4AQJA

Structure of human s100a7 d24g bound to zinc and calcium
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
b'SNTQAERSIIGMIDMFHKYTRRDGKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A7
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqjA00
1HQVA 1AUIB 1ZUZA 1VRKA 2LANA 4OCIA 3SG7A 1AK8A 1OMRA 4C0KA 3SG2A 3BOWB 4WQ2A 4N1GA 2SCPA 1DTLA 2KI6D 4CIDA 1K93D 2M7LA 4N5XA 1U5IA 1NCZA 1SR6B 1LKJA 1NCXA 2F8PA 2JNXA 2BBMA 2MRDA 2OS8C 4PHMA 1QASA 5B8IB 2KGBC 2MLFC 2D8NA 1DJWA 1S5GZ 2P6BB 1PVAA 2BL0B 2LLTA 2LVIA 3WNXB 2FOTA 2JOJA 4U8DA 1RK9A 3AKAA 1NX3A 2I94A 1WRZA 1LA3A 2HQWA 4QJ5B 2JT3A 3SG5A 1KFUL 2L2EA 1BODA 2E6WA 2KNEA 3O4YA 2JT0A 1F55A 1KSMA 2LUXA 1JFKA 2FJUB 5HKWA 5HKYA 4YGCB 1FW4A 2JWWA 2LVKA 1AVSA 1RTP1 3FWCA 1NX1A 1MXLC 2F33A 3MSEB 1LA0A 1DJHA 5D69A 1QXPA 1U5IB 4WRIA 4USLA 1A75B 1XFWO 1ODBA 1DJXA 1OSAA 2PSRA 4L9MA 4F0ZB 5JJGA 1IJ5A 2SASA 1CFCA 1S5GY 1DJZA 1KWOB 2ZNDA 3EK7A 3OP0A 1IJ6A 1F54A 1SMGA 1QJTA 4UPGA 4GFTA 2DOQA 1CDLA 1PALA 1TCOB 4R1EA 1TTXA 1KFUS 4OV2A 1IH0A 5CPVA 3OX6A 3A4UB 2K0JA 1QLKA 2HF5A 2AMIA 4PE1A 1H4BA 2LAPA 2R2IA 1Q80A 1IRJA 3F45A 1QVIY 1S6IA 3OHMB 1GJYA 1NIWA 2A4JA 1YX7A 4I5JA 4PCWA 3GK1A 1ZFSA 4DS7A 1XK4A 1XA5A 1UHNA 1OQPA 2ZKMX 1F71A 1KQMB 1YUTA 1C7VA 5BPJA 1FPWA 1J55A 2V53A 1SL8A 1G33A 4ETOA 1AHRA 4HREE 1XYDA 1AJ5A 1IWQA 1TOPA 1CDMA 2MLEC 3CLNA 3HCMA 1V1GA 2BCBA 2BKIB 3O6BA 1Y1AA 1UUSA 2RGIA 1CLMA 3NSLA 1QIWA 1UURA 1WY9A 1DJIA 2LUCA 2LCPA 2L4IA 3KPXA 1TNPA 1N2DA 4MZLA 2LMUA 2KAXA 2PALA 4JQ0D 3M0WA 3WXAA 1NYAA 4C0LA 1OZOA 2BE4A 3QRXA 1XFVO 3OB1B 4ORAB 1YRTB 1LXFC 1KQVA 1L7ZA 1J7PA 1QIVA 3FS7A 4M2PA 1QS7A 2K2FA 2KSPA 3I5IC 1IGVA 2OTGC 1XFXO 1JUOA 2JPTA 3TDZA 2JXCA 3I5IB 1SKTA 1BR4B 2OTGB 5D7FA 4DCKA 3DD4A 1R6PA 1AJ4A 2KAYA 3DF0B 2EHBA 1TNXA 1QV0A 2K7CA 2OPOA 2BE6A 1K9UA 1QX5B 3PLFB 4ZCVA 2CCMA 4ORBB 4MN0A 2WNDA 1BT6A 2WCBA 3RLZA 2M8UA 1YR5A 2JC2A 2H61A 4MVFA 5ER5A 1B4CA 1W7IB 1ALWA 1ZOTB 1C07A 1E8AA 1QX7A 1SR6C 2CNPA 2BCAA 2QACA 4MEWA 1SYMA 2H2KA 2KBMA 2B1UA 2LV7A 2LVJA 1PSBA 2CTNA 3AAJA 1S6CA 1G8IA 2BL0C 1WRLA 1B47A 2Q4UA 1DT7B 3AAKA 4NDDA 3NSOA 2NLNA 3BQ3A 4DIRA 1JF0A 4PDZA 5HYDA 1S36A 4WQ3A 1CFFA 3EVVA 5F6TA 2CBLA 1KK7Z 1K94A 2O5GA 1XFYO 2MBXA 3FIAA 2L51A 2LHIA 2M9GA 3BUWB 3E3RA 2M7NA 1K9KA 1XO5A 1F4QA 2ZN8A 1QVIZ 4CFQA 1B8RA 2EC6B 2K7DA 2KBIA 3CZTX 1PULA 4M2QA 3WHUB 2LLUA 1X02A 4I5KA 1YTZC 5TNCA 3PSRA 5FYXA 4I5NB 1SCVA 2BKHB 3GK4X 1KWOC 3TDIA 5HLVA 3A8RA 1PK0D 1LINA 3SIAA 1CMGA 3ZWHA 1CLLA 4MBEA 2M0RA 2KYCA 2BBNA 1KCYA 2HPSA 3PFVA 3VRNA 2L4HA 4PHKA 1UP5A 1ALVA 1MXEA 1N0YA 4ICBA 1S3PA 5DKQA 1J7QA 1FI6A 1KK7Y 4OR9B 1CFDA 3GOFA 1ZMZA 4HSZA 4MLWA 1WDCC 4D1EA 2TN4A 1S1EA 2HQ8A 3WHTB 2KFHA 1B8LA 1CB1A 2KGRA 1WDCB 5HLOA 1YVLA 1NCYA 1A2XA 1MUXA 1XFUO 1SY9A 1QV1A 1KQMC 1B7TY 1MHOA 2JTZA 3JVTB 1OMVA 2CT9A 4E68A 5HKZA 1JFJA 2MHHA 1YVHA 3NXAA 3CR5X 5GQQC 2NCOA 1R2UA 3LL8B 1M31A 2CXJA 1BR1B 1W7JB 4XJKA 1HT9A 3DVEA 2KI6C 2K8MB 4P5OE 2AUCA 1UHKA 5KSZA 2NXQA 1DGVA 1WLZA 1F70A 1YRUB 4YGDB 1CNPA 2LP3A 3CR2A 1NSHA 1NUBA 1WLMA 2M3WA 2LNKA 2WORA 1A03A 2WCFA 5KTYA 1NX0A 1TIZA 3GK2A 1QATA 3BUXB 1Y1UA 2ZRSA 3D0YA 2Y1NA 3TS5B 2VRGA 1TRFA 4IL1A 1XK4C 1RROA 1RFJA 4ZCUA 1XFZO 1L2OB 2JNFA 2LHLA 1K90D 2LE9B 3AKBA 3BUOB 2I7AA 4HRHA 1JF2A 1MWNA 1DMOA 3O2PA 4A4CA 5AERA 1DJGA 1M46A 3OB2B 1NP8A 1UWOA 2KFFA 4FQOA 4PHNA 4QJ4B 4YGEB 4GAOA 5K89A 3PALA 4OVNF 2KQYA 3D10A 2LC5A 3CGAA 4PE4A 4AOMA 1CM1A 4XJKB 4GGFA 1EG3A 1DF0A 3EVUA 2KOTA 3KEVA 4GPLB 1BLQA 2IS9A 1MR8A 2K7OA 3BOWA 4C0JA 2MAZA 2KI4C 1D1OA 1TNQA 1M45A 3PM8A 1S6JA 1BG1A 2KFGA 2KI4B 2QPTA 1RECA 1Y0VH 1BJFA 1PRWA 1BU3A 2GGMA 2K61A 1EJ3A 3D0YB 1FI5A 4JPZB 2LVVA 1UHHA 4MZJA 2JQ6A 5CSIA 1BF5A 4YI8A 2FCEA 2JT8A 4BY4A 1FBVA 3VRRA 5I2QA 1KK8B 1MQ1A 5ER4X 2JTTA 3IF7A 4CFRA 3LK1A 1SK6D 2PASA 2NZ0A 2Y1MA 4PE0A 5I2LA 3CWGA 1DF0B 3I5HC 3OX5A 1OMDA 4MSPA 4BY5A 2LMTA 2M1UA 1JC2A 3KF9A 4CLNA 4DRWA 1YX8A 5I8NA 1RWYA 1YUUA 1SL9A 1SRAA 2F3ZA 3I5HB 5JOLA 5AEQA 4MRYA 3SG3A 3ZNIA 3VRQA 2H61C 1DVIA 2KDHA 1RJVA 1KFXS 5CSFA 1EH2A 2JU0A 1A75A 2EC6C 2WC8A 2AAOA 4CPVA 3I5GC 4P2YB 2WCEA 2GGZA 4MRXA 4M2OA 5AANA 4GUKA 3I5GB 2EGDA 4YGAA 3PATA 2G2BA 1B7TZ 1NX2A 5J3XA 2OS8B 3BYAA 2GV5A 1YUSA 2I2RE 2KAVA 4PHJA 1Y1XA 4GNKB 1FF1A 1QTXA 1CDPA 2MA2A 1TNWA 3ICBA 1KSOA 1UHJA 2ZRTA 1TN4A 1EG4A 1GGZA 1M63B 2BCXA 2E30A 3LK0A 4YGBB 4JWQA 3TZ1A 4YRUA 5IBWA 4NDBA 5CSJA 2HETA 4PALA 3VROA 1B8CA 3PN7C 1CLBA 2JRFA 4GGNA 3NSIA 4ORCB 1JSAA 3NSKA 3VRPA 3PN7B 1AP4A 3CR4X 3IQOA 4MZKA 5AFPA 1B1GA 1PVBA 2M29A 2PMYA 4NQGA 2FCDA 4HRGA 1SCMC 2Y4QA 4YBHB 4I5LB 3IQQA 2F2PA 1SW8A 1SPYA 2JULA 2K7BA 1SCMB 3JVTC 1J7RA 1IG5A 1NPQA 1EXRA 2Q91A 1NWDA 4PE7A 2I18A 3TUYC 4DUQA 2F2OA 2PVBA 1DGUA 3SIBA 3TUYB 1K95A 2M97A 1PSRA 2F3YA 3SG6A 3SG4A 1A29A 1G4YR 2L5XB 1GQMA 4YI9A 4A4BA 1BOCA 3EK4A 2ZFDA 1S26D 4QJ3B 4AQJA 3BUNB 4N1FA 2BECA 5DKNA 3KHEA 2G9BA 1CMFA 1UHIA 2LMVA 3FWBA 1MF8B 2M1KB 1YURA 1J7OA 5DKRA 5G08A 1A4PA 2JXLA 4AQIA 3TS5C 1H8BA 1XVJA 1IQ3A 2COLB 1K2HA 3DVMA 1QLSA 1CKKA 2MJWB 3EKJA 1L2OC 2O60A 1EL4A 4NDCA 2LM5A 4OKHA 2L98A 1K8UA 2LP2A 3DVKA 1N65A 1OOJA 1IKUA 1CTRA 1GGWA 4Q04A 3BXKA 1CM4A 3EK8A 5AXIA 1C7WA 1ZACA 2NCPA 3DF0A 1CDNA 1SBJA 1SNLA 4TNCA 5CSNA 4XYNA 3I5FC 1CFPA 3SJSA 4FTGA 3CS1A 2M49B 2ZN9A 1OE9B 1Y6WA 2KHNA 3HX4A 3I5FB 3EVRA 2K2AA 3EKHA 5I2OA 3VGOA 2KYFA 3LLEA 3BUMB 1JWDA 1LVCD 1QX2A 3RM1A 1J1DA 5KU1A 1BMOA 2L0PA 1OZSA 1IQ5A 3O78A 1WRKA 1SL7A 1K96A 1V1FA 1KFXL 2PRUA 3LCPC 1K9PA 1F8HA 1B9AA 3JTDC 1M39A 2L50A 2LLSA 1KK8C 3TDUA 2ZNEA 3JTDB 5PALA 3C1VA 3CTNA 1TCFA 1JBAA 1F4OA 2ISDA 3DVJA 3H4SE 1J1EA 2Y5IA 2WOSA 3K21A 4GGFC 3KO0A 2KQ6A 4GBAA 2JZIA 1DJYA
