1JC2A

Complex of the c-domain of troponin c with residues 1-40 of troponin i
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
EDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TROPONIN C, SKELETAL MUSCLE
publication title Structure, dynamics, and thermodynamics of the structural domain of troponin C in complex with the regulatory peptide 1-40 of troponin I
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jc2A00
1G33A 2KI6C 2R2IA 3I5HB 3LL8B 2L2EA 2I18A 2GGZA 2LMVA 1KFXS 4TNCA 4DS7A 1CM1A 1QV0A 2CTNA 1OMDA 5JJGA 3M0WA 3PN7B 4DUQA 1G4YR 3EKJA 2M0RA 4I5LB 1QIVA 2BL0C 2GV5A 1XVJA 4AOMA 1SL8A 3OX6A 1KQVA 1KK8B 1TOPA 2H61C 2CT9A 3RM1A 4OR9B 4JQ0D 1A75A 3PSRA 2O5GA 2LMUA 1KFUS 1Y6WA 2FJUB 2F33A 1BG1A 1ZMZA 1B8CA 1Q80A 2KGBC 3OB2B 2KQ6A 2MBXA 4I5JA 1M45A 2BL0B 2LM5A 1CFCA 1IGVA 2JNXA 2L4HA 2KHNA 4P2YB 4P5OE 1XK4A 2KFHA 1LINA 1OMRA 4HRGA 1UHIA 1QTXA 1GQMA 2FCEA 3ZWHA 3BUNB 2Y1NA 4YGBB 1NX3A 1RJVA 3PLFB 4QJ4B 2SASA 1AK8A 4GGFC 4MN0A 1J7RA 1KK7Z 1JUOA 1QXPA 2JC2A 3FS7A 1KQMC 1TNQA 2LVIA 4GFTA 3NXAA 2JOJA 3LK0A 1W7IB 4R1EA 1FF1A 2JTZA 2HETA 2KBIA 4MSPA 3LK1A 1KFXL 1YX8A 2Y4QA 3BUOB 4IL1A 1B8RA 1JFKA 1VRKA 2WC8A 3O78A 2WNDA 2K7BA 2IS9A 3CZTX 2JXCA 1G8IA 2K7CA 1NSHA 2LLTA 4MZJA 1XFZO 2NCPA 5AXIA 1IWQA 1KQMB 2LV7A 4N5XA 4PALA 4YBHB 1AP4A 2EC6C 1PSRA 4PHKA 5IBWA 1F55A 2OTGB 1WRLA 2LHLA 1S5GZ 1UUSA 4PE4A 3I5IC 3PALA 1UHHA 4C0KA 3EK7A 2K0JA 4MBEA 2KYFA 4YGDB 2OS8C 3SIAA 3SG4A 4HRHA 5DKQA 1F4OA 1TTXA 4Q04A 4YI8A 2F8PA 3CR2A 1IRJA 4JWQA 1AVSA 1HQVA 5CSIA 2KFFA 2G9BA 3OP0A 1FI6A 1K94A 2KNEA 3TZ1A 2BE6A 1CM4A 4WRIA 2LP2A 2ISDA 3KHEA 1LA3A 2KAYA 1RFJA 1RROA 2PALA 3I5IB 3ICBA 1PK0D 4ZCUA 4I5NB 1XFWO 3KO0A 1CNPA 3TS5C 2MJWB 1NUBA 1L2OC 2B1UA 1JSAA 1NCXA 1SPYA 1XO5A 3E3RA 1ZFSA 1PULA 1NX1A 3VRPA 5KU1A 1JF2A 2ZN9A 1W7JB 2JWWA 2K8MB 2LLSA 3TDIA 2HPSA 5F6TA 3WHTB 3CWGA 2BKIB 4CFQA 1YVLA 3AKBA 3TDUA 1MXEA 1HT9A 3PN7C 4PHMA 1AJ4A 3AAJA 1GGZA 1QJTA 3DVMA 2O60A 1OZSA 3KEVA 1BMOA 1L2OB 1UP5A 3HX4A 3KPXA 3RLZA 1DJIA 4F0ZB 5TNCA 2JQ6A 1A29A 2PVBA 1KWOB 4GNKB 1LKJA 1ALVA 1SW8A 1YUSA 4AQJA 1A4PA 1YUUA 3ZNIA 2PRUA 2H61A 4C0JA 2ZNDA 1AUIB 2VRGA 1BR4B 3O6BA 1SKTA 1CFFA 1DTLA 1K96A 1B4CA 3BUWB 1Y1AA 4DCKA 3VRRA 1CLBA 1S1EA 1RK9A 2ZN8A 4WQ3A 3CS1A 1S3PA 4MRYA 4UPGA 2MHHA 2JNFA 1WLMA 1OE9B 2PMYA 1OMVA 1M39A 1CLMA 5GQQC 1ZOTB 5HLVA 4GGNA 1WY9A 2CBLA 1AJ5A 1SMGA 2AUCA 1J1EA 2L98A 1QIWA 1MWNA 1KCYA 2M3WA 1D1OA 3VRQA 3QRXA 2ZFDA 2LVVA 1TRFA 2ZNEA 2LAPA 1NP8A 2PASA 2P6BB 4GGFA 3NSKA 4QJ3B 3BUXB 1QX7A 1MF8B 2AAOA 5I2LA 3DF0A 2DOQA 4USLA 2LVJA 1CDLA 1IQ3A 1TCOB 2QACA 1CFPA 1DJYA 1SCMC 2CCMA 1QX5B 3I5GC 1J7OA 1RTP1 4A4CA 1KK7Y 2M29A 5ER5A 3A8RA 4JPZB 3DVEA 1ODBA 1DJHA 3H4SE 2OTGC 2Q4UA 2RGIA 3EVVA 1K9KA 