4AQJA

Structure of human s100a7 d24g bound to zinc and calcium
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDGKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A7
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqjA00
1Y1AA 1UHHA 2O60A 2LMTA 2WNDA 3BOWB 4MEWA 1TCFA 1LA0A 3FWBA 2KI6D 1SCVA 2KAXA 2K2FA 3SIAA 1CM4A 1OMVA 2EHBA 1AUIB 3SG6A 3SG3A 3GK1A 2LMUA 3BUNB 2LHLA 2NLNA 3QRXA 1TTXA 5G08A 4D1EA 4UPGA 2BCAA 3CGAA 5I8NA 1DTLA 4M2PA 3H4SE 1OSAA 1A75B 1QATA 1L2OB 2ISDA 4ZCVA 3I5HC 2LM5A 2F2OA 1FPWA 1NX2A 4WQ3A 2K61A 3CR4X 2LE9B 1NWDA 2CCMA 3KF9A 1DGVA 1KCYA 4AQJA 1BG1A 2LAPA 1AP4A 2CNPA 5AFPA 1WDCB 2AAOA 1M45A 2E6WA 1YUTA 1NYAA 1S1EA 2JOJA 2MA2A 4C0JA 1W7IB 1TNPA 2K2AA 4U8DA 4ICBA 1NUBA 1KK8B 3BUOB 1PVBA 1WY9A 2JQ6A 1CLLA 2SCPA 1PSRA 5HLVA 2M7NA 1PALA 2AMIA 3ZWHA 1J7RA 1CLMA 2D8NA 3TDUA 1SKTA 1DVIA 4AOMA 4PHKA 4CPVA 5J3XA 2PMYA 2NCOA 4OV2A 3KPXA 1DJGA 1NCZA 1LVCD 2KI4B 3NSLA 2LP2A 3O6BA 5D69A 2K8MB 1J7PA 2ZN9A 1IGVA 1QIVA 1CDLA 2HQ8A 3EKHA 1BOCA 1KK7Y 3DVKA 2JT0A 1NX3A 3A8RA 2ZRSA 1MXEA 2L51A 4I5LB 1TCOB 2M97A 2OS8C 1KFUS 1V1FA 2KYCA 4ETOA 4XJKB 2COLB 2VRGA 2E30A 3HCMA 2JRFA 3GK2A 1QS7A 2IS9A 2F2PA 3OB2B 2Q91A 4PHNA 1B8CA 3PM8A 1S6JA 1Y1XA 1SW8A 3I5IC 1RWYA 1U5IA 1S3PA 3TDIA 1BF5A 1JFJA 3PN7C 1BR1B 1LINA 1IWQA 2SASA 3DF0A 1YRTB 1YUUA 1QX7A 1S36A 1X02A 2H2KA 4ORAB 4PE1A 4N5XA 5ER5A 4M2OA 1IH0A 1BMOA 4AQIA 1GJYA 1SY9A 2JXCA 3FIAA 3EK8A 1KQMC 2BL0B 3TUYB 1CFFA 1JF0A 3JTDC 1BR4B 2LNKA 2HPSA 3DVEA 4TNCA 5HLOA 2KSPA 2WORA 1XFWO 2ZN8A 3EK7A 1F4OA 1YVHA 1ZOTB 3EKJA 3FWCA 1K94A 1UHIA 2KQYA 3TS5C 4OR9B 3EVRA 1E8AA 1DJZA 2BCXA 3VRPA 1JWDA 3MSEB 1KFUL 1N2DA 1SMGA 1SCMB 1AJ4A 1K90D 2BKHB 2KBMA 3IQOA 4JPZB 1BU3A 5JOLA 1SL8A 1G33A 2KGRA 3VRQA 5AEQA 1F4QA 1PULA 1QVIZ 2PALA 3GK4X 3M0WA 3CR5X 2JULA 2F3YA 1F71A 3BQ3A 5ER4X 1NX1A 1W7JB 3WHTB 2ZRTA 4NDDA 4GPLB 5F6TA 1CFCA 2CBLA 4R1EA 5IBWA 2K0JA 2Y1MA 4HREE 1IG5A 2A4JA 2LUXA 1QX5B 1J1EA 1RFJA 1RROA 3FS7A 1WRZA 3I5HB 2JTTA 1NSHA 1OZSA 1WLZA 4PHJA 1YVLA 2OTGC 3I5GC 2NXQA 2LVJA 2OPOA 1CKKA 4C0LA 1CMFA 3A4UB 4F0ZB 3CR2A 1S5GZ 2M3WA 3NSIA 3ZNIA 4PALA 1SBJA 2KI6C 4MSPA 3BUXB 2L4IA 1JF2A 2JXLA 1XFUO 2MLEC 2M1KB 4MZKA 5HYDA 2JU0A 4GGFC 3BUWB 1F54A 3BUMB 2F8PA 4XYNA 1SR6C 1IQ5A 1ZACA 1UUSA 2ZNEA 4OKHA 1CM1A 4BY5A 2LLUA 2Y5IA 2GGZA 2KHNA 1ALVA 1QV0A 1FF1A 2KNEA 1IQ3A 2LLSA 2MLFC 2PSRA 1DT7B 2QACA 4YGCB 2PVBA 1B8LA 2M0RA 2JTZA 4WRIA 4CLNA 1Y0VH 2PRUA 3PFVA 1SRAA 2NCPA 2BE6A 2M49B 2CTNA 2JZIA 1XYDA 2Q4UA 5CPVA 1EL4A 3JVTC 3C1VA 4OCIA 1HQVA 4HRHA 3AKBA 1GGWA 1DF0A 3LLEA 1WDCC 1K9PA 4MRYA 1EJ3A 3WNXB 2KAVA 5I2LA 1CDPA 1QASA 1L7ZA 1YX7A 1KK8C 1OMDA 1SL7A 2HETA 2L4HA 4NDBA 1AVSA 5HKZA 2LP3A 1J7QA 2G9BA 2JNFA 1Q80A 3SG4A 1XFZO 4P5OE 4WQ2A 1EG3A 1NPQA 2K7DA 3I5FB 1EH2A 1TN4A 1QVIY 4MBEA 2EC6B 3D10A 3BOWA 1QJTA 4GGFA 3DVMA 4M2QA 1J1DA 1GGZA 2BKIB 2EGDA 1MXLC 2LCPA 3E3RA 4MN0A 1JBAA 2KFGA 2LC5A 2Y1NA 1WRKA 3TDZA 1MR8A 3PN7B 1IRJA 1VRKA 5CSFA 4CFQA 2KI4C 4OVNF 1OMRA 1JC2A 5AERA 4GNKB 1YURA 1SK6D 1TIZA 3SIBA 1YUSA 3DVJA 2DOQA 4MZLA 1CDMA 1TNQA 5B8IB 1KQMB 1F70A 4YGAA 1XO5A 5TNCA 3JTDB 5AXIA 4JWQA 3F45A 1G8IA 1KQVA 2KAYA 2TN4A 5HKWA 1WRLA 2KYFA 1M39A 1NIWA 2L5XB 3BXKA 2FJUB 4DUQA 3PSRA 5BPJA 1CNPA 4FQOA 2FCDA 2KOTA 1FBVA 4ORCB 1H4BA 5I2OA 1DJYA 3O78A 2GGMA 3IQQA 4PDZA 3D0YA 1B7TZ 1K9UA 4IL1A 1BLQA 2O5GA 2F3ZA 1YTZC 4BY4A 1CB1A 4GUKA 3EK4A 3SG5A 4NDCA 1NX0A 1CFDA 1M31A 4MLWA 1XA5A 2BBNA 4C0KA 4CFRA 4N1FA 3LK1A 1QX2A 1ODBA 1YRUB 2GV5A 1DGUA 1SPYA 2WOSA 1XK4C 1SYMA 1LA3A 2WC8A 4YI8A 2KDHA 2LVIA 1A4PA 1QIWA 3TUYC 3CS1A 4NQGA 1KWOC 3NSOA 2BCBA 4DCKA 1OZOA 3CZTX 3SJSA 4PE7A 3OP0A 1D1OA 2ZNDA 1QXPA 1NCYA 2M9GA 2WCBA 2WCEA 5DKQA 2LVVA 1R2UA 1DMOA 1DJXA 1G4YR 4YI9A 3KEVA 1TNWA 2JPTA 4L9MA 1S6IA 3HX4A 2L2EA 4XJKA 2LVKA 2OTGB 3I5GB 1FI5A 2FCEA 1KFXS 2AUCA 1C7WA 1RECA 2KBIA 4DS7A 1DJWA 1RTP1 3K21A 4QJ3B 1KSMA 1A29A 1FI6A 1QLSA 1K93D 2I18A 2M8UA 2MJWB 1FW4A 4USLA 1MHOA 5DKRA 4YGDB 5HKYA 1M63B 4Q04A 1NCXA 1SR6B 1UURA 3VROA 2KFFA 1QTXA 3AAKA 1Y1UA 1TOPA 4QJ5B 2L98A 2RGIA 1B47A 4ORBB 4PE4A 3CTNA 1U5IB 4PE0A 1A03A 2K7CA 3WXAA 1XK4A 5KSZA 2JT8A 4DIRA 1K96A 4FTGA 3DF0B 1S6CA 4QJ4B 2LLTA 2CXJA 1QLKA 1TNXA 2MRDA 3PALA 3VRRA 1JUOA 5DKNA 5CSIA 1UHNA 1YR5A 2I94A 1KSOA 3JVTB 1L2OC 3BYAA 3IF7A 4PCWA 5CSJA 2M7LA 4A4CA 2BECA 4A4BA 2JNXA 4YGBB 2K7BA 2QPTA 1TRFA 1WLMA 1CTRA 1GQMA 1B7TY 1K95A 1OQPA 4P2YB 4MRXA 2WCFA 4GFTA 3D0YB 2KFHA 2I7AA 1A2XA 3CWGA 1PVAA 1CFPA 1UHKA 1IKUA 1MUXA 1IJ6A 1J55A 2BE4A 4HSZA 1MQ1A 3AAJA 1B1GA 2OS8B 1XFVO 2P6BB 1KFXL 3VRNA 1F55A 3AKAA 1UP5A 3OHMB 3OB1B 2LV7A 5D7FA 2LMVA 1K8UA 4PHMA 1AHRA 1ZUZA 2MHHA 3LL8B 2BBMA 2KQ6A 2V53A 3I5IB 3O2PA 1AJ5A 1N0YA 2I2RE 1V1GA 2HF5A 2NZ0A 1BT6A 4GBAA 5AANA 2LUCA 3TZ1A 5I2QA 2PASA 1MWNA 2MAZA 3ICBA 4DRWA 3LCPC 1B4CA 2CT9A 1N65A 1NP8A 3LK0A 1OE9B 4YRUA 1SL9A 1A75A 1IJ5A 1LKJA 2L0PA 3CLNA 5FYXA 1JSAA 1CDNA 2F33A 1EG4A 1CLBA 1PRWA 3KO0A 3I5FC 1QV1A 2L50A 1MF8B 3NSKA 2ZFDA 2MBXA 1S5GY 2EC6C 4E68A 5GQQC 1BJFA 1B8RA 4I5NB 1R6PA 2H61C 1UHJA 4GAOA 1AK8A 2G2BA 1J7OA 1UWOA 3TS5B 1CMGA 2ZKMX 1SNLA 1C07A 2LANA 2Y4QA 3VGOA 5CSNA 1BODA 2LHIA 1C7VA 3EVUA 2K7OA 4I5JA 1K2HA 1LXFC 2R2IA 1RJVA 1XFYO 2JWWA 5KTYA 1S26D 1ZFSA 2JT3A 1YX8A 1DJHA 1ZMZA 2FOTA 1PK0D 1H8BA 4ZCUA 1EXRA 1KWOB 3EVVA 1JFKA 1HT9A 3GOFA 4GGNA 3RM1A 2BL0C 4MZJA 3DD4A 2M1UA 4CIDA 4MVFA 1K9KA 3O4YA 4I5KA 4N1GA 3KHEA 1PSBA 1M46A 5PALA 1XFXO 4YGEB 1DJIA 2B1UA 2HQWA 1F8HA 4HRGA 1OOJA 4YBHB 3WHUB 2KGBC 2JC2A 3SG2A 1XVJA 5JJGA 1DF0B 3OX6A 3PLFB 1Y6WA 3NXAA 1KK7Z 1RK9A 5K89A 4JQ0D 3SG7A 2M29A 3RLZA 5KU1A 3OX5A 1SCMC 1B9AA 1ALWA 3PATA 2H61A