chains in the Genus database with same CATH superfamily
1HQVA 4PT1A 1AUIB 1ZUZA 1VRKA 2LANA 4OCIA 3SG7A 1AK8A 1OMRA 4C0KA 3SG2A 3BOWB 4WQ2A 4N1GA 2SCPA 1DTLA 2KI6D 4CIDA 1K93D 2M7LA 4N5XA 1U5IA 1NCZA 1SR6B 1LKJA 3B88A 1NCXA 2F8PA 2JNXA 1DQEA 2BBMA 3BFAA 2MRDA 2OS8C 3D74A 4PHMA 1QASA 5B8IB 2KGBC 2MLFC 2D8NA 1DJWA 1S5GZ 2P6BB 1QWVA 1PVAA 5FI6A 2BL0B 2LLTA 2LVIA 3WNXB 2FOTA 2JOJA 2P70A 4U8DA 1C3YA 2ERBA 1RK9A 3AKAA 1NX3A 2KLEA 2I94A 1WRZA 2QEVA 1LA3A 2HQWA 4QJ5B 2JT3A 2L2CA 3SG5A 1KFUL 2L2EA 3S0FA 1BODA 2E6WA 2KNEA 3O4YA 2JT0A 1F55A 1KSMA 2LUXA 1JFKA 2FJUB 3DXLA 5HKWA 5HKYA 4YGCB 1FW4A 2JWWA 2LVKA 1AVSA 1RTP1 3FWCA 1NX1A 1MXLC 2F33A 3MSEB 1LA0A 1DJHA 5D69A 1QXPA 1U5IB 4WRIA 4USLA 1A75B 1XFWO 1ODBA 1DJXA 1OSAA 2PSRA 2GTEA 4L9MA 4F0ZB 5JJGA 1OOFA 1IJ5A 2SASA 1CFCA 1C3ZA 1S5GY 3D73A 1DJZA 3B7AA 1KWOB 2ZNDA 3EK7A 3OP0A 1IJ6A 1F54A 1SMGA 1QJTA 4UPGA 4GFTA 2DOQA 1CDLA 1PALA 1TCOB 4R1EA 1TTXA 1KFUS 4OV2A 1IH0A 5CPVA 3OX6A 3A4UB 2K0JA 1QLKA 2HF5A 2AMIA 4PE1A 1H4BA 2LAPA 2R2IA 1Q80A 1IRJA 3F45A 1QVIY 1S6IA 3OHMB 1GJYA 3VB1A 1NIWA 2A4JA 1YX7A 4I5JA 4PCWA 3GK1A 4INWA 1ZFSA 4DS7A 1XK4A 1XA5A 1UHNA 1OQPA 2ZKMX 1F71A 1KQMB 1YUTA 1C7VA 5BPJA 1FPWA 1J55A 2V53A 2WCLA 1SL8A 1G33A 4ETOA 1AHRA 4HREE 1XYDA 1AJ5A 1IWQA 1TOPA 1CDMA 2MLEC 3CLNA 3HCMA 3S0AA 1V1GA 2BCBA 2BAPA 2BKIB 3O6BA 1Y1AA 3CZ2A 2QEHA 3UO9A 1UUSA 2PYQA 1P28A 1CLMA 2RGIA 3NSLA 1QIWA 1UURA 1WY9A 1DJIA 2LUCA 2LCPA 1TUZA 2L4IA 3KPXA 1TNPA 1N2DA 4MZLA 2LMUA 2KAXA 2PALA 4JQ0D 3M0WA 3WXAA 2WCKA 1NYAA 4C0LA 4FQTA 1OZOA 3D75A 2BE4A 3QRXA 1XFVO 3OB1B 4ORAB 1YRTB 1LXFC 1KQVA 1L7ZA 2KPHA 1J7PA 1QIVA 3FS7A 4M2PA 3R1PA 3PJIA 1QS7A 2K2FA 2KSPA 3FE8A 3I5IC 1IGVA 3R1OA 3EG5B 2OTGC 1XFXO 1JUOA 2JPTA 3TDZA 2K60A 2JXCA 3I5IB 1SKTA 1BR4B 2OTGB 3S0EA 5D7FA 4DCKA 3RZSA 3DD4A 3SS3A 1R6PA 1AJ4A 2KAYA 3DF0B 2EHBA 3V2LA 1TNXA 1QV0A 2K7CA 2OPOA 2BE6A 1K9UA 1QX5B 1SSEB 3PLFB 4ZCVA 1OOGA 2CCMA 4ORBB 4MN0A 2WNDA 1BT6A 2WCBA 3RLZA 2M8UA 3B6XA 1YR5A 2JC2A 2H61A 4MVFA 3NHIA 5ER5A 1W7IB 1B4CA 1ALWA 3BFHA 1ZOTB 1C07A 1OOHA 1E8AA 1QX7A 1SR6C 2CNPA 2BCAA 3D77A 2QACA 4MEWA 1SYMA 4INXA 2H2KA 2KBMA 2B1UA 2KLDA 2LV7A 2LVJA 1PSBA 2CTNA 3AAJA 1S6CA 2WCHA 1G8IA 2BL0C 1WRLA 1B47A 3QMEA 2Q4UA 1DT7B 3AAKA 4NDDA 3NSOA 2NLNA 3BQ3A 4DIRA 3IVTA 1JF0A 4PDZA 5HYDA 1S36A 4WQ3A 1CFFA 3EVVA 5F6TA 2CBLA 1KK7Z 1K94A 2WCMA 2O5GA 1XFYO 5FI2A 3FIAA 2MBXA 2L51A 2LHIA 2M9GA 1OOIX 3BUWB 3E3RA 5DICA 2M7NA 1T14A 1K9KA 1XO5A 1F4QA 2ZN8A 1QVIZ 4CFQA 1B8RA 2EC6B 2K7DA 2KBIA 2P71A 3CZTX 1PULA 4M2QA 3WHUB 2LLUA 3CYZA 1X02A 4I5KA 1YTZC 2L5YA 5TNCA 1ORGA 3PSRA 5FYXA 3DYEA 1SCVA 2BKHB 3GK4X 4I5NB 1KWOC 3TDIA 5HLVA 3A8RA 1PK0D 1LINA 3SIAA 1CMGA 3ZWHA 1CLLA 4MBEA 2M0RA 1OW4A 2BBNA 2KYCA 3N7HA 1KCYA 2HPSA 3PFVA 3VRNA 2L4HA 4PHKA 1UP5A 2PQLA 1ALVA 1MXEA 1N0YA 4ICBA 1S3PA 5DKQA 1J7QA 4IJ7A 1FI6A 1KK7Y 4OR9B 1CFDA 3GOFA 1ZMZA 2FJYA 3R1VA 4HSZA 4MLWA 1WDCC 4D1EA 3B86A 2TN4A 1S1EA 2HQ8A 3WHTB 2KFHA 1B8LA 1CB1A 2KGRA 1WDCB 2WC5A 5HLOA 1YVLA 3DY9A 1NCYA 1A2XA 1MUXA 1XFUO 1SY9A 1QV1A 1KQMC 1B7TY 1MHOA 2JTZA 1IIOA 3JVTB 1OMVA 2CT9A 4E68A 5HKZA 1JFJA 2MHHA 1YVHA 3NXAA 3CR5X 5GQQC 2NCOA 1R2UA 3LL8B 1M31A 2CXJA 1BR1B 1W7JB 4XJKA 1HT9A 3DVEA 2KI6C 2K8MB 3FE9A 4P5OE 2AUCA 1UHKA 1DELA 5KSZA 2QEBA 2NXQA 1DGVA 1WLZA 1F70A 1YRUB 4YGDB 1CNPA 2LP3A 3CR2A 1NSHA 1NUBA 1WLMA 2M3WA 2LNKA 2WORA 3S0DA 1A03A 2WCFA 5KTYA 1NX0A 1TIZA 3CABA 1XFRA 3GK2A 1QATA 3S0BA 3BUXB 1Y1UA 2ZRSA 5HL1A 3D0YA 2Y1NA 3TS5B 3UNWA 2VRGA 1TRFA 4IL1A 1XK4C 1RROA 1RFJA 4ZCUA 1XFZO 1L2OB 2JNFA 2LHLA 1K90D 2LE9B 3AKBA 3BUOB 2I7AA 3K1EA 4HRHA 1JF2A 1MWNA 1DMOA 3O2PA 4A4CA 5AERA 1DJGA 1M46A 3OB2B 4KYNA 1NP8A 1UWOA 1Z4HA 2KFFA 4FQOA 4PHNA 4YGEB 3SS4A 4GAOA 4QJ4B 5K89A 3PALA 4OVNF 2KQYA 3D10A 1TWOA 2LC5A 3CGAA 4PE4A 2QEOA 4AOMA 1CM1A 4XJKB 4GGFA 1EG3A 1DF0A 3EVUA 2KOTA 3KEVA 4GPLB 1BLQA 1DC1A 2IS9A 1MR8A 2K7OA 3BOWA 4C0JA 3BJHA 2MAZA 2KI4C 1D1OA 1TNQA 1M45A 3PM8A 1S6JA 1BG1A 2KFGA 2KI4B 2QPTA 1RECA 1Y0VH 1BJFA 1PRWA 1BU3A 2GGMA 2K61A 1EJ3A 3D0YB 3S0GA 1FI5A 3BFBA 4JPZB 2LVVA 2WC6A 1UHHA 4MZJA 2JQ6A 3D76A 5CSIA 1BF5A 4YI8A 2FCEA 2JT8A 4BY4A 1FBVA 3L4AA 3VRRA 5I2QA 1KK8B 1MQ1A 4JD9A 2JTTA 3IF7A 5ER4X 4CFRA 3LK1A 1SK6D 2PASA 2H8VA 2NZ0A 2Y1MA 4PE0A 5I2LA 3CWGA 1DF0B 3I5HC 3O4XA 1OMDA 3OX5A 4MSPA 4BY5A 2LMTA 2M1UA 1JC2A 3KF9A 2WCJA 4CLNA 4DRWA 1YX8A 5I8NA 1RWYA 1YUUA 1SL9A 1SRAA 2F3ZA 3I5HB 3Q8IA 5JOLA 4MRYA 5AEQA 3SG3A 3ZNIA 1W9ZA 3VRQA 3CDNA 2H61C 1DVIA 2KDHA 3D78A 1RJVA 1KFXS 5CSFA 5D3OA 1EH2A 2JU0A 1A75A 2EC6C 2WC8A 2AAOA 4CPVA 3I5GC 4P2YB 5I94A 2WCEA 1GM0A 2GGZA 4MRXA 4M2OA 5AANA 4GUKA 3I5GB 2EGDA 4YGAA 3PATA 3PM2A 2G2BA 1B7TZ 1NX2A 5FI7A 5J3XA 2OS8B 3BYAA 2GV5A 1YUSA 2I2RE 3CZ0A 2KAVA 3B87A 4PHJA 1Y1XA 4GNKB 1FF1A 1QTXA 1CDPA 2MA2A 1TNWA 3ICBA 3L47A 1KSOA 1UHJA 2ZRTA 1TN4A 1EG4A 1GGZA 1LS8A 1M63B 2BCXA 2E30A 3LK0A 4YGBB 4JWQA 1DEKA 3TZ1A 4YRUA 5IBWA 4NDBA 5CSJA 2HETA 4PALA 3VROA 1B8CA 3PN7C 1CLBA 2JRFA 4GGNA 3NSIA 4ORCB 1JSAA 3NSKA 3VRPA 3PN7B 1AP4A 3CR4X 3IQOA 4MZKA 5AFPA 1B1GA 1PVBA 2M29A 2PMYA 4NQGA 2FCDA 4HRGA 1SCMC 2Y4QA 4YBHB 4I5LB 3IQQA 2F2PA 1SW8A 