1JC2A

Complex of the c-domain of troponin c with residues 1-40 of troponin i
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
EDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords TROPONIN C, SKELETAL MUSCLE
publication title Structure, dynamics, and thermodynamics of the structural domain of troponin C in complex with the regulatory peptide 1-40 of troponin I
pubmed doi rcsb
source organism Gallus gallus
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jc2A00
2LM5A 2L2EA 2OPOA 4JWQA 3VRRA 4JQ0D 1SW8A 4GGNA 1OSAA 3TDIA 1LA0A 5CSJA 3F45A 3KHEA 1HQVA 2KBMA 2ZKMX 2BE4A 3SJSA 2QACA 4Q04A 1QTXA 2SASA 1JUOA 1RFJA 1KSOA 1CFCA 1JSAA 1SPYA 3EKJA 1XFXO 1AJ4A 2FCDA 2PSRA 2LVKA 3VGOA 2JWWA 3SG7A 2JU0A 1IQ5A 1PRWA 4N1GA 3C1VA 1TN4A 1SMGA 1PSRA 4ETOA 1EJ3A 3I5HB 3NXAA 4FQOA 1WLZA 4GGFC 3I5IC 3WXAA 4AQJA 1WRZA 2WOSA 1BODA 1M31A 4XJKB 1M39A 4TNCA 2PALA 4GUKA 1S5GZ 2CCMA 2O60A 1K94A 1J1EA 3SG3A 3DD4A 1AUIB 1TTXA 4L9MA 4CFRA 2HPSA 3IQQA 4YGEB 1QS7A 1Y1UA 1UP5A 1YVLA 1PULA 4ORAB 2CBLA 2K0JA 2MRDA 2E30A 1S26D 3MSEB 5DKQA 2ZFDA 4UPGA 2KI4B 4HRGA 4N5XA 5HKYA 1H8BA 1NIWA 4A4BA 2GV5A 1Y1XA 4MVFA 3K21A 2M3WA 2MJWB 4QJ4B 3TUYC 3D10A 1SL8A 1J7PA 5JOLA 1G8IA 1CLBA 1NCYA 2KFGA 1ZUZA 2LV7A 2WNDA 2L98A 3GK2A 2K2AA 3LK0A 4MRXA 4U8DA 1BG1A 1W7IB 1SK6D 2M7LA 1QX5B 3OX5A 1PVAA 5AXIA 4YBHB 1K9UA 1RJVA 4I5NB 3CS1A 3I5GC 2ZNDA 3JVTC 3E3RA 3M0WA 1QVIY 2P6BB 2M97A 3OHMB 2EHBA 4GFTA 1S1EA 1DGVA 2AAOA 4XJKA 5AANA 2LMVA 3OB1B 1S6JA 2CNPA 4YGAA 1S36A 2LHIA 3SG2A 1PK0D 3AKBA 2I7AA 3I5IB 2KFHA 3CLNA 1GGWA 1WDCB 2M29A 1BJFA 1S6IA 1K2HA 2EC6C 1KK7Y 1YTZC 2BECA 3EK7A 1MHOA 2FJUB 1OMVA 1G33A 3JTDC 3IF7A 2LMTA 2Y4QA 3NSLA 1N2DA 1YRTB 3O6BA 1A4PA 1OQPA 2GGZA 2PRUA 3PN7C 5HLVA 5HKWA 1IJ5A 1XK4A 5ER4X 2MBXA 4N1FA 1M46A 1B7TZ 4PHMA 1MF8B 3WHTB 3CR5X 3TUYB 1DJXA 2GGMA 1CNPA 2IS9A 1CLMA 1XA5A 2BKIB 1S3PA 1EL4A 3CR2A 1PVBA 4MZLA 4YGCB 3GOFA 1K95A 4JPZB 2Q91A 5KU1A 1L7ZA 2HQ8A 2LUXA 1CDNA 1MXLC 2JT0A 1FW4A 1N65A 2ZRTA 1AJ5A 1SL7A 1KSMA 1F55A 1K9PA 2H61A 3JVTB 1K90D 2JPTA 1A2XA 1JFKA 1GGZA 3DVKA 1QIWA 2JTZA 2WCFA 2F8PA 4USLA 5CSNA 1K96A 3DVJA 4PHKA 3TS5C 2HF5A 1S5GY 1GJYA 1QV0A 1F70A 1Y0VH 4GPLB 3TZ1A 2LHLA 2K2FA 2R2IA 2WC8A 1FI5A 2M7NA 1RTP1 3TDUA 2EC6B 1DJYA 1H4BA 1DGUA 2JQ6A 1DJWA 5FYXA 3JTDB 4WRIA 2MLFC 1EH2A 1A03A 1SKTA 1KFUL 2AUCA 3PN7B 1EG3A 5GQQC 1U5IA 1F8HA 4OVNF 2JTTA 2KAVA 1QXPA 3A8RA 1XK4C 2KI6C 4P2YB 4CLNA 2LAPA 1QJTA 2PASA 1MQ1A 3I5FC 1J55A 4WQ2A 2HETA 2L5XB 3WHUB 3GK4X 3PM8A 4NDDA 1UURA 1CMGA 1YUUA 1MR8A 2D8NA 3OX6A 1CKKA 1QATA 2I94A 4I5LB 2L50A 1Y6WA 3DVMA 5BPJA 2LVJA 2H61C 1JF2A 1D1OA 1SR6C 1DTLA 2K61A 1E8AA 1KCYA 1LVCD 5I2OA 1NX3A 1QLKA 1MUXA 1WDCC 2G2BA 1UHKA 1IG5A 4MSPA 3TS5B 1QIVA 2ZNEA 1UHNA 2M9GA 1IKUA 3BOWB 4PE7A 1SL9A 2KHNA 2BL0B 4YI8A 2WCEA 4E68A 1JBAA 3LK1A 2NZ0A 1CMFA 1S6CA 5DKNA 5I2LA 1ZOTB 2I2RE 3KF9A 1F4QA 1MXEA 3BUXB 1SNLA 3ZWHA 1B7TY 1CLLA 1YURA 1NUBA 1RROA 1NYAA 2F2PA 1RK9A 3SIBA 2COLB 1XFUO 2M0RA 3I5FB 3VRNA 1N0YA 1B47A 2K7OA 4DCKA 1BOCA 1WRKA 3AKAA 1PALA 3SG6A 3FWBA 1C07A 1TCFA 2L0PA 1NX2A 5I2QA 4ORBB 2CTNA 2KOTA 4GNKB 1UHJA 1KK8C 5JJGA 4PDZA 2EGDA 1G4YR 4NDCA 3RM1A 1DT7B 3DVEA 1AK8A 2JT3A 5J3XA 2TN4A 5TNCA 2KDHA 1SR6B 1ALVA 1WLMA 1UHIA 2BE6A 3BOWA 3WNXB 4PE4A 1M45A 1M63B 3EVVA 4PHNA 3DF0B 4NQGA 5K89A 1QV1A 1KFUS 1ALWA 4MZJA 1F54A 2AMIA 1LA3A 2ZN9A 1B8RA 2RGIA 2KBIA 1OZSA 2LP2A 5IBWA 5CPVA 1V1GA 2LE9B 1B4CA 1J7RA 1OZOA 2PMYA 1DJIA 3BUOB 1DVIA 1YVHA 3KO0A 1NCZA 4MLWA 4CFQA 3QRXA 4YGDB 1UWOA 3NSOA 1CM4A 3D0YA 2FOTA 1W7JB 1U5IB 4PHJA 1TNXA 3ZNIA 2LLSA 1UUSA 1IH0A 1BU3A 1YX8A 1BR1B 2Y1MA 4WQ3A 1XFVO 1TNQA 4MBEA 1JFJA 4MN0A 2B1UA 2KGRA 3EKHA 4DS7A 2E6WA 5CSFA 1EXRA 4GBAA 2MA2A 1C7VA 1K9KA 3PALA 1KK8B 5I8NA 1L2OB 2V53A 1GQMA 2KNEA 3AAKA 3AAJA 3DF0A 3O78A 5D69A 5F6TA 3SG4A 1YRUB 1C7WA 5B8IB 1J7QA 3FWCA 2CT9A 3HX4A 1NPQA 2LLUA 1CFDA 1CM1A 1CDPA 1AP4A 2LVVA 2BL0C 2ZN8A 4DUQA 2PVBA 1ZFSA 2KYFA 2KGBC 5DKRA 2ZRSA 3LLEA 2QPTA 1QX2A 1QVIZ 2H2KA 2LANA 4GAOA 1DJGA 1OOJA 1BT6A 4CPVA 4P5OE 4PE1A 2K7DA 1JC2A 2LCPA 2JXCA 3ICBA 1HT9A 1QX7A 1TCOB 2I18A 1OE9B 3GK1A 4CIDA 5AERA 1FF1A 3BQ3A 3KEVA 1BR4B 1BLQA 1IGVA 1WY9A 2JOJA 2NCOA 4D1EA 2M1KB 1K8UA 2KQ6A 2JNFA 1XYDA 2LUCA 1KK7Z 1BF5A 5CSIA 3VROA 1IQ3A 1Y1AA 3PFVA 2A4JA 2MLEC 1DMOA 2L51A 2JULA 4OCIA 3IQOA 1DJZA 2LC5A 1CFFA 1QASA 3BYAA 2M8UA 1V1FA 1RWYA 1J1DA 3PATA 3CGAA 2L4IA 3EK8A 2Y1NA 3BXKA 2F2OA 2KAYA 4ZCVA 1F4OA 4FTGA 2FCEA 2SCPA 3BUNB 4QJ5B 1CDMA 2OTGC 4ORCB 1FBVA 4M2OA 2WCBA 4AOMA 1KWOC 1XFZO 4PCWA 1ZMZA 1J7OA 2DOQA 2KI6D 4AQIA 4BY4A 1A75A 1XFYO 2KQYA 3OB2B 1KQMB 1YUTA 1NCXA 4PALA 2BBNA 4HREE 1IJ6A 3BUWB 5G08A 5KTYA 1R2UA 1YX7A 1CB1A 2NLNA 4C0JA 1Q80A 3FS7A 3EVUA 1OMRA 1K93D 3D0YB 1ZACA 4YI9A 3FIAA 4HSZA 1AHRA 2G9BA 1KQVA 1KFXL 1L2OC 2BBMA 1R6PA 2BCAA 1SCMB 3RLZA 2NCPA 3PSRA 1OMDA 1YUSA 3EK4A 1JF0A 2JT8A 2JXLA 1XVJA 1IRJA 4R1EA 1B9AA 2BKHB 1CDLA 1SY9A 4DRWA 1SRAA 3VRPA 4HRHA 4YRUA 1TRFA 3SG5A 1AVSA 1JWDA 3O4YA 5HKZA 3H4SE 1EG4A 2BCXA 1IWQA 1TNWA 1A29A 2BCBA 2OTGB 4MRYA 2ISDA 1VRKA 1KWOB 4OV2A 3A4UB 3HCMA 4MZKA 1X02A 1DF0B 2LP3A 3LCPC 5AEQA 2JZIA 2F3YA 1SBJA 1SCVA 5HLOA 3VRQA 4C0LA 3O2PA 4I5JA 4QJ3B 3LL8B 2Q4UA 2LVIA 1CTRA 2VRGA 4XYNA 2K7CA 2M49B 2O5GA 4ICBA 1NX1A 3PLFB 1LINA 4BY5A 1ODBA 2K7BA 3CZTX 2LLTA 1TOPA 2OS8C 4I5KA 1NP8A 3TDZA 5KSZA 1NX0A 4NDBA 2F33A 5ER5A 1FPWA 5PALA 1B1GA 4IL1A 1XO5A 1NSHA 1YR5A 2LMUA 1BMOA 1UHHA 1XFWO 1B8LA 1RECA 1SYMA 2LNKA 3BUMB 1LKJA 2CXJA 5HYDA 4MEWA 2JRFA 4M2PA 5AFPA 3CR4X 1DJHA 3SIAA 4YGBB 1FI6A 4OR9B 4PE0A 1DF0A 2KFFA 3NSKA 3I5GB 1CFPA 2NXQA 4GGFA 3I5HC 1KQMC 2MHHA 1WRLA 4ZCUA 3NSIA 2JC2A 2KSPA 2KAXA 2L4HA 2Y5IA 2WORA 4DIRA 1A75B 2M1UA 2MAZA 1LXFC 4A4CA 5D7FA 1KFXS 3OP0A 1NWDA 2F3ZA 2K8MB 2KYCA 3EVRA 4C0KA 4F0ZB 2JNXA 1TNPA 2HQWA 4M2QA 1MWNA 2KI4C 1B8CA 3CTNA 1PSBA 1SCMC 2OS8B 1QLSA 4OKHA 1F71A 3CWGA 3KPXA 1TIZA