chains in the Genus database with same CATH superfamily
1Y1AA 1UHHA 2O60A 2LMTA 2WNDA 3B87A 3BOWB 4MEWA 3DY9A 1TCFA 1LA0A 2K60A 3FWBA 2KI6D 3CZ1A 1SCVA 2KAXA 2K2FA 3B86A 3SIAA 1CM4A 1OMVA 2EHBA 1AUIB 3SG6A 3SG3A 3GK1A 2LMUA 3BUNB 3EG5B 2LHLA 2NLNA 3QRXA 1TTXA 5G08A 4D1EA 4UPGA 2BCAA 3CGAA 5I8NA 1DTLA 4M2PA 2WCHA 3H4SE 1OSAA 1A75B 1QATA 1L2OB 2ISDA 5FI6A 4ZCVA 3I5HC 2LM5A 2F2OA 3RZSA 3NHTA 1FPWA 1NX2A 4WQ3A 2K61A 3CR4X 2LE9B 1NWDA 2CCMA 3KF9A 1DGVA 1LS8A 1KCYA 4AQJA 1BG1A 2LAPA 3OGNA 1AP4A 2CNPA 5AFPA 1WDCB 2AAOA 1M45A 2E6WA 1YUTA 1NYAA 1S1EA 2ERBA 2JOJA 2MA2A 1W7IB 1TNPA 2K2AA 4U8DA 4ICBA 1NUBA 1KK8B 3BUOB 3D74A 1PVBA 1WY9A 2JQ6A 3V2LA 1CLLA 2SCPA 3DYEA 1QWVA 1PSRA 5HLVA 2M7NA 1PALA 2AMIA 3ZWHA 1J7RA 1CLMA 2D8NA 5FI2A 3TDUA 1SKTA 1DVIA 2L2CA 3IVTA 4PHKA 3D77A 4AOMA 4CPVA 5J3XA 2PMYA 2NCOA 4OV2A 3KPXA 1DJGA 1NCZA 1LVCD 2KI4B 3NSLA 2LP2A 3O6BA 5D69A 2K8MB 4JD9A 1J7PA 2ZN9A 1IGVA 1QIVA 1CDLA 2HQ8A 3EKHA 1BOCA 1KK7Y 3CZ2A 2JT0A 1NX3A 3DVKA 1DQEA 3A8RA 2ZRSA 1MXEA 2L51A 3K1EA 4I5LB 1TCOB 4C0JA 2M97A 2OS8C 3S0FA 1KFUS 1V1FA 2KYCA 4ETOA 4XJKB 2COLB 2VRGA 2E30A 3D73A 3HCMA 2JRFA 3GK2A 1QS7A 2IS9A 2F2PA 3OB2B 2Q91A 4PHNA 1B8CA 3PM8A 1S6JA 1Y1XA 1SW8A 3I5IC 1RWYA 1U5IA 1S3PA 3TDIA 1BF5A 1JFJA 3PN7C 1BR1B 1LINA 3D75A 1IWQA 3BFAA 2SASA 3DF0A 1YRTB 5EL2A 1YUUA 1QX7A 1S36A 1X02A 2H2KA 1SSEB 2QEHA 4ORAB 4PE1A 4N5XA 5ER5A 4M2OA 1IH0A 1BMOA 4AQIA 1GJYA 1SY9A 2JXCA 3FIAA 3L4AA 3EK8A 1KQMC 2BL0B 3TUYB 2QEOA 1CFFA 1JF0A 3JTDC 1BR4B 2LNKA 2HPSA 3DVEA 4TNCA 5HLOA 2KSPA 2WORA 1XFWO 2ZN8A 3EK7A 1F4OA 1YVHA 1T14A 1ZOTB 3EKJA 1C3YA 3FWCA 1K94A 1UHIA 2KQYA 2KLDA 3TS5C 4OR9B 3EVRA 1E8AA 1DJZA 2BCXA 3DZTA 3OBVA 5FI7A 3VRPA 1JWDA 3CABA 3MSEB 5HL1A 3BFHA 1KFUL 1N2DA 3QMEA 1SMGA 1SCMB 4F7FA 1AJ4A 1K90D 2BKHB 2KBMA 3IQOA 4JPZB 1BU3A 5JOLA 1SL8A 1G33A 2KGRA 3VRQA 5AEQA 1TUJA 1F4QA 1PULA 1QVIZ 2PALA 3GK4X 3M0WA 3CR5X 2JULA 2F3YA 1F71A 1Z4HA 3BQ3A 5ER4X 1NX1A 1W7JB 3WHTB 2ZRTA 1TUZA 4GPLB 4NDDA 5F6TA 2CBLA 4R1EA 3SS4A 1CFCA 5IBWA 2K0JA 2Y1MA 4HREE 1IG5A 2A4JA 2LUXA 1QX5B 1J1EA 1TWOA 1RFJA 1RROA 3FS7A 1WRZA 3I5HB 2JTTA 3B88A 1NSHA 1OZSA 2GTEA 1WLZA 4PHJA 3B7AA 1YVLA 2OTGC 3I5GC 2NXQA 3VB1A 2LVJA 2OPOA 1CKKA 4C0LA 1CMFA 3A4UB 4F0ZB 3CR2A 1S5GZ 2M3WA 3NSIA 3ZNIA 4PALA 2L5YA 1SBJA 2KI6C 4MSPA 3BUXB 2KLEA 2L4IA 1JF2A 2JXLA 1XFUO 2MLEC 2M1KB 4MZKA 3S0BA 5HYDA 2JU0A 4GGFC 3BUWB 1F54A 3BUMB 4JKTA 2F8PA 3S0DA 4XYNA 1SR6C 1IQ5A 1ZACA 1UUSA 2ZNEA 4OKHA 1CM1A 4BY5A 2LLUA 2Y5IA 2GGZA 2KHNA 1ALVA 1QV0A 1FF1A 2KNEA 1IQ3A 2LLSA 2MLFC 2PSRA 4KYNA 1DT7B 2QACA 4YGCB 2PVBA 1B8LA 2M0RA 2JTZA 4WRIA 4CLNA 1Y0VH 2PRUA 3PFVA 1SRAA 2NCPA 2BE6A 2M49B 2CTNA 2JZIA 1XYDA 2Q4UA 5CPVA 1OOFA 5I94A 1EL4A 3JVTC 3C1VA 3O4XA 1HQVA 4OCIA 4HRHA 5DICA 3AKBA 1GGWA 3DXLA 1DF0A 2H8VA 3LLEA 1WDCC 1K9PA 4MRYA 1EJ3A 3WNXB 2KAVA 5I2LA 1CDPA 1QASA 3UO9A 1L7ZA 1YX7A 1KK8C 1OMDA 1SL7A 2HETA 2L4HA 4NDBA 1AVSA 5HKZA 2LP3A 1J7QA 2G9BA 2JNFA 1Q80A 3SG4A 1XFZO 4P5OE 1OOIX 4WQ2A 1EG3A 1NPQA 2K7DA 3I5FB 1EH2A 1TN4A 1QVIY 4MBEA 2EC6B 3D10A 3BOWA 1QJTA 4PT1A 3L4LA 4GGFA 3SS5A 3DVMA 4M2QA 1J1DA 1GGZA 2BKIB 2EGDA 1MXLC 2LCPA 3E3RA 4MN0A 1JBAA 2KFGA 2LC5A 2Y1NA 1WRKA 3TDZA 1MR8A 3PN7B 1IRJA 1VRKA 5CSFA 4CFQA 2KI4C 4OVNF 1OMRA 1JC2A 3NGVA 5AERA 4GNKB 2QEBA 1YURA 1SK6D 1TIZA 3SIBA 1YUSA 3DVJA 2DOQA 4MZLA 1CDMA 1TNQA 5B8IB 3R1OA 1KQMB 1F70A 4YGAA 1XO5A 5TNCA 3JTDB 5AXIA 4JWQA 3F45A 1G8IA 1KQVA 2KAYA 2TN4A 3CDNA 1WRLA 2KYFA 5HKWA 1M39A 1NIWA 2L5XB 3BXKA 1IIOA 2FJUB 4DUQA 3PSRA 5BPJA 1CNPA 1DELA 4FQOA 2FCDA 2KOTA 1FBVA 4ORCB 1H4BA 5I2OA 1DJYA 3O78A 2GGMA 3IQQA 4PDZA 3D0YA 1B7TZ 1K9UA 4IL1A 1BLQA 2O5GA 2F3ZA 1YTZC 4BY4A 1CB1A 4GUKA 3EK4A 3SG5A 4NDCA 1NX0A 1CFDA 1C3ZA 3L47A 1M31A 4MLWA 1XA5A 2BBNA 3FE8A 4C0KA 4CFRA 4N1FA 3LK1A 1QX2A 1ODBA 1YRUB 3UNWA 2GV5A 1DGUA 1SPYA 2WOSA 1XK4C 3PM2A 1SYMA 1LA3A 2WC8A 4YI8A 2KDHA 2LVIA 1A4PA 1QIWA 3TUYC 1OOGA 3CS1A 4NQGA 1KWOC 3NSOA 2BCBA 4DCKA 1OZOA 3CZTX 3SJSA 4PE7A 3OP0A 2QEVA 1D1OA 2ZNDA 1QXPA 1NCYA 2M9GA 3PATA 2WCBA 2WCEA 5DKQA 2LVVA 1R2UA 3Q8IA 1DMOA 1DJXA 3FE6A 1G4YR 4YI9A 3KEVA 3R1VA 1TNWA 2JPTA 2KPHA 4L9MA 1S6IA 3HX4A 2L2EA 4XJKA 2LVKA 2OTGB 3I5GB 1Z2CB 1FI5A 2FCEA 1KFXS 2AUCA 1C7WA 1RECA 3BJHA 3N7HA 3NHIA 4IJ7A 2KBIA 4DS7A 1DJWA 1RTP1 3K21A 2WCKA 3PJIA 1DEKA 4QJ3B 1KSMA 1A29A 1FI6A 1QLSA 1K93D 2I18A 2M8UA 2MJWB 1FW4A 4USLA 1MHOA 3BFBA 4YGDB 5DKRA 5HKYA 1M63B 4Q04A 1NCXA 1SR6B 1UURA 3VROA 1GM0A 2KFFA 1QTXA 3AAKA 1Y1UA 1TOPA 4QJ5B 2L98A 2RGIA 1B47A 4ORBB 4PE4A 3CTNA 1U5IB 4PE0A 1A03A 2K7CA 3WXAA 1XK4A 5KSZA 2JT8A 4DIRA 1K96A 4FTGA 3DF0B 1S6CA 4QJ4B 2LLTA 2CXJA 1QLKA 1TNXA 2MRDA 3PALA 3VRRA 1JUOA 5DKNA 5CSIA 1UHNA 1YR5A 2I94A 1KSOA 3JVTB 1L2OC 3BYAA 3IF7A 4PCWA 5CSJA 4INWA 2M7LA 4A4CA 2BECA 4A4BA 1P28A 2JNXA 4YGBB 2K7BA 2QPTA 1TRFA 1WLMA 1CTRA 1GQMA 1B7TY 4INXA 1K95A 1OQPA 4P2YB 4MRXA 2WCFA 4GFTA 3D0YB 2KFHA 2I7AA 1A2XA 3CWGA 1PVAA 1CFPA 1UHKA 1IKUA 1MUXA 4FQTA 1IJ6A 1J55A 2BE4A 4HSZA 1MQ1A 3AAJA 1B1GA 2OS8B 1XFVO 2P6BB 1KFXL 3VRNA 3CYZA 1F55A 3AKAA 1UP5A 3OHMB 3OB1B 2LV7A 5D7FA 2LMVA 1K8UA 4PHMA 1AHRA 1ZUZA 2MHHA 3LL8B 2BBMA 2KQ6A 2V53A 3I5IB 