1SPYA 2JULA 2K7BA 1SCMB 3JVTC 3NHTA 1J7RA 1IG5A 1NPQA 1EXRA 2Q91A 1NWDA 4PE7A 2JPOA 2I18A 3TUYC 4DUQA 2F2OA 2PVBA 1DGUA 3SIBA 3TUYB 1K95A 3NGVA 2M97A 1PSRA 2F3YA 3SG6A 3SS5A 3SG4A 1A29A 1G4YR 2L5XB 1GQMA 2YGUA 4YI9A 4A4BA 1BOCA 3EK4A 2ZFDA 1S26D 4QJ3B 4AQJA 3BUNB 4N1FA 2BECA 3CZ1A 5DKNA 3KHEA 2G9BA 1CMFA 1UHIA 2LMVA 3FWBA 1MF8B 2M1KB 3L4LA 1YURA 1J7OA 5DKRA 5G08A 1A4PA 2JXLA 4AQIA 3TS5C 1H8BA 1XVJA 1IQ3A 2COLB 1K2HA 3DVMA 1QLSA 1CKKA 2MJWB 3FE6A 3EKJA 1L2OC 2O60A 1EL4A 4NDCA 2LM5A 4OKHA 2L98A 1K8UA 2LP2A 3DVKA 1N65A 1OOJA 1IKUA 1CTRA 1GGWA 4OZDA 4Q04A 3BXKA 1CM4A 3EK8A 5AXIA 1C7WA 2QDIA 1ZACA 2NCPA 3DF0A 1CDNA 1SBJA 1SNLA 1Z2CB 4TNCA 5CSNA 4XYNA 3I5FC 1CFPA 4F7FA 3SJSA 4FTGA 3CS1A 2M49B 2ZN9A 1OE9B 1Y6WA 2KHNA 3HX4A 3I5FB 3EVRA 2K2AA 3EKHA 5I2OA 3VGOA 2KYFA 3LLEA 3BUMB 1JWDA 1LVCD 1QX2A 3RM1A 1J1DA 5KU1A 1BMOA 1TUJA 2L0PA 1OZSA 1IQ5A 3O78A 3R72A 1WRKA 1SL7A 1K96A 2BNXA 1V1FA 3OBVA 1KFXL 2PRUA 3LCPC 3OGNA 1K9PA 1F8HA 1B9AA 3JTDC 1M39A 2L50A 2LLSA 1KK8C 3TDUA 2ZNEA 3JTDB 5PALA 3C1VA 3CTNA 1TCFA 1JBAA 1F4OA 5EL2A 3DVJA 3H4SE 1J1EA 2Y5IA 4JKTA 2WOSA 3K21A 2ISDA 4GGFC 3KO0A 2KQ6A 4GBAA 2JZIA 1DJYA 3DZTA
chains in the Genus database with same CATH topology
1HQVA 1AUIB 1ZUZA 1VRKA 2LANA 4OCIA 3SG7A 1AK8A 1OMRA 4C0KA 3SG2A 3BOWB 4WQ2A 4N1GA 2SCPA 1DTLA 2KI6D 4CIDA 1K93D 2M7LA 4N5XA 1U5IA 1NCZA 1SR6B 1LKJA 1NCXA 2F8PA 2JNXA 2BBMA 2MRDA 2OS8C 4PHMA 1QASA 5B8IB 2KGBC 2MLFC 2D8NA 1DJWA 1S5GZ 2P6BB 1PVAA 2BL0B 2LLTA 2LVIA 3WNXB 2FOTA 2JOJA 4U8DA 1RK9A 3AKAA 1NX3A 2I94A 1WRZA 1LA3A 2HQWA 4QJ5B 2JT3A 3SG5A 1KFUL 2L2EA 1BODA 2E6WA 2KNEA 3O4YA 2JT0A 1F55A 1KSMA 2LUXA 1JFKA 2FJUB 5HKWA 5HKYA 4YGCB 1FW4A 2JWWA 2LVKA 1AVSA 1RTP1 3FWCA 1NX1A 1MXLC 2F33A 3MSEB 1LA0A 1DJHA 5D69A 1QXPA 1U5IB 4WRIA 4USLA 1A75B 1XFWO 1ODBA 1DJXA 1OSAA 2PSRA 4L9MA 4F0ZB 5JJGA 1IJ5A 2SASA 1CFCA 1S5GY 1DJZA 1KWOB 2ZNDA 3EK7A 3OP0A 1IJ6A 1F54A 1SMGA 1QJTA 4UPGA 4GFTA 2DOQA 1CDLA 1PALA 1TCOB 4R1EA 1TTXA 1KFUS 4OV2A 1IH0A 5CPVA 3OX6A 3A4UB 2K0JA 1QLKA 2HF5A 2AMIA 4PE1A 1H4BA 2LAPA 2R2IA 1Q80A 1IRJA 3F45A 1QVIY 1S6IA 3OHMB 1GJYA 1NIWA 2A4JA 1YX7A 4I5JA 4PCWA 3GK1A 1ZFSA 4DS7A 1XK4A 1XA5A 1UHNA 1OQPA 2ZKMX 1F71A 1KQMB 1YUTA 1C7VA 5BPJA 1FPWA 1J55A 2V53A 1SL8A 1G33A 4ETOA 1AHRA 4HREE 1XYDA 1AJ5A 1IWQA 1TOPA 1CDMA 2MLEC 3CLNA 3HCMA 1V1GA 2BCBA 2BKIB 3O6BA 1Y1AA 1UUSA 2RGIA 1CLMA 3NSLA 1QIWA 1UURA 1WY9A 1DJIA 2LUCA 2LCPA 2L4IA 3KPXA 1TNPA 1N2DA 4MZLA 2LMUA 2KAXA 2PALA 4JQ0D 3M0WA 3WXAA 1NYAA 4C0LA 1OZOA 2BE4A 3QRXA 1XFVO 3OB1B 4ORAB 1YRTB 1LXFC 1KQVA 1L7ZA 1J7PA 1QIVA 3FS7A 4M2PA 1QS7A 2K2FA 2KSPA 3I5IC 1IGVA 2OTGC 1XFXO 1JUOA 2JPTA 3TDZA 2JXCA 3I5IB 1SKTA 1BR4B 2OTGB 5D7FA 4DCKA 3DD4A 1R6PA 1AJ4A 2KAYA 3DF0B 2EHBA 1TNXA 1QV0A 2K7CA 2OPOA 2BE6A 1K9UA 1QX5B 3PLFB 4ZCVA 2CCMA 4ORBB 4MN0A 2WNDA 1BT6A 2WCBA 3RLZA 2M8UA 1YR5A 2JC2A 2H61A 4MVFA 5ER5A 1B4CA 1W7IB 1ALWA 1ZOTB 1C07A 1E8AA 1QX7A 1SR6C 2CNPA 2BCAA 2QACA 4MEWA 1SYMA 2H2KA 2KBMA 2B1UA 2LV7A 2LVJA 1PSBA 2CTNA 3AAJA 1S6CA 1G8IA 2BL0C 1WRLA 1B47A 2Q4UA 1DT7B 3AAKA 4NDDA 3NSOA 2NLNA 3BQ3A 4DIRA 1JF0A 4PDZA 5HYDA 1S36A 4WQ3A 1CFFA 3EVVA 5F6TA 2CBLA 1KK7Z 1K94A 2O5GA 1XFYO 2MBXA 3FIAA 2L51A 2LHIA 2M9GA 3BUWB 3E3RA 2M7NA 1K9KA 1XO5A 1F4QA 2ZN8A 1QVIZ 4CFQA 1B8RA 2EC6B 2K7DA 2KBIA 3CZTX 1PULA 4M2QA 3WHUB 2LLUA 1X02A 4I5KA 1YTZC 5TNCA 3PSRA 5FYXA 4I5NB 1SCVA 2BKHB 3GK4X 1KWOC 3TDIA 5HLVA 3A8RA 1PK0D 1LINA 3SIAA 1CMGA 3ZWHA 1CLLA 4MBEA 2M0RA 2KYCA 2BBNA 1KCYA 2HPSA 3PFVA 3VRNA 2L4HA 4PHKA 1UP5A 1ALVA 1MXEA 1N0YA 4ICBA 1S3PA 5DKQA 1J7QA 1FI6A 1KK7Y 4OR9B 1CFDA 3GOFA 1ZMZA 4HSZA 4MLWA 1WDCC 4D1EA 2TN4A 1S1EA 2HQ8A 3WHTB 2KFHA 1B8LA 1CB1A 2KGRA 1WDCB 5HLOA 1YVLA 1NCYA 1A2XA 1MUXA 1XFUO 1SY9A 1QV1A 1KQMC 1B7TY 1MHOA 2JTZA 3JVTB 1OMVA 2CT9A 4E68A 5HKZA 1JFJA 2MHHA 1YVHA 3NXAA 3CR5X 5GQQC 2NCOA 1R2UA 3LL8B 1M31A 2CXJA 1BR1B 1W7JB 4XJKA 1HT9A 3DVEA 2KI6C 2K8MB 4P5OE 2AUCA 1UHKA 5KSZA 2NXQA 1DGVA 1WLZA 1F70A 1YRUB 4YGDB 1CNPA 2LP3A 3CR2A 1NSHA 1NUBA 1WLMA 2M3WA 2LNKA 2WORA 1A03A 2WCFA 5KTYA 1NX0A 1TIZA 3GK2A 1QATA 3BUXB 1Y1UA 2ZRSA 3D0YA 2Y1NA 3TS5B 2VRGA 1TRFA 4IL1A 1XK4C 1RROA 1RFJA 4ZCUA 1XFZO 1L2OB 2JNFA 2LHLA 1K90D 2LE9B 3AKBA 3BUOB 2I7AA 4HRHA 1JF2A 1MWNA 1DMOA 3O2PA 4A4CA 5AERA 1DJGA 1M46A 3OB2B 1NP8A 1UWOA 2KFFA 4FQOA 4PHNA 4QJ4B 4YGEB 4GAOA 5K89A 3PALA 4OVNF 2KQYA 3D10A 2LC5A 3CGAA 4PE4A 4AOMA 1CM1A 4XJKB 4GGFA 1EG3A 1DF0A 3EVUA 2KOTA 3KEVA 4GPLB 1BLQA 2IS9A 1MR8A 2K7OA 3BOWA 4C0JA 2MAZA 2KI4C 1D1OA 1TNQA 1M45A 3PM8A 1S6JA 1BG1A 2KFGA 2KI4B 2QPTA 1RECA 1Y0VH 1BJFA 1PRWA 1BU3A 2GGMA 2K61A 1EJ3A 3D0YB 1FI5A 4JPZB 2LVVA 1UHHA 4MZJA 2JQ6A 5CSIA 1BF5A 4YI8A 2FCEA 2JT8A 4BY4A 1FBVA 3VRRA 5I2QA 1KK8B 1MQ1A 5ER4X 2JTTA 3IF7A 4CFRA 3LK1A 1SK6D 2PASA 2NZ0A 2Y1MA 4PE0A 5I2LA 3CWGA 1DF0B 3I5HC 3OX5A 1OMDA 4MSPA 4BY5A 2LMTA 2M1UA 1JC2A 3KF9A 4CLNA 4DRWA 1YX8A 5I8NA 1RWYA 1YUUA 1SL9A 1SRAA 2F3ZA 3I5HB 5JOLA 5AEQA 4MRYA 3SG3A 3ZNIA 3VRQA 2H61C 1DVIA 2KDHA 1RJVA 1KFXS 5CSFA 1EH2A 2JU0A 1A75A 2EC6C 2WC8A 2AAOA 4CPVA 3I5GC 4P2YB 2WCEA 2GGZA 4MRXA 4M2OA 5AANA 4GUKA 3I5GB 2EGDA 4YGAA 3PATA 2G2BA 1B7TZ 1NX2A 5J3XA 2OS8B 3BYAA 2GV5A 1YUSA 2I2RE 2KAVA 4PHJA 1Y1XA 4GNKB 1FF1A 1QTXA 1CDPA 2MA2A 1TNWA 3ICBA 1KSOA 1UHJA 2ZRTA 1TN4A 1EG4A 1GGZA 1M63B 2BCXA 2E30A 3LK0A 4YGBB 4JWQA 3TZ1A 4YRUA 5IBWA 4NDBA 5CSJA 2HETA 4PALA 3VROA 1B8CA 3PN7C 1CLBA 