1S36A 2Y1MA 3DD4A 1J55A 1SL7A 2LUCA 1PALA 4GBAA 5CSNA 2KQYA 2LE9B 4XJKB 5D69A 4I5KA 2JT3A 1TIZA 3BOWA 3PM8A 1CB1A 1YVHA 1SCMB 1NX0A 3WNXB 1SYMA 1GJYA 4N1GA 3I5GB 1DVIA 2LC5A 1DJZA 2BBMA 1WRKA 1SY9A 1DF0A 2K61A 3WXAA 1TNWA 4MEWA 4HREE 1U5IB 1BR1B 3EVUA 3SG2A 4M2QA 1KFUL 2KI4C 4MRXA 2JPTA 3EK8A 2SCPA 3CR5X 1OZOA 1DGVA 1S5GY 1RWYA 1K90D 3SG7A 1EH2A 2Q91A 3KF9A 3VRNA 1UWOA 2NLNA 1BF5A 5DKRA 4N1FA 3HCMA 2K7DA 1X02A 5I8NA 5HYDA 1IKUA 2NZ0A 1SR6C 1QASA 1NCYA 1QV1A 2LVKA 5ER4X 3FWBA 2KI4B 1Y1UA 4PE0A 1N65A 1MXLC 1C7WA 1DGUA 5KSZA 3C1VA 1F70A 1H4BA 1CDNA 4A4BA 2WORA 1YRTB 4PDZA 1XFUO 2LLUA 3A4UB 2EGDA 2H2KA 1EJ3A 3NSOA 5I2QA 1QVIZ 5HLOA 4ORBB 4BY4A 1SR6B 2MA2A 2BCXA 1S26D 2WCBA 1KWOC 1PVAA 2WCEA 1BT6A 2V53A 4FQOA 2K2AA 4L9MA 3IF7A 1NCZA 1LA0A 1QLKA 4ETOA 2M1KB 2HF5A 4MLWA 1IJ6A 1JBAA 3DVKA 3I5FB 1NIWA 1SCVA 2LANA 4E68A 4C0LA 1BU3A 1QS7A 1K8UA 2WCFA 3CLNA 3FWCA 1CMFA 1MHOA 1CFDA 2F2PA 2L0PA 4MVFA 3EKHA 4OVNF 3LCPC 1TNPA 3BYAA 1K2HA 3D0YB 3BUMB 2K7OA 1SRAA 4WQ2A 1PSBA 5AEQA 1YX7A 1B7TZ 1M46A 2I94A 1BLQA 2L5XB 4U8DA 1K95A 2MRDA 2F3YA 3TDZA 1QLSA 1KSOA 3SG6A 2KGRA 2WOSA 4NDCA 4DRWA 4XYNA 4ORAB 4PCWA 1B8LA 1B1GA 3CGAA 1IH0A 1MQ1A 4OV2A 1EL4A 4CPVA 2L51A 2EHBA 3SJSA 2E6WA 3SIBA 5CSJA 2JU0A 1BOCA 4GAOA 5JOLA 3AAKA 2JZIA 2BBNA 1CTRA 4HSZA 4PE1A 5FYXA 1J1DA 2TN4A 1YTZC 3OHMB 5HKZA 1SK6D 2JULA 2NXQA 2QPTA 4XJKA 2HQWA 2A4JA 1OQPA 1F4QA 2M8UA 2E30A 4CLNA 5CSFA 2ZRSA 1A2XA 2ZRTA 4DIRA 4BY5A 1MUXA 3BQ3A 3PFVA 2NCOA 1B9AA 1IJ5A 1CLLA 1SNLA 1XA5A 2BCAA 4GPLB 1C7VA 3SG3A 3DVJA 1JFJA 1DJXA 2L50A 1U5IA 1FBVA 1XFYO 1BODA 1PRWA 4MZLA 5HKWA 1WRZA 2BKHB 2AMIA 5DKNA 4QJ5B 5AFPA 1KSMA 1K9PA 2G2BA 1V1FA 1DJWA 4ICBA 3SG5A 1F71A 1NPQA 3LLEA 4AQIA 1J7QA 1FW4A 2LMTA 3GK4X 1OOJA 3K21A 1F54A 2L4IA 1OSAA 2M9GA 3CTNA 2KI6D 1DMOA 1EXRA 1RECA 2BCBA 5G08A 1TN4A 1R6PA 3FIAA 2KAVA 1K9UA 2HQ8A 2ZKMX 1XK4C 4FTGA 4YI9A 2I2RE 1A75B 2KBMA 1IQ5A 2CNPA 1NX2A 2JTTA 3IQOA 4OKHA 1NYAA 4PE7A 3NSIA 1CKKA 3GK2A 3NSLA 2MAZA 1H8BA 3BXKA 4NQGA 2COLB 3O2PA 2FOTA 1EG4A 1JWDA 1LXFC 3PATA 2KOTA 3MSEB 1EG3A 1S6JA 1QATA 2LCPA 2M49B 1ZACA 1YUTA 1M63B 1Y1XA 5I2OA 1F8HA 3AKAA 4PHNA 1UHJA 5CPVA 3JVTC 1SBJA 1Y0VH 2M1UA 2LNKA 2KFGA 4NDDA 2Y5IA 1WDCC 5D7FA 1MR8A 2LHIA 2KDHA 3DF0B 3EK4A 1QX2A 2LP3A 1CDPA 4CIDA 1PVBA 1N0YA 3JTDC 1CDMA 1FI5A 4GUKA 3CR4X 1R2UA 3D0YA 2FCDA 1YR5A 3TUYC 1TNXA 1A03A 3I5FC 2JT0A 1ALWA 2F3ZA 3JVTB 1GGWA 1FPWA 2M7LA 1TCFA 1JF0A 3OB1B 1WDCB 1SL9A 4M2OA 1K93D 1UURA 2EC6B 4MZKA 2D8NA 2GGMA 2PSRA 1QVIY 3O4YA 4CFRA 3JTDB 2KYCA 4D1EA 5KTYA 2JRFA 3BOWB 5B8IB 2CXJA 1NWDA 2LUXA 3TUYB 2KSPA 2JXLA 1DJGA 4ORCB 2M7NA 1XFXO 4OCIA 1L7ZA 5K89A 4YGEB 5J3XA 2I7AA 2MLEC 1CMGA 1DF0B 2OS8B 1WLZA 3IQQA 1YRUB 5PALA 5BPJA 1BJFA 4PHJA 3OX5A 1YURA 1JC2A 1DT7B 1LVCD 2JT8A 3VGOA 4YRUA 1XYDA 3GK1A 4YGCB 3GOFA 3I5HC 1B47A 2M97A 1N2DA 3WHUB 3F45A 1XFVO 1E8AA 4M2PA 4YGAA 5HKYA 1S6IA 4ZCVA 1AHRA 2MLFC 5AANA 3D10A 1S6CA 1V1GA 1B7TY 1J7PA 1IG5A 2K2FA 5AERA 2KAXA 1M31A 4NDBA 2OPOA 3TS5B 1ZUZA 2BECA 1UHKA 3EVRA 1C07A 1UHNA 2BE4A 3VROA 1KK8C 2F2OA