1OW4A 2WC6A 1AJ5A 1N0YA 3O2PA 1OOHA 2I2RE 1V1GA 2HF5A 2NZ0A 1BT6A 1W9ZA 4GBAA 2LUCA 5AANA 3TZ1A 2QDIA 5I2QA 2PASA 1MWNA 2MAZA 2PQLA 3ICBA 3LCPC 4DRWA 1B4CA 2CT9A 1N65A 1NP8A 3LK0A 1OE9B 1ORGA 4YRUA 1SL9A 1A75A 1IJ5A 1LKJA 2L0PA 3CLNA 5FYXA 1JSAA 1CDNA 2F33A 1EG4A 2WCJA 1CLBA 2WCMA 1PRWA 3S0EA 3KO0A 3I5FC 1QV1A 2L50A 1MF8B 3NSKA 2ZFDA 3R72A 2MBXA 1S5GY 2EC6C 4E68A 1XFRA 5GQQC 1BJFA 1B8RA 4I5NB 1R6PA 2H61C 1UHJA 4GAOA 1AK8A 2G2BA 1J7OA 1UWOA 3TS5B 1CMGA 2ZKMX 1SNLA 1C07A 3R1PA 2LANA 2Y4QA 3VGOA 5CSNA 1BODA 2LHIA 1C7VA 3EVUA 2K7OA 3SS3A 3S0AA 4I5JA 1K2HA 1LXFC 2R2IA 2JPOA 1RJVA 1XFYO 2JWWA 2PYQA 5KTYA 1S26D 1ZFSA 2P70A 3CZ0A 2JT3A 1YX8A 1DJHA 1ZMZA 2FOTA 1PK0D 1H8BA 3D76A 4ZCUA 2WC5A 1EXRA 1KWOB 3EVVA 1JFKA 1HT9A 2FJYA 3GOFA 4GGNA 3RM1A 2BL0C 4MZJA 3DD4A 2M1UA 4CIDA 4MVFA 1K9KA 3O4YA 4I5KA 4N1GA 2YGUA 3KHEA 1PSBA 1M46A 1DC1A 5PALA 1XFXO 4YGEB 1DJIA 2B1UA 2HQWA 1F8HA 3D78A 4HRGA 1OOJA 4YBHB 3WHUB 2KGBC 2JC2A 3SG2A 1XVJA 5JJGA 4OZDA 1DF0B 3OX6A 2BAPA 3PLFB 1Y6WA 5D3OA 3NXAA 1KK7Z 2P71A 1RK9A 2BNXA 5K89A 4JQ0D 2WCLA 3SG7A 2M29A 3RLZA 5KU1A 3OX5A 1SCMC 1B9AA 1ALWA 3B6XA 2H61A 3FE9A 3S0GA
chains in the Genus database with same CATH topology
1Y1AA 1UHHA 2O60A 2LMTA 2WNDA 3BOWB 4MEWA 1TCFA 1LA0A 3FWBA 2KI6D 1SCVA 2KAXA 2K2FA 3SIAA 1CM4A 1OMVA 2EHBA 1AUIB 3SG6A 3SG3A 3GK1A 2LMUA 3BUNB 2LHLA 2NLNA 3QRXA 1TTXA 5G08A 4D1EA 4UPGA 2BCAA 3CGAA 5I8NA 1DTLA 4M2PA 3H4SE 1OSAA 1A75B 1QATA 1L2OB 2ISDA 4ZCVA 3I5HC 2LM5A 2F2OA 1FPWA 1NX2A 4WQ3A 2K61A 3CR4X 2LE9B 1NWDA 2CCMA 3KF9A 1DGVA 1KCYA 4AQJA 1BG1A 2LAPA 1AP4A 2CNPA 5AFPA 1WDCB 2AAOA 1M45A 2E6WA 1YUTA 1NYAA 1S1EA 2JOJA 2MA2A 4C0JA 1W7IB 1TNPA 2K2AA 4U8DA 4ICBA 1NUBA 1KK8B 3BUOB 1PVBA 1WY9A 2JQ6A 1CLLA 2SCPA 1PSRA 5HLVA 2M7NA 1PALA 2AMIA 3ZWHA 1J7RA 1CLMA 2D8NA 3TDUA 1SKTA 1DVIA 4AOMA 4PHKA 4CPVA 5J3XA 2PMYA 2NCOA 4OV2A 3KPXA 1DJGA 1NCZA 1LVCD 2KI4B 3NSLA 2LP2A 3O6BA 5D69A 2K8MB 1J7PA 2ZN9A 1IGVA 1QIVA 1CDLA 2HQ8A 3EKHA 1BOCA 1KK7Y 3DVKA 2JT0A 1NX3A 3A8RA 2ZRSA 1MXEA 2L51A 4I5LB 1TCOB 2M97A 2OS8C 1KFUS 1V1FA 2KYCA 4ETOA 4XJKB 2COLB 2VRGA 2E30A 3HCMA 2JRFA 3GK2A 1QS7A 2IS9A 2F2PA 3OB2B 2Q91A 4PHNA 1B8CA 3PM8A 1S6JA 1Y1XA 1SW8A 3I5IC 1RWYA 1U5IA 1S3PA 3TDIA 1BF5A 1JFJA 3PN7C 1BR1B 1LINA 1IWQA 2SASA 3DF0A 1YRTB 1YUUA 1QX7A 1S36A 1X02A 2H2KA 4ORAB 4PE1A 4N5XA 5ER5A 4M2OA 1IH0A 1BMOA 4AQIA 1GJYA 1SY9A 2JXCA 3FIAA 3EK8A 1KQMC 2BL0B 3TUYB 1CFFA 1JF0A 3JTDC 1BR4B 2LNKA 2HPSA 3DVEA 4TNCA 5HLOA 2KSPA 2WORA 1XFWO 2ZN8A 3EK7A 1F4OA 1YVHA 1ZOTB 3EKJA 3FWCA 1K94A 1UHIA 2KQYA 3TS5C 4OR9B 3EVRA 1E8AA 1DJZA 2BCXA 3VRPA 1JWDA 3MSEB 1KFUL 1N2DA 1SMGA 1SCMB 1AJ4A 1K90D 2BKHB 2KBMA 3IQOA 4JPZB 1BU3A 5JOLA 1SL8A 1G33A 2KGRA 3VRQA 5AEQA 1F4QA 1PULA 1QVIZ 2PALA 3GK4X 3M0WA 3CR5X 2JULA 2F3YA 1F71A 3BQ3A 5ER4X 1NX1A 1W7JB 3WHTB 2ZRTA 4NDDA 4GPLB 5F6TA 1CFCA 2CBLA 4R1EA 5IBWA 2K0JA 2Y1MA 4HREE 1IG5A 2A4JA 2LUXA 1QX5B 1J1EA 1RFJA 1RROA 3FS7A 1WRZA 3I5HB 2JTTA 1NSHA 1OZSA 1WLZA 4PHJA 1YVLA 2OTGC 3I5GC 2NXQA 2LVJA 2OPOA 1CKKA 4C0LA 1CMFA 3A4UB 4F0ZB 3CR2A 1S5GZ 2M3WA 3NSIA 3ZNIA 4PALA 1SBJA 2KI6C 4MSPA 3BUXB 2L4IA 1JF2A 2JXLA 1XFUO 2MLEC 2M1KB 4MZKA 5HYDA 2JU0A 4GGFC 3BUWB 1F54A 3BUMB 2F8PA 4XYNA 1SR6C 1IQ5A 1ZACA 1UUSA 2ZNEA 4OKHA 1CM1A 4BY5A 2LLUA 2Y5IA 2GGZA 2KHNA 1ALVA 1QV0A 1FF1A 2KNEA 1IQ3A 2LLSA 2MLFC 2PSRA 1DT7B 2QACA 4YGCB 2PVBA 1B8LA 2M0RA 2JTZA 4WRIA 4CLNA 1Y0VH 2PRUA 3PFVA 1SRAA 2NCPA 2BE6A 2M49B 2CTNA 2JZIA 1XYDA 2Q4UA 5CPVA 1EL4A 3JVTC 3C1VA 4OCIA 1HQVA 4HRHA 3AKBA 1GGWA 1DF0A 3LLEA 1WDCC 1K9PA 4MRYA 1EJ3A 3WNXB 2KAVA 5I2LA 1CDPA 1QASA 1L7ZA 1YX7A 1KK8C 1OMDA 1SL7A 2HETA 2L4HA 4NDBA 1AVSA 5HKZA 2LP3A 1J7QA 2G9BA 2JNFA 1Q80A 3SG4A 1XFZO 4P5OE 4WQ2A 1EG3A 1NPQA 2K7DA 3I5FB 1EH2A 1TN4A 1QVIY 4MBEA 2EC6B 3D10A 3BOWA 1QJTA 4GGFA 3DVMA 4M2QA 1J1DA 1GGZA 2BKIB 2EGDA 1MXLC 2LCPA 3E3RA 4MN0A 1JBAA 2KFGA 2LC5A 2Y1NA 1WRKA 3TDZA 1MR8A 3PN7B 1IRJA 1VRKA 5CSFA 4CFQA 2KI4C 4OVNF 1OMRA 1JC2A 5AERA 4GNKB 1YURA 1SK6D 1TIZA 3SIBA 1YUSA 3DVJA 2DOQA 4MZLA 1CDMA 1TNQA 5B8IB 1KQMB 1F70A 4YGAA 1XO5A 5TNCA 3JTDB 5AXIA 4JWQA 3F45A 1G8IA 1KQVA 2KAYA 2TN4A 5HKWA 1WRLA 2KYFA 1M39A 1NIWA 2L5XB 3BXKA 2FJUB 4DUQA 3PSRA 5BPJA 1CNPA 4FQOA 2FCDA 2KOTA 1FBVA 4ORCB 1H4BA 5I2OA 1DJYA 3O78A 2GGMA 3IQQA 4PDZA 3D0YA 1B7TZ 1K9UA 4IL1A 1BLQA 2O5GA 2F3ZA 1YTZC 4BY4A 1CB1A 4GUKA 3EK4A 3SG5A 4NDCA 1NX0A 1CFDA 1M31A 4MLWA 1XA5A 2BBNA 4C0KA 4CFRA 4N1FA 3LK1A 1QX2A 1ODBA 1YRUB 2GV5A 1DGUA 1SPYA 2WOSA 1XK4C 1SYMA 1LA3A 2WC8A 4YI8A 2KDHA 2LVIA 1A4PA 1QIWA 3TUYC 3CS1A 4NQGA 1KWOC 3NSOA 2BCBA 4DCKA 1OZOA 3CZTX 3SJSA 4PE7A 3OP0A 1D1OA 2ZNDA 1QXPA 1NCYA 2M9GA 2WCBA 2WCEA 5DKQA 2LVVA 1R2UA 1DMOA 1DJXA 1G4YR 4YI9A 3KEVA 1TNWA 2JPTA 4L9MA 1S6IA 3HX4A 2L2EA 4XJKA 2LVKA 2OTGB 3I5GB 1FI5A 2FCEA 1KFXS 2AUCA 1C7WA 1RECA 2KBIA 4DS7A 1DJWA 1RTP1 3K21A 4QJ3B 1KSMA 1A29A 1FI6A 1QLSA 1K93D 2I18A 2M8UA 2MJWB 1FW4A 4USLA 1MHOA 5DKRA 4YGDB 5HKYA 1M63B 4Q04A 1NCXA 1SR6B 1UURA 3VROA 2KFFA 1QTXA 3AAKA 1Y1UA 1TOPA 4QJ5B 2L98A 2RGIA 1B47A 4ORBB 4PE4A 3CTNA 1U5IB 4PE0A 1A03A 2K7CA 3WXAA 1XK4A 5KSZA 2JT8A 4DIRA 1K96A 4FTGA 3DF0B 1S6CA 4QJ4B 2LLTA 2CXJA 1QLKA 1TNXA 2MRDA 3PALA 3VRRA 1JUOA 5DKNA 5CSIA 1UHNA 1YR5A 2I94A 1KSOA 3JVTB 1L2OC 3BYAA 3IF7A 4PCWA 5CSJA 2M7LA 4A4CA 2BECA 4A4BA 2JNXA 4YGBB 2K7BA 2QPTA 1TRFA 1WLMA 1CTRA 1GQMA 1B7TY 1K95A 1OQPA 4P2YB 4MRXA 2WCFA 