2JRFA 4GGNA 3NSIA 4ORCB 1JSAA 3NSKA 3VRPA 3PN7B 1AP4A 3CR4X 3IQOA 4MZKA 5AFPA 1B1GA 1PVBA 2M29A 2PMYA 4NQGA 2FCDA 4HRGA 1SCMC 2Y4QA 4YBHB 4I5LB 3IQQA 2F2PA 1SW8A 1SPYA 2JULA 2K7BA 1SCMB 3JVTC 1J7RA 1IG5A 1NPQA 1EXRA 2Q91A 1NWDA 4PE7A 2I18A 3TUYC 4DUQA 2F2OA 2PVBA 1DGUA 3SIBA 3TUYB 1K95A 2M97A 1PSRA 2F3YA 3SG6A 3SG4A 1A29A 1G4YR 2L5XB 1GQMA 4YI9A 4A4BA 1BOCA 3EK4A 2ZFDA 1S26D 4QJ3B 4AQJA 3BUNB 4N1FA 2BECA 5DKNA 3KHEA 2G9BA 1CMFA 1UHIA 2LMVA 3FWBA 1MF8B 2M1KB 1YURA 1J7OA 5DKRA 5G08A 1A4PA 2JXLA 4AQIA 3TS5C 1H8BA 1XVJA 1IQ3A 2COLB 1K2HA 3DVMA 1QLSA 1CKKA 2MJWB 3EKJA 1L2OC 2O60A 1EL4A 4NDCA 2LM5A 4OKHA 2L98A 1K8UA 2LP2A 3DVKA 1N65A 1OOJA 1IKUA 1CTRA 1GGWA 4Q04A 3BXKA 1CM4A 3EK8A 5AXIA 1C7WA 1ZACA 2NCPA 3DF0A 1CDNA 1SBJA 1SNLA 4TNCA 5CSNA 4XYNA 3I5FC 1CFPA 3SJSA 4FTGA 3CS1A 2M49B 2ZN9A 1OE9B 1Y6WA 2KHNA 3HX4A 3I5FB 3EVRA 2K2AA 3EKHA 5I2OA 3VGOA 2KYFA 3LLEA 3BUMB 1JWDA 1LVCD 1QX2A 3RM1A 1J1DA 5KU1A 1BMOA 2L0PA 1OZSA 1IQ5A 3O78A 1WRKA 1SL7A 1K96A 1V1FA 1KFXL 2PRUA 3LCPC 1K9PA 1F8HA 1B9AA 3JTDC 1M39A 2L50A 2LLSA 1KK8C 3TDUA 2ZNEA 3JTDB 5PALA 3C1VA 3CTNA 1TCFA 1JBAA 1F4OA 2ISDA 3DVJA 3H4SE 1J1EA 2Y5IA 2WOSA 3K21A 4GGFC 3KO0A 2KQ6A 4GBAA 2JZIA 1DJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQV A;  1AUI B;  1ZUZ A;  1VRK A;  2LAN A;  4OCI A;  3SG7 A;  1AK8 A;  1OMR A;  4C0K A;  3SG2 A;  3BOW B;  4WQ2 A;  4N1G A;  2SCP A;  1DTL A;  2KI6 D;  4CID A;  1K93 D;  2M7L A;  4N5X A;  1U5I A;  1NCZ A;  1SR6 B;  1LKJ A;  1NCX A;  2F8P A;  2JNX A;  2BBM A;  2MRD A;  2OS8 C;  4PHM A;  1QAS A;  5B8I B;  2KGB C;  2MLF C;  2D8N A;  1DJW A;  1S5G Z;  2P6B B;  1PVA A;  2BL0 B;  2LLT A;  2LVI A;  3WNX B;  2FOT A;  2JOJ A;  4U8D A;  1RK9 A;  3AKA A;  1NX3 A;  2I94 A;  1WRZ A;  1LA3 A;  2HQW A;  4QJ5 B;  2JT3 A;  3SG5 A;  1KFU L;  2L2E A;  1BOD A;  2E6W A;  2KNE A;  3O4Y A;  2JT0 A;  1F55 A;  1KSM A;  2LUX A;  1JFK A;  2FJU B;  5HKW A;  5HKY A;  4YGC B;  1FW4 A;  2JWW A;  2LVK A;  1AVS A;  1RTP 1;  3FWC A;  1NX1 A;  1MXL C;  2F33 A;  3MSE B;  1LA0 A;  1DJH A;  5D69 A;  1QXP A;  1U5I B;  4WRI A;  4USL A;  1A75 B;  1XFW O;  1ODB A;  1DJX A;  1OSA A;  2PSR A;  4L9M A;  4F0Z B;  5JJG A;  1IJ5 A;  2SAS A;  1CFC A;  1S5G Y;  1DJZ A;  1KWO B;  2ZND A;  3EK7 A;  3OP0 A;  1IJ6 A;  1F54 A;  1SMG A;  1QJT A;  4UPG A;  4GFT A;  2DOQ A;  1CDL A;  1PAL A;  1TCO B;  4R1E A;  1TTX A;  1KFU S;  4OV2 A;  1IH0 A;  5CPV A;  3OX6 A;  3A4U B;  2K0J A;  1QLK A;  2HF5 A;  2AMI A;  4PE1 A;  1H4B A;  2LAP A;  2R2I A;  1Q80 A;  1IRJ A;  3F45 A;  1QVI Y;  1S6I A;  3OHM B;  1GJY A;  1NIW A;  2A4J A;  1YX7 A;  4I5J A;  4PCW A;  3GK1 A;  1ZFS A;  4DS7 A;  1XK4 A;  1XA5 A;  1UHN A;  1OQP A;  2ZKM X;  1F71 A;  1KQM B;  1YUT A;  1C7V A;  5BPJ A;  1FPW A;  1J55 A;  2V53 A;  1SL8 A;  1G33 A;  4ETO A;  1AHR A;  4HRE E;  1XYD A;  1AJ5 A;  1IWQ A;  1TOP A;  1CDM A;  2MLE C;  3CLN A;  3HCM A;  1V1G A;  2BCB A;  2BKI B;  3O6B A;  1Y1A A;  1UUS A;  2RGI A;  1CLM A;  3NSL A;  1QIW A;  1UUR A;  1WY9 A;  1DJI A;  2LUC A;  2LCP A;  2L4I A;  3KPX A;  1TNP A;  1N2D A;  4MZL A;  2LMU A;  2KAX A;  2PAL A;  4JQ0 D;  3M0W A;  3WXA A;  1NYA A;  4C0L A;  1OZO A;  2BE4 A;  3QRX A;  1XFV O;  3OB1 B;  4ORA B;  1YRT B;  1LXF C;  1KQV A;  1L7Z A;  1J7P A;  1QIV A;  3FS7 A;  4M2P A;  1QS7 A;  2K2F A;  2KSP A;  3I5I C;  1IGV A;  2OTG C;  1XFX O;  1JUO A;  2JPT A;  3TDZ A;  2JXC A;  3I5I B;  1SKT A;  1BR4 B;  2OTG B;  5D7F A;  4DCK A;  3DD4 A;  1R6P A;  1AJ4 A;  2KAY A;  3DF0 B;  2EHB A;  1TNX A;  1QV0 A;  2K7C A;  2OPO A;  2BE6 A;  1K9U A;  1QX5 B;  3PLF B;  4ZCV A;  2CCM A;  4ORB B;  4MN0 A;  2WND A;  1BT6 A;  2WCB A;  3RLZ A;  2M8U A;  1YR5 A;  2JC2 A;  2H61 A;  4MVF A;  5ER5 A;  1B4C A;  1W7I B;  1ALW A;  1ZOT B;  1C07 A;  1E8A A;  1QX7 A;  1SR6 C;  2CNP A;  2BCA A;  2QAC A;  4MEW A;  1SYM A;  2H2K A;  2KBM A;  2B1U A;  2LV7 A;  2LVJ A;  1PSB A;  2CTN A;  3AAJ A;  1S6C A;  1G8I A;  2BL0 C;  1WRL A;  1B47 A;  2Q4U A;  1DT7 B;  3AAK A;  4NDD A;  3NSO A;  2NLN A;  3BQ3 A;  4DIR A;  1JF0 A;  4PDZ A;  5HYD A;  1S36 A;  4WQ3 A;  1CFF A;  3EVV A;  5F6T A;  2CBL A;  1KK7 Z;  1K94 A;  2O5G A;  1XFY O;  2MBX A;  3FIA A;  2L51 A;  2LHI A;  2M9G A;  3BUW B;  3E3R A;  2M7N A;  1K9K A;  1XO5 A;  1F4Q A;  2ZN8 A;  1QVI Z;  4CFQ A;  1B8R A;  2EC6 B;  2K7D A;  2KBI A;  3CZT X;  1PUL A;  4M2Q A;  3WHU B;  2LLU A;  1X02 A;  4I5K A;  1YTZ C;  5TNC A;  3PSR A;  5FYX A;  4I5N B;  1SCV A;  2BKH B;  3GK4 X;  1KWO C;  3TDI A;  5HLV A;  3A8R A;  1PK0 D;  1LIN A;  3SIA A;  1CMG A;  3ZWH A;  1CLL A;  4MBE A;  2M0R A;  2KYC A;  2BBN A;  1KCY A;  2HPS A;  3PFV A;  3VRN A;  2L4H A;  4PHK A;  1UP5 A;  1ALV A;  1MXE A;  1N0Y A;  4ICB A;  1S3P A;  5DKQ A;  1J7Q A;  1FI6 A;  1KK7 Y;  4OR9 B;  1CFD A;  3GOF A;  1ZMZ A;  4HSZ A;  4MLW A;  1WDC C;  4D1E A;  2TN4 A;  1S1E A;  2HQ8 A;  3WHT B;  2KFH A;  1B8L A;  1CB1 A;  2KGR A;  1WDC B;  5HLO A;  1YVL A;  1NCY A;  1A2X A;  1MUX A;  1XFU O;  1SY9 A;  1QV1 A;  1KQM C;  1B7T Y;  1MHO A;  2JTZ A;  3JVT B;  1OMV A;  2CT9 A;  4E68 A;  5HKZ A;  1JFJ A;  2MHH A;  1YVH A;  3NXA A;  3CR5 X;  5GQQ C;  2NCO A;  1R2U A;  3LL8 B;  1M31 A;  2CXJ A;  1BR1 B;  1W7J B;  4XJK A;  1HT9 A;  3DVE A;  2KI6 C;  2K8M B;  4P5O E;  2AUC A;  1UHK A;  5KSZ A;  2NXQ A;  1DGV A;  1WLZ A;  1F70 A;  1YRU B;  