chains in the Genus database with same CATH superfamily
1G33A 2KI6C 2R2IA 3I5HB 3LL8B 5FI7A 2L2EA 2I18A 5I94A 2GGZA 2LMVA 1KFXS 4TNCA 4DS7A 1CM1A 1QV0A 2CTNA 1OMDA 5JJGA 2JPOA 3M0WA 3PN7B 3D77A 4DUQA 1G4YR 1W9ZA 3EKJA 2M0RA 4I5LB 1OOIX 1QIVA 2BL0C 2GV5A 1XVJA 4AOMA 2QEBA 1SL8A 3BFAA 3CABA 3OX6A 1KQVA 1KK8B 1TOPA 2H61C 2CT9A 3RM1A 4OR9B 4JQ0D 1A75A 3PSRA 3NHIA 3D75A 2O5GA 2LMUA 1KFUS 1Y6WA 2FJUB 2F33A 4JD9A 1ZMZA 1B8CA 1Q80A 2KGBC 3OB2B 3S0BA 2KQ6A 2MBXA 5HL1A 4I5JA 3V2LA 4INWA 1M45A 3SS5A 2BL0B 2LM5A 1OOGA 4INXA 1CFCA 1IGVA 2JNXA 2L4HA 2KHNA 4P2YB 4P5OE 1XK4A 2KFHA 1LINA 1QWVA 1DELA 1OW4A 1OMRA 4HRGA 1UHIA 1QTXA 1GQMA 2FCEA 3ZWHA 3BUNB 2Y1NA 4YGBB 1NX3A 1RJVA 3PLFB 4QJ4B 2SASA 1AK8A 4GGFC 3B7AA 4MN0A 1J7RA 1KK7Z 1JUOA 1QXPA 2KLDA 2JC2A 3FS7A 1KQMC 1TNQA 2LVIA 4GFTA 3NXAA 2JOJA 3LK0A 1W7IB 4R1EA 1DEKA 1FF1A 2JTZA 2HETA 2KBIA 3L47A 4MSPA 2WCKA 3LK1A 1KFXL 1YX8A 2Y4QA 3L4AA 3BUOB 4IL1A 1B8RA 1JFKA 1VRKA 2WC8A 3O78A 3B88A 2WNDA 3DZTA 2K7BA 2IS9A 3CZTX 2JXCA 1G8IA 2K7CA 1NSHA 2LLTA 3PM2A 4MZJA 1XFZO 2NCPA 5AXIA 1IWQA 1KQMB 2LV7A 4N5XA 4PALA 4YBHB 1AP4A 2EC6C 1PSRA 4PHKA 5IBWA 1F55A 2OTGB 3D76A 1WRLA 2LHLA 1S5GZ 1UUSA 3EG5B 4PE4A 3OBVA 3I5IC 3DYEA 3FE8A 3PALA 1UHHA 4C0KA 2BAPA 2K0JA 3EK7A 4MBEA 4FQTA 1OOHA 2KYFA 4YGDB 2OS8C 3SIAA 3SG4A 4HRHA 5DKQA 1F4OA 1TTXA 4Q04A 4YI8A 2F8PA 3CR2A 1IRJA 4JWQA 1AVSA 1HQVA 5CSIA 2KFFA 2G9BA 3OP0A 1FI6A 1K94A 2KNEA 3CZ1A 3TZ1A 2BE6A 3UO9A 1CM4A 4WRIA 2LP2A 2ISDA 3KHEA 1LA3A 2KAYA 1RFJA 1RROA 2PALA 3I5IB 3ICBA 1PK0D 3PJIA 4ZCUA 4I5NB 2P71A 1XFWO 2PQLA 3KO0A 1CNPA 3TS5C 2MJWB 1NUBA 1L2OC 2B1UA 1JSAA 1NCXA 1SPYA 3CZ2A 1XO5A 3E3RA 1ZFSA 1PULA 1NX1A 3VRPA 5KU1A 2QEOA 1JF2A 2ZN9A 1W7JB 2JWWA 2K8MB 2LLSA 3TDIA 2HPSA 5F6TA 3WHTB 3CWGA 2BKIB 1P28A 4CFQA 1YVLA 3AKBA 3TDUA 1MXEA 1HT9A 3PN7C 4PHMA 1AJ4A 3AAJA 1GGZA 1QJTA 3DVMA 3NHTA 1GM0A 2O60A 1OZSA 3KEVA 1BMOA 1L2OB 1UP5A 3HX4A 3KPXA 3RLZA 1DJIA 3S0AA 2KPHA 4F0ZB 5TNCA 3S0FA 2JQ6A 1A29A 2PVBA 3OGNA 1KWOB 4GNKB 1LKJA 1ALVA 1SW8A 1YUSA 2PYQA 2WC6A 3NGVA 4AQJA 1A4PA 1YUUA 3VB1A 3ZNIA 2PRUA 2H61A 1TUZA 2ZNDA 1AUIB 2VRGA 1BR4B 3O6BA 1SKTA 2QDIA 3BJHA 4F7FA 1DTLA 1K96A 2YGUA 1B4CA 3BUWB 1Y1AA 4DCKA 3VRRA 1CLBA 1S1EA 4JKTA 1RK9A 2ZN8A 4WQ3A 3B86A 3CS1A 2BNXA 1S3PA 4MRYA 2FJYA 4UPGA 2MHHA 2JNFA 1WLMA 1OE9B 2PMYA 1OMVA 1M39A 1CLMA 5GQQC 2ERBA 1ZOTB 5HLVA 4GGNA 1WY9A 2CBLA 1AJ5A 1SMGA 2AUCA 1J1EA 2L98A 1QIWA 1MWNA 1KCYA 