;  4GGN A;  1K9U A;  4WQ2 A;  4P5O E;  1CMG A;  2LHL A;  2MRD A;  3SIB A;  2GGZ A;  3O2P A;  1IJ6 A;  2JWW A;  1OZO A;  3KPX A;  2R2I A;  1B7T Z;  2JOJ A;  1ZMZ A;  4WQ3 A;  3TS5 C;  1AP4 A;  3EVV A;  4U8D A;  2MAZ A;  3RM1 A;  1UUR A;  1S26 D;  1XFW O;  4USL A;  1B7T Y;  2Y4Q A;  3DVM A;  3AKA A;  4I5L B;  1ZOT B;  4NDB A;  1NX2 A;  1OQP A;  4MRY A;  3JTD B;  3I5G C;  2ZRS A;  1WLZ A;  2FCD A;  1CDM A;  1DTL A;  1GJY A;  4MBE A;  1CLM A;  1WDC B;  2MLF C;  1YRT B;  3EKH A;  1K9K A;  3E3R A;  3GK1 A;  1A29 A;  1BR1 B;  1KQM C;  2K7D A;  2O60 A;  3EVU A;  4OCI A;  1U5I A;  3AAJ A;  2Y1M A;  1C7V A;  2K2F A;  1KFU S;  1AHR A;  1LA0 A;  2KAX A;  2FJU B;  5DKN A;  2Q91 A;  1DJX A;  3DVE A;  1EG3 A;  4Q04 A;  2WC8 A;  4PHK A;  3I5F B;  1DJI A;  2KSP A;  1CFD A;  1YRU B;  5HKY A;  2HQ8 A;  3OB1 B;  1PVA A;  2KQ6 A;  1TNP A;  3PN7 C;  3WNX B;  2B1U A;  3VRR A;  1YUU A;  2LAN A;  4I5N B;  2WOS A;  1DJY A;  1GGW A;  1XK4 A;  4C0L A;  5B8I B;  5CSF A;  1AK8 A;  1MUX A;  1M63 B;  1SMG A;  2PMY A;  2Y1N A;  4MLW A;  1QIV A;  2KBI A;  1XVJ A;  1Y6W A;  3I5H B;  1LVC D;  1RFJ A;  2JU0 A;  2M49 B;  2LVI A;  1NCY A;  1C7W A;  3SIA A;  1S36 A;  1CKK A;  3K21 A;  2JT3 A;  1K8U A;  3FIA A;  4GNK B;  1TCO B;  1QVI Z;  1BF5 A;  1UHJ A;  2LV7 A;  1BOC A;  2BKH B;  4PE4 A;  1QVI Y;  3CWG A;  3FWC A;  4HSZ A;  1M45 A;  1K2H A;  2KQY A;  1WLM A;  3HX4 A;  5I2Q A;  5FYX A;  4XJK B;  2FOT A;  2JNX A;  3DF0 A;  1RJV A;  1J7O A;  1DT7 B;  2Y5I A;  4C0K A;  3VRO A;  3LLE A;  1R2U A;  2JXC A;  2JQ6 A;  3VRN A;  4C0J A;  2H61 A;  5HYD A;  1SL8 A;  4HRE E;  1HT9 A;  1SKT A;  1Y1U A;  1BU3 A;  1EJ3 A;  4YRU A;  1NCZ A;  2OPO A;  1B9A A;  1NUB A;  2EHB A;  2LLT A;  1S6C A;  3GK4 X;  3M0W A;  2MBX A;  3EKJ A;  1A75 A;  1B8L A;  1N0Y A;  4MZL A;  2DOQ A;  5CSN A;  1DJH A;  1K9P A;  1QAS A;  1AVS A;  1F8H A;  1CDL A;  2KDH A;  2M0R A;  2WCF A;  1AJ4 A;  3IF7 A;  1Y1X A;  1CM4 A;  4YGB B;  2EC6 C;  3EK4 A;  3TZ1 A;  3D0Y B;  1E8A A;  4ZCV A;  2JC2 A;  3BOW B;  3CZT X;  2KNE A;  2GV5 A;  1NIW A;  1WRZ A;  2LVV A;  2PVB A;  1IG5 A;  3GK2 A;  2F2O A;  3DVK A;  3CS1 A;  3LK1 A;  4ETO A;  4PE0 A;  2CTN A;  1H4B A;  1K96 A;  1WY9 A;  1MXL C;  1XK4 C;  2CT9 A;  3D10 A;  3FWB A;  2QAC A;  4MSP A;  1DJG A;  3PM8 A;  4PCW A;  1XFZ O;  1QV0 A;  4A4B A;  4FQO A;  4GGF A;  3CR5 X;  2G9B A;  1PAL A;  1WRL A;  3TS5 B;  1SY9 A;  2NZ0 A;  1QX2 A;  1YUR A;  1SCM C;  