4YGD B;  1CNP A;  2LP3 A;  3CR2 A;  1NSH A;  1NUB A;  1WLM A;  2M3W A;  2LNK A;  2WOR A;  1A03 A;  2WCF A;  5KTY A;  1NX0 A;  1TIZ A;  3GK2 A;  1QAT A;  3BUX B;  1Y1U A;  2ZRS A;  3D0Y A;  2Y1N A;  3TS5 B;  2VRG A;  1TRF A;  4IL1 A;  1XK4 C;  1RRO A;  1RFJ A;  4ZCU A;  1XFZ O;  1L2O B;  2JNF A;  2LHL A;  1K90 D;  2LE9 B;  3AKB A;  3BUO B;  2I7A A;  4HRH A;  1JF2 A;  1MWN A;  1DMO A;  3O2P A;  4A4C A;  5AER A;  1DJG A;  1M46 A;  3OB2 B;  1NP8 A;  1UWO A;  2KFF A;  4FQO A;  4PHN A;  4QJ4 B;  4YGE B;  4GAO A;  5K89 A;  3PAL A;  4OVN F;  2KQY A;  3D10 A;  2LC5 A;  3CGA A;  4PE4 A;  4AOM A;  1CM1 A;  4XJK B;  4GGF A;  1EG3 A;  1DF0 A;  3EVU A;  2KOT A;  3KEV A;  4GPL B;  1BLQ A;  2IS9 A;  1MR8 A;  2K7O A;  3BOW A;  4C0J A;  2MAZ A;  2KI4 C;  1D1O A;  1TNQ A;  1M45 A;  3PM8 A;  1S6J A;  1BG1 A;  2KFG A;  2KI4 B;  2QPT A;  1REC A;  1Y0V H;  1BJF A;  1PRW A;  1BU3 A;  2GGM A;  2K61 A;  1EJ3 A;  3D0Y B;  1FI5 A;  4JPZ B;  2LVV A;  1UHH A;  4MZJ A;  2JQ6 A;  5CSI A;  1BF5 A;  4YI8 A;  2FCE A;  2JT8 A;  4BY4 A;  1FBV A;  3VRR A;  5I2Q A;  1KK8 B;  1MQ1 A;  5ER4 X;  2JTT A;  3IF7 A;  4CFR A;  3LK1 A;  1SK6 D;  2PAS A;  2NZ0 A;  2Y1M A;  4PE0 A;  5I2L A;  3CWG A;  1DF0 B;  3I5H C;  3OX5 A;  1OMD A;  4MSP A;  4BY5 A;  2LMT A;  2M1U A;  1JC2 A;  3KF9 A;  4CLN A;  4DRW A;  1YX8 A;  5I8N A;  1RWY A;  1YUU A;  1SL9 A;  1SRA A;  2F3Z A;  3I5H B;  5JOL A;  5AEQ A;  4MRY A;  3SG3 A;  3ZNI A;  3VRQ A;  2H61 C;  1DVI A;  2KDH A;  1RJV A;  1KFX S;  5CSF A;  1EH2 A;  2JU0 A;  1A75 A;  2EC6 C;  2WC8 A;  2AAO A;  4CPV A;  3I5G C;  4P2Y B;  2WCE A;  2GGZ A;  4MRX A;  4M2O A;  5AAN A;  4GUK A;  3I5G B;  2EGD A;  4YGA A;  3PAT A;  2G2B A;  1B7T Z;  1NX2 A;  5J3X A;  2OS8 B;  3BYA A;  2GV5 A;  1YUS A;  2I2R E;  2KAV A;  4PHJ A;  1Y1X A;  4GNK B;  1FF1 A;  1QTX A;  1CDP A;  2MA2 A;  1TNW A;  3ICB A;  1KSO A;  1UHJ A;  2ZRT A;  1TN4 A;  1EG4 A;  1GGZ A;  1M63 B;  2BCX A;  2E30 A;  3LK0 A;  4YGB B;  4JWQ A;  3TZ1 A;  4YRU A;  5IBW A;  4NDB A;  5CSJ A;  2HET A;  4PAL A;  3VRO A;  1B8C A;  3PN7 C;  1CLB A;  2JRF A;  4GGN A;  3NSI A;  4ORC B;  1JSA A;  3NSK A;  3VRP A;  3PN7 B;  1AP4 A;  3CR4 X;  3IQO A;  4MZK A;  5AFP A;  1B1G A;  1PVB A;  2M29 A;  2PMY A;  4NQG A;  2FCD A;  4HRG A;  1SCM C;  2Y4Q A;  4YBH B;  4I5L B;  3IQQ A;  2F2P A;  1SW8 A;  1SPY A;  2JUL A;  2K7B A;  1SCM B;  3JVT C;  1J7R A;  1IG5 A;  1NPQ A;  1EXR A;  2Q91 A;  1NWD A;  4PE7 A;  2I18 A;  3TUY C;  4DUQ A;  2F2O A;  2PVB A;  1DGU A;  3SIB A;  3TUY B;  1K95 A;  2M97 A;  1PSR A;  2F3Y A;  3SG6 A;  3SG4 A;  1A29 A;  1G4Y R;  2L5X B;  1GQM A;  4YI9 A;  4A4B A;  1BOC A;  3EK4 A;  2ZFD A;  1S26 D;  4QJ3 B;  4AQJ A;  3BUN B;  4N1F A;  2BEC A;  5DKN A;  3KHE A;  2G9B A;  1CMF A;  1UHI A;  2LMV A;  3FWB A;  1MF8 B;  2M1K B;  1YUR A;  1J7O A;  5DKR A;  5G08 A;  1A4P A;  2JXL A;  4AQI A;  3TS5 C;  1H8B A;  1XVJ A;  1IQ3 A;  2COL B;  1K2H A;  3DVM A;  1QLS A;  1CKK A;  2MJW B;  3EKJ A;  1L2O C;  2O60 A;  1EL4 A;  4NDC A;  2LM5 A;  4OKH A;  2L98 A;  1K8U A;  2LP2 A;  3DVK A;  1N65 A;  1OOJ A;  1IKU A;  1CTR A;  1GGW A;  4Q04 A;  3BXK A;  1CM4 A;  3EK8 A;  5AXI A;  1C7W A;  1ZAC A;  2NCP A;  3DF0 A;  1CDN A;  1SBJ A;  1SNL A;  4TNC A;  5CSN A;  4XYN A;  3I5F C;  1CFP A;  3SJS A;  4FTG A;  3CS1 A;  2M49 B;  2ZN9 A;  1OE9 B;  1Y6W A;  2KHN A;  3HX4 A;  3I5F B;  3EVR A;  2K2A A;  3EKH A;  5I2O A;  3VGO A;  2KYF A;  3LLE A;  3BUM B;  1JWD A;  1LVC D;  1QX2 A;  3RM1 A;  1J1D A;  5KU1 A;  1BMO A;  2L0P A;  1OZS A;  1IQ5 A;  3O78 A;  1WRK A;  1SL7 A;  1K96 A;  1V1F A;  1KFX L;  2PRU A;  3LCP C;  1K9P A;  1F8H A;  1B9A A;  3JTD C;  1M39 A;  2L50 A;  2LLS A;  1KK8 C;  3TDU A;  2ZNE A;  3JTD B;  5PAL A;  3C1V A;  3CTN A;  1TCF A;  1JBA A;  1F4O A;  2ISD A;  3DVJ A;  3H4S E;  1J1E A;  2Y5I A;  2WOS A;  3K21 A;  4GGF C;  3KO0 A;  2KQ6 A;  4GBA A;  2JZI A;  1DJY A; 
#chains in the Genus database with same CATH topology
 1HQV A;  4PT1 A;  1AUI B;  1ZUZ A;  1VRK A;  2LAN A;  4OCI A;  3SG7 A;  1AK8 A;  1OMR A;  4C0K A;  3SG2 A;  3BOW B;  4WQ2 A;  4N1G A;  2SCP A;  1DTL A;  2KI6 D;  4CID A;  1K93 D;  2M7L A;  4N5X A;  1U5I A;  1NCZ A;  1SR6 B;  1LKJ A;  3B88 A;  1NCX A;  2F8P A;  2JNX A;  1DQE A;  2BBM A;  3BFA A;  2MRD A;  2OS8 C;  3D74 A;  4PHM A;  1QAS A;  5B8I B;  2KGB C;  2MLF C;  2D8N A;  1DJW A;  1S5G Z;  2P6B B;  1QWV A;  1PVA A;  5FI6 A;  2BL0 B;  2LLT A;  2LVI A;  3WNX B;  2FOT A;  2JOJ A;  2P70 A;  4U8D A;  1C3Y A;  2ERB A;  1RK9 A;  3AKA A;  1NX3 A;  2KLE A;  2I94 A;  1WRZ A;  2QEV A;  1LA3 A;  2HQW A;  4QJ5 B;  2JT3 A;  2L2C A;  3SG5 A;  1KFU L;  2L2E A;  3S0F A;  1BOD A;  2E6W A;  2KNE A;  3O4Y A;  2JT0 A;  1F55 A;  1KSM A;  2LUX A;  1JFK A;  2FJU B;  3DXL A;  5HKW A;  5HKY A;  4YGC B;  1FW4 A;  2JWW A;  2LVK A;  1AVS A;  1RTP 1;  3FWC A;  1NX1 A;  1MXL C;  2F33 A;  3MSE B;  1LA0 A;  1DJH A;  5D69 A;  1QXP A;  1U5I B;  4WRI A;  4USL A;  1A75 B;  1XFW O;  1ODB A;  1DJX A;  1OSA A;  2PSR A;  2GTE A;  4L9M A;  4F0Z B;  5JJG A;  1OOF A;  1IJ5 A;  2SAS A;  1CFC A;  1C3Z A;  1S5G Y;  3D73 A;  1DJZ A;  3B7A A;  1KWO B;  2ZND A;  3EK7 A;  3OP0 A;  1IJ6 A;  1F54 A;  1SMG A;  1QJT A;  4UPG A;  4GFT A;  2DOQ A;  1CDL A;  1PAL A;  1TCO B;  4R1E A;  1TTX A;  1KFU S;  4OV2 A;  1IH0 A;  5CPV A;  3OX6 A;  