2M3WA 1D1OA 3VRQA 3QRXA 2ZFDA 2LVVA 1TRFA 1IIOA 2ZNEA 2LAPA 1NP8A 2PASA 2P6BB 1Z4HA 4GGFA 3NSKA 4QJ3B 3BUXB 1QX7A 1MF8B 2AAOA 3D74A 3DY9A 5I2LA 3R1VA 3DF0A 2DOQA 3CYZA 4USLA 2LVJA 1CDLA 1IQ3A 1TCOB 2QACA 1CFPA 1DJYA 1SCMC 2CCMA 1QX5B 3L4LA 3I5GC 4PT1A 1J7OA 1RTP1 4A4CA 1KK7Y 2M29A 5ER5A 3B6XA 3A8RA 4JPZB 3DVEA 1ODBA 1DJHA 3H4SE 2OTGC 2Q4UA 2RGIA 3EVVA 1K9KA 1S36A 2Y1MA 3DD4A 1J55A 1SL7A 2LUCA 1PALA 4GBAA 5CSNA 2KQYA 2LE9B 4XJKB 5D69A 4I5KA 2JT3A 1TIZA 3BOWA 3PM8A 1CB1A 1YVHA 3FE6A 1SCMB 1NX0A 3WNXB 1SYMA 1GJYA 4N1GA 3I5GB 1DVIA 2LC5A 1DJZA 2BBMA 1WRKA 1SY9A 1DF0A 2K61A 3WXAA 1CFFA 1TNWA 4MEWA 4HREE 1U5IB 1BR1B 3EVUA 3SG2A 1C3ZA 4M2QA 1KFUL 2KI4C 4MRXA 2JPTA 3EK8A 2SCPA 3CR5X 1LS8A 3R1PA 1OZOA 1DGVA 1S5GY 1RWYA 1K90D 3SG7A 1EH2A 2Q91A 3KF9A 3VRNA 1UWOA 2NLNA 1BF5A 5DKRA 4N1FA 2QEHA 3HCMA 2K7DA 1X02A 3SS3A 5HYDA 5I8NA 1IKUA 2NZ0A 1SR6C 1QASA 1NCYA 1QV1A 2LVKA 5ER4X 3FWBA 3S0GA 2KI4B 1Y1UA 4PE0A 1N65A 1MXLC 1C7WA 1BG1A 1DGUA 2WCHA 1OOFA 3C1VA 5KSZA 1F70A 1H4BA 1CDNA 4A4BA 1TUJA 2WORA 1YRTB 4PDZA 3IVTA 1XFUO 2LLUA 3A4UB 5D3OA 2EGDA 2H2KA 1EJ3A 3NSOA 5I2QA 1QVIZ 5HLOA 4ORBB 4BY4A 1SR6B 2MA2A 4IJ7A 2BCXA 1S26D 2WCBA 1KWOC 1PVAA 2WCEA 1BT6A 2V53A 4FQOA 2K2AA 4L9MA 1SSEB 1NCZA 1LA0A 1QLKA 3IF7A 4ETOA 2M1KB 2HF5A 4MLWA 1IJ6A 1JBAA 3DVKA 3I5FB 1NIWA 1SCVA 2LANA 4E68A 2P70A 4C0LA 1BU3A 1QS7A 1K8UA 3BFBA 2WCFA 3CLNA 3FWCA 1CMFA 1MHOA 1CFDA 2F2PA 2L0PA 4MVFA 3EKHA 4OVNF 3LCPC 1TNPA 3BYAA 1K2HA 3D0YB 3BUMB 2K7OA 1SRAA 4WQ2A 1PSBA 5AEQA 1YX7A 1B7TZ 1M46A 2I94A 1BLQA 2L5XB 4U8DA 1K95A 3K1EA 3D78A 2MRDA 2F3YA 3TDZA 3N7HA 1QLSA 1KSOA 3CDNA 3SG6A 2KGRA 2WOSA 4NDCA 4DRWA 4XYNA 4ORAB 4KYNA 4PCWA 1B8LA 1B1GA 3CGAA 1IH0A 1MQ1A 4OV2A 1EL4A 4CPVA 2L51A 1ORGA 2EHBA 3B87A 2E6WA 3SJSA 3SIBA 5CSJA 2JU0A 1BOCA 4GAOA 3CZ0A 5JOLA 3AAKA 2JZIA 2BBNA 1CTRA 4HSZA 4PE1A 5FYXA 1J1DA 2TN4A 2WCMA 1YTZC 3OHMB 5HKZA 1SK6D 2JULA 2NXQA 2QEVA 2QPTA 4XJKA 2HQWA 2A4JA 1OQPA 3BFHA 1F4QA 2M8UA 2E30A 3O4XA 5CSFA 2ZRSA 4CLNA 1A2XA 2ZRTA 4DIRA 4BY5A 1MUXA 3BQ3A 3PFVA 2NCOA 1B9AA 1IJ5A 1CLLA 1SNLA 1XA5A 2BCAA 4GPLB 1C7VA 3SG3A 3DVJA 1JFJA 1DJXA 2L50A 1U5IA 5EL2A 1FBVA 1XFYO 1BODA 1PRWA 3FE9A 4MZLA 5HKWA 1WRZA 2BKHB 2AMIA 5DKNA 4QJ5B 5AFPA 1KSMA 1K9PA 2G2BA 1V1FA 1DJWA 4ICBA 3SG5A 1F71A 1NPQA 3LLEA 4AQIA 1J7QA 1FW4A 2LMTA 3GK4X 1OOJA 3DXLA 3K21A 2L4IA 1OSAA 1F54A 2M9GA 3CTNA 2KI6D 1C3YA 1DMOA 1EXRA 1RECA 2BCBA 5G08A 2L5YA 1TN4A 1R6PA 3FIAA 1TWOA 2KAVA 1K9UA 2WCLA 2HQ8A 2ZKMX 1XK4C 4FTGA 4YI9A 2I2RE 1A75B 2KBMA 4C0JA 1IQ5A 2CNPA 1NX2A 2JTTA 3IQOA 4OKHA 1NYAA 4PE7A 3NSIA 1CKKA 3GK2A 2WCJA 2MAZA 3NSLA 3S0EA 1H8BA 3BXKA 4NQGA 2COLB 3O2PA 2FOTA 1EG4A 1JWDA 1LXFC 3PATA 3SS4A 2KOTA 3MSEB 1EG3A 1S6JA 1QATA 2LCPA 2M49B 1ZACA 1YUTA 