chains in the Genus database with same CATH superfamily
2LM5A 2L2EA 2OPOA 4JWQA 3VRRA 4JQ0D 1SW8A 4GGNA 1OSAA 3TDIA 1LA0A 5CSJA 3F45A 3KHEA 1HQVA 2KBMA 2ZKMX 2BE4A 3SJSA 2QACA 4Q04A 1QTXA 2SASA 1JUOA 1RFJA 1KSOA 1CFCA 1JSAA 1SPYA 3OGNA 3EKJA 1XFXO 1AJ4A 2FCDA 2PSRA 2LVKA 3VGOA 2JWWA 3SG7A 3SS4A 2JU0A 1IQ5A 1PRWA 4N1GA 3DXLA 3C1VA 1TN4A 3Q8IA 1SMGA 1PSRA 3UNWA 4ETOA 1EJ3A 3I5HB 3NXAA 4FQOA 1WLZA 4GGFC 3I5IC 3WXAA 4AQJA 1WRZA 2WOSA 1BODA 1M31A 4XJKB 1M39A 3RZSA 1OW4A 4TNCA 2PALA 4GUKA 1S5GZ 2CCMA 2O60A 1K94A 4JKTA 1J1EA 3SG3A 3DD4A 1AUIB 1TTXA 4L9MA 4CFRA 2HPSA 3CABA 3IQQA 4YGEB 1QS7A 1Y1UA 1UP5A 1YVLA 1PULA 4ORAB 2CBLA 2K0JA 2MRDA 2E30A 1S26D 3MSEB 4INWA 5DKQA 2ZFDA 4UPGA 2KI4B 4HRGA 4N5XA 5HKYA 1H8BA 1NIWA 4A4BA 2GV5A 1Y1XA 4MVFA 3K21A 2M3WA 2MJWB 4QJ4B 3TUYC 3D10A 1SL8A 3FE6A 1J7PA 5JOLA 1G8IA 1TUJA 1CLBA 1NCYA 2KFGA 1ZUZA 2LV7A 2WNDA 2L98A 3D74A 2K2AA 3GK2A 3LK0A 4MRXA 2KLEA 4U8DA 5DICA 1BG1A 1JWDA 2FJYA 1W7IB 1SK6D 2M7LA 1QX5B 3OX5A 1PVAA 5AXIA 4YBHB 1K9UA 1RJVA 4I5NB 3CS1A 3I5GC 2ZNDA 3JVTC 3E3RA 3M0WA 3D78A 2K60A 1QVIY 2P6BB 3R1VA 2QEOA 2M97A 3OHMB 2EHBA 3PM2A 4GFTA 1S1EA 1DGVA 2AAOA 4XJKA 5EL2A 1Z4HA 5AANA 2LMVA 3OB1B 1S6JA 1OOFA 2CNPA 4YGAA 1S36A 2LHIA 3SG2A 5FI6A 1PK0D 3AKBA 3B86A 2I7AA 3I5IB 2KFHA 3N7HA 3CLNA 1GGWA 1WDCB 2M29A 1BJFA 1S6IA 1K2HA 2EC6C 1KK7Y 1YTZC 2BECA 3EK7A 1MHOA 2FJUB 1OMVA 1G33A 3JTDC 3IF7A 2LMTA 2Y4QA 3NSLA 1N2DA 1YRTB 3O6BA 1A4PA 1OQPA 2GGZA 2PRUA 3PN7C 5HLVA 5HKWA 1IJ5A 1XK4A 5ER4X 2PYQA 2MBXA 4N1FA 1M46A 1B7TZ 4PHMA 1MF8B 3WHTB 3B6XA 3CR5X 3TUYB 1DJXA 2GGMA 1CNPA 4FQTA 2IS9A 1CLMA 1XA5A 2BKIB 1S3PA 1EL4A 3CR2A 1PVBA 4MZLA 4YGCB 2QEBA 1K95A 3D73A 2Q91A 3GOFA 4JPZB 5KU1A 1L7ZA 2HQ8A 2LUXA 2QEHA 1CDNA 1MXLC 2JT0A 1FW4A 1N65A 2ZRTA 1AJ5A 2WCMA 1SL7A 1KSMA 1F55A 1K9PA 2H61A 3JVTB 1K90D 2JPTA 1A2XA 1JFKA 1SSEB 1GGZA 3DVKA 1QIWA 2JTZA 2WCFA 2F8PA 4USLA 5CSNA 1K96A 3DVJA 4PHKA 3TS5C 2HF5A 1S5GY 1GJYA 1QV0A 1F70A 1Y0VH 4GPLB 3TZ1A 2LHLA 2K2FA 2R2IA 2JPOA 2WC8A 5D3OA 1FI5A 2M7NA 3VB1A 1RTP1 3TDUA 2EC6B 5FI2A 1DJYA 2BAPA 3CZ1A 1H4BA 1DGUA 2JQ6A 1DJWA 1W9ZA 5FYXA 3JTDB 4WRIA 2MLFC 1EH2A 1A03A 1SKTA 1KFUL 2AUCA 3PN7B 1EG3A 5GQQC 1U5IA 1F8HA 4OVNF 2JTTA 2KAVA 1QXPA 3A8RA 1XK4C 1OOHA 2KI6C 4P2YB 4CLNA 2LAPA 1QJTA 2PASA 1MQ1A 3I5FC 1J55A 4WQ2A 2HETA 2L5XB 3BFHA 2WCJA 3WHUB 3CZ0A 3GK4X 3PM8A 4NDDA 1UURA 1CMGA 2L2CA 1DEKA 1YUUA 2P70A 1MR8A 2D8NA 3OX6A 1CKKA 1QATA 2I94A 4I5LB 2L50A 1Y6WA 3DVMA 5BPJA 2LVJA 2H61C 1JF2A 1D1OA 1SR6C 1DTLA 2K61A 1E8AA 1KCYA 2L5YA 1LVCD 5I2OA 1NX3A 1QLKA 1MUXA 1WDCC 1XFRA 2G2BA 1UHKA 1IG5A 4MSPA 3TS5B 1QIVA 3D77A 2ZNEA 1UHNA 2M9GA 1IKUA 3BOWB 4PE7A 1SL9A 2KHNA 2BL0B 4YI8A 2WCEA 4E68A 1JBAA 3LK1A 2NZ0A 1CMFA 1S6CA 5DKNA 5I2LA 1ZOTB 2I2RE 3KF9A 1F4QA 1MXEA 3BUXB 1SNLA 3ZWHA 1B7TY 1CLLA 1YURA 1NUBA 1RROA 1NYAA 2F2PA 1RK9A 3SIBA 3SG5A 2COLB 1XFUO 3FE9A 2M0RA 3I5FB 3VRNA 1N0YA 1B47A 2K7OA 4DCKA 1BOCA 1WRKA 3AKAA 1PALA 3IVTA 3FWBA 3SG6A 3S0AA 1C07A 1TCFA 2L0PA 1NX2A 1OOIX 5I2QA 4ORBB 2CTNA 2KOTA 2WCLA 4GNKB 3FE8A 1UHJA 1KK8C 5JJGA 4PDZA 2EGDA 1G4YR 4NDCA 4F7FA 3B7AA 3RM1A 1DT7B 3DVEA 1AK8A 2JT3A 5J3XA 2TN4A 5TNCA 2KDHA 1SR6B 1ALVA 1WLMA 1UHIA 2BE6A 3BOWA 3WNXB 4PE4A 1M45A 1M63B 3EVVA 4PHNA 3DF0B 3SS3A 1LS8A 4NQGA 5K89A 1QV1A 1KFUS 1ALWA 3L4LA 1QWVA 4MZJA 1F54A 2AMIA 1LA3A 2ZN9A 1B8RA 2RGIA 2KBIA 1OZSA 2LP2A 5IBWA 5CPVA 1V1GA 2LE9B 1B4CA 1J7RA 1OZOA 2PMYA 1DJIA 3BUOB 1DVIA 1YVHA 3DZTA 4PT1A 3KO0A 1NCZA 4MLWA 4CFQA 3QRXA 4YGDB 3SS5A 1UWOA 3NSOA 3S0DA 1CM4A 3D0YA 2FOTA 1W7JB 1U5IB 4PHJA 1TNXA 3ZNIA 2LLSA 1UUSA 1IH0A 1BU3A 1YX8A 1BR1B 2QDIA 2Y1MA 4WQ3A 1XFVO 1TNQA 3BJHA 4MBEA 4MN0A 1JFJA 2B1UA 2WC5A 2KGRA 3EKHA 4DS7A 2E6WA 1DQEA 1EXRA 2P71A 4GBAA 5CSFA 2MA2A 1C7VA 1K9KA 3PALA 1KK8B 5I8NA 1L2OB 2V53A 1GQMA 2KNEA 3AAKA 3AAJA 3DF0A 3O78A 5D69A 5F6TA 3SG4A 1YRUB 1C7WA 2KPHA 5B8IB 3FWCA 1J7QA 2CT9A 3HX4A 3S0EA 1NPQA 2LLUA 1CFDA 1CM1A 1CDPA 1AP4A 2LVVA 2BL0C 2ZN8A 4DUQA 2PVBA 1ZFSA 2KYFA 2KGBC 5DKRA 2ZRSA 3CDNA 2QPTA 3LLEA 1QX2A 1QVIZ 2H2KA 2LANA 4GAOA 1DJGA 1OOJA 3B87A 1BT6A 4CPVA 4P5OE 4PE1A 2K7DA 1JC2A 2LCPA 2JXCA 3ICBA 1HT9A 1QX7A 1TCOB 2I18A 1OE9B 3B88A 3GK1A 4CIDA 5AERA 3BQ3A 3KEVA 1BR4B 1P28A 1BLQA 1IGVA 1WY9A 2JOJA 2NCOA 4D1EA 2M1KB 1K8UA 2KQ6A 2JNFA 1XYDA 3R1OA 2LUCA 2WC6A 1KK7Z 1BF5A 3NGVA 5CSIA 3VROA 1IQ3A 1Y1AA 3L47A 3PFVA 2A4JA 2MLEC 1DMOA 2L51A 2JULA 4OCIA 3IQOA 1DJZA 2LC5A 1CFFA 1QASA 3BYAA 2M8UA 1V1FA 1RWYA 1J1DA 3PATA 3R1PA 1C3YA 3CGAA 2L4IA 3D75A 3EK8A 2Y1NA 3BXKA 2F2OA 2KAYA 4ZCVA 1F4OA 4FTGA 2FCEA 2SCPA 3BUNB 4QJ5B 2H8VA 1CDMA 2OTGC 1TWOA 5FI7A 4ORCB 1FBVA 4M2OA 2WCBA 3D76A 4AOMA 1KWOC 1XFZO 4PCWA 4IJ7A 1ZMZA 1J7OA 2DOQA 2KI6D 3BFBA 4AQIA 4BY4A 1A75A 3QMEA 2WCHA 1XFYO 2KQYA 3OB2B 1Z2CB 1KQMB 3K1EA 1YUTA 1NCXA 4PALA 2BBNA 4HREE 1IJ6A 3BUWB 5G08A 5KTYA 1R2UA 1YX7A 1CB1A 2NLNA 4C0JA 1Q80A 3FS7A 3EVUA 1OMRA 1K93D 3D0YB 1ZACA 4YI9A 3FIAA 4HSZA 1AHRA 2G9BA 1KQVA 