4GFTA 3D0YB 2KFHA 2I7AA 1A2XA 3CWGA 1PVAA 1CFPA 1UHKA 1IKUA 1MUXA 1IJ6A 1J55A 2BE4A 4HSZA 1MQ1A 3AAJA 1B1GA 2OS8B 1XFVO 2P6BB 1KFXL 3VRNA 1F55A 3AKAA 1UP5A 3OHMB 3OB1B 2LV7A 5D7FA 2LMVA 1K8UA 4PHMA 1AHRA 1ZUZA 2MHHA 3LL8B 2BBMA 2KQ6A 2V53A 3I5IB 3O2PA 1AJ5A 1N0YA 2I2RE 1V1GA 2HF5A 2NZ0A 1BT6A 4GBAA 5AANA 2LUCA 3TZ1A 5I2QA 2PASA 1MWNA 2MAZA 3ICBA 4DRWA 3LCPC 1B4CA 2CT9A 1N65A 1NP8A 3LK0A 1OE9B 4YRUA 1SL9A 1A75A 1IJ5A 1LKJA 2L0PA 3CLNA 5FYXA 1JSAA 1CDNA 2F33A 1EG4A 1CLBA 1PRWA 3KO0A 3I5FC 1QV1A 2L50A 1MF8B 3NSKA 2ZFDA 2MBXA 1S5GY 2EC6C 4E68A 5GQQC 1BJFA 1B8RA 4I5NB 1R6PA 2H61C 1UHJA 4GAOA 1AK8A 2G2BA 1J7OA 1UWOA 3TS5B 1CMGA 2ZKMX 1SNLA 1C07A 2LANA 2Y4QA 3VGOA 5CSNA 1BODA 2LHIA 1C7VA 3EVUA 2K7OA 4I5JA 1K2HA 1LXFC 2R2IA 1RJVA 1XFYO 2JWWA 5KTYA 1S26D 1ZFSA 2JT3A 1YX8A 1DJHA 1ZMZA 2FOTA 1PK0D 1H8BA 4ZCUA 1EXRA 1KWOB 3EVVA 1JFKA 1HT9A 3GOFA 4GGNA 3RM1A 2BL0C 4MZJA 3DD4A 2M1UA 4CIDA 4MVFA 1K9KA 3O4YA 4I5KA 4N1GA 3KHEA 1PSBA 1M46A 5PALA 1XFXO 4YGEB 1DJIA 2B1UA 2HQWA 1F8HA 4HRGA 1OOJA 4YBHB 3WHUB 2KGBC 2JC2A 3SG2A 1XVJA 5JJGA 1DF0B 3OX6A 3PLFB 1Y6WA 3NXAA 1KK7Z 1RK9A 5K89A 4JQ0D 3SG7A 2M29A 3RLZA 5KU1A 3OX5A 1SCMC 1B9AA 1ALWA 3PATA 2H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1A A;  1UHH A;  2O60 A;  2LMT A;  2WND A;  3BOW B;  4MEW A;  1TCF A;  1LA0 A;  3FWB A;  2KI6 D;  1SCV A;  2KAX A;  2K2F A;  3SIA A;  1CM4 A;  1OMV A;  2EHB A;  1AUI B;  3SG6 A;  3SG3 A;  3GK1 A;  2LMU A;  3BUN B;  2LHL A;  2NLN A;  3QRX A;  1TTX A;  5G08 A;  4D1E A;  4UPG A;  2BCA A;  3CGA A;  5I8N A;  1DTL A;  4M2P A;  3H4S E;  1OSA A;  1A75 B;  1QAT A;  1L2O B;  2ISD A;  4ZCV A;  3I5H C;  2LM5 A;  2F2O A;  1FPW A;  1NX2 A;  4WQ3 A;  2K61 A;  3CR4 X;  2LE9 B;  1NWD A;  2CCM A;  3KF9 A;  1DGV A;  1KCY A;  4AQJ A;  1BG1 A;  2LAP A;  1AP4 A;  2CNP A;  5AFP A;  1WDC B;  2AAO A;  1M45 A;  2E6W A;  1YUT A;  1NYA A;  1S1E A;  2JOJ A;  2MA2 A;  4C0J A;  1W7I B;  1TNP A;  2K2A A;  4U8D A;  4ICB A;  1NUB A;  1KK8 B;  3BUO B;  1PVB A;  1WY9 A;  2JQ6 A;  1CLL A;  2SCP A;  1PSR A;  5HLV A;  2M7N A;  1PAL A;  2AMI A;  3ZWH A;  1J7R A;  1CLM A;  2D8N A;  3TDU A;  1SKT A;  1DVI A;  4AOM A;  4PHK A;  4CPV A;  5J3X A;  2PMY A;  2NCO A;  4OV2 A;  3KPX A;  1DJG A;  1NCZ A;  1LVC D;  2KI4 B;  3NSL A;  2LP2 A;  3O6B A;  5D69 A;  2K8M B;  1J7P A;  2ZN9 A;  1IGV A;  1QIV A;  1CDL A;  2HQ8 A;  3EKH A;  1BOC A;  1KK7 Y;  3DVK A;  2JT0 A;  1NX3 A;  3A8R A;  2ZRS A;  1MXE A;  2L51 A;  4I5L B;  1TCO B;  2M97 A;  2OS8 C;  1KFU S;  1V1F A;  2KYC A;  4ETO A;  4XJK B;  2COL B;  2VRG A;  2E30 A;  3HCM A;  2JRF A;  3GK2 A;  1QS7 A;  2IS9 A;  2F2P A;  3OB2 B;  2Q91 A;  4PHN A;  1B8C A;  3PM8 A;  1S6J A;  1Y1X A;  1SW8 A;  3I5I C;  1RWY A;  1U5I A;  1S3P A;  3TDI A;  1BF5 A;  1JFJ A;  3PN7 C;  1BR1 B;  1LIN A;  1IWQ A;  2SAS A;  3DF0 A;  1YRT B;  1YUU A;  1QX7 A;  1S36 A;  1X02 A;  2H2K A;  4ORA B;  4PE1 A;  4N5X A;  5ER5 A;  4M2O A;  1IH0 A;  1BMO A;  4AQI A;  1GJY A;  1SY9 A;  2JXC A;  3FIA A;  3EK8 A;  1KQM C;  2BL0 B;  3TUY B;  1CFF A;  1JF0 A;  3JTD C;  1BR4 B;  2LNK A;  2HPS A;  3DVE A;  4TNC A;  5HLO A;  2KSP A;  2WOR A;  1XFW O;  2ZN8 A;  3EK7 A;  1F4O A;  1YVH A;  1ZOT B;  3EKJ A;  3FWC A;  1K94 A;  1UHI A;  2KQY A;  3TS5 C;  4OR9 B;  3EVR A;  1E8A A;  1DJZ A;  2BCX A;  3VRP A;  1JWD A;  3MSE B;  1KFU L;  1N2D A;  1SMG A;  1SCM B;  1AJ4 A;  1K90 D;  2BKH B;  2KBM A;  3IQO A;  4JPZ B;  1BU3 A;  5JOL A;  1SL8 A;  1G33 A;  2KGR A;  3VRQ A;  5AEQ A;  1F4Q A;  1PUL A;  1QVI Z;  2PAL A;  3GK4 X;  3M0W A;  3CR5 X;  2JUL A;  2F3Y A;  1F71 A;  3BQ3 A;  5ER4 X;  1NX1 A;  1W7J B;  3WHT B;  2ZRT A;  4NDD A;  4GPL B;  5F6T A;  1CFC A;  2CBL A;  4R1E A;  5IBW A;  2K0J A;  2Y1M A;  4HRE E;  1IG5 A;  2A4J A;  2LUX A;  1QX5 B;  1J1E A;  1RFJ A;  1RRO A;  3FS7 A;  1WRZ A;  3I5H B;  2JTT A;  1NSH A;  1OZS A;  1WLZ A;  4PHJ A;  1YVL A;  2OTG C;  3I5G C;  2NXQ A;  2LVJ A;  2OPO A;  1CKK A;  4C0L A;  1CMF A;  3A4U B;  4F0Z B;  3CR2 A;  1S5G Z;  2M3W A;  3NSI A;  3ZNI A;  4PAL A;  1SBJ A;  2KI6 C;  4MSP A;  3BUX B;  2L4I A;  1JF2 A;  2JXL A;  1XFU O;  2MLE C;  2M1K B;  4MZK A;  5HYD A;  2JU0 A;  4GGF C;  3BUW B;  1F54 A;  3BUM B;  2F8P A;  4XYN A;  1SR6 C;  1IQ5 A;  1ZAC A;  1UUS A;  2ZNE A;  4OKH A;  1CM1 A;  4BY5 A;  2LLU A;  2Y5I A;  2GGZ A;  2KHN A;  1ALV A;  1QV0 A;  1FF1 A;  2KNE A;  1IQ3 A;  2LLS A;  2MLF C;  2PSR A;  1DT7 B;  2QAC A;  4YGC B;  2PVB A;  1B8L A;  2M0R A;  2JTZ A;  4WRI A;  4CLN A;  1Y0V H;  2PRU A;  3PFV A;  1SRA A;  2NCP A;  2BE6 A;  2M49 B;  2CTN A;  2JZI A;  1XYD A;  2Q4U A;  5CPV A;  1EL4 A;  3JVT C;  3C1V A;  4OCI A;  1HQV A;  4HRH A;  3AKB A;  1GGW A;  1DF0 A;  3LLE A;  1WDC C;  1K9P A;  4MRY A;  1EJ3 A;  3WNX B;  2KAV A;  5I2L A;  1CDP A;  1QAS A;  1L7Z A;  1YX7 A;  1KK8 C;  1OMD A;  1SL7 A;  2HET A;  2L4H A;  4NDB A;  1AVS A;  5HKZ A;  2LP3 A;  1J7Q A;  2G9B A;  2JNF A;  1Q80 A;  3SG4 A;  1XFZ O;  4P5O E;  4WQ2 A;  1EG3 A;  1NPQ A;  2K7D A;  3I5F B;  1EH2 A;  1TN4 A;  1QVI Y;  4MBE A;  2EC6 B;  3D10 A;  3BOW A;  1QJT A;  4GGF A;  3DVM A;  4M2Q A;  1J1D A;  1GGZ A;  2BKI B;  2EGD A;  1MXL C;  2LCP A;  3E3R A;  4MN0 A;  1JBA A;  2KFG A;  2LC5 A;  2Y1N A;  1WRK A;  3TDZ A;  1MR8 A;  3PN7 B;  1IRJ A;  1VRK A;  5CSF A;  4CFQ A;  2KI4 C;  4OVN F;  1OMR A;  1JC2 