1T14A 1M63B 1Y1XA 5I2OA 1F8HA 3AKAA 4PHNA 1UHJA 5CPVA 3JVTC 1SBJA 1Y0VH 2M1UA 2L2CA 2KFGA 2LNKA 4NDDA 5FI2A 2Y5IA 3S0DA 1WDCC 5D7FA 1MR8A 2LHIA 2KDHA 3DF0B 3EK4A 1QX2A 2LP3A 1CDPA 4CIDA 1PVBA 1N0YA 3JTDC 3UNWA 1DC1A 1CDMA 1FI5A 4GUKA 3CR4X 1R2UA 3D0YA 2FCDA 1YR5A 3TUYC 5FI6A 1TNXA 1A03A 3I5FC 2JT0A 2H8VA 1ALWA 2F3ZA 1DQEA 3Q8IA 3JVTB 1GGWA 1FPWA 2M7LA 1TCFA 1JF0A 3OB1B 1WDCB 1SL9A 4M2OA 1K93D 5DICA 1UURA 2EC6B 4MZKA 2D8NA 2GGMA 2PSRA 1QVIY 3O4YA 4CFRA 3JTDB 2KYCA 4D1EA 5KTYA 2JRFA 3BOWB 3R1OA 2WC5A 5B8IB 2CXJA 1NWDA 2GTEA 2LUXA 3TUYB 2KSPA 2JXLA 1DJGA 4ORCB 2M7NA 1XFXO 4OCIA 1L7ZA 5K89A 4OZDA 4YGEB 5J3XA 2I7AA 2MLEC 1CMGA 1DF0B 2OS8B 1WLZA 3IQQA 1YRUB 5PALA 5BPJA 3QMEA 1BJFA 4PHJA 1Z2CB 3OX5A 1YURA 3D73A 1JC2A 1DT7B 1LVCD 2JT8A 3VGOA 4YRUA 1XYDA 3GK1A 4YGCB 3GOFA 3I5HC 1B47A 2M97A 1N2DA 3WHUB 2KLEA 1XFVO 1E8AA 2K60A 3F45A 3R72A 4M2PA 4YGAA 5HKYA 1S6IA 4ZCVA 1AHRA 2MLFC 5AANA 3D10A 1S6CA 1V1GA 1B7TY 1J7PA 1IG5A 2K2FA 5AERA 2KAXA 1M31A 4NDBA 3RZSA 2OPOA 3TS5B 1ZUZA 2BECA 1UHKA 1XFRA 3EVRA 1C07A 1UHNA 2BE4A 3VROA 1KK8C 2F2OA
chains in the Genus database with same CATH topology
1G33A 2KI6C 2R2IA 3I5HB 3LL8B 2L2EA 2I18A 2GGZA 2LMVA 1KFXS 4TNCA 4DS7A 1CM1A 1QV0A 2CTNA 1OMDA 5JJGA 3M0WA 3PN7B 4DUQA 1G4YR 3EKJA 2M0RA 4I5LB 1QIVA 2BL0C 2GV5A 1XVJA 4AOMA 1SL8A 3OX6A 1KQVA 1KK8B 1TOPA 2H61C 2CT9A 3RM1A 4OR9B 4JQ0D 1A75A 3PSRA 2O5GA 2LMUA 1KFUS 1Y6WA 2FJUB 2F33A 1BG1A 1ZMZA 1B8CA 1Q80A 2KGBC 3OB2B 2KQ6A 2MBXA 4I5JA 1M45A 2BL0B 2LM5A 1CFCA 1IGVA 2JNXA 2L4HA 2KHNA 4P2YB 4P5OE 1XK4A 2KFHA 1LINA 1OMRA 4HRGA 1UHIA 1QTXA 1GQMA 2FCEA 3ZWHA 3BUNB 2Y1NA 4YGBB 1NX3A 1RJVA 3PLFB 4QJ4B 2SASA 1AK8A 4GGFC 4MN0A 1J7RA 1KK7Z 1JUOA 1QXPA 2JC2A 3FS7A 1KQMC 1TNQA 2LVIA 4GFTA 3NXAA 2JOJA 3LK0A 1W7IB 4R1EA 1FF1A 2JTZA 2HETA 2KBIA 4MSPA 3LK1A 1KFXL 1YX8A 2Y4QA 3BUOB 4IL1A 1B8RA 1JFKA 1VRKA 2WC8A 3O78A 2WNDA 2K7BA 2IS9A 3CZTX 2JXCA 1G8IA 2K7CA 1NSHA 2LLTA 4MZJA 1XFZO 2NCPA 5AXIA 1IWQA 1KQMB 2LV7A 4N5XA 4PALA 4YBHB 1AP4A 2EC6C 1PSRA 4PHKA 5IBWA 1F55A 2OTGB 1WRLA 2LHLA 1S5GZ 1UUSA 4PE4A 3I5IC 3PALA 1UHHA 4C0KA 3EK7A 2K0JA 4MBEA 2KYFA 4YGDB 2OS8C 3SIAA 3SG4A 4HRHA 5DKQA 1F4OA 1TTXA 4Q04A 4YI8A 2F8PA 3CR2A 1IRJA 4JWQA 1AVSA 1HQVA 5CSIA 2KFFA 2G9BA 3OP0A 1FI6A 1K94A 2KNEA 3TZ1A 2BE6A 1CM4A 4WRIA 2LP2A 2ISDA 3KHEA 1LA3A 2KAYA 1RFJA 1RROA 2PALA 3I5IB 3ICBA 1PK0D 4ZCUA 4I5NB 1XFWO 3KO0A 1CNPA 3TS5C 2MJWB 1NUBA 1L2OC 2B1UA 1JSAA 1NCXA 1SPYA 1XO5A 3E3RA 1ZFSA 1PULA 1NX1A 3VRPA 5KU1A 1JF2A 2ZN9A 1W7JB 2JWWA 2K8MB 2LLSA 3TDIA 2HPSA 5F6TA 3WHTB 3CWGA 2BKIB 4CFQA 1YVLA 3AKBA 3TDUA 1MXEA 1HT9A 3PN7C 4PHMA 1AJ4A 3AAJA 1GGZA 1QJTA 3DVMA 2O60A 1OZSA 3KEVA 1BMOA 1L2OB 1UP5A 3HX4A 3KPXA 3RLZA 1DJIA 4F0ZB 5TNCA 2JQ6A 1A29A 