1KFXL 1L2OC 2BBMA 1R6PA 2BCAA 1SCMB 3RLZA 2NCPA 3PSRA 1OMDA 1YUSA 3EK4A 1JF0A 3S0FA 2JT8A 2JXLA 1XVJA 1IRJA 4R1EA 1B9AA 2BKHB 1CDLA 1SY9A 2GTEA 4DRWA 1ORGA 1SRAA 3VRPA 4HRHA 4YRUA 1GM0A 3NHTA 1C3ZA 1TRFA 1T14A 1AVSA 3BFAA 3CYZA 3O4YA 3H4SE 5HKZA 3S0BA 1EG4A 2BCXA 1IWQA 1TNWA 1A29A 2BCBA 2OTGB 4MRYA 2ISDA 1VRKA 1OOGA 1KWOB 3EG5B 4OV2A 3V2LA 3A4UB 1IIOA 3HCMA 4MZKA 1X02A 1DF0B 2LP3A 3LCPC 5AEQA 2JZIA 2F3YA 1SBJA 1SCVA 5HLOA 3DYEA 3VRQA 4C0LA 3O2PA 3R72A 4I5JA 4QJ3B 3LL8B 3UO9A 3OBVA 2Q4UA 2LVIA 1CTRA 3DY9A 2VRGA 4XYNA 2K7CA 2M49B 2O5GA 4ICBA 4KYNA 1NX1A 3PLFB 2BNXA 2ERBA 1LINA 4BY5A 1ODBA 4OZDA 2K7BA 3CZTX 2LLTA 1TOPA 2OS8C 4I5KA 1NP8A 3TDZA 5KSZA 1NX0A 4NDBA 2F33A 5ER5A 1FPWA 5PALA 1B1GA 4IL1A 1XO5A 3S0GA 1NSHA 1YR5A 2LMUA 1BMOA 1UHHA 1XFWO 1B8LA 1RECA 1SYMA 2LNKA 3BUMB 1LKJA 2CXJA 5HYDA 4MEWA 2JRFA 4M2PA 5AFPA 3CR4X 2YGUA 1DJHA 3SIAA 4YGBB 1FI6A 4OR9B 4JD9A 4PE0A 1DF0A 2KFFA 3NSKA 1DC1A 2PQLA 3I5GB 3L4AA 3NHIA 1CFPA 2NXQA 4GGFA 3I5HC 1KQMC 2MHHA 1WRLA 4ZCUA 3PJIA 3NSIA 2JC2A 2KSPA 2KAXA 2L4HA 2Y5IA 2WORA 4DIRA 1A75B 1DELA 2WCKA 2M1UA 2MAZA 1TUZA 1LXFC 4A4CA 5D7FA 1KFXS 3OP0A 1NWDA 2F3ZA 2K8MB 2KYCA 3EVRA 4C0KA 4F0ZB 2JNXA 1TNPA 4INXA 2HQWA 5HL1A 4M2QA 1MWNA 2KI4C 1B8CA 3CTNA 5I94A 1PSBA 1SCMC 3O4XA 1FF1A 2OS8B 2QEVA 1QLSA 2KLDA 4OKHA 1F71A 3CZ2A 3CWGA 3KPXA 1TIZA
chains in the Genus database with same CATH topology
2LM5A 2L2EA 2OPOA 4JWQA 3VRRA 4JQ0D 1SW8A 4GGNA 1OSAA 3TDIA 1LA0A 5CSJA 3F45A 3KHEA 1HQVA 2KBMA 2ZKMX 2BE4A 3SJSA 2QACA 4Q04A 1QTXA 2SASA 1JUOA 1RFJA 1KSOA 1CFCA 1JSAA 1SPYA 3EKJA 1XFXO 1AJ4A 2FCDA 2PSRA 2LVKA 3VGOA 2JWWA 3SG7A 2JU0A 1IQ5A 1PRWA 4N1GA 3C1VA 1TN4A 1SMGA 1PSRA 4ETOA 1EJ3A 3I5HB 3NXAA 4FQOA 1WLZA 4GGFC 3I5IC 3WXAA 4AQJA 1WRZA 2WOSA 1BODA 1M31A 4XJKB 1M39A 4TNCA 2PALA 4GUKA 1S5GZ 2CCMA 2O60A 1K94A 1J1EA 3SG3A 3DD4A 1AUIB 1TTXA 4L9MA 4CFRA 2HPSA 3IQQA 4YGEB 1QS7A 1Y1UA 1UP5A 1YVLA 1PULA 4ORAB 2CBLA 2K0JA 2MRDA 2E30A 1S26D 3MSEB 5DKQA 2ZFDA 4UPGA 2KI4B 4HRGA 4N5XA 5HKYA 1H8BA 1NIWA 4A4BA 2GV5A 1Y1XA 4MVFA 3K21A 2M3WA 2MJWB 4QJ4B 3TUYC 3D10A 1SL8A 1J7PA 5JOLA 1G8IA 1CLBA 1NCYA 2KFGA 1ZUZA 2LV7A 2WNDA 2L98A 3GK2A 2K2AA 3LK0A 4MRXA 4U8DA 1BG1A 1W7IB 1SK6D 2M7LA 1QX5B 3OX5A 1PVAA 5AXIA 4YBHB 1K9UA 1RJVA 4I5NB 3CS1A 3I5GC 2ZNDA 3JVTC 3E3RA 3M0WA 1QVIY 2P6BB 2M97A 3OHMB 2EHBA 4GFTA 1S1EA 1DGVA 2AAOA 4XJKA 5AANA 2LMVA 3OB1B 1S6JA 2CNPA 4YGAA 1S36A 2LHIA 3SG2A 1PK0D 3AKBA 2I7AA 3I5IB 2KFHA 3CLNA 1GGWA 1WDCB 2M29A 1BJFA 1S6IA 1K2HA 2EC6C 1KK7Y 1YTZC 2BECA 3EK7A 1MHOA 2FJUB 1OMVA 1G33A 3JTDC 3IF7A 2LMTA 2Y4QA 3NSLA 1N2DA 1YRTB 3O6BA 1A4PA 1OQPA 2GGZA 2PRUA 3PN7C 5HLVA 5HKWA 1IJ5A 1XK4A 5ER4X 2MBXA 4N1FA 1M46A 1B7TZ 4PHMA 1MF8B 3WHTB 3CR5X 3TUYB 1DJXA 2GGMA 1CNPA 2IS9A 1CLMA 1XA5A 2BKIB 1S3PA 1EL4A 3CR2A 1PVBA 4MZLA 4YGCB 3GOFA 1K95A 4JPZB 2Q91A 5KU1A 1L7ZA 2HQ8A 2LUXA 1CDNA 1MXLC 2JT0A 1FW4A 1N65A 2ZRTA 1AJ5A 1SL7A 1KSMA 1F55A 1K9PA 2H61A 3JVTB 1K90D 2JPTA 1A2XA 1JFKA 1GGZA 3DVKA 1QIWA 2JTZA 2WCFA 2F8PA 4USLA 5CSNA 1K96A 3DVJA 4PHKA 3TS5C 2HF5A 1S5GY 1GJYA 1QV0A 1F70A 1Y0VH 4GPLB 3TZ1A 2LHLA 2K2FA 2R2IA 2WC8A 1FI5A 2M7NA 1RTP1 3TDUA 2EC6B 1DJYA 1H4BA 1DGUA 2JQ6A 1DJWA 5FYXA 3JTDB 4WRIA 2MLFC 1EH2A 1A03A 1SKTA 1KFUL 2AUCA 3PN7B 1EG3A 5GQQC 1U5IA 1F8HA 4OVNF 2JTTA 2KAVA 1QXPA 3A8RA 1XK4C 2KI6C 4P2YB 4CLNA 2LAPA 1QJTA 2PASA 1MQ1A 3I5FC 1J55A 4WQ2A 2HETA 2L5XB 3WHUB 3GK4X 3PM8A 4NDDA 1UURA 1CMGA 1YUUA 1MR8A 2D8NA 3OX6A 1CKKA 1QATA 2I94A 4I5LB 2L50A 1Y6WA 3DVMA 5BPJA 2LVJA 2H61C 1JF2A 1D1OA 1SR6C 1DTLA 2K61A 1E8AA 1KCYA 1LVCD 5I2OA 1NX3A 1QLKA 1MUXA 1WDCC 2G2BA 1UHKA 1IG5A 4MSPA 3TS5B 1QIVA 2ZNEA 1UHNA 2M9GA 1IKUA 3BOWB 4PE7A 1SL9A 2KHNA 2BL0B 4YI8A 2WCEA 4E68A 1JBAA 3LK1A 2NZ0A 1CMFA 1S6CA 5DKNA 5I2LA 1ZOTB 2I2RE 3KF9A 1F4QA 1MXEA 3BUXB 1SNLA 3ZWHA 1B7TY 1CLLA 1YURA 1NUBA 1RROA 1NYAA 2F2PA 1RK9A 3SIBA 2COLB 1XFUO 2M0RA 3I5FB 3VRNA 1N0YA 1B47A 2K7OA 4DCKA 1BOCA 1WRKA 3AKAA 1PALA 3SG6A 3FWBA 1C07A 1TCFA 2L0PA 1NX2A 5I2QA 4ORBB 2CTNA 2KOTA 4GNKB 1UHJA 1KK8C 5JJGA 4PDZA 2EGDA 1G4YR 4NDCA 3RM1A 1DT7B 3DVEA 1AK8A 2JT3A 5J3XA 2TN4A 5TNCA 2KDHA 1SR6B 1ALVA 1WLMA 1UHIA 2BE6A 3BOWA 3WNXB 4PE4A 1M45A 1M63B 3EVVA 4PHNA 3DF0B 4NQGA 5K89A 1QV1A 1KFUS 1ALWA 4MZJA 1F54A 2AMIA 1LA3A 2ZN9A 1B8RA 2RGIA 2KBIA 1OZSA 2LP2A 5IBWA 5CPVA 1V1GA 2LE9B 1B4CA 1J7RA 1OZOA 2PMYA 1DJIA 3BUOB 1DVIA 1YVHA 3KO0A 1NCZA 4MLWA 4CFQA 3QRXA 4YGDB 1UWOA 3NSOA 1CM4A 3D0YA 2FOTA 1W7JB 1U5IB 4PHJA 1TNXA 3ZNIA 2LLSA 1UUSA 1IH0A 1BU3A 1YX8A 1BR1B 2Y1MA 4WQ3A 1XFVO 1TNQA 4MBEA 1JFJA 4MN0A 2B1UA 2KGRA 3EKHA 4DS7A 2E6WA 5CSFA 1EXRA 4GBAA 2MA2A 1C7VA 1K9KA 3PALA 1KK8B 5I8NA 1L2OB 2V53A 1GQMA 2KNEA 3AAKA 3AAJA 3DF0A 3O78A 5D69A 5F6TA 3SG4A 1YRUB 1C7WA 5B8IB 1J7QA 3FWCA 2CT9A 3HX4A 1NPQA 2LLUA 1CFDA 1CM1A 1CDPA 1AP4A 2LVVA 2BL0C 2ZN8A 4DUQA 2PVBA 1ZFSA 2KYFA 2KGBC 5DKRA 2ZRSA 3LLEA 2QPTA 1QX2A 1QVIZ 2H2KA 2LANA 4GAOA 1DJGA 1OOJA 1BT6A 4CPVA 4P5OE 4PE1A 2K7DA 1JC2A 2LCPA 2JXCA 3ICBA 1HT9A 1QX7A 1TCOB 2I18A 1OE9B 3GK1A 4CIDA 5AERA 1FF1A 3BQ3A 3KEVA 1BR4B 1BLQA 1IGVA 1WY9A 2JOJA 2NCOA 4D1EA 2M1KB 1K8UA 2KQ6A 2JNFA 1XYDA 2LUCA 1KK7Z 1BF5A 5CSIA 3VROA 1IQ3A 1Y1AA 3PFVA 2A4JA 2MLEC 1DMOA 2L51A 2JULA 4OCIA 3IQOA 1DJZA 2LC5A 1CFFA 1QASA 3BYAA 2M8UA 1V1FA 1RWYA 1J1DA 3PATA 3CGAA 2L4IA 3EK8A 2Y1NA 3BXKA 2F2OA 2KAYA 4ZCVA 1F4OA 4FTGA 2FCEA 2SCPA 3BUNB 4QJ5B 1CDMA 2OTGC 4ORCB 1FBVA 4M2OA 2WCBA 