A;  5AER A;  4GNK B;  1YUR A;  1SK6 D;  1TIZ A;  3SIB A;  1YUS A;  3DVJ A;  2DOQ A;  4MZL A;  1CDM A;  1TNQ A;  5B8I B;  1KQM B;  1F70 A;  4YGA A;  1XO5 A;  5TNC A;  3JTD B;  5AXI A;  4JWQ A;  3F45 A;  1G8I A;  1KQV A;  2KAY A;  2TN4 A;  5HKW A;  1WRL A;  2KYF A;  1M39 A;  1NIW A;  2L5X B;  3BXK A;  2FJU B;  4DUQ A;  3PSR A;  5BPJ A;  1CNP A;  4FQO A;  2FCD A;  2KOT A;  1FBV A;  4ORC B;  1H4B A;  5I2O A;  1DJY A;  3O78 A;  2GGM A;  3IQQ A;  4PDZ A;  3D0Y A;  1B7T Z;  1K9U A;  4IL1 A;  1BLQ A;  2O5G A;  2F3Z A;  1YTZ C;  4BY4 A;  1CB1 A;  4GUK A;  3EK4 A;  3SG5 A;  4NDC A;  1NX0 A;  1CFD A;  1M31 A;  4MLW A;  1XA5 A;  2BBN A;  4C0K A;  4CFR A;  4N1F A;  3LK1 A;  1QX2 A;  1ODB A;  1YRU B;  2GV5 A;  1DGU A;  1SPY A;  2WOS A;  1XK4 C;  1SYM A;  1LA3 A;  2WC8 A;  4YI8 A;  2KDH A;  2LVI A;  1A4P A;  1QIW A;  3TUY C;  3CS1 A;  4NQG A;  1KWO C;  3NSO A;  2BCB A;  4DCK A;  1OZO A;  3CZT X;  3SJS A;  4PE7 A;  3OP0 A;  1D1O A;  2ZND A;  1QXP A;  1NCY A;  2M9G A;  2WCB A;  2WCE A;  5DKQ A;  2LVV A;  1R2U A;  1DMO A;  1DJX A;  1G4Y R;  4YI9 A;  3KEV A;  1TNW A;  2JPT A;  4L9M A;  1S6I A;  3HX4 A;  2L2E A;  4XJK A;  2LVK A;  2OTG B;  3I5G B;  1FI5 A;  2FCE A;  1KFX S;  2AUC A;  1C7W A;  1REC A;  2KBI A;  4DS7 A;  1DJW A;  1RTP 1;  3K21 A;  4QJ3 B;  1KSM A;  1A29 A;  1FI6 A;  1QLS A;  1K93 D;  2I18 A;  2M8U A;  2MJW B;  1FW4 A;  4USL A;  1MHO A;  5DKR A;  4YGD B;  5HKY A;  1M63 B;  4Q04 A;  1NCX A;  1SR6 B;  1UUR A;  3VRO A;  2KFF A;  1QTX A;  3AAK A;  1Y1U A;  1TOP A;  4QJ5 B;  2L98 A;  2RGI A;  1B47 A;  4ORB B;  4PE4 A;  3CTN A;  1U5I B;  4PE0 A;  1A03 A;  2K7C A;  3WXA A;  1XK4 A;  5KSZ A;  2JT8 A;  4DIR A;  1K96 A;  4FTG A;  3DF0 B;  1S6C A;  4QJ4 B;  2LLT A;  2CXJ A;  1QLK A;  1TNX A;  2MRD A;  3PAL A;  3VRR A;  1JUO A;  5DKN A;  5CSI A;  1UHN A;  1YR5 A;  2I94 A;  1KSO A;  3JVT B;  1L2O C;  3BYA A;  3IF7 A;  4PCW A;  5CSJ A;  2M7L A;  4A4C A;  2BEC A;  4A4B A;  2JNX A;  4YGB B;  2K7B A;  2QPT A;  1TRF A;  1WLM A;  1CTR A;  1GQM A;  1B7T Y;  1K95 A;  1OQP A;  4P2Y B;  4MRX A;  2WCF A;  4GFT A;  3D0Y B;  2KFH A;  2I7A A;  1A2X A;  3CWG A;  1PVA A;  1CFP A;  1UHK A;  1IKU A;  1MUX A;  1IJ6 A;  1J55 A;  2BE4 A;  4HSZ A;  1MQ1 A;  3AAJ A;  1B1G A;  2OS8 B;  1XFV O;  2P6B B;  1KFX L;  3VRN A;  1F55 A;  3AKA A;  1UP5 A;  3OHM B;  3OB1 B;  2LV7 A;  5D7F A;  2LMV A;  1K8U A;  4PHM A;  1AHR A;  1ZUZ A;  2MHH A;  3LL8 B;  2BBM A;  2KQ6 A;  2V53 A;  3I5I B;  3O2P A;  1AJ5 A;  1N0Y A;  2I2R E;  1V1G A;  2HF5 A;  2NZ0 A;  1BT6 A;  4GBA A;  5AAN A;  2LUC A;  3TZ1 A;  5I2Q A;  2PAS A;  1MWN A;  2MAZ A;  3ICB A;  4DRW A;  3LCP C;  1B4C A;  2CT9 A;  1N65 A;  1NP8 A;  3LK0 A;  1OE9 B;  4YRU A;  1SL9 A;  1A75 A;  1IJ5 A;  1LKJ A;  2L0P A;  3CLN A;  5FYX A;  1JSA A;  1CDN A;  2F33 A;  1EG4 A;  1CLB A;  1PRW A;  3KO0 A;  3I5F C;  1QV1 A;  2L50 A;  1MF8 B;  3NSK A;  2ZFD A;  2MBX A;  1S5G Y;  2EC6 C;  4E68 A;  5GQQ C;  1BJF A;  1B8R A;  4I5N B;  1R6P A;  2H61 C;  1UHJ A;  4GAO A;  1AK8 A;  2G2B A;  1J7O A;  1UWO A;  3TS5 B;  1CMG A;  2ZKM X;  1SNL A;  1C07 A;  2LAN A;  2Y4Q A;  3VGO A;  5CSN A;  1BOD A;  2LHI A;  1C7V A;  3EVU A;  2K7O A;  4I5J A;  1K2H A;  1LXF C;  2R2I A;  1RJV A;  1XFY O;  2JWW A;  5KTY A;  1S26 D;  1ZFS A;  2JT3 A;  1YX8 A;  1DJH A;  1ZMZ A;  2FOT A;  1PK0 D;  1H8B A;  4ZCU A;  1EXR A;  1KWO B;  3EVV A;  1JFK A;  1HT9 A;  3GOF A;  4GGN A;  3RM1 A;  2BL0 C;  4MZJ A;  3DD4 A;  2M1U A;  4CID A;  4MVF A;  1K9K A;  3O4Y A;  4I5K A;  4N1G A;  3KHE A;  1PSB A;  1M46 A;  5PAL A;  1XFX O;  4YGE B;  1DJI A;  2B1U A;  2HQW A;  1F8H A;  4HRG A;  1OOJ A;  4YBH B;  3WHU B;  2KGB C;  2JC2 A;  3SG2 A;  1XVJ A;  5JJG A;  1DF0 B;  3OX6 A;  3PLF B;  1Y6W A;  3NXA A;  1KK7 Z;  1RK9 A;  5K89 A;  4JQ0 D;  3SG7 A;  2M29 A;  3RLZ A;  5KU1 A;  3OX5 A;  1SCM C;  1B9A A;  1ALW A;  3PAT A;  2H61 A; 
#chains in the Genus database with same CATH topology
 1Y1A A;  1UHH A;  2O60 A;  2LMT A;  2WND A;  3B87 A;  3BOW B;  4MEW A;  3DY9 A;  1TCF A;  1LA0 A;  2K60 A;  3FWB A;  2KI6 D;  3CZ1 A;  1SCV A;  2KAX A;  2K2F A;  3B86 A;  3SIA A;  1CM4 A;  1OMV A;  2EHB A;  1AUI B;  3SG6 A;  3SG3 A;  3GK1 A;  2LMU A;  3BUN B;  3EG5 B;  2LHL A;  2NLN A;  3QRX A;  1TTX A;  5G08 A;  4D1E A;  4UPG A;  2BCA A;  3CGA A;  5I8N A;  1DTL A;  4M2P A;  2WCH A;  3H4S E;  1OSA A;  1A75 B;  1QAT A;  1L2O B;  2ISD A;  5FI6 A;  4ZCV A;  3I5H C;  2LM5 A;  2F2O A;  3RZS A;  3NHT A;  1FPW A;  1NX2 A;  4WQ3 A;  2K61 A;  3CR4 X;  2LE9 B;  1NWD A;  2CCM A;  3KF9 A;  1DGV A;  1LS8 A;  1KCY A;  4AQJ A;  1BG1 A;  2LAP A;  3OGN A;  1AP4 A;  2CNP A;  5AFP A;  1WDC B;  2AAO A;  1M45 A;  2E6W A;  1YUT A;  1NYA A;  1S1E A;  2ERB A;  2JOJ A;  2MA2 A;  1W7I B;  1TNP A;  2K2A A;  4U8D A;  4ICB A;  1NUB A;  1KK8 B;  3BUO B;  3D74 A;  1PVB A;  1WY9 A;  2JQ6 A;  3V2L A;  1CLL A;  2SCP A;  3DYE A;  1QWV A;  1PSR A;  5HLV A;  2M7N A;  1PAL A;  2AMI A;  3ZWH A;  1J7R A;  1CLM A;  2D8N A;  5FI2 A;  3TDU A;  1SKT A;  1DVI A;  2L2C A;  3IVT A;  4PHK A;  3D77 A;  4AOM A;  4CPV A;  5J3X A;  2PMY A;  2NCO A;  4OV2 A;  3KPX A;  1DJG A;  1NCZ A;  1LVC D;  2KI4 B;  3NSL A;  2LP2 A;  3O6B A;  5D69 A;  2K8M B;  4JD9 A;  1J7P A;  2ZN9 A;  1IGV A;  1QIV A;  1CDL A;  2HQ8 A;  3EKH A;  1BOC A;  1KK7 Y;  3CZ2 A;  