2PVBA 1KWOB 4GNKB 1LKJA 1ALVA 1SW8A 1YUSA 4AQJA 1A4PA 1YUUA 3ZNIA 2PRUA 2H61A 4C0JA 2ZNDA 1AUIB 2VRGA 1BR4B 3O6BA 1SKTA 1CFFA 1DTLA 1K96A 1B4CA 3BUWB 1Y1AA 4DCKA 3VRRA 1CLBA 1S1EA 1RK9A 2ZN8A 4WQ3A 3CS1A 1S3PA 4MRYA 4UPGA 2MHHA 2JNFA 1WLMA 1OE9B 2PMYA 1OMVA 1M39A 1CLMA 5GQQC 1ZOTB 5HLVA 4GGNA 1WY9A 2CBLA 1AJ5A 1SMGA 2AUCA 1J1EA 2L98A 1QIWA 1MWNA 1KCYA 2M3WA 1D1OA 3VRQA 3QRXA 2ZFDA 2LVVA 1TRFA 2ZNEA 2LAPA 1NP8A 2PASA 2P6BB 4GGFA 3NSKA 4QJ3B 3BUXB 1QX7A 1MF8B 2AAOA 5I2LA 3DF0A 2DOQA 4USLA 2LVJA 1CDLA 1IQ3A 1TCOB 2QACA 1CFPA 1DJYA 1SCMC 2CCMA 1QX5B 3I5GC 1J7OA 1RTP1 4A4CA 1KK7Y 2M29A 5ER5A 3A8RA 4JPZB 3DVEA 1ODBA 1DJHA 3H4SE 2OTGC 2Q4UA 2RGIA 3EVVA 1K9KA 1S36A 2Y1MA 3DD4A 1J55A 1SL7A 2LUCA 1PALA 4GBAA 5CSNA 2KQYA 2LE9B 4XJKB 5D69A 4I5KA 2JT3A 1TIZA 3BOWA 3PM8A 1CB1A 1YVHA 1SCMB 1NX0A 3WNXB 1SYMA 1GJYA 4N1GA 3I5GB 1DVIA 2LC5A 1DJZA 2BBMA 1WRKA 1SY9A 1DF0A 2K61A 3WXAA 1TNWA 4MEWA 4HREE 1U5IB 1BR1B 3EVUA 3SG2A 4M2QA 1KFUL 2KI4C 4MRXA 2JPTA 3EK8A 2SCPA 3CR5X 1OZOA 1DGVA 1S5GY 1RWYA 1K90D 3SG7A 1EH2A 2Q91A 3KF9A 3VRNA 1UWOA 2NLNA 1BF5A 5DKRA 4N1FA 3HCMA 2K7DA 1X02A 5I8NA 5HYDA 1IKUA 2NZ0A 1SR6C 1QASA 1NCYA 1QV1A 2LVKA 5ER4X 3FWBA 2KI4B 1Y1UA 4PE0A 1N65A 1MXLC 1C7WA 1DGUA 5KSZA 3C1VA 1F70A 1H4BA 1CDNA 4A4BA 2WORA 1YRTB 4PDZA 1XFUO 2LLUA 3A4UB 2EGDA 2H2KA 1EJ3A 3NSOA 5I2QA 1QVIZ 5HLOA 4ORBB 4BY4A 1SR6B 2MA2A 2BCXA 1S26D 2WCBA 1KWOC 1PVAA 2WCEA 1BT6A 2V53A 4FQOA 2K2AA 4L9MA 3IF7A 1NCZA 1LA0A 1QLKA 4ETOA 2M1KB 2HF5A 4MLWA 1IJ6A 1JBAA 3DVKA 3I5FB 1NIWA 1SCVA 2LANA 4E68A 4C0LA 1BU3A 1QS7A 1K8UA 2WCFA 3CLNA 3FWCA 1CMFA 1MHOA 1CFDA 2F2PA 2L0PA 4MVFA 3EKHA 4OVNF 3LCPC 1TNPA 3BYAA 1K2HA 3D0YB 3BUMB 2K7OA 1SRAA 4WQ2A 1PSBA 5AEQA 1YX7A 1B7TZ 1M46A 2I94A 1BLQA 2L5XB 4U8DA 1K95A 2MRDA 2F3YA 3TDZA 1QLSA 1KSOA 3SG6A 2KGRA 2WOSA 4NDCA 4DRWA 4XYNA 4ORAB 4PCWA 1B8LA 1B1GA 3CGAA 1IH0A 1MQ1A 4OV2A 1EL4A 4CPVA 2L51A 2EHBA 3SJSA 2E6WA 3SIBA 5CSJA 2JU0A 1BOCA 4GAOA 5JOLA 3AAKA 2JZIA 2BBNA 1CTRA 4HSZA 4PE1A 5FYXA 1J1DA 2TN4A 1YTZC 3OHMB 5HKZA 1SK6D 2JULA 2NXQA 2QPTA 4XJKA 2HQWA 2A4JA 1OQPA 1F4QA 2M8UA 2E30A 4CLNA 5CSFA 2ZRSA 1A2XA 2ZRTA 4DIRA 4BY5A 1MUXA 3BQ3A 3PFVA 2NCOA 1B9AA 1IJ5A 1CLLA 1SNLA 1XA5A 2BCAA 4GPLB 1C7VA 3SG3A 3DVJA 1JFJA 1DJXA 2L50A 1U5IA 1FBVA 1XFYO 1BODA 1PRWA 4MZLA 5HKWA 1WRZA 2BKHB 2AMIA 5DKNA 4QJ5B 5AFPA 1KSMA 1K9PA 2G2BA 1V1FA 1DJWA 4ICBA 3SG5A 1F71A 1NPQA 3LLEA 4AQIA 1J7QA 1FW4A 2LMTA 3GK4X 1OOJA 3K21A 1F54A 2L4IA 1OSAA 2M9GA 3CTNA 2KI6D 1DMOA 1EXRA 1RECA 2BCBA 5G08A 1TN4A 1R6PA 3FIAA 2KAVA 1K9UA 2HQ8A 2ZKMX 1XK4C 4FTGA 4YI9A 2I2RE 1A75B 2KBMA 1IQ5A 2CNPA 1NX2A 2JTTA 3IQOA 4OKHA 1NYAA 4PE7A 3NSIA 1CKKA 3GK2A 3NSLA 2MAZA 1H8BA 3BXKA 4NQGA 2COLB 3O2PA 2FOTA 1EG4A 1JWDA 1LXFC 