4AOMA 1KWOC 1XFZO 4PCWA 1ZMZA 1J7OA 2DOQA 2KI6D 4AQIA 4BY4A 1A75A 1XFYO 2KQYA 3OB2B 1KQMB 1YUTA 1NCXA 4PALA 2BBNA 4HREE 1IJ6A 3BUWB 5G08A 5KTYA 1R2UA 1YX7A 1CB1A 2NLNA 4C0JA 1Q80A 3FS7A 3EVUA 1OMRA 1K93D 3D0YB 1ZACA 4YI9A 3FIAA 4HSZA 1AHRA 2G9BA 1KQVA 1KFXL 1L2OC 2BBMA 1R6PA 2BCAA 1SCMB 3RLZA 2NCPA 3PSRA 1OMDA 1YUSA 3EK4A 1JF0A 2JT8A 2JXLA 1XVJA 1IRJA 4R1EA 1B9AA 2BKHB 1CDLA 1SY9A 4DRWA 1SRAA 3VRPA 4HRHA 4YRUA 1TRFA 3SG5A 1AVSA 1JWDA 3O4YA 5HKZA 3H4SE 1EG4A 2BCXA 1IWQA 1TNWA 1A29A 2BCBA 2OTGB 4MRYA 2ISDA 1VRKA 1KWOB 4OV2A 3A4UB 3HCMA 4MZKA 1X02A 1DF0B 2LP3A 3LCPC 5AEQA 2JZIA 2F3YA 1SBJA 1SCVA 5HLOA 3VRQA 4C0LA 3O2PA 4I5JA 4QJ3B 3LL8B 2Q4UA 2LVIA 1CTRA 2VRGA 4XYNA 2K7CA 2M49B 2O5GA 4ICBA 1NX1A 3PLFB 1LINA 4BY5A 1ODBA 2K7BA 3CZTX 2LLTA 1TOPA 2OS8C 4I5KA 1NP8A 3TDZA 5KSZA 1NX0A 4NDBA 2F33A 5ER5A 1FPWA 5PALA 1B1GA 4IL1A 1XO5A 1NSHA 1YR5A 2LMUA 1BMOA 1UHHA 1XFWO 1B8LA 1RECA 1SYMA 2LNKA 3BUMB 1LKJA 2CXJA 5HYDA 4MEWA 2JRFA 4M2PA 5AFPA 3CR4X 1DJHA 3SIAA 4YGBB 1FI6A 4OR9B 4PE0A 1DF0A 2KFFA 3NSKA 3I5GB 1CFPA 2NXQA 4GGFA 3I5HC 1KQMC 2MHHA 1WRLA 4ZCUA 3NSIA 2JC2A 2KSPA 2KAXA 2L4HA 2Y5IA 2WORA 4DIRA 1A75B 2M1UA 2MAZA 1LXFC 4A4CA 5D7FA 1KFXS 3OP0A 1NWDA 2F3ZA 2K8MB 2KYCA 3EVRA 4C0KA 4F0ZB 2JNXA 1TNPA 2HQWA 4M2QA 1MWNA 2KI4C 1B8CA 3CTNA 1PSBA 1SCMC 2OS8B 1QLSA 4OKHA 1F71A 3CWGA 3KPXA 1TIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM5 A;  2L2E A;  2OPO A;  4JWQ A;  3VRR A;  4JQ0 D;  1SW8 A;  4GGN A;  1OSA A;  3TDI A;  1LA0 A;  5CSJ A;  3F45 A;  3KHE A;  1HQV A;  2KBM A;  2ZKM X;  2BE4 A;  3SJS A;  2QAC A;  4Q04 A;  1QTX A;  2SAS A;  1JUO A;  1RFJ A;  1KSO A;  1CFC A;  1JSA A;  1SPY A;  3EKJ A;  1XFX O;  1AJ4 A;  2FCD A;  2PSR A;  2LVK A;  3VGO A;  2JWW A;  3SG7 A;  2JU0 A;  1IQ5 A;  1PRW A;  4N1G A;  3C1V A;  1TN4 A;  1SMG A;  1PSR A;  4ETO A;  1EJ3 A;  3I5H B;  3NXA A;  4FQO A;  1WLZ A;  4GGF C;  3I5I C;  3WXA A;  4AQJ A;  1WRZ A;  2WOS A;  1BOD A;  1M31 A;  4XJK B;  1M39 A;  4TNC A;  2PAL A;  4GUK A;  1S5G Z;  2CCM A;  2O60 A;  1K94 A;  1J1E A;  3SG3 A;  3DD4 A;  1AUI B;  1TTX A;  4L9M A;  4CFR A;  2HPS A;  3IQQ A;  4YGE B;  1QS7 A;  1Y1U A;  1UP5 A;  1YVL A;  1PUL A;  4ORA B;  2CBL A;  2K0J A;  2MRD A;  2E30 A;  1S26 D;  3MSE B;  5DKQ A;  2ZFD A;  4UPG A;  2KI4 B;  4HRG A;  4N5X A;  5HKY A;  1H8B A;  1NIW A;  4A4B A;  2GV5 A;  1Y1X A;  4MVF A;  3K21 A;  2M3W A;  2MJW B;  4QJ4 B;  3TUY C;  3D10 A;  1SL8 A;  1J7P A;  5JOL A;  1G8I A;  1CLB A;  1NCY A;  2KFG A;  1ZUZ A;  2LV7 A;  2WND A;  2L98 A;  3GK2 A;  2K2A A;  3LK0 A;  4MRX A;  4U8D A;  1BG1 A;  1W7I B;  1SK6 D;  2M7L A;  1QX5 B;  3OX5 A;  1PVA A;  5AXI A;  4YBH B;  1K9U A;  1RJV A;  4I5N B;  3CS1 A;  3I5G C;  2ZND A;  3JVT C;  3E3R A;  3M0W A;  1QVI Y;  2P6B B;  2M97 A;  3OHM B;  2EHB A;  4GFT A;  1S1E A;  1DGV A;  2AAO A;  4XJK A;  5AAN A;  2LMV A;  3OB1 B;  1S6J A;  2CNP A;  4YGA A;  1S36 A;  2LHI A;  3SG2 A;  1PK0 D;  3AKB A;  2I7A A;  3I5I B;  2KFH A;  3CLN A;  1GGW A;  1WDC B;  2M29 A;  1BJF A;  1S6I A;  1K2H A;  2EC6 C;  1KK7 Y;  1YTZ C;  2BEC A;  3EK7 A;  1MHO A;  2FJU B;  1OMV A;  1G33 A;  3JTD C;  3IF7 A;  2LMT A;  2Y4Q A;  3NSL A;  1N2D A;  1YRT B;  3O6B A;  1A4P A;  1OQP A;  2GGZ A;  2PRU A;  3PN7 C;  5HLV A;  5HKW A;  1IJ5 A;  1XK4 A;  5ER4 X;  2MBX A;  4N1F A;  1M46 A;  1B7T Z;  4PHM A;  1MF8 B;  3WHT B;  3CR5 X;  3TUY B;  1DJX A;  2GGM A;  1CNP A;  2IS9 A;  1CLM A;  1XA5 A;  2BKI B;  1S3P A;  1EL4 A;  3CR2 A;  1PVB A;  4MZL A;  4YGC B;  3GOF A;  1K95 A;  4JPZ B;  2Q91 A;  5KU1 A;  1L7Z A;  2HQ8 A;  2LUX A;  1CDN A;  1MXL C;  2JT0 A;  1FW4 A;  1N65 A;  2ZRT A;  1AJ5 A;  1SL7 A;  1KSM A;  1F55 A;  1K9P A;  2H61 A;  3JVT B;  1K90 D;  2JPT A;  1A2X A;  1JFK A;  1GGZ A;  3DVK A;  1QIW A;  2JTZ A;  2WCF A;  2F8P A;  4USL A;  5CSN A;  1K96 A;  3DVJ A;  4PHK A;  3TS5 C;  2HF5 A;  1S5G Y;  1GJY A;  1QV0 A;  1F70 A;  1Y0V H;  4GPL B;  3TZ1 A;  2LHL A;  2K2F A;  2R2I A;  2WC8 A;  1FI5 A;  2M7N A;  1RTP 1;  3TDU A;  2EC6 B;  1DJY A;  1H4B A;  1DGU A;  2JQ6 A;  1DJW A;  5FYX A;  3JTD B;  4WRI A;  2MLF C;  1EH2 A;  1A03 A;  1SKT A;  1KFU L;  2AUC A;  3PN7 B;  1EG3 A;  5GQQ C;  1U5I A;  1F8H A;  4OVN F;  2JTT A;  2KAV A;  1QXP A;  3A8R A;  1XK4 C;  2KI6 C;  4P2Y B;  4CLN A;  2LAP A;  1QJT A;  2PAS A;  1MQ1 A;  3I5F C;  1J55 A;  4WQ2 A;  2HET A;  2L5X B;  3WHU B;  3GK4 X;  3PM8 A;  4NDD A;  1UUR A;  1CMG A;  1YUU A;  1MR8 A;  2D8N A;  3OX6 A;  1CKK A;  1QAT A;  2I94 A;  4I5L B;  2L50 A;  1Y6W A;  3DVM A;  5BPJ A;  2LVJ A;  2H61 C;  1JF2 A;  1D1O A;  1SR6 C;  1DTL A;  2K61 A;  1E8A A;  1KCY A;  1LVC D;  5I2O A;  1NX3 A;  1QLK A;  1MUX A;  1WDC C;  2G2B A;  1UHK A;  1IG5 A;  4MSP A;  3TS5 B;  1QIV A;  2ZNE A;  1UHN A;  2M9G A;  1IKU A;  3BOW B;  4PE7 A;  1SL9 A;  2KHN A;  2BL0 B;  4YI8 A;  2WCE A;  4E68 A;  1JBA A;  3LK1 A;  2NZ0 A;  1CMF A;  1S6C A;  5DKN A;  5I2L A;  1ZOT B;  2I2R E;  3KF9 A;  1F4Q A;  1MXE A;  3BUX B;  1SNL A;  3ZWH A;  1B7T Y;  1CLL A;  1YUR A;  1NUB A;  1RRO A;  1NYA A;  2F2P A;  1RK9 A;  3SIB A;  2COL B;  1XFU O;  2M0R A;  3I5F B;  3VRN A;  1N0Y A;  1B47 A;  2K7O A;  4DCK A;  1BOC A;  1WRK A;  3AKA A;  1PAL A;  3SG6 A;  3FWB A;  1C07 A;  1TCF A;  2L0P A;  1NX2 A;  5I2Q A;  4ORB B;  2CTN A;  2KOT A;  4GNK B;  1UHJ A;  1KK8 C;  5JJG A;  4PDZ A;  2EGD A;  1G4Y R;  4NDC