2JT0 A;  1NX3 A;  3DVK A;  1DQE A;  3A8R A;  2ZRS A;  1MXE A;  2L51 A;  3K1E A;  4I5L B;  1TCO B;  4C0J A;  2M97 A;  2OS8 C;  3S0F A;  1KFU S;  1V1F A;  2KYC A;  4ETO A;  4XJK B;  2COL B;  2VRG A;  2E30 A;  3D73 A;  3HCM A;  2JRF A;  3GK2 A;  1QS7 A;  2IS9 A;  2F2P A;  3OB2 B;  2Q91 A;  4PHN A;  1B8C A;  3PM8 A;  1S6J A;  1Y1X A;  1SW8 A;  3I5I C;  1RWY A;  1U5I A;  1S3P A;  3TDI A;  1BF5 A;  1JFJ A;  3PN7 C;  1BR1 B;  1LIN A;  3D75 A;  1IWQ A;  3BFA A;  2SAS A;  3DF0 A;  1YRT B;  5EL2 A;  1YUU A;  1QX7 A;  1S36 A;  1X02 A;  2H2K A;  1SSE B;  2QEH A;  4ORA B;  4PE1 A;  4N5X A;  5ER5 A;  4M2O A;  1IH0 A;  1BMO A;  4AQI A;  1GJY A;  1SY9 A;  2JXC A;  3FIA A;  3L4A A;  3EK8 A;  1KQM C;  2BL0 B;  3TUY B;  2QEO A;  1CFF A;  1JF0 A;  3JTD C;  1BR4 B;  2LNK A;  2HPS A;  3DVE A;  4TNC A;  5HLO A;  2KSP A;  2WOR A;  1XFW O;  2ZN8 A;  3EK7 A;  1F4O A;  1YVH A;  1T14 A;  1ZOT B;  3EKJ A;  1C3Y A;  3FWC A;  1K94 A;  1UHI A;  2KQY A;  2KLD A;  3TS5 C;  4OR9 B;  3EVR A;  1E8A A;  1DJZ A;  2BCX A;  3DZT A;  3OBV A;  5FI7 A;  3VRP A;  1JWD A;  3CAB A;  3MSE B;  5HL1 A;  3BFH A;  1KFU L;  1N2D A;  3QME A;  1SMG A;  1SCM B;  4F7F A;  1AJ4 A;  1K90 D;  2BKH B;  2KBM A;  3IQO A;  4JPZ B;  1BU3 A;  5JOL A;  1SL8 A;  1G33 A;  2KGR A;  3VRQ A;  5AEQ A;  1TUJ A;  1F4Q A;  1PUL A;  1QVI Z;  2PAL A;  3GK4 X;  3M0W A;  3CR5 X;  2JUL A;  2F3Y A;  1F71 A;  1Z4H A;  3BQ3 A;  5ER4 X;  1NX1 A;  1W7J B;  3WHT B;  2ZRT A;  1TUZ A;  4GPL B;  4NDD A;  5F6T A;  2CBL A;  4R1E A;  3SS4 A;  1CFC A;  5IBW A;  2K0J A;  2Y1M A;  4HRE E;  1IG5 A;  2A4J A;  2LUX A;  1QX5 B;  1J1E A;  1TWO A;  1RFJ A;  1RRO A;  3FS7 A;  1WRZ A;  3I5H B;  2JTT A;  3B88 A;  1NSH A;  1OZS A;  2GTE A;  1WLZ A;  4PHJ A;  3B7A A;  1YVL A;  2OTG C;  3I5G C;  2NXQ A;  3VB1 A;  2LVJ A;  2OPO A;  1CKK A;  4C0L A;  1CMF A;  3A4U B;  4F0Z B;  3CR2 A;  1S5G Z;  2M3W A;  3NSI A;  3ZNI A;  4PAL A;  2L5Y A;  1SBJ A;  2KI6 C;  4MSP A;  3BUX B;  2KLE A;  2L4I A;  1JF2 A;  2JXL A;  1XFU O;  2MLE C;  2M1K B;  4MZK A;  3S0B A;  5HYD A;  2JU0 A;  4GGF C;  3BUW B;  1F54 A;  3BUM B;  4JKT A;  2F8P A;  3S0D A;  4XYN A;  1SR6 C;  1IQ5 A;  1ZAC A;  1UUS A;  2ZNE A;  4OKH A;  1CM1 A;  4BY5 A;  2LLU A;  2Y5I A;  2GGZ A;  2KHN A;  1ALV A;  1QV0 A;  1FF1 A;  2KNE A;  1IQ3 A;  2LLS A;  2MLF C;  2PSR A;  4KYN A;  1DT7 B;  2QAC A;  4YGC B;  2PVB A;  1B8L A;  2M0R A;  2JTZ A;  4WRI A;  4CLN A;  1Y0V H;  2PRU A;  3PFV A;  1SRA A;  2NCP A;  2BE6 A;  2M49 B;  2CTN A;  2JZI A;  1XYD A;  2Q4U A;  5CPV A;  1OOF A;  5I94 A;  1EL4 A;  3JVT C;  3C1V A;  3O4X A;  1HQV A;  4OCI A;  4HRH A;  5DIC A;  3AKB A;  1GGW A;  3DXL A;  1DF0 A;  2H8V A;  3LLE A;  1WDC C;  1K9P A;  4MRY A;  1EJ3 A;  3WNX B;  2KAV A;  5I2L A;  1CDP A;  1QAS A;  3UO9 A;  1L7Z A;  1YX7 A;  1KK8 C;  1OMD A;  1SL7 A;  2HET A;  2L4H A;  4NDB A;  1AVS A;  5HKZ A;  2LP3 A;  1J7Q A;  2G9B A;  2JNF A;  1Q80 A;  3SG4 A;  1XFZ O;  4P5O E;  1OOI X;  4WQ2 A;  1EG3 A;  1NPQ A;  2K7D A;  3I5F B;  1EH2 A;  1TN4 A;  1QVI Y;  4MBE A;  2EC6 B;  3D10 A;  3BOW A;  1QJT A;  4PT1 A;  3L4L A;  4GGF A;  3SS5 A;  3DVM A;  4M2Q A;  1J1D A;  1GGZ A;  2BKI B;  2EGD A;  1MXL C;  2LCP A;  3E3R A;  4MN0 A;  1JBA A;  2KFG A;  2LC5 A;  2Y1N A;  1WRK A;  3TDZ A;  1MR8 A;  3PN7 B;  1IRJ A;  1VRK A;  5CSF A;  4CFQ A;  2KI4 C;  4OVN F;  1OMR A;  1JC2 A;  3NGV A;  5AER A;  4GNK B;  2QEB A;  1YUR A;  1SK6 D;  1TIZ A;  3SIB A;  1YUS A;  3DVJ A;  2DOQ A;  4MZL A;  1CDM A;  1TNQ A;  5B8I B;  3R1O A;  1KQM B;  1F70 A;  4YGA A;  1XO5 A;  5TNC A;  3JTD B;  5AXI A;  4JWQ A;  3F45 A;  1G8I A;  1KQV A;  2KAY A;  2TN4 A;  3CDN A;  1WRL A;  2KYF A;  5HKW A;  1M39 A;  1NIW A;  2L5X B;  3BXK A;  1IIO A;  2FJU B;  4DUQ A;  3PSR A;  5BPJ A;  1CNP A;  1DEL A;  4FQO A;  2FCD A;  2KOT A;  1FBV A;  4ORC B;  1H4B A;  5I2O A;  1DJY A;  3O78 A;  2GGM A;  3IQQ A;  4PDZ A;  3D0Y A;  1B7T Z;  1K9U A;  4IL1 A;  1BLQ A;  2O5G A;  2F3Z A;  1YTZ C;  4BY4 A;  1CB1 A;  4GUK A;  3EK4 A;  3SG5 A;  4NDC A;  1NX0 A;  1CFD A;  1C3Z A;  3L47 A;  1M31 A;  4MLW A;  1XA5 A;  2BBN A;  3FE8 A;  4C0K A;  4CFR A;  4N1F A;  3LK1 A;  1QX2 A;  1ODB A;  1YRU B;  3UNW A;  2GV5 A;  1DGU A;  1SPY A;  2WOS A;  1XK4 C;  3PM2 A;  1SYM A;  1LA3 A;  2WC8 A;  4YI8 A;  2KDH A;  2LVI A;  1A4P A;  1QIW A;  3TUY C;  1OOG A;  3CS1 A;  4NQG A;  1KWO C;  3NSO A;  2BCB A;  4DCK A;  1OZO A;  3CZT X;  3SJS A;  4PE7 A;  3OP0 A;  2QEV A;  1D1O A;  2ZND A;  1QXP A;  1NCY A;  2M9G A;  3PAT A;  2WCB A;  2WCE A;  5DKQ A;  2LVV A;  1R2U A;  3Q8I A;  1DMO A;  1DJX A;  3FE6 A;  1G4Y R;  4YI9 A;  3KEV A;  3R1V A;  1TNW A;  2JPT A;  2KPH A;  4L9M A;  1S6I A;  3HX4 A;  2L2E A;  4XJK A;  2LVK A;  2OTG B;  3I5G B;  1Z2C B;  1FI5 A;  2FCE A;  1KFX S;  2AUC A;  1C7W A;  1REC A;  3BJH A;  3N7H A;  3NHI A;  4IJ7 A;  2KBI A;  4DS7 A;  1DJW A;  1RTP 1;  3K21 A;  2WCK A;  3PJI A;  1DEK A;  4QJ3 B;  1KSM A;  1A29 A;  1FI6 A;  1QLS A;  1K93 D;  2I18 A;  2M8U A;  2MJW B;  1FW4 A;  4USL A;  1MHO A;  3BFB A;  4YGD B;  5DKR A;  5HKY A;  1M63 B;  4Q04 A;  1NCX A;  1SR6 B;  1UUR A;  3VRO A;  1GM0 A;  2KFF A;  1QTX A;  3AAK A;  1Y1U A;  1TOP A;  4QJ5 B;  2L98 A;  2RGI A;  1B47 A;  4ORB B;  4PE4 A;  3CTN A;  1U5I B;  4PE0 A;  1A03 A;  2K7C A;  3WXA A;  1XK4 A;  5KSZ A;  2JT8 A;  