1UWO A;  4PAL A;  4DUQ A;  1MQ1 A;  1QX7 A;  3BUW B;  3SG7 A;  1IKU A;  4M2O A;  3BUN B;  2AAO A;  3I5I B;  1OSA A;  3I5G B;  3IQO A;  4ORA B;  5HKW A;  4MZJ A;  2BE4 A;  1VRK A;  4AOM A;  2NXQ A;  1FW4 A;  4M2Q A;  1IH0 A;  1A2X A;  1SRA A;  4NDC A;  1KQM B;  1KK7 Z;  1PUL A;  2KHN A;  3O78 A;  4PDZ A;  1FF1 A;  1DF0 A;  2LVK A;  1BLQ A;  2KFG A;  1CDP A;  2ZND A;  4AQJ A;  2L50 A;  1KK7 Y;  1Q80 A;  4QJ4 B;  4ICB A;  5PAL A;  4MZK A;  1J1D A;  2H61 C;  1XYD A;  1K90 D;  3BQ3 A;  5JJG A;  1DGV A;  3OP0 A;  1TNX A;  2F2P A;  1CB1 A;  2G2B A;  1SBJ A;  3MSE B;  2F3Y A;  1LA3 A;  1LIN A;  1QLS A;  1S6I A;  1RTP 1;  3OX5 A;  1KK8 C;  4HRG A;  4BY5 A;  2L4I A;  1EG4 A;  5HKZ A;  3EVR A;  2LE9 B;  1LXF C;  1M46 A;  2EGD A;  1BR4 B;  4XYN A;  2KAY A;  1K93 D;  2E6W A;  2K7C A;  1G33 A;  4HRH A;  3AAK A;  3NSO A;  3KEV A;  1KSO A;  2WOR A;  2PAL A;  2MA2 A;  3QRX A;  4CID A;  3PAL A;  5D69 A;  1UUS A;  4JQ0 D;  2RGI A;  3SG4 A;  1QJT A;  4GFT A;  3IQQ A;  1AJ5 A;  5HLO A;  1XO5 A;  1SR6 C;  2BCX A;  3BXK A;  1EH2 A;  1UHI A;  1X02 A;  2OTG C;  5F6T A;  2PRU A;  4GPL B;  3VRP A;  2WCB A;  1BJF A;  1TRF A;  1KCY A;  1YTZ C;  5GQQ C;  1TNQ A;  5K89 A;  1TCF A;  2JXL A;  2KI4 C;  5KTY A;  2JT8 A;  1FPW A;  1KFX S;  1ODB A;  2I18 A;  4FTG A;  4GGF C;  5I2L A;  4DS7 A;  4ORB B;  3TUY C;  2A4J A;  4P2Y B;  4M2P A;  1J7R A;  1PRW A;  1IGV A;  1L7Z A;  4DRW A;  1B8R A;  2F3Z A;  1SYM A;  3BOW A;  1QTX A;  3GOF A;  2AUC A;  5JOL A;  2KAV A;  1H8B A;  1TNW A;  1YVH A;  2LP3 A;  4OV2 A;  2KGB C;  4E68 A;  2NCP A;  2H2K A;  4ZCU A;  1B8C A;  1DJZ A;  5I2O A;  5AER A;  4R1E A;  2LUX A;  1SL7 A;  2ISD A;  5ER4 X;  2O5G A;  1ZAC A;  4QJ3 B;  4YGC B;  1A4P A;  1NCX A;  2MJW B;  4I5K A;  1NYA A;  3O4Y A;  2L5X B;  2LCP A;  2L2E A;  2EC6 B;  4GAO A;  4IL1 A;  1ZUZ A;  1K95 A;  1SW8 A;  2CXJ A;  4F0Z B;  1Y1A A;  4WRI A;  5TNC A;  2M29 A;  1B1G A;  2KYC A;  3F45 A;  1QAT A;  1F55 A;  1DVI A;  2LMV A;  2M3W A;  1UHK A;  2BCA A;  1XFU O;  3KF9 A;  2K7B A;  1YUT A;  2LC5 A;  1BMO A;  1B4C A;  1L2O C;  1EL4 A;  1SNL A;  3LK0 A;  5D7F A;  2IS9 A;  3JVT C;  5HLV A;  2BKI B;  2L0P A;  2LHI A;  1JBA A;  1FI6 A;  1S5G Z;  1PSB A;  1W7I B;  3KHE A;  3OB2 B;  2JZI A;  1CMF A;  1SCV A;  5KSZ A;  4YGA A;  1F4O A;  5AEQ A;  2K7O A;  1S5G Y;  4UPG A;  4YGE B;  1RRO A;  1G4Y R;  1DJW A;  4A4C A;  1XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...