A;  3RM1 A;  1DT7 B;  3DVE A;  1AK8 A;  2JT3 A;  5J3X A;  2TN4 A;  5TNC A;  2KDH A;  1SR6 B;  1ALV A;  1WLM A;  1UHI A;  2BE6 A;  3BOW A;  3WNX B;  4PE4 A;  1M45 A;  1M63 B;  3EVV A;  4PHN A;  3DF0 B;  4NQG A;  5K89 A;  1QV1 A;  1KFU S;  1ALW A;  4MZJ A;  1F54 A;  2AMI A;  1LA3 A;  2ZN9 A;  1B8R A;  2RGI A;  2KBI A;  1OZS A;  2LP2 A;  5IBW A;  5CPV A;  1V1G A;  2LE9 B;  1B4C A;  1J7R A;  1OZO A;  2PMY A;  1DJI A;  3BUO B;  1DVI A;  1YVH A;  3KO0 A;  1NCZ A;  4MLW A;  4CFQ A;  3QRX A;  4YGD B;  1UWO A;  3NSO A;  1CM4 A;  3D0Y A;  2FOT A;  1W7J B;  1U5I B;  4PHJ A;  1TNX A;  3ZNI A;  2LLS A;  1UUS A;  1IH0 A;  1BU3 A;  1YX8 A;  1BR1 B;  2Y1M A;  4WQ3 A;  1XFV O;  1TNQ A;  4MBE A;  1JFJ A;  4MN0 A;  2B1U A;  2KGR A;  3EKH A;  4DS7 A;  2E6W A;  5CSF A;  1EXR A;  4GBA A;  2MA2 A;  1C7V A;  1K9K A;  3PAL A;  1KK8 B;  5I8N A;  1L2O B;  2V53 A;  1GQM A;  2KNE A;  3AAK A;  3AAJ A;  3DF0 A;  3O78 A;  5D69 A;  5F6T A;  3SG4 A;  1YRU B;  1C7W A;  5B8I B;  1J7Q A;  3FWC A;  2CT9 A;  3HX4 A;  1NPQ A;  2LLU A;  1CFD A;  1CM1 A;  1CDP A;  1AP4 A;  2LVV A;  2BL0 C;  2ZN8 A;  4DUQ A;  2PVB A;  1ZFS A;  2KYF A;  2KGB C;  5DKR A;  2ZRS A;  3LLE A;  2QPT A;  1QX2 A;  1QVI Z;  2H2K A;  2LAN A;  4GAO A;  1DJG A;  1OOJ A;  1BT6 A;  4CPV A;  4P5O E;  4PE1 A;  2K7D A;  1JC2 A;  2LCP A;  2JXC A;  3ICB A;  1HT9 A;  1QX7 A;  1TCO B;  2I18 A;  1OE9 B;  3GK1 A;  4CID A;  5AER A;  1FF1 A;  3BQ3 A;  3KEV A;  1BR4 B;  1BLQ A;  1IGV A;  1WY9 A;  2JOJ A;  2NCO A;  4D1E A;  2M1K B;  1K8U A;  2KQ6 A;  2JNF A;  1XYD A;  2LUC A;  1KK7 Z;  1BF5 A;  5CSI A;  3VRO A;  1IQ3 A;  1Y1A A;  3PFV A;  2A4J A;  2MLE C;  1DMO A;  2L51 A;  2JUL A;  4OCI A;  3IQO A;  1DJZ A;  2LC5 A;  1CFF A;  1QAS A;  3BYA A;  2M8U A;  1V1F A;  1RWY A;  1J1D A;  3PAT A;  3CGA A;  2L4I A;  3EK8 A;  2Y1N A;  3BXK A;  2F2O A;  2KAY A;  4ZCV A;  1F4O A;  4FTG A;  2FCE A;  2SCP A;  3BUN B;  4QJ5 B;  1CDM A;  2OTG C;  4ORC B;  1FBV A;  4M2O A;  2WCB A;  4AOM A;  1KWO C;  1XFZ O;  4PCW A;  1ZMZ A;  1J7O A;  2DOQ A;  2KI6 D;  4AQI A;  4BY4 A;  1A75 A;  1XFY O;  2KQY A;  3OB2 B;  1KQM B;  1YUT A;  1NCX A;  4PAL A;  2BBN A;  4HRE E;  1IJ6 A;  3BUW B;  5G08 A;  5KTY A;  1R2U A;  1YX7 A;  1CB1 A;  2NLN A;  4C0J A;  1Q80 A;  3FS7 A;  3EVU A;  1OMR A;  1K93 D;  3D0Y B;  1ZAC A;  4YI9 A;  3FIA A;  4HSZ A;  1AHR A;  2G9B A;  1KQV A;  1KFX L;  1L2O C;  2BBM A;  1R6P A;  2BCA A;  1SCM B;  3RLZ A;  2NCP A;  3PSR A;  1OMD A;  1YUS A;  3EK4 A;  1JF0 A;  2JT8 A;  2JXL A;  1XVJ A;  1IRJ A;  4R1E A;  1B9A A;  2BKH B;  1CDL A;  1SY9 A;  4DRW A;  1SRA A;  3VRP A;  4HRH A;  4YRU A;  1TRF A;  3SG5 A;  1AVS A;  1JWD A;  3O4Y A;  5HKZ A;  3H4S E;  1EG4 A;  2BCX A;  1IWQ A;  1TNW A;  1A29 A;  2BCB A;  2OTG B;  4MRY A;  2ISD A;  1VRK A;  1KWO B;  4OV2 A;  3A4U B;  3HCM A;  4MZK A;  1X02 A;  1DF0 B;  2LP3 A;  3LCP C;  5AEQ A;  2JZI A;  2F3Y A;  1SBJ A;  1SCV A;  5HLO A;  3VRQ A;  4C0L A;  3O2P A;  4I5J A;  4QJ3 B;  3LL8 B;  2Q4U A;  2LVI A;  1CTR A;  2VRG A;  4XYN A;  2K7C A;  2M49 B;  2O5G A;  4ICB A;  1NX1 A;  3PLF B;  1LIN A;  4BY5 A;  1ODB A;  2K7B A;  3CZT X;  2LLT A;  1TOP A;  2OS8 C;  4I5K A;  1NP8 A;  3TDZ A;  5KSZ A;  1NX0 A;  4NDB A;  2F33 A;  5ER5 A;  1FPW A;  5PAL A;  1B1G A;  4IL1 A;  1XO5 A;  1NSH A;  1YR5 A;  2LMU A;  1BMO A;  1UHH A;  1XFW O;  1B8L A;  1REC A;  1SYM A;  2LNK A;  3BUM B;  1LKJ A;  2CXJ A;  5HYD A;  4MEW A;  2JRF A;  4M2P A;  5AFP A;  3CR4 X;  1DJH A;  3SIA A;  4YGB B;  1FI6 A;  4OR9 B;  4PE0 A;  1DF0 A;  2KFF A;  3NSK A;  3I5G B;  1CFP A;  2NXQ A;  4GGF A;  3I5H C;  1KQM C;  2MHH A;  1WRL A;  4ZCU A;  3NSI A;  2JC2 A;  2KSP A;  2KAX A;  2L4H A;  2Y5I A;  2WOR A;  4DIR A;  1A75 B;  2M1U A;  2MAZ A;  1LXF C;  4A4C A;  5D7F A;  1KFX S;  3OP0 A;  1NWD A;  2F3Z A;  2K8M B;  2KYC A;  3EVR A;  4C0K A;  4F0Z B;  2JNX A;  1TNP A;  2HQW A;  4M2Q A;  1MWN A;  2KI4 C;  1B8C A;  3CTN A;  1PSB A;  1SCM C;  2OS8 B;  1QLS A;  4OKH A;  1F71 A;  3CWG A;  3KPX A;  1TIZ A; 
#chains in the Genus database with same CATH topology
 2LM5 A;  2L2E A;  2OPO A;  4JWQ A;  3VRR A;  4JQ0 D;  1SW8 A;  4GGN A;  1OSA A;  3TDI A;  1LA0 A;  5CSJ A;  3F45 A;  3KHE A;  1HQV A;  2KBM A;  2ZKM X;  2BE4 A;  3SJS A;  2QAC A;  4Q04 A;  1QTX A;  2SAS A;  1JUO A;  1RFJ A;  1KSO A;  1CFC A;  1JSA A;  1SPY A;  3OGN A;  3EKJ A;  1XFX O;  1AJ4 A;  2FCD A;  2PSR A;  2LVK A;  3VGO A;  2JWW A;  3SG7 A;  3SS4 A;  2JU0 A;  1IQ5 A;  1PRW A;  4N1G A;  3DXL A;  3C1V A;  1TN4 A;  3Q8I A;  1SMG A;  1PSR A;  3UNW A;  4ETO A;  1EJ3 A;  3I5H B;  3NXA A;  4FQO A;  1WLZ A;  4GGF C;  3I5I C;  3WXA A;  4AQJ A;  1WRZ A;  2WOS A;  1BOD A;  1M31 A;  4XJK B;  1M39 A;  3RZS A;  1OW4 A;  4TNC A;  2PAL A;  4GUK A;  1S5G Z;  2CCM A;  2O60 A;  1K94 A;  4JKT A;  1J1E A;  3SG3 A;  3DD4 A;  1AUI B;  1TTX A;  4L9M A;  4CFR A;  2HPS A;  3CAB A;  3IQQ A;  4YGE B;  1QS7 A;  1Y1U A;  1UP5 A;  1YVL A;  1PUL A;  4ORA B;  2CBL A;  2K0J A;  2MRD A;  2E30 A;  1S26 D;  3MSE B;  4INW A;  5DKQ A;  2ZFD A;  4UPG A;  2KI4 B;  4HRG A;  4N5X A;  5HKY A;  1H8B A;  1NIW A;  4A4B A;  2GV5 A;  1Y1X A;  4MVF A;  3K21 A;  2M3W A;  2MJW B;  4QJ4 B;  3TUY C;  3D10 A;  1SL8 A;  3FE6 A;  1J7P A;  5JOL A;  1G8I A;  1TUJ A;  1CLB A;  1NCY A;  2KFG A;  1ZUZ A;  2LV7 A;  2WND A;  2L98 A;  3D74 A;  2K2A A;  3GK2 A;  