4DIR A;  1K96 A;  4FTG A;  3DF0 B;  1S6C A;  4QJ4 B;  2LLT A;  2CXJ A;  1QLK A;  1TNX A;  2MRD A;  3PAL A;  3VRR A;  1JUO A;  5DKN A;  5CSI A;  1UHN A;  1YR5 A;  2I94 A;  1KSO A;  3JVT B;  1L2O C;  3BYA A;  3IF7 A;  4PCW A;  5CSJ A;  4INW A;  2M7L A;  4A4C A;  2BEC A;  4A4B A;  1P28 A;  2JNX A;  4YGB B;  2K7B A;  2QPT A;  1TRF A;  1WLM A;  1CTR A;  1GQM A;  1B7T Y;  4INX A;  1K95 A;  1OQP A;  4P2Y B;  4MRX A;  2WCF A;  4GFT A;  3D0Y B;  2KFH A;  2I7A A;  1A2X A;  3CWG A;  1PVA A;  1CFP A;  1UHK A;  1IKU A;  1MUX A;  4FQT A;  1IJ6 A;  1J55 A;  2BE4 A;  4HSZ A;  1MQ1 A;  3AAJ A;  1B1G A;  2OS8 B;  1XFV O;  2P6B B;  1KFX L;  3VRN A;  3CYZ A;  1F55 A;  3AKA A;  1UP5 A;  3OHM B;  3OB1 B;  2LV7 A;  5D7F A;  2LMV A;  1K8U A;  4PHM A;  1AHR A;  1ZUZ A;  2MHH A;  3LL8 B;  2BBM A;  2KQ6 A;  2V53 A;  3I5I B;  1OW4 A;  2WC6 A;  1AJ5 A;  1N0Y A;  3O2P A;  1OOH A;  2I2R E;  1V1G A;  2HF5 A;  2NZ0 A;  1BT6 A;  1W9Z A;  4GBA A;  2LUC A;  5AAN A;  3TZ1 A;  2QDI A;  5I2Q A;  2PAS A;  1MWN A;  2MAZ A;  2PQL A;  3ICB A;  3LCP C;  4DRW A;  1B4C A;  2CT9 A;  1N65 A;  1NP8 A;  3LK0 A;  1OE9 B;  1ORG A;  4YRU A;  1SL9 A;  1A75 A;  1IJ5 A;  1LKJ A;  2L0P A;  3CLN A;  5FYX A;  1JSA A;  1CDN A;  2F33 A;  1EG4 A;  2WCJ A;  1CLB A;  2WCM A;  1PRW A;  3S0E A;  3KO0 A;  3I5F C;  1QV1 A;  2L50 A;  1MF8 B;  3NSK A;  2ZFD A;  3R72 A;  2MBX A;  1S5G Y;  2EC6 C;  4E68 A;  1XFR A;  5GQQ C;  1BJF A;  1B8R A;  4I5N B;  1R6P A;  2H61 C;  1UHJ A;  4GAO A;  1AK8 A;  2G2B A;  1J7O A;  1UWO A;  3TS5 B;  1CMG A;  2ZKM X;  1SNL A;  1C07 A;  3R1P A;  2LAN A;  2Y4Q A;  3VGO A;  5CSN A;  1BOD A;  2LHI A;  1C7V A;  3EVU A;  2K7O A;  3SS3 A;  3S0A A;  4I5J A;  1K2H A;  1LXF C;  2R2I A;  2JPO A;  1RJV A;  1XFY O;  2JWW A;  2PYQ A;  5KTY A;  1S26 D;  1ZFS A;  2P70 A;  3CZ0 A;  2JT3 A;  1YX8 A;  1DJH A;  1ZMZ A;  2FOT A;  1PK0 D;  1H8B A;  3D76 A;  4ZCU A;  2WC5 A;  1EXR A;  1KWO B;  3EVV A;  1JFK A;  1HT9 A;  2FJY A;  3GOF A;  4GGN A;  3RM1 A;  2BL0 C;  4MZJ A;  3DD4 A;  2M1U A;  4CID A;  4MVF A;  1K9K A;  3O4Y A;  4I5K A;  4N1G A;  2YGU A;  3KHE A;  1PSB A;  1M46 A;  1DC1 A;  5PAL A;  1XFX O;  4YGE B;  1DJI A;  2B1U A;  2HQW A;  1F8H A;  3D78 A;  4HRG A;  1OOJ A;  4YBH B;  3WHU B;  2KGB C;  2JC2 A;  3SG2 A;  1XVJ A;  5JJG A;  4OZD A;  1DF0 B;  3OX6 A;  2BAP A;  3PLF B;  1Y6W A;  5D3O A;  3NXA A;  1KK7 Z;  2P71 A;  1RK9 A;  2BNX A;  5K89 A;  4JQ0 D;  2WCL A;  3SG7 A;  2M29 A;  3RLZ A;  5KU1 A;  3OX5 A;  1SCM C;  1B9A A;  1ALW A;  3B6X A;  2H61 A;  3FE9 A;  3S0G A; 
#chains in the Genus database with same CATH homology
 1Y1A A;  1UHH A;  2O60 A;  2LMT A;  2WND A;  3BOW B;  4MEW A;  1TCF A;  1LA0 A;  3FWB A;  2KI6 D;  1SCV A;  2KAX A;  2K2F A;  3SIA A;  1CM4 A;  1OMV A;  2EHB A;  1AUI B;  3SG6 A;  3SG3 A;  3GK1 A;  2LMU A;  3BUN B;  2LHL A;  2NLN A;  3QRX A;  1TTX A;  5G08 A;  4D1E A;  4UPG A;  2BCA A;  3CGA A;  5I8N A;  1DTL A;  4M2P A;  3H4S E;  1OSA A;  1A75 B;  1QAT A;  1L2O B;  2ISD A;  4ZCV A;  3I5H C;  2LM5 A;  2F2O A;  1FPW A;  1NX2 A;  4WQ3 A;  2K61 A;  3CR4 X;  2LE9 B;  1NWD A;  2CCM A;  3KF9 A;  1DGV A;  1KCY A;  4AQJ A;  1BG1 A;  2LAP A;  1AP4 A;  2CNP A;  5AFP A;  1WDC B;  2AAO A;  1M45 A;  2E6W A;  1YUT A;  1NYA A;  1S1E A;  2JOJ A;  2MA2 A;  4C0J A;  1W7I B;  1TNP A;  2K2A A;  4U8D A;  4ICB A;  1NUB A;  1KK8 B;  3BUO B;  1PVB A;  1WY9 A;  2JQ6 A;  1CLL A;  2SCP A;  1PSR A;  5HLV A;  2M7N A;  1PAL A;  2AMI A;  3ZWH A;  1J7R A;  1CLM A;  2D8N A;  3TDU A;  1SKT A;  1DVI A;  4AOM A;  4PHK A;  4CPV A;  5J3X A;  2PMY A;  2NCO A;  4OV2 A;  3KPX A;  1DJG A;  1NCZ A;  1LVC D;  2KI4 B;  3NSL A;  2LP2 A;  3O6B A;  5D69 A;  2K8M B;  1J7P A;  2ZN9 A;  1IGV A;  1QIV A;  1CDL A;  2HQ8 A;  3EKH A;  1BOC A;  1KK7 Y;  3DVK A;  2JT0 A;  1NX3 A;  3A8R A;  2ZRS A;  1MXE A;  2L51 A;  4I5L B;  1TCO B;  2M97 A;  2OS8 C;  1KFU S;  1V1F A;  2KYC A;  4ETO A;  4XJK B;  2COL B;  2VRG A;  2E30 A;  3HCM A;  2JRF A;  3GK2 A;  1QS7 A;  2IS9 A;  2F2P A;  3OB2 B;  2Q91 A;  4PHN A;  1B8C A;  3PM8 A;  1S6J A;  1Y1X A;  1SW8 A;  3I5I C;  1RWY A;  1U5I A;  1S3P A;  3TDI A;  1BF5 A;  1JFJ A;  3PN7 C;  1BR1 B;  1LIN A;  1IWQ A;  2SAS A;  3DF0 A;  1YRT B;  1YUU A;  1QX7 A;  1S36 A;  1X02 A;  2H2K A;  4ORA B;  4PE1 A;  4N5X A;  5ER5 A;  4M2O A;  1IH0 A;  1BMO A;  4AQI A;  1GJY A;  1SY9 A;  2JXC A;  3FIA A;  3EK8 A;  1KQM C;  2BL0 B;  3TUY B;  1CFF A;  1JF0 A;  3JTD C;  1BR4 B;  2LNK A;  2HPS A;  3DVE A;  4TNC A;  5HLO A;  2KSP A;  2WOR A;  1XFW O;  2ZN8 A;  3EK7 A;  1F4O A;  1YVH A;  1ZOT B;  3EKJ A;  3FWC A;  1K94 A;  1UHI A;  2KQY A;  3TS5 C;  4OR9 B;  3EVR A;  1E8A A;  1DJZ A;  2BCX A;  3VRP A;  1JWD A;  3MSE B;  1KFU L;  1N2D A;  1SMG A;  1SCM B;  1AJ4 A;  1K90 D;  2BKH B;  2KBM A;  3IQO A;  4JPZ B;  1BU3 A;  5JOL A;  1SL8 A;  1G33 A;  2KGR A;  3VRQ A;  5AEQ A;  1F4Q A;  1PUL A;  1QVI Z;  2PAL A;  3GK4 X;  3M0W A;  3CR5 X;  2JUL A;  2F3Y A;  1F71 A;  3BQ3 A;  5ER4 X;  1NX1 A;  1W7J B;  3WHT B;  2ZRT A;  4NDD A;  4GPL B;  5F6T A;  1CFC A;  2CBL A;  4R1E A;  5IBW A;  2K0J A;  2Y1M A;  4HRE E;  1IG5 A;  2A4J A;  2LUX A;  1QX5 B;  1J1E A;  1RFJ A;  1RRO A;  3FS7 A;  1WRZ A;  3I5H B;  2JTT A;  1NSH A;  1OZS A;  1WLZ A;  4PHJ A;  1YVL A;  2OTG C;  3I5G C;  2NXQ A;  2LVJ A;  2OPO A;  1CKK