3PATA 2KOTA 3MSEB 1EG3A 1S6JA 1QATA 2LCPA 2M49B 1ZACA 1YUTA 1M63B 1Y1XA 5I2OA 1F8HA 3AKAA 4PHNA 1UHJA 5CPVA 3JVTC 1SBJA 1Y0VH 2M1UA 2LNKA 2KFGA 4NDDA 2Y5IA 1WDCC 5D7FA 1MR8A 2LHIA 2KDHA 3DF0B 3EK4A 1QX2A 2LP3A 1CDPA 4CIDA 1PVBA 1N0YA 3JTDC 1CDMA 1FI5A 4GUKA 3CR4X 1R2UA 3D0YA 2FCDA 1YR5A 3TUYC 1TNXA 1A03A 3I5FC 2JT0A 1ALWA 2F3ZA 3JVTB 1GGWA 1FPWA 2M7LA 1TCFA 1JF0A 3OB1B 1WDCB 1SL9A 4M2OA 1K93D 1UURA 2EC6B 4MZKA 2D8NA 2GGMA 2PSRA 1QVIY 3O4YA 4CFRA 3JTDB 2KYCA 4D1EA 5KTYA 2JRFA 3BOWB 5B8IB 2CXJA 1NWDA 2LUXA 3TUYB 2KSPA 2JXLA 1DJGA 4ORCB 2M7NA 1XFXO 4OCIA 1L7ZA 5K89A 4YGEB 5J3XA 2I7AA 2MLEC 1CMGA 1DF0B 2OS8B 1WLZA 3IQQA 1YRUB 5PALA 5BPJA 1BJFA 4PHJA 3OX5A 1YURA 1JC2A 1DT7B 1LVCD 2JT8A 3VGOA 4YRUA 1XYDA 3GK1A 4YGCB 3GOFA 3I5HC 1B47A 2M97A 1N2DA 3WHUB 3F45A 1XFVO 1E8AA 4M2PA 4YGAA 5HKYA 1S6IA 4ZCVA 1AHRA 2MLFC 5AANA 3D10A 1S6CA 1V1GA 1B7TY 1J7PA 1IG5A 2K2FA 5AERA 2KAXA 1M31A 4NDBA 2OPOA 3TS5B 1ZUZA 2BECA 1UHKA 3EVRA 1C07A 1UHNA 2BE4A 3VROA 1KK8C 2F2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G33 A;  2KI6 C;  2R2I A;  3I5H B;  3LL8 B;  2L2E A;  2I18 A;  2GGZ A;  2LMV A;  1KFX S;  4TNC A;  4DS7 A;  1CM1 A;  1QV0 A;  2CTN A;  1OMD A;  5JJG A;  3M0W A;  3PN7 B;  4DUQ A;  1G4Y R;  3EKJ A;  2M0R A;  4I5L B;  1QIV A;  2BL0 C;  2GV5 A;  1XVJ A;  4AOM A;  1SL8 A;  3OX6 A;  1KQV A;  1KK8 B;  1TOP A;  2H61 C;  2CT9 A;  3RM1 A;  4OR9 B;  4JQ0 D;  1A75 A;  3PSR A;  2O5G A;  2LMU A;  1KFU S;  1Y6W A;  2FJU B;  2F33 A;  1BG1 A;  1ZMZ A;  1B8C A;  1Q80 A;  2KGB C;  3OB2 B;  2KQ6 A;  2MBX A;  4I5J A;  1M45 A;  2BL0 B;  2LM5 A;  1CFC A;  1IGV A;  2JNX A;  2L4H A;  2KHN A;  4P2Y B;  4P5O E;  1XK4 A;  2KFH A;  1LIN A;  1OMR A;  4HRG A;  1UHI A;  1QTX A;  1GQM A;  2FCE A;  3ZWH A;  3BUN B;  2Y1N A;  4YGB B;  1NX3 A;  1RJV A;  3PLF B;  4QJ4 B;  2SAS A;  1AK8 A;  4GGF C;  4MN0 A;  1J7R A;  1KK7 Z;  1JUO A;  1QXP A;  2JC2 A;  3FS7 A;  1KQM C;  1TNQ A;  2LVI A;  4GFT A;  3NXA A;  2JOJ A;  3LK0 A;  1W7I B;  4R1E A;  1FF1 A;  2JTZ A;  2HET A;  2KBI A;  4MSP A;  3LK1 A;  1KFX L;  1YX8 A;  2Y4Q A;  3BUO B;  4IL1 A;  1B8R A;  1JFK A;  1VRK A;  2WC8 A;  3O78 A;  2WND A;  2K7B A;  2IS9 A;  3CZT X;  2JXC A;  1G8I A;  2K7C A;  1NSH A;  2LLT A;  4MZJ A;  1XFZ O;  2NCP A;  5AXI A;  1IWQ A;  1KQM B;  2LV7 A;  4N5X A;  4PAL A;  4YBH B;  1AP4 A;  2EC6 C;  1PSR A;  4PHK A;  5IBW A;  1F55 A;  2OTG B;  1WRL A;  2LHL A;  1S5G Z;  1UUS A;  4PE4 A;  3I5I C;  3PAL A;  1UHH A;  4C0K A;  3EK7 A;  2K0J A;  4MBE A;  2KYF A;  4YGD B;  2OS8 C;  3SIA A;  3SG4 A;  4HRH A;  5DKQ A;  1F4O A;  1TTX A;  4Q04 A;  4YI8 A;  2F8P A;  3CR2 A;  1IRJ A;  4JWQ A;  1AVS A;  1HQV A;  5CSI A;  2KFF A;  2G9B A;  3OP0 A;  1FI6 A;  1K94 