3LK0 A;  4MRX A;  2KLE A;  4U8D A;  5DIC A;  1BG1 A;  1JWD A;  2FJY A;  1W7I B;  1SK6 D;  2M7L A;  1QX5 B;  3OX5 A;  1PVA A;  5AXI A;  4YBH B;  1K9U A;  1RJV A;  4I5N B;  3CS1 A;  3I5G C;  2ZND A;  3JVT C;  3E3R A;  3M0W A;  3D78 A;  2K60 A;  1QVI Y;  2P6B B;  3R1V A;  2QEO A;  2M97 A;  3OHM B;  2EHB A;  3PM2 A;  4GFT A;  1S1E A;  1DGV A;  2AAO A;  4XJK A;  5EL2 A;  1Z4H A;  5AAN A;  2LMV A;  3OB1 B;  1S6J A;  1OOF A;  2CNP A;  4YGA A;  1S36 A;  2LHI A;  3SG2 A;  5FI6 A;  1PK0 D;  3AKB A;  3B86 A;  2I7A A;  3I5I B;  2KFH A;  3N7H A;  3CLN A;  1GGW A;  1WDC B;  2M29 A;  1BJF A;  1S6I A;  1K2H A;  2EC6 C;  1KK7 Y;  1YTZ C;  2BEC A;  3EK7 A;  1MHO A;  2FJU B;  1OMV A;  1G33 A;  3JTD C;  3IF7 A;  2LMT A;  2Y4Q A;  3NSL A;  1N2D A;  1YRT B;  3O6B A;  1A4P A;  1OQP A;  2GGZ A;  2PRU A;  3PN7 C;  5HLV A;  5HKW A;  1IJ5 A;  1XK4 A;  5ER4 X;  2PYQ A;  2MBX A;  4N1F A;  1M46 A;  1B7T Z;  4PHM A;  1MF8 B;  3WHT B;  3B6X A;  3CR5 X;  3TUY B;  1DJX A;  2GGM A;  1CNP A;  4FQT A;  2IS9 A;  1CLM A;  1XA5 A;  2BKI B;  1S3P A;  1EL4 A;  3CR2 A;  1PVB A;  4MZL A;  4YGC B;  2QEB A;  1K95 A;  3D73 A;  2Q91 A;  3GOF A;  4JPZ B;  5KU1 A;  1L7Z A;  2HQ8 A;  2LUX A;  2QEH A;  1CDN A;  1MXL C;  2JT0 A;  1FW4 A;  1N65 A;  2ZRT A;  1AJ5 A;  2WCM A;  1SL7 A;  1KSM A;  1F55 A;  1K9P A;  2H61 A;  3JVT B;  1K90 D;  2JPT A;  1A2X A;  1JFK A;  1SSE B;  1GGZ A;  3DVK A;  1QIW A;  2JTZ A;  2WCF A;  2F8P A;  4USL A;  5CSN A;  1K96 A;  3DVJ A;  4PHK A;  3TS5 C;  2HF5 A;  1S5G Y;  1GJY A;  1QV0 A;  1F70 A;  1Y0V H;  4GPL B;  3TZ1 A;  2LHL A;  2K2F A;  2R2I A;  2JPO A;  2WC8 A;  5D3O A;  1FI5 A;  2M7N A;  3VB1 A;  1RTP 1;  3TDU A;  2EC6 B;  5FI2 A;  1DJY A;  2BAP A;  3CZ1 A;  1H4B A;  1DGU A;  2JQ6 A;  1DJW A;  1W9Z A;  5FYX A;  3JTD B;  4WRI A;  2MLF C;  1EH2 A;  1A03 A;  1SKT A;  1KFU L;  2AUC A;  3PN7 B;  1EG3 A;  5GQQ C;  1U5I A;  1F8H A;  4OVN F;  2JTT A;  2KAV A;  1QXP A;  3A8R A;  1XK4 C;  1OOH A;  2KI6 C;  4P2Y B;  4CLN A;  2LAP A;  1QJT A;  2PAS A;  1MQ1 A;  3I5F C;  1J55 A;  4WQ2 A;  2HET A;  2L5X B;  3BFH A;  2WCJ A;  3WHU B;  3CZ0 A;  3GK4 X;  3PM8 A;  4NDD A;  1UUR A;  1CMG A;  2L2C A;  1DEK A;  1YUU A;  2P70 A;  1MR8 A;  2D8N A;  3OX6 A;  1CKK A;  1QAT A;  2I94 A;  4I5L B;  2L50 A;  1Y6W A;  3DVM A;  5BPJ A;  2LVJ A;  2H61 C;  1JF2 A;  1D1O A;  1SR6 C;  1DTL A;  2K61 A;  1E8A A;  1KCY A;  2L5Y A;  1LVC D;  5I2O A;  1NX3 A;  1QLK A;  1MUX A;  1WDC C;  1XFR A;  2G2B A;  1UHK A;  1IG5 A;  4MSP A;  3TS5 B;  1QIV A;  3D77 A;  2ZNE A;  1UHN A;  2M9G A;  1IKU A;  3BOW B;  4PE7 A;  1SL9 A;  2KHN A;  2BL0 B;  4YI8 A;  2WCE A;  4E68 A;  1JBA A;  3LK1 A;  2NZ0 A;  1CMF A;  1S6C A;  5DKN A;  5I2L A;  1ZOT B;  2I2R E;  3KF9 A;  1F4Q A;  1MXE A;  3BUX B;  1SNL A;  3ZWH A;  1B7T Y;  1CLL A;  1YUR A;  1NUB A;  1RRO A;  1NYA A;  2F2P A;  1RK9 A;  3SIB A;  3SG5 A;  2COL B;  1XFU O;  3FE9 A;  2M0R A;  3I5F B;  3VRN A;  1N0Y A;  1B47 A;  2K7O A;  4DCK A;  1BOC A;  1WRK A;  3AKA A;  1PAL A;  3IVT A;  3FWB A;  3SG6 A;  3S0A A;  1C07 A;  1TCF A;  2L0P A;  1NX2 A;  1OOI X;  5I2Q A;  4ORB B;  2CTN A;  2KOT A;  2WCL A;  4GNK B;  3FE8 A;  1UHJ A;  1KK8 C;  5JJG A;  4PDZ A;  2EGD A;  1G4Y R;  4NDC A;  4F7F A;  3B7A A;  3RM1 A;  1DT7 B;  3DVE A;  1AK8 A;  2JT3 A;  5J3X A;  2TN4 A;  5TNC A;  2KDH A;  1SR6 B;  1ALV A;  1WLM A;  1UHI A;  2BE6 A;  3BOW A;  3WNX B;  4PE4 A;  1M45 A;  1M63 B;  3EVV A;  4PHN A;  3DF0 B;  3SS3 A;  1LS8 A;  4NQG A;  5K89 A;  1QV1 A;  1KFU S;  1ALW A;  3L4L A;  1QWV A;  4MZJ A;  1F54 A;  2AMI A;  1LA3 A;  2ZN9 A;  1B8R A;  2RGI A;  2KBI A;  1OZS A;  2LP2 A;  5IBW A;  5CPV A;  1V1G A;  2LE9 B;  1B4C A;  1J7R A;  1OZO A;  2PMY A;  1DJI A;  3BUO B;  1DVI A;  1YVH A;  3DZT A;  4PT1 A;  3KO0 A;  1NCZ A;  4MLW A;  4CFQ A;  3QRX A;  4YGD B;  3SS5 A;  1UWO A;  3NSO A;  3S0D A;  1CM4 A;  3D0Y A;  2FOT A;  1W7J B;  1U5I B;  4PHJ A;  1TNX A;  3ZNI A;  2LLS A;  1UUS A;  1IH0 A;  1BU3 A;  1YX8 A;  1BR1 B;  2QDI A;  2Y1M A;  4WQ3 A;  1XFV O;  1TNQ A;  3BJH A;  4MBE A;  4MN0 A;  1JFJ A;  2B1U A;  2WC5 A;  2KGR A;  3EKH A;  4DS7 A;  2E6W A;  1DQE A;  1EXR A;  2P71 A;  4GBA A;  5CSF A;  2MA2 A;  1C7V A;  1K9K A;  3PAL A;  1KK8 B;  5I8N A;  1L2O B;  2V53 A;  1GQM A;  2KNE A;  3AAK A;  3AAJ A;  3DF0 A;  3O78 A;  5D69 A;  5F6T A;  3SG4 A;  1YRU B;  1C7W A;  2KPH A;  5B8I B;  3FWC A;  1J7Q A;  2CT9 A;  3HX4 A;  3S0E A;  1NPQ A;  2LLU A;  1CFD A;  1CM1 A;  1CDP A;  1AP4 A;  2LVV A;  2BL0 C;  2ZN8 A;  4DUQ A;  2PVB A;  1ZFS A;  2KYF A;  2KGB C;  5DKR A;  2ZRS A;  3CDN A;  2QPT A;  3LLE A;  1QX2 A;  1QVI Z;  2H2K A;  2LAN A;  4GAO A;  1DJG A;  1OOJ A;  3B87 A;  1BT6 A;  4CPV A;  4P5O E;  4PE1 A;  2K7D A;  1JC2 A;  2LCP A;  2JXC A;  3ICB A;  1HT9 A;  1QX7 A;  1TCO B;  2I18 A;  1OE9 B;  3B88 A;  3GK1 A;  4CID A;  5AER A;  3BQ3 A;  3KEV A;  1BR4 B;  1P28 A;  1BLQ A;  1IGV A;  1WY9 A;  2JOJ A;  2NCO A;  4D1E A;  2M1K B;  1K8U A;  2KQ6 A;  2JNF A;  1XYD A;  3R1O A;  2LUC A;  2WC6 A;  1KK7 Z;  1BF5 A;  3NGV A;  5CSI A;  3VRO A;  1IQ3 A;  1Y1A A;  3L47 A;  3PFV A;  2A4J A;  2MLE C;  1DMO A;  2L51 A;  2JUL A;  4OCI A;  3IQO A;  1DJZ A;  2LC5 A;  1CFF A;  1QAS A;  3BYA A;  2M8U A;  1V1F A;  1RWY A;  1J1D A;  3PAT A;  3R1P A;  1C3Y A;  3CGA A;  2L4I A;  3D75 A;  3EK8 A;  2Y1N A;  3BXK A;  2F2O A;  