3A4U B;  2K0J A;  1QLK A;  2HF5 A;  2AMI A;  4PE1 A;  1H4B A;  2LAP A;  2R2I A;  1Q80 A;  1IRJ A;  3F45 A;  1QVI Y;  1S6I A;  3OHM B;  1GJY A;  3VB1 A;  1NIW A;  2A4J A;  1YX7 A;  4I5J A;  4PCW A;  3GK1 A;  4INW A;  1ZFS A;  4DS7 A;  1XK4 A;  1XA5 A;  1UHN A;  1OQP A;  2ZKM X;  1F71 A;  1KQM B;  1YUT A;  1C7V A;  5BPJ A;  1FPW A;  1J55 A;  2V53 A;  2WCL A;  1SL8 A;  1G33 A;  4ETO A;  1AHR A;  4HRE E;  1XYD A;  1AJ5 A;  1IWQ A;  1TOP A;  1CDM A;  2MLE C;  3CLN A;  3HCM A;  3S0A A;  1V1G A;  2BCB A;  2BAP A;  2BKI B;  3O6B A;  1Y1A A;  3CZ2 A;  2QEH A;  3UO9 A;  1UUS A;  2PYQ A;  1P28 A;  1CLM A;  2RGI A;  3NSL A;  1QIW A;  1UUR A;  1WY9 A;  1DJI A;  2LUC A;  2LCP A;  1TUZ A;  2L4I A;  3KPX A;  1TNP A;  1N2D A;  4MZL A;  2LMU A;  2KAX A;  2PAL A;  4JQ0 D;  3M0W A;  3WXA A;  2WCK A;  1NYA A;  4C0L A;  4FQT A;  1OZO A;  3D75 A;  2BE4 A;  3QRX A;  1XFV O;  3OB1 B;  4ORA B;  1YRT B;  1LXF C;  1KQV A;  1L7Z A;  2KPH A;  1J7P A;  1QIV A;  3FS7 A;  4M2P A;  3R1P A;  3PJI A;  1QS7 A;  2K2F A;  2KSP A;  3FE8 A;  3I5I C;  1IGV A;  3R1O A;  3EG5 B;  2OTG C;  1XFX O;  1JUO A;  2JPT A;  3TDZ A;  2K60 A;  2JXC A;  3I5I B;  1SKT A;  1BR4 B;  2OTG B;  3S0E A;  5D7F A;  4DCK A;  3RZS A;  3DD4 A;  3SS3 A;  1R6P A;  1AJ4 A;  2KAY A;  3DF0 B;  2EHB A;  3V2L A;  1TNX A;  1QV0 A;  2K7C A;  2OPO A;  2BE6 A;  1K9U A;  1QX5 B;  1SSE B;  3PLF B;  4ZCV A;  1OOG A;  2CCM A;  4ORB B;  4MN0 A;  2WND A;  1BT6 A;  2WCB A;  3RLZ A;  2M8U A;  3B6X A;  1YR5 A;  2JC2 A;  2H61 A;  4MVF A;  3NHI A;  5ER5 A;  1W7I B;  1B4C A;  1ALW A;  3BFH A;  1ZOT B;  1C07 A;  1OOH A;  1E8A A;  1QX7 A;  1SR6 C;  2CNP A;  2BCA A;  3D77 A;  2QAC A;  4MEW A;  1SYM A;  4INX A;  2H2K A;  2KBM A;  2B1U A;  2KLD A;  2LV7 A;  2LVJ A;  1PSB A;  2CTN A;  3AAJ A;  1S6C A;  2WCH A;  1G8I A;  2BL0 C;  1WRL A;  1B47 A;  3QME A;  2Q4U A;  1DT7 B;  3AAK A;  4NDD A;  3NSO A;  2NLN A;  3BQ3 A;  4DIR A;  3IVT A;  1JF0 A;  4PDZ A;  5HYD A;  1S36 A;  4WQ3 A;  1CFF A;  3EVV A;  5F6T A;  2CBL A;  1KK7 Z;  1K94 A;  2WCM A;  2O5G A;  1XFY O;  5FI2 A;  3FIA A;  2MBX A;  2L51 A;  2LHI A;  2M9G A;  1OOI X;  3BUW B;  3E3R A;  5DIC A;  2M7N A;  1T14 A;  1K9K A;  1XO5 A;  1F4Q A;  2ZN8 A;  1QVI Z;  4CFQ A;  1B8R A;  2EC6 B;  2K7D A;  2KBI A;  2P71 A;  3CZT X;  1PUL A;  4M2Q A;  3WHU B;  2LLU A;  3CYZ A;  1X02 A;  4I5K A;  1YTZ C;  2L5Y A;  5TNC A;  1ORG A;  3PSR A;  5FYX A;  3DYE A;  1SCV A;  2BKH B;  3GK4 X;  4I5N B;  1KWO C;  3TDI A;  5HLV A;  3A8R A;  1PK0 D;  1LIN A;  3SIA A;  1CMG A;  3ZWH A;  1CLL A;  4MBE A;  2M0R A;  1OW4 A;  2BBN A;  2KYC A;  3N7H A;  1KCY A;  2HPS A;  3PFV A;  3VRN A;  2L4H A;  4PHK A;  1UP5 A;  2PQL A;  1ALV A;  1MXE A;  1N0Y A;  4ICB A;  1S3P A;  5DKQ A;  1J7Q A;  4IJ7 A;  1FI6 A;  1KK7 Y;  4OR9 B;  1CFD A;  3GOF A;  1ZMZ A;  2FJY A;  3R1V A;  4HSZ A;  4MLW A;  1WDC C;  4D1E A;  3B86 A;  2TN4 A;  1S1E A;  2HQ8 A;  3WHT B;  2KFH A;  1B8L A;  1CB1 A;  2KGR A;  1WDC B;  2WC5 A;  5HLO A;  1YVL A;  3DY9 A;  1NCY A;  1A2X A;  1MUX A;  1XFU O;  1SY9 A;  1QV1 A;  1KQM C;  1B7T Y;  1MHO A;  2JTZ A;  1IIO A;  3JVT B;  1OMV A;  2CT9 A;  4E68 A;  5HKZ A;  1JFJ A;  2MHH A;  1YVH A;  3NXA A;  3CR5 X;  5GQQ C;  2NCO A;  1R2U A;  3LL8 B;  1M31 A;  2CXJ A;  1BR1 B;  1W7J B;  4XJK A;  1HT9 A;  3DVE A;  2KI6 C;  2K8M B;  3FE9 A;  4P5O E;  2AUC A;  1UHK A;  1DEL A;  5KSZ A;  2QEB A;  2NXQ A;  1DGV A;  1WLZ A;  1F70 A;  1YRU B;  4YGD B;  1CNP A;  2LP3 A;  3CR2 A;  1NSH A;  1NUB A;  1WLM A;  2M3W A;  2LNK A;  2WOR A;  3S0D A;  1A03 A;  2WCF A;  5KTY A;  1NX0 A;  1TIZ A;  3CAB A;  1XFR A;  3GK2 A;  1QAT A;  3S0B A;  3BUX B;  1Y1U A;  2ZRS A;  5HL1 A;  3D0Y A;  2Y1N A;  3TS5 B;  3UNW A;  2VRG A;  1TRF A;  4IL1 A;  1XK4 C;  1RRO A;  1RFJ A;  4ZCU A;  1XFZ O;  1L2O B;  2JNF A;  2LHL A;  1K90 D;  2LE9 B;  3AKB A;  3BUO B;  2I7A A;  3K1E A;  4HRH A;  1JF2 A;  1MWN A;  1DMO A;  3O2P A;  4A4C A;  5AER A;  1DJG A;  1M46 A;  3OB2 B;  4KYN A;  1NP8 A;  1UWO A;  1Z4H A;  2KFF A;  4FQO A;  4PHN A;  4YGE B;  3SS4 A;  4GAO A;  4QJ4 B;  5K89 A;  3PAL A;  4OVN F;  2KQY A;  3D10 A;  1TWO A;  2LC5 A;  3CGA A;  4PE4 A;  2QEO A;  4AOM A;  1CM1 A;  4XJK B;  4GGF A;  1EG3 A;  1DF0 A;  3EVU A;  2KOT A;  3KEV A;  4GPL B;  1BLQ A;  1DC1 A;  2IS9 A;  1MR8 A;  2K7O A;  3BOW A;  4C0J A;  3BJH A;  2MAZ A;  2KI4 C;  1D1O A;  1TNQ A;  1M45 A;  3PM8 A;  1S6J A;  1BG1 A;  2KFG A;  2KI4 B;  2QPT A;  1REC A;  1Y0V H;  1BJF A;  1PRW A;  1BU3 A;  2GGM A;  2K61 A;  1EJ3 A;  3D0Y B;  3S0G A;  1FI5 A;  3BFB A;  4JPZ B;  2LVV A;  2WC6 A;  1UHH A;  4MZJ A;  2JQ6 A;  3D76 A;  5CSI A;  1BF5 A;  4YI8 A;  2FCE A;  2JT8 A;  4BY4 A;  1FBV A;  3L4A A;  3VRR A;  5I2Q A;  1KK8 B;  1MQ1 A;  4JD9 A;  2JTT A;  3IF7 A;  5ER4 X;  4CFR A;  3LK1 A;  1SK6 D;  2PAS A;  2H8V A;  2NZ0 A;  2Y1M A;  4PE0 A;  5I2L A;  3CWG A;  1DF0 B;  3I5H C;  3O4X A;  1OMD A;  3OX5 A;  4MSP A;  4BY5 A;  2LMT A;  2M1U A;  1JC2 A;  3KF9 A;  2WCJ A;  4CLN A;  4DRW A;  1YX8 A;  5I8N A;  1RWY A;  1YUU A;  1SL9 A;  1SRA A;  2F3Z A;  3I5H B;  3Q8I A;  5JOL A;  4MRY A;  5AEQ A;  3SG3 A;  3ZNI A;  1W9Z A;  3VRQ A;  3CDN A;  2H61 C;  1DVI A;  2KDH A;  3D78 A;  1RJV A;  1KFX S;  5CSF A;  5D3O A;  1EH2 A;  2JU0 A;  1A75 A;  2EC6 C;  2WC8 A;  2AAO A;  4CPV A;  3I5G C;  4P2Y B;  5I94 