A;  4C0L A;  1CMF A;  3A4U B;  4F0Z B;  3CR2 A;  1S5G Z;  2M3W A;  3NSI A;  3ZNI A;  4PAL A;  1SBJ A;  2KI6 C;  4MSP A;  3BUX B;  2L4I A;  1JF2 A;  2JXL A;  1XFU O;  2MLE C;  2M1K B;  4MZK A;  5HYD A;  2JU0 A;  4GGF C;  3BUW B;  1F54 A;  3BUM B;  2F8P A;  4XYN A;  1SR6 C;  1IQ5 A;  1ZAC A;  1UUS A;  2ZNE A;  4OKH A;  1CM1 A;  4BY5 A;  2LLU A;  2Y5I A;  2GGZ A;  2KHN A;  1ALV A;  1QV0 A;  1FF1 A;  2KNE A;  1IQ3 A;  2LLS A;  2MLF C;  2PSR A;  1DT7 B;  2QAC A;  4YGC B;  2PVB A;  1B8L A;  2M0R A;  2JTZ A;  4WRI A;  4CLN A;  1Y0V H;  2PRU A;  3PFV A;  1SRA A;  2NCP A;  2BE6 A;  2M49 B;  2CTN A;  2JZI A;  1XYD A;  2Q4U A;  5CPV A;  1EL4 A;  3JVT C;  3C1V A;  4OCI A;  1HQV A;  4HRH A;  3AKB A;  1GGW A;  1DF0 A;  3LLE A;  1WDC C;  1K9P A;  4MRY A;  1EJ3 A;  3WNX B;  2KAV A;  5I2L A;  1CDP A;  1QAS A;  1L7Z A;  1YX7 A;  1KK8 C;  1OMD A;  1SL7 A;  2HET A;  2L4H A;  4NDB A;  1AVS A;  5HKZ A;  2LP3 A;  1J7Q A;  2G9B A;  2JNF A;  1Q80 A;  3SG4 A;  1XFZ O;  4P5O E;  4WQ2 A;  1EG3 A;  1NPQ A;  2K7D A;  3I5F B;  1EH2 A;  1TN4 A;  1QVI Y;  4MBE A;  2EC6 B;  3D10 A;  3BOW A;  1QJT A;  4GGF A;  3DVM A;  4M2Q A;  1J1D A;  1GGZ A;  2BKI B;  2EGD A;  1MXL C;  2LCP A;  3E3R A;  4MN0 A;  1JBA A;  2KFG A;  2LC5 A;  2Y1N A;  1WRK A;  3TDZ A;  1MR8 A;  3PN7 B;  1IRJ A;  1VRK A;  5CSF A;  4CFQ A;  2KI4 C;  4OVN F;  1OMR A;  1JC2 A;  5AER A;  4GNK B;  1YUR A;  1SK6 D;  1TIZ A;  3SIB A;  1YUS A;  3DVJ A;  2DOQ A;  4MZL A;  1CDM A;  1TNQ A;  5B8I B;  1KQM B;  1F70 A;  4YGA A;  1XO5 A;  5TNC A;  3JTD B;  5AXI A;  4JWQ A;  3F45 A;  1G8I A;  1KQV A;  2KAY A;  2TN4 A;  5HKW A;  1WRL A;  2KYF A;  1M39 A;  1NIW A;  2L5X B;  3BXK A;  2FJU B;  4DUQ A;  3PSR A;  5BPJ A;  1CNP A;  4FQO A;  2FCD A;  2KOT A;  1FBV A;  4ORC B;  1H4B A;  5I2O A;  1DJY A;  3O78 A;  2GGM A;  3IQQ A;  4PDZ A;  3D0Y A;  1B7T Z;  1K9U A;  4IL1 A;  1BLQ A;  2O5G A;  2F3Z A;  1YTZ C;  4BY4 A;  1CB1 A;  4GUK A;  3EK4 A;  3SG5 A;  4NDC A;  1NX0 A;  1CFD A;  1M31 A;  4MLW A;  1XA5 A;  2BBN A;  4C0K A;  4CFR A;  4N1F A;  3LK1 A;  1QX2 A;  1ODB A;  1YRU B;  2GV5 A;  1DGU A;  1SPY A;  2WOS A;  1XK4 C;  1SYM A;  1LA3 A;  2WC8 A;  4YI8 A;  2KDH A;  2LVI A;  1A4P A;  1QIW A;  3TUY C;  3CS1 A;  4NQG A;  1KWO C;  3NSO A;  2BCB A;  4DCK A;  1OZO A;  3CZT X;  3SJS A;  4PE7 A;  3OP0 A;  1D1O A;  2ZND A;  1QXP A;  1NCY A;  2M9G A;  2WCB A;  2WCE A;  5DKQ A;  2LVV A;  1R2U A;  1DMO A;  1DJX A;  1G4Y R;  4YI9 A;  3KEV A;  1TNW A;  2JPT A;  4L9M A;  1S6I A;  3HX4 A;  2L2E A;  4XJK A;  2LVK A;  2OTG B;  3I5G B;  1FI5 A;  2FCE A;  1KFX S;  2AUC A;  1C7W A;  1REC A;  2KBI A;  4DS7 A;  1DJW A;  1RTP 1;  3K21 A;  4QJ3 B;  1KSM A;  1A29 A;  1FI6 A;  1QLS A;  1K93 D;  2I18 A;  2M8U A;  2MJW B;  1FW4 A;  4USL A;  1MHO A;  5DKR A;  4YGD B;  5HKY A;  1M63 B;  4Q04 A;  1NCX A;  1SR6 B;  1UUR A;  3VRO A;  2KFF A;  1QTX A;  3AAK A;  1Y1U A;  1TOP A;  4QJ5 B;  2L98 A;  2RGI A;  1B47 A;  4ORB B;  4PE4 A;  3CTN A;  1U5I B;  4PE0 A;  1A03 A;  2K7C A;  3WXA A;  1XK4 A;  5KSZ A;  2JT8 A;  4DIR A;  1K96 A;  4FTG A;  3DF0 B;  1S6C A;  4QJ4 B;  2LLT A;  2CXJ A;  1QLK A;  1TNX A;  2MRD A;  3PAL A;  3VRR A;  1JUO A;  5DKN A;  5CSI A;  1UHN A;  1YR5 A;  2I94 A;  1KSO A;  3JVT B;  1L2O C;  3BYA A;  3IF7 A;  4PCW A;  5CSJ A;  2M7L A;  4A4C A;  2BEC A;  4A4B A;  2JNX A;  4YGB B;  2K7B A;  2QPT A;  1TRF A;  1WLM A;  1CTR A;  1GQM A;  1B7T Y;  1K95 A;  1OQP A;  4P2Y B;  4MRX A;  2WCF A;  4GFT A;  3D0Y B;  2KFH A;  2I7A A;  1A2X A;  3CWG A;  1PVA A;  1CFP A;  1UHK A;  1IKU A;  1MUX A;  1IJ6 A;  1J55 A;  2BE4 A;  4HSZ A;  1MQ1 A;  3AAJ A;  1B1G A;  2OS8 B;  1XFV O;  2P6B B;  1KFX L;  3VRN A;  1F55 A;  3AKA A;  1UP5 A;  3OHM B;  3OB1 B;  2LV7 A;  5D7F A;  2LMV A;  1K8U A;  4PHM A;  1AHR A;  1ZUZ A;  2MHH A;  3LL8 B;  2BBM A;  2KQ6 A;  2V53 A;  3I5I B;  3O2P A;  1AJ5 A;  1N0Y A;  2I2R E;  1V1G A;  2HF5 A;  2NZ0 A;  1BT6 A;  4GBA A;  5AAN A;  2LUC A;  3TZ1 A;  5I2Q A;  2PAS A;  1MWN A;  2MAZ A;  3ICB A;  4DRW A;  3LCP C;  1B4C A;  2CT9 A;  1N65 A;  1NP8 A;  3LK0 A;  1OE9 B;  4YRU A;  1SL9 A;  1A75 A;  1IJ5 A;  1LKJ A;  2L0P A;  3CLN A;  5FYX A;  1JSA A;  1CDN A;  2F33 A;  1EG4 A;  1CLB A;  1PRW A;  3KO0 A;  3I5F C;  1QV1 A;  2L50 A;  1MF8 B;  3NSK A;  2ZFD A;  2MBX A;  1S5G Y;  2EC6 C;  4E68 A;  5GQQ C;  1BJF A;  1B8R A;  4I5N B;  1R6P A;  2H61 C;  1UHJ A;  4GAO A;  1AK8 A;  2G2B A;  1J7O A;  1UWO A;  3TS5 B;  1CMG A;  2ZKM X;  1SNL A;  1C07 A;  2LAN A;  2Y4Q A;  3VGO A;  5CSN A;  1BOD A;  2LHI A;  1C7V A;  3EVU A;  2K7O A;  4I5J A;  1K2H A;  1LXF C;  2R2I A;  1RJV A;  1XFY O;  2JWW A;  5KTY A;  1S26 D;  1ZFS A;  2JT3 A;  1YX8 A;  1DJH A;  1ZMZ A;  2FOT A;  1PK0 D;  1H8B A;  4ZCU A;  1EXR A;  1KWO B;  3EVV A;  1JFK A;  1HT9 A;  3GOF A;  4GGN A;  3RM1 A;  2BL0 C;  4MZJ A;  3DD4 A;  2M1U A;  4CID A;  4MVF A;  1K9K A;  3O4Y A;  4I5K A;  4N1G A;  3KHE A;  1PSB A;  1M46 A;  5PAL A;  1XFX O;  4YGE B;  1DJI A;  2B1U A;  2HQW A;  1F8H A;  4HRG A;  1OOJ A;  4YBH B;  3WHU B;  2KGB C;  2JC2 A;  3SG2 A;  1XVJ A;  5JJG A;  1DF0 B;  3OX6 A;  3PLF B;  1Y6W A;  3NXA A;  1KK7 Z;  1RK9 A;  5K89 A;  4JQ0 D;  3SG7 A;  2M29 A;  3RLZ A;  5KU1 A;  3OX5 A;  1SCM C;  1B9A A;  1ALW A;  3PAT A;  2H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...