2KAY A;  4ZCV A;  1F4O A;  4FTG A;  2FCE A;  2SCP A;  3BUN B;  4QJ5 B;  2H8V A;  1CDM A;  2OTG C;  1TWO A;  5FI7 A;  4ORC B;  1FBV A;  4M2O A;  2WCB A;  3D76 A;  4AOM A;  1KWO C;  1XFZ O;  4PCW A;  4IJ7 A;  1ZMZ A;  1J7O A;  2DOQ A;  2KI6 D;  3BFB A;  4AQI A;  4BY4 A;  1A75 A;  3QME A;  2WCH A;  1XFY O;  2KQY A;  3OB2 B;  1Z2C B;  1KQM B;  3K1E A;  1YUT A;  1NCX A;  4PAL A;  2BBN A;  4HRE E;  1IJ6 A;  3BUW B;  5G08 A;  5KTY A;  1R2U A;  1YX7 A;  1CB1 A;  2NLN A;  4C0J A;  1Q80 A;  3FS7 A;  3EVU A;  1OMR A;  1K93 D;  3D0Y B;  1ZAC A;  4YI9 A;  3FIA A;  4HSZ A;  1AHR A;  2G9B A;  1KQV A;  1KFX L;  1L2O C;  2BBM A;  1R6P A;  2BCA A;  1SCM B;  3RLZ A;  2NCP A;  3PSR A;  1OMD A;  1YUS A;  3EK4 A;  1JF0 A;  3S0F A;  2JT8 A;  2JXL A;  1XVJ A;  1IRJ A;  4R1E A;  1B9A A;  2BKH B;  1CDL A;  1SY9 A;  2GTE A;  4DRW A;  1ORG A;  1SRA A;  3VRP A;  4HRH A;  4YRU A;  1GM0 A;  3NHT A;  1C3Z A;  1TRF A;  1T14 A;  1AVS A;  3BFA A;  3CYZ A;  3O4Y A;  3H4S E;  5HKZ A;  3S0B A;  1EG4 A;  2BCX A;  1IWQ A;  1TNW A;  1A29 A;  2BCB A;  2OTG B;  4MRY A;  2ISD A;  1VRK A;  1OOG A;  1KWO B;  3EG5 B;  4OV2 A;  3V2L A;  3A4U B;  1IIO A;  3HCM A;  4MZK A;  1X02 A;  1DF0 B;  2LP3 A;  3LCP C;  5AEQ A;  2JZI A;  2F3Y A;  1SBJ A;  1SCV A;  5HLO A;  3DYE A;  3VRQ A;  4C0L A;  3O2P A;  3R72 A;  4I5J A;  4QJ3 B;  3LL8 B;  3UO9 A;  3OBV A;  2Q4U A;  2LVI A;  1CTR A;  3DY9 A;  2VRG A;  4XYN A;  2K7C A;  2M49 B;  2O5G A;  4ICB A;  4KYN A;  1NX1 A;  3PLF B;  2BNX A;  2ERB A;  1LIN A;  4BY5 A;  1ODB A;  4OZD A;  2K7B A;  3CZT X;  2LLT A;  1TOP A;  2OS8 C;  4I5K A;  1NP8 A;  3TDZ A;  5KSZ A;  1NX0 A;  4NDB A;  2F33 A;  5ER5 A;  1FPW A;  5PAL A;  1B1G A;  4IL1 A;  1XO5 A;  3S0G A;  1NSH A;  1YR5 A;  2LMU A;  1BMO A;  1UHH A;  1XFW O;  1B8L A;  1REC A;  1SYM A;  2LNK A;  3BUM B;  1LKJ A;  2CXJ A;  5HYD A;  4MEW A;  2JRF A;  4M2P A;  5AFP A;  3CR4 X;  2YGU A;  1DJH A;  3SIA A;  4YGB B;  1FI6 A;  4OR9 B;  4JD9 A;  4PE0 A;  1DF0 A;  2KFF A;  3NSK A;  1DC1 A;  2PQL A;  3I5G B;  3L4A A;  3NHI A;  1CFP A;  2NXQ A;  4GGF A;  3I5H C;  1KQM C;  2MHH A;  1WRL A;  4ZCU A;  3PJI A;  3NSI A;  2JC2 A;  2KSP A;  2KAX A;  2L4H A;  2Y5I A;  2WOR A;  4DIR A;  1A75 B;  1DEL A;  2WCK A;  2M1U A;  2MAZ A;  1TUZ A;  1LXF C;  4A4C A;  5D7F A;  1KFX S;  3OP0 A;  1NWD A;  2F3Z A;  2K8M B;  2KYC A;  3EVR A;  4C0K A;  4F0Z B;  2JNX A;  1TNP A;  4INX A;  2HQW A;  5HL1 A;  4M2Q A;  1MWN A;  2KI4 C;  1B8C A;  3CTN A;  5I94 A;  1PSB A;  1SCM C;  3O4X A;  1FF1 A;  2OS8 B;  2QEV A;  1QLS A;  2KLD A;  4OKH A;  1F71 A;  3CZ2 A;  3CWG A;  3KPX A;  1TIZ A; 
#chains in the Genus database with same CATH homology
 2LM5 A;  2L2E A;  2OPO A;  4JWQ A;  3VRR A;  4JQ0 D;  1SW8 A;  4GGN A;  1OSA A;  3TDI A;  1LA0 A;  5CSJ A;  3F45 A;  3KHE A;  1HQV A;  2KBM A;  2ZKM X;  2BE4 A;  3SJS A;  2QAC A;  4Q04 A;  1QTX A;  2SAS A;  1JUO A;  1RFJ A;  1KSO A;  1CFC A;  1JSA A;  1SPY A;  3EKJ A;  1XFX O;  1AJ4 A;  2FCD A;  2PSR A;  2LVK A;  3VGO A;  2JWW A;  3SG7 A;  2JU0 A;  1IQ5 A;  1PRW A;  4N1G A;  3C1V A;  1TN4 A;  1SMG A;  1PSR A;  4ETO A;  1EJ3 A;  3I5H B;  3NXA A;  4FQO A;  1WLZ A;  4GGF C;  3I5I C;  3WXA A;  4AQJ A;  1WRZ A;  2WOS A;  1BOD A;  1M31 A;  4XJK B;  1M39 A;  4TNC A;  2PAL A;  4GUK A;  1S5G Z;  2CCM A;  2O60 A;  1K94 A;  1J1E A;  3SG3 A;  3DD4 A;  1AUI B;  1TTX A;  4L9M A;  4CFR A;  2HPS A;  3IQQ A;  4YGE B;  1QS7 A;  1Y1U A;  1UP5 A;  1YVL A;  1PUL A;  4ORA B;  2CBL A;  2K0J A;  2MRD A;  2E30 A;  1S26 D;  3MSE B;  5DKQ A;  2ZFD A;  4UPG A;  2KI4 B;  4HRG A;  4N5X A;  5HKY A;  1H8B A;  1NIW A;  4A4B A;  2GV5 A;  1Y1X A;  4MVF A;  3K21 A;  2M3W A;  2MJW B;  4QJ4 B;  3TUY C;  3D10 A;  1SL8 A;  1J7P A;  5JOL A;  1G8I A;  1CLB A;  1NCY A;  2KFG A;  1ZUZ A;  2LV7 A;  2WND A;  2L98 A;  3GK2 A;  2K2A A;  3LK0 A;  4MRX A;  4U8D A;  1BG1 A;  1W7I B;  1SK6 D;  2M7L A;  1QX5 B;  3OX5 A;  1PVA A;  5AXI A;  4YBH B;  1K9U A;  1RJV A;  4I5N B;  3CS1 A;  3I5G C;  2ZND A;  3JVT C;  3E3R A;  3M0W A;  1QVI Y;  2P6B B;  2M97 A;  3OHM B;  2EHB A;  4GFT A;  1S1E A;  1DGV A;  2AAO A;  4XJK A;  5AAN A;  2LMV A;  3OB1 B;  1S6J A;  2CNP A;  4YGA A;  1S36 A;  2LHI A;  3SG2 A;  1PK0 D;  3AKB A;  2I7A A;  3I5I B;  2KFH A;  3CLN A;  1GGW A;  1WDC B;  2M29 A;  1BJF A;  1S6I A;  1K2H A;  2EC6 C;  1KK7 Y;  1YTZ C;  2BEC A;  3EK7 A;  1MHO A;  2FJU B;  1OMV A;  1G33 A;  3JTD C;  3IF7 A;  2LMT A;  2Y4Q A;  3NSL A;  1N2D A;  1YRT B;  3O6B A;  1A4P A;  1OQP A;  2GGZ A;  2PRU A;  3PN7 C;  5HLV A;  5HKW A;  1IJ5 A;  1XK4 A;  5ER4 X;  2MBX A;  4N1F A;  1M46 A;  1B7T Z;  4PHM A;  1MF8 B;  3WHT B;  3CR5 X;  3TUY B;  1DJX A;  2GGM A;  1CNP A;  2IS9 A;  1CLM A;  1XA5 A;  2BKI B;  1S3P A;  1EL4 A;  3CR2 A;  1PVB A;  4MZL A;  4YGC B;  3GOF A;  1K95 A;  4JPZ B;  2Q91 A;  5KU1 A;  1L7Z A;  2HQ8 A;  2LUX A;  1CDN A;  1MXL C;  2JT0 A;  1FW4 A;  1N65 A;  2ZRT A;  1AJ5 A;  1SL7 A;  1KSM A;  1F55 A;  1K9P A;  2H61 A;  3JVT B;  1K90 D;  2JPT A;  1A2X A;  1JFK A;  1GGZ A;  3DVK A;  1QIW A;  2JTZ A;  2WCF A;  2F8P A;  4USL A;  5CSN A;  1K96 A;  3DVJ A;  4PHK A;  3TS5 C;  2HF5 A;  1S5G Y;  1GJY A;  1QV0 A;  1F70 A;  1Y0V H;  4GPL B;  3TZ1 A;  2LHL A;  2K2F A;  2R2I A;  2WC8 A;  1FI5 A;  2M7N A;  1RTP 1;  3TDU A;  2EC6 B;  1DJY A;  1H4B A;  1DGU A;  2JQ6 A;  1DJW A;  5FYX A;  3JTD