A;  2WCE A;  1GM0 A;  2GGZ A;  4MRX A;  4M2O A;  5AAN A;  4GUK A;  3I5G B;  2EGD A;  4YGA A;  3PAT A;  3PM2 A;  2G2B A;  1B7T Z;  1NX2 A;  5FI7 A;  5J3X A;  2OS8 B;  3BYA A;  2GV5 A;  1YUS A;  2I2R E;  3CZ0 A;  2KAV A;  3B87 A;  4PHJ A;  1Y1X A;  4GNK B;  1FF1 A;  1QTX A;  1CDP A;  2MA2 A;  1TNW A;  3ICB A;  3L47 A;  1KSO A;  1UHJ A;  2ZRT A;  1TN4 A;  1EG4 A;  1GGZ A;  1LS8 A;  1M63 B;  2BCX A;  2E30 A;  3LK0 A;  4YGB B;  4JWQ A;  1DEK A;  3TZ1 A;  4YRU A;  5IBW A;  4NDB A;  5CSJ A;  2HET A;  4PAL A;  3VRO A;  1B8C A;  3PN7 C;  1CLB A;  2JRF A;  4GGN A;  3NSI A;  4ORC B;  1JSA A;  3NSK A;  3VRP A;  3PN7 B;  1AP4 A;  3CR4 X;  3IQO A;  4MZK A;  5AFP A;  1B1G A;  1PVB A;  2M29 A;  2PMY A;  4NQG A;  2FCD A;  4HRG A;  1SCM C;  2Y4Q A;  4YBH B;  4I5L B;  3IQQ A;  2F2P A;  1SW8 A;  1SPY A;  2JUL A;  2K7B A;  1SCM B;  3JVT C;  3NHT A;  1J7R A;  1IG5 A;  1NPQ A;  1EXR A;  2Q91 A;  1NWD A;  4PE7 A;  2JPO A;  2I18 A;  3TUY C;  4DUQ A;  2F2O A;  2PVB A;  1DGU A;  3SIB A;  3TUY B;  1K95 A;  3NGV A;  2M97 A;  1PSR A;  2F3Y A;  3SG6 A;  3SS5 A;  3SG4 A;  1A29 A;  1G4Y R;  2L5X B;  1GQM A;  2YGU A;  4YI9 A;  4A4B A;  1BOC A;  3EK4 A;  2ZFD A;  1S26 D;  4QJ3 B;  4AQJ A;  3BUN B;  4N1F A;  2BEC A;  3CZ1 A;  5DKN A;  3KHE A;  2G9B A;  1CMF A;  1UHI A;  2LMV A;  3FWB A;  1MF8 B;  2M1K B;  3L4L A;  1YUR A;  1J7O A;  5DKR A;  5G08 A;  1A4P A;  2JXL A;  4AQI A;  3TS5 C;  1H8B A;  1XVJ A;  1IQ3 A;  2COL B;  1K2H A;  3DVM A;  1QLS A;  1CKK A;  2MJW B;  3FE6 A;  3EKJ A;  1L2O C;  2O60 A;  1EL4 A;  4NDC A;  2LM5 A;  4OKH A;  2L98 A;  1K8U A;  2LP2 A;  3DVK A;  1N65 A;  1OOJ A;  1IKU A;  1CTR A;  1GGW A;  4OZD A;  4Q04 A;  3BXK A;  1CM4 A;  3EK8 A;  5AXI A;  1C7W A;  2QDI A;  1ZAC A;  2NCP A;  3DF0 A;  1CDN A;  1SBJ A;  1SNL A;  1Z2C B;  4TNC A;  5CSN A;  4XYN A;  3I5F C;  1CFP A;  4F7F A;  3SJS A;  4FTG A;  3CS1 A;  2M49 B;  2ZN9 A;  1OE9 B;  1Y6W A;  2KHN A;  3HX4 A;  3I5F B;  3EVR A;  2K2A A;  3EKH A;  5I2O A;  3VGO A;  2KYF A;  3LLE A;  3BUM B;  1JWD A;  1LVC D;  1QX2 A;  3RM1 A;  1J1D A;  5KU1 A;  1BMO A;  1TUJ A;  2L0P A;  1OZS A;  1IQ5 A;  3O78 A;  3R72 A;  1WRK A;  1SL7 A;  1K96 A;  2BNX A;  1V1F A;  3OBV A;  1KFX L;  2PRU A;  3LCP C;  3OGN A;  1K9P A;  1F8H A;  1B9A A;  3JTD C;  1M39 A;  2L50 A;  2LLS A;  1KK8 C;  3TDU A;  2ZNE A;  3JTD B;  5PAL A;  3C1V A;  3CTN A;  1TCF A;  1JBA A;  1F4O A;  5EL2 A;  3DVJ A;  3H4S E;  1J1E A;  2Y5I A;  4JKT A;  2WOS A;  3K21 A;  2ISD A;  4GGF C;  3KO0 A;  2KQ6 A;  4GBA A;  2JZI A;  1DJY A;  3DZT A; 
#chains in the Genus database with same CATH homology
 1HQV A;  1AUI B;  1ZUZ A;  1VRK A;  2LAN A;  4OCI A;  3SG7 A;  1AK8 A;  1OMR A;  4C0K A;  3SG2 A;  3BOW B;  4WQ2 A;  4N1G A;  2SCP A;  1DTL A;  2KI6 D;  4CID A;  1K93 D;  2M7L A;  4N5X A;  1U5I A;  1NCZ A;  1SR6 B;  1LKJ A;  1NCX A;  2F8P A;  2JNX A;  2BBM A;  2MRD A;  2OS8 C;  4PHM A;  1QAS A;  5B8I B;  2KGB C;  2MLF C;  2D8N A;  1DJW A;  1S5G Z;  2P6B B;  1PVA A;  2BL0 B;  2LLT A;  2LVI A;  3WNX B;  2FOT A;  2JOJ A;  4U8D A;  1RK9 A;  3AKA A;  1NX3 A;  2I94 A;  1WRZ A;  1LA3 A;  2HQW A;  4QJ5 B;  2JT3 A;  3SG5 A;  1KFU L;  2L2E A;  1BOD A;  2E6W A;  2KNE A;  3O4Y A;  2JT0 A;  1F55 A;  1KSM A;  2LUX A;  1JFK A;  2FJU B;  5HKW A;  5HKY A;  4YGC B;  1FW4 A;  2JWW A;  2LVK A;  1AVS A;  1RTP 1;  3FWC A;  1NX1 A;  1MXL C;  2F33 A;  3MSE B;  1LA0 A;  1DJH A;  5D69 A;  1QXP A;  1U5I B;  4WRI A;  4USL A;  1A75 B;  1XFW O;  1ODB A;  1DJX A;  1OSA A;  2PSR A;  4L9M A;  4F0Z B;  5JJG A;  1IJ5 A;  2SAS A;  1CFC A;  1S5G Y;  1DJZ A;  1KWO B;  2ZND A;  3EK7 A;  3OP0 A;  1IJ6 A;  1F54 A;  1SMG A;  1QJT A;  4UPG A;  4GFT A;  2DOQ A;  1CDL A;  1PAL A;  1TCO B;  4R1E A;  1TTX A;  1KFU S;  4OV2 A;  1IH0 A;  5CPV A;  3OX6 A;  3A4U B;  2K0J A;  1QLK A;  2HF5 A;  2AMI A;  4PE1 A;  1H4B A;  2LAP A;  2R2I A;  1Q80 A;  1IRJ A;  3F45 A;  1QVI Y;  1S6I A;  3OHM B;  1GJY A;  1NIW A;  2A4J A;  1YX7 A;  4I5J A;  4PCW A;  3GK1 A;  1ZFS A;  4DS7 A;  1XK4 A;  1XA5 A;  1UHN A;  1OQP A;  2ZKM X;  1F71 A;  1KQM B;  1YUT A;  1C7V A;  5BPJ A;  1FPW A;  1J55 A;  2V53 A;  1SL8 A;  1G33 A;  4ETO A;  1AHR A;  4HRE E;  1XYD A;  1AJ5 A;  1IWQ A;  1TOP A;  1CDM A;  2MLE C;  3CLN A;  3HCM A;  1V1G A;  2BCB A;  2BKI B;  3O6B A;  1Y1A A;  1UUS A;  2RGI A;  1CLM A;  3NSL A;  1QIW A;  1UUR A;  1WY9 A;  1DJI A;  2LUC A;  2LCP A;  2L4I A;  3KPX A;  1TNP A;  1N2D A;  4MZL A;  2LMU A;  2KAX A;  2PAL A;  4JQ0 D;  3M0W A;  3WXA A;  1NYA A;  4C0L A;  1OZO A;  2BE4 A;  3QRX A;  1XFV O;  3OB1 B;  4ORA B;  1YRT B;  1LXF C;  1KQV A;  1L7Z A;  1J7P A;  1QIV A;  3FS7 A;  4M2P A;  1QS7 A;  2K2F A;  2KSP A;  3I5I C;  1IGV A;  2OTG C;  1XFX O;  1JUO A;  2JPT A;  3TDZ A;  2JXC A;  3I5I B;  1SKT A;  1BR4 B;  2OTG B;  5D7F A;  4DCK A;  3DD4 A;  1R6P A;  1AJ4 A;  2KAY A;  3DF0 B;  2EHB A;  1TNX A;  1QV0 A;  2K7C A;  2OPO A;  2BE6 A;  1K9U A;  1QX5 B;  3PLF B;  4ZCV A;  2CCM A;  4ORB B;  4MN0 A;  2WND A;  1BT6 A;  2WCB A;  3RLZ A;  2M8U A;  1YR5 A;  2JC2 A;  2H61 A;  4MVF A;  5ER5 A;  1B4C A;  1W7I B;  1ALW A;  1ZOT B;  1C07 A;  1E8A A;  1QX7 A;  1SR6 C;  2CNP A;  2BCA A;  2QAC A;  4MEW A;  1SYM A;  2H2K A;  2KBM A;  2B1U A;  2LV7 A;  2LVJ A;  1PSB A;  2CTN A;  3AAJ A;  1S6C A;  1G8I A;  2BL0 C;  1WRL A;  1B47 A;  2Q4U A;  1DT7 B;  3AAK A;  4NDD A;  3NSO A;  2NLN A;  3BQ3 A;  4DIR A;  1JF0 A;  4PDZ A;  5HYD A;  1S36 A;  4WQ3 A;  1CFF A;  3EVV A;  5F6T A;  2CBL A;  1KK7 Z;  1K94 A;  2O5G A;  1XFY O;  2MBX A;  3FIA A;  2L51 A;  2LHI A;  2M9G A;  3BUW B;  3E3R A;  2M7N A;  1K9K A;  1XO5 A;  1F4Q A;  2ZN8 A;  1QVI Z;  4CFQ A;  1B8R A;  2EC6 B;  2K7D A;  2KBI A;  3CZT X;  1PUL A;  4M2Q A;  3WHU B;  2LLU A;  1X02 A;  4I5K A;  1YTZ C;  5TNC A;  3PSR A;  5FYX A;  4I5N B;  1SCV A;  2BKH B;  3GK4 X;  1KWO C;  3TDI A;  5HLV A;  3A8R A;  1PK0 D;  1LIN A;  3SIA A;  1CMG A;  3ZWH A;  1CLL A;  4MBE A;  2M0R A;  2KYC A;  2BBN A;  1KCY A;  2HPS A;  3PFV A;  3VRN A;  2L4H A;  4PHK A;  1UP5 A;  1ALV A;  1MXE A;  1N0Y A;  4ICB A;  1S3P A;  5DKQ A;  1J7Q A;  1FI6 A;  1KK7 Y;  4OR9 B;  1CFD A;  3GOF A;  1ZMZ A;  4HSZ A;  4MLW A;  1WDC C;  4D1E A;  2TN4 A;  1S1E A;  2HQ8 A;  3WHT B;  2KFH A;  1B8L A;  1CB1 A;  2KGR A;  1WDC B;  5HLO A;  1YVL A;  1NCY A;  1A2X A;  1MUX A;  1XFU O;  1SY9 A;  1QV1 A;  1KQM C;  1B7T Y;  1MHO A;  2JTZ A;  3JVT B;  1OMV A;  2CT9 A;  4E68 A;  5HKZ A;  1JFJ A;  2MHH A;  1YVH A;  3NXA A;  3CR5 X;  5GQQ C;  2NCO A;  1R2U A;  3LL8 B;  1M31 A;  2CXJ A;  1BR1 B;  1W7J B;  4XJK A;  1HT9 A;  3DVE A;  2KI6 C;  2K8M B;  4P5O E;  2AUC A;  1UHK A;  5KSZ A;  2NXQ A;  1DGV A;  1WLZ A;  1F70 A;  1YRU B;  4YGD B;  1CNP A;  2LP3 A;  3CR2 A;  1NSH A;  1NUB A;  1WLM A;  2M3W A;  2LNK A;  2WOR A;  1A03 A;  2WCF A;  5KTY A;  1NX0 A;  1TIZ A;  3GK2 A;  1QAT A;  3BUX B;  1Y1U A;  2ZRS A;  3D0Y A;  2Y1N A;  3TS5 B;  2VRG A;  1TRF A;  4IL1 A;  1XK4 C;  1RRO A;  1RFJ A;  4ZCU A;  1XFZ O;  1L2O B;  2JNF A;  2LHL A;  1K90 D;  2LE9 B;  3AKB A;  3BUO B;  2I7A A;  4HRH A;  1JF2 A;  1MWN A;  1DMO A;  3O2P A;  4A4C A;  5AER A;  1DJG A;  1M46 A;  3OB2 B;  1NP8 A;  1UWO A;  2KFF A;  4FQO A;  4PHN A;  4QJ4 B;  4YGE B;  4GAO A;  5K89 A;  3PAL A;  4OVN F;  2KQY A;  3D10 A;  2LC5 A;  3CGA A;  4PE4 A;  4AOM A;  1CM1 A;  4XJK B;  4GGF A;  1EG3 A;  1DF0 A;  3EVU A;  2KOT A;  3KEV A;  4GPL B;  1BLQ A;  2IS9 A;  1MR8 A;  2K7O A;  3BOW A;  4C0J A;  2MAZ A;  2KI4 C;  1D1O A;  1TNQ A;  1M45 A;  3PM8 A;  1S6J A;  1BG1 A;  2KFG A;  2KI4 B;  2QPT A;  1REC A;  1Y0V H;  1BJF A;  1PRW A;  1BU3 A;  2GGM A;  2K61 A;  1EJ3 A;  3D0Y B;  1FI5 A;  4JPZ B;  2LVV A;  1UHH A;  4MZJ A;  2JQ6 A;  5CSI A;  1BF5 A;  4YI8 A;  2FCE A;  2JT8 A;  4BY4 A;  1FBV A;  3VRR A;  5I2Q A;  1KK8 B;  1MQ1 A;  5ER4 X;  2JTT A;  3IF7 A;  4CFR A;  3LK1 A;  1SK6 D;  2PAS A;  2NZ0 A;  2Y1M A;  4PE0 A;  5I2L A;  3CWG A;  1DF0 B;  3I5H C;  3OX5 A;  1OMD A;  4MSP A;  4BY5 A;  2LMT A;  2M1U A;  1JC2 A;  3KF9 A;  4CLN A;  4DRW A;  1YX8 A;  5I8N A;  1RWY A;  1YUU A;  1SL9 A;  1SRA A;  2F3Z A;  3I5H B;  5JOL A;  5AEQ A;  4MRY A;  3SG3 A;  3ZNI A;  3VRQ A;  2H61 C;  1DVI A;  2KDH A;  1RJV A;  1KFX S;  5CSF A;  1EH2 A;  2JU0 A;  1A75 A;  2EC6 C;  2WC8 A;  2AAO A;  4CPV A;  3I5G C;  4P2Y B;  2WCE A;  2GGZ A;  4MRX A;  4M2O A;  5AAN A;  4GUK A;  3I5G B;  2EGD A;  4YGA A;  3PAT A;  2G2B A;  1B7T Z;  1NX2 A;  5J3X A;  2OS8 B;  3BYA A;  2GV5 A;  1YUS A;  2I2R E;  2KAV A;  4PHJ A;  1Y1X A;  4GNK B;  1FF1 A;  1QTX A;  1CDP A;  2MA2 A;  1TNW A;  3ICB A;  1KSO A;  1UHJ A;  2ZRT A;  1TN4 A;  1EG4 A;  1GGZ A;  1M63 B;  2BCX A;  2E30 A;  3LK0 A;  4YGB B;  4JWQ A;  3TZ1 A;  4YRU A;  5IBW A;  4NDB A;  5CSJ A;  2HET A;  4PAL A;  3VRO A;  1B8C A;  3PN7 C;  1CLB A;  2JRF A;  4GGN A;  3NSI A;  4ORC B;  1JSA A;  3NSK A;  3VRP A;  3PN7 B;  1AP4 A;  3CR4 X;  3IQO A;  4MZK A;  5AFP A;  1B1G A;  1PVB A;  2M29 A;  2PMY A;  4NQG A;  2FCD A;  4HRG A;  1SCM C;  2Y4Q A;  4YBH B;  4I5L B;  3IQQ A;  2F2P A;  1SW8 A;  1SPY A;  2JUL A;  2K7B A;  1SCM B;  3JVT C;  1J7R A;  1IG5 A;  1NPQ A;  1EXR A;  2Q91 A;  1NWD A;  4PE7 A;  2I18 A;  3TUY C;  4DUQ A;  2F2O A;  2PVB A;  1DGU A;  3SIB A;  3TUY B;  1K95 A;  2M97 A;  1PSR A;  2F3Y A;  3SG6 A;  3SG4 A;  1A29 A;  1G4Y R;  2L5X B;  1GQM A;  4YI9 A;  4A4B A;  1BOC A;  3EK4 A;  2ZFD A;  1S26 D;  4QJ3 B;  4AQJ A;  3BUN B;  4N1F A;  2BEC A;  5DKN A;  3KHE A;  2G9B A;  1CMF A;  1UHI A;  2LMV A;  3FWB A;  1MF8 B;  2M1K B;  1YUR A;  1J7O A;  5DKR A;  5G08 A;  1A4P A;  2JXL A;  4AQI A;  3TS5 C;  1H8B A;  1XVJ A;  1IQ3 A;  2COL B;  1K2H A;  3DVM A;  1QLS A;  1CKK A;  2MJW B;  3EKJ A;  1L2O C;  2O60 A;  1EL4 A;  4NDC A;  2LM5 A;  4OKH A;  2L98 A;  1K8U A;  2LP2 A;  3DVK A;  1N65 A;  1OOJ A;  1IKU A;  1CTR A;  1GGW A;  4Q04 A;  3BXK A;  1CM4 A;  3EK8 A;  5AXI A;  1C7W A;  1ZAC A;  2NCP A;  3DF0 A;  1CDN A;  1SBJ A;  1SNL A;  4TNC A;  5CSN A;  4XYN A;  3I5F C;  1CFP A;  3SJS A;  4FTG A;  3CS1 A;  2M49 B;  2ZN9 A;  1OE9 B;  1Y6W A;  2KHN A;  3HX4 A;  3I5F B;  3EVR A;  2K2A A;  3EKH A;  5I2O A;  3VGO A;  2KYF A;  3LLE A;  3BUM B;  1JWD A;  1LVC D;  1QX2 A;  3RM1 A;  1J1D A;  5KU1 A;  1BMO A;  2L0P A;  1OZS A;  1IQ5 A;  3O78 A;  1WRK A;  1SL7 A;  1K96 A;  1V1F A;  1KFX L;  2PRU A;  3LCP C;  1K9P A;  1F8H A;  1B9A A;  3JTD C;  1M39 A;  2L50 A;  2LLS A;  1KK8 C;  3TDU A;  2ZNE A;  3JTD B;  5PAL A;  3C1V A;  3CTN A;  1TCF A;  1JBA A;  1F4O A;  2ISD A;  3DVJ A;  3H4S E;  1J1E A;  2Y5I A;  2WOS A;  3K21 A;  4GGF C;  3KO0 A;  2KQ6 A;  4GBA A;  2JZI A;  1DJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...