B;  4WRI A;  2MLF C;  1EH2 A;  1A03 A;  1SKT A;  1KFU L;  2AUC A;  3PN7 B;  1EG3 A;  5GQQ C;  1U5I A;  1F8H A;  4OVN F;  2JTT A;  2KAV A;  1QXP A;  3A8R A;  1XK4 C;  2KI6 C;  4P2Y B;  4CLN A;  2LAP A;  1QJT A;  2PAS A;  1MQ1 A;  3I5F C;  1J55 A;  4WQ2 A;  2HET A;  2L5X B;  3WHU B;  3GK4 X;  3PM8 A;  4NDD A;  1UUR A;  1CMG A;  1YUU A;  1MR8 A;  2D8N A;  3OX6 A;  1CKK A;  1QAT A;  2I94 A;  4I5L B;  2L50 A;  1Y6W A;  3DVM A;  5BPJ A;  2LVJ A;  2H61 C;  1JF2 A;  1D1O A;  1SR6 C;  1DTL A;  2K61 A;  1E8A A;  1KCY A;  1LVC D;  5I2O A;  1NX3 A;  1QLK A;  1MUX A;  1WDC C;  2G2B A;  1UHK A;  1IG5 A;  4MSP A;  3TS5 B;  1QIV A;  2ZNE A;  1UHN A;  2M9G A;  1IKU A;  3BOW B;  4PE7 A;  1SL9 A;  2KHN A;  2BL0 B;  4YI8 A;  2WCE A;  4E68 A;  1JBA A;  3LK1 A;  2NZ0 A;  1CMF A;  1S6C A;  5DKN A;  5I2L A;  1ZOT B;  2I2R E;  3KF9 A;  1F4Q A;  1MXE A;  3BUX B;  1SNL A;  3ZWH A;  1B7T Y;  1CLL A;  1YUR A;  1NUB A;  1RRO A;  1NYA A;  2F2P A;  1RK9 A;  3SIB A;  2COL B;  1XFU O;  2M0R A;  3I5F B;  3VRN A;  1N0Y A;  1B47 A;  2K7O A;  4DCK A;  1BOC A;  1WRK A;  3AKA A;  1PAL A;  3SG6 A;  3FWB A;  1C07 A;  1TCF A;  2L0P A;  1NX2 A;  5I2Q A;  4ORB B;  2CTN A;  2KOT A;  4GNK B;  1UHJ A;  1KK8 C;  5JJG A;  4PDZ A;  2EGD A;  1G4Y R;  4NDC A;  3RM1 A;  1DT7 B;  3DVE A;  1AK8 A;  2JT3 A;  5J3X A;  2TN4 A;  5TNC A;  2KDH A;  1SR6 B;  1ALV A;  1WLM A;  1UHI A;  2BE6 A;  3BOW A;  3WNX B;  4PE4 A;  1M45 A;  1M63 B;  3EVV A;  4PHN A;  3DF0 B;  4NQG A;  5K89 A;  1QV1 A;  1KFU S;  1ALW A;  4MZJ A;  1F54 A;  2AMI A;  1LA3 A;  2ZN9 A;  1B8R A;  2RGI A;  2KBI A;  1OZS A;  2LP2 A;  5IBW A;  5CPV A;  1V1G A;  2LE9 B;  1B4C A;  1J7R A;  1OZO A;  2PMY A;  1DJI A;  3BUO B;  1DVI A;  1YVH A;  3KO0 A;  1NCZ A;  4MLW A;  4CFQ A;  3QRX A;  4YGD B;  1UWO A;  3NSO A;  1CM4 A;  3D0Y A;  2FOT A;  1W7J B;  1U5I B;  4PHJ A;  1TNX A;  3ZNI A;  2LLS A;  1UUS A;  1IH0 A;  1BU3 A;  1YX8 A;  1BR1 B;  2Y1M A;  4WQ3 A;  1XFV O;  1TNQ A;  4MBE A;  1JFJ A;  4MN0 A;  2B1U A;  2KGR A;  3EKH A;  4DS7 A;  2E6W A;  5CSF A;  1EXR A;  4GBA A;  2MA2 A;  1C7V A;  1K9K A;  3PAL A;  1KK8 B;  5I8N A;  1L2O B;  2V53 A;  1GQM A;  2KNE A;  3AAK A;  3AAJ A;  3DF0 A;  3O78 A;  5D69 A;  5F6T A;  3SG4 A;  1YRU B;  1C7W A;  5B8I B;  1J7Q A;  3FWC A;  2CT9 A;  3HX4 A;  1NPQ A;  2LLU A;  1CFD A;  1CM1 A;  1CDP A;  1AP4 A;  2LVV A;  2BL0 C;  2ZN8 A;  4DUQ A;  2PVB A;  1ZFS A;  2KYF A;  2KGB C;  5DKR A;  2ZRS A;  3LLE A;  2QPT A;  1QX2 A;  1QVI Z;  2H2K A;  2LAN A;  4GAO A;  1DJG A;  1OOJ A;  1BT6 A;  4CPV A;  4P5O E;  4PE1 A;  2K7D A;  1JC2 A;  2LCP A;  2JXC A;  3ICB A;  1HT9 A;  1QX7 A;  1TCO B;  2I18 A;  1OE9 B;  3GK1 A;  4CID A;  5AER A;  1FF1 A;  3BQ3 A;  3KEV A;  1BR4 B;  1BLQ A;  1IGV A;  1WY9 A;  2JOJ A;  2NCO A;  4D1E A;  2M1K B;  1K8U A;  2KQ6 A;  2JNF A;  1XYD A;  2LUC A;  1KK7 Z;  1BF5 A;  5CSI A;  3VRO A;  1IQ3 A;  1Y1A A;  3PFV A;  2A4J A;  2MLE C;  1DMO A;  2L51 A;  2JUL A;  4OCI A;  3IQO A;  1DJZ A;  2LC5 A;  1CFF A;  1QAS A;  3BYA A;  2M8U A;  1V1F A;  1RWY A;  1J1D A;  3PAT A;  3CGA A;  2L4I A;  3EK8 A;  2Y1N A;  3BXK A;  2F2O A;  2KAY A;  4ZCV A;  1F4O A;  4FTG A;  2FCE A;  2SCP A;  3BUN B;  4QJ5 B;  1CDM A;  2OTG C;  4ORC B;  1FBV A;  4M2O A;  2WCB A;  4AOM A;  1KWO C;  1XFZ O;  4PCW A;  1ZMZ A;  1J7O A;  2DOQ A;  2KI6 D;  4AQI A;  4BY4 A;  1A75 A;  1XFY O;  2KQY A;  3OB2 B;  1KQM B;  1YUT A;  1NCX A;  4PAL A;  2BBN A;  4HRE E;  1IJ6 A;  3BUW B;  5G08 A;  5KTY A;  1R2U A;  1YX7 A;  1CB1 A;  2NLN A;  4C0J A;  1Q80 A;  3FS7 A;  3EVU A;  1OMR A;  1K93 D;  3D0Y B;  1ZAC A;  4YI9 A;  3FIA A;  4HSZ A;  1AHR A;  2G9B A;  1KQV A;  1KFX L;  1L2O C;  2BBM A;  1R6P A;  2BCA A;  1SCM B;  3RLZ A;  2NCP A;  3PSR A;  1OMD A;  1YUS A;  3EK4 A;  1JF0 A;  2JT8 A;  2JXL A;  1XVJ A;  1IRJ A;  4R1E A;  1B9A A;  2BKH B;  1CDL A;  1SY9 A;  4DRW A;  1SRA A;  3VRP A;  4HRH A;  4YRU A;  1TRF A;  3SG5 A;  1AVS A;  1JWD A;  3O4Y A;  5HKZ A;  3H4S E;  1EG4 A;  2BCX A;  1IWQ A;  1TNW A;  1A29 A;  2BCB A;  2OTG B;  4MRY A;  2ISD A;  1VRK A;  1KWO B;  4OV2 A;  3A4U B;  3HCM A;  4MZK A;  1X02 A;  1DF0 B;  2LP3 A;  3LCP C;  5AEQ A;  2JZI A;  2F3Y A;  1SBJ A;  1SCV A;  5HLO A;  3VRQ A;  4C0L A;  3O2P A;  4I5J A;  4QJ3 B;  3LL8 B;  2Q4U A;  2LVI A;  1CTR A;  2VRG A;  4XYN A;  2K7C A;  2M49 B;  2O5G A;  4ICB A;  1NX1 A;  3PLF B;  1LIN A;  4BY5 A;  1ODB A;  2K7B A;  3CZT X;  2LLT A;  1TOP A;  2OS8 C;  4I5K A;  1NP8 A;  3TDZ A;  5KSZ A;  1NX0 A;  4NDB A;  2F33 A;  5ER5 A;  1FPW A;  5PAL A;  1B1G A;  4IL1 A;  1XO5 A;  1NSH A;  1YR5 A;  2LMU A;  1BMO A;  1UHH A;  1XFW O;  1B8L A;  1REC A;  1SYM A;  2LNK A;  3BUM B;  1LKJ A;  2CXJ A;  5HYD A;  4MEW A;  2JRF A;  4M2P A;  5AFP A;  3CR4 X;  1DJH A;  3SIA A;  4YGB B;  1FI6 A;  4OR9 B;  4PE0 A;  1DF0 A;  2KFF A;  3NSK A;  3I5G B;  1CFP A;  2NXQ A;  4GGF A;  3I5H C;  1KQM C;  2MHH A;  1WRL A;  4ZCU A;  3NSI A;  2JC2 A;  2KSP A;  2KAX A;  2L4H A;  2Y5I A;  2WOR A;  4DIR A;  1A75 B;  2M1U A;  2MAZ A;  1LXF C;  4A4C A;  5D7F A;  1KFX S;  3OP0 A;  1NWD A;  2F3Z A;  2K8M B;  2KYC A;  3EVR A;  4C0K A;  4F0Z B;  2JNX A;  1TNP A;  2HQW A;  4M2Q A;  1MWN A;  2KI4 C;  1B8C A;  3CTN A;  1PSB A;  1SCM C;  2OS8 B;  1QLS A;  4OKH A;  1F71 A;  3CWG A;  3KPX A;  1TIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...