A;  2KNE A;  3TZ1 A;  2BE6 A;  1CM4 A;  4WRI A;  2LP2 A;  2ISD A;  3KHE A;  1LA3 A;  2KAY A;  1RFJ A;  1RRO A;  2PAL A;  3I5I B;  3ICB A;  1PK0 D;  4ZCU A;  4I5N B;  1XFW O;  3KO0 A;  1CNP A;  3TS5 C;  2MJW B;  1NUB A;  1L2O C;  2B1U A;  1JSA A;  1NCX A;  1SPY A;  1XO5 A;  3E3R A;  1ZFS A;  1PUL A;  1NX1 A;  3VRP A;  5KU1 A;  1JF2 A;  2ZN9 A;  1W7J B;  2JWW A;  2K8M B;  2LLS A;  3TDI A;  2HPS A;  5F6T A;  3WHT B;  3CWG A;  2BKI B;  4CFQ A;  1YVL A;  3AKB A;  3TDU A;  1MXE A;  1HT9 A;  3PN7 C;  4PHM A;  1AJ4 A;  3AAJ A;  1GGZ A;  1QJT A;  3DVM A;  2O60 A;  1OZS A;  3KEV A;  1BMO A;  1L2O B;  1UP5 A;  3HX4 A;  3KPX A;  3RLZ A;  1DJI A;  4F0Z B;  5TNC A;  2JQ6 A;  1A29 A;  2PVB A;  1KWO B;  4GNK B;  1LKJ A;  1ALV A;  1SW8 A;  1YUS A;  4AQJ A;  1A4P A;  1YUU A;  3ZNI A;  2PRU A;  2H61 A;  4C0J A;  2ZND A;  1AUI B;  2VRG A;  1BR4 B;  3O6B A;  1SKT A;  1CFF A;  1DTL A;  1K96 A;  1B4C A;  3BUW B;  1Y1A A;  4DCK A;  3VRR A;  1CLB A;  1S1E A;  1RK9 A;  2ZN8 A;  4WQ3 A;  3CS1 A;  1S3P A;  4MRY A;  4UPG A;  2MHH A;  2JNF A;  1WLM A;  1OE9 B;  2PMY A;  1OMV A;  1M39 A;  1CLM A;  5GQQ C;  1ZOT B;  5HLV A;  4GGN A;  1WY9 A;  2CBL A;  1AJ5 A;  1SMG A;  2AUC A;  1J1E A;  2L98 A;  1QIW A;  1MWN A;  1KCY A;  2M3W A;  1D1O A;  3VRQ A;  3QRX A;  2ZFD A;  2LVV A;  1TRF A;  2ZNE A;  2LAP A;  1NP8 A;  2PAS A;  2P6B B;  4GGF A;  3NSK A;  4QJ3 B;  3BUX B;  1QX7 A;  1MF8 B;  2AAO A;  5I2L A;  3DF0 A;  2DOQ A;  4USL A;  2LVJ A;  1CDL A;  1IQ3 A;  1TCO B;  2QAC A;  1CFP A;  1DJY A;  1SCM C;  2CCM A;  1QX5 B;  3I5G C;  1J7O A;  1RTP 1;  4A4C A;  1KK7 Y;  2M29 A;  5ER5 A;  3A8R A;  4JPZ B;  3DVE A;  1ODB A;  1DJH A;  3H4S E;  2OTG C;  2Q4U A;  2RGI A;  3EVV A;  1K9K A;  1S36 A;  2Y1M A;  3DD4 A;  1J55 A;  1SL7 A;  2LUC A;  1PAL A;  4GBA A;  5CSN A;  2KQY A;  2LE9 B;  4XJK B;  5D69 A;  4I5K A;  2JT3 A;  1TIZ A;  3BOW A;  3PM8 A;  1CB1 A;  1YVH A;  1SCM B;  1NX0 A;  3WNX B;  1SYM A;  1GJY A;  4N1G A;  3I5G B;  1DVI A;  2LC5 A;  1DJZ A;  2BBM A;  1WRK A;  1SY9 A;  1DF0 A;  2K61 A;  3WXA A;  1TNW A;  4MEW A;  4HRE E;  1U5I B;  1BR1 B;  3EVU A;  3SG2 A;  4M2Q A;  1KFU L;  2KI4 C;  4MRX A;  2JPT A;  3EK8 A;  2SCP A;  3CR5 X;  1OZO A;  1DGV A;  1S5G Y;  1RWY A;  1K90 D;  3SG7 A;  1EH2 A;  2Q91 A;  3KF9 A;  3VRN A;  1UWO A;  2NLN A;  1BF5 A;  5DKR A;  4N1F A;  3HCM A;  2K7D A;  1X02 A;  5I8N A;  5HYD A;  1IKU A;  2NZ0 A;  1SR6 C;  1QAS A;  1NCY A;  1QV1 A;  2LVK A;  5ER4 X;  3FWB A;  2KI4 B;  1Y1U A;  4PE0 A;  1N65 A;  1MXL C;  1C7W A;  1DGU A;  5KSZ A;  3C1V A;  1F70 A;  1H4B A;  1CDN A;  4A4B A;  2WOR A;  1YRT B;  4PDZ A;  1XFU O;  2LLU A;  3A4U B;  2EGD A;  2H2K A;  1EJ3 A;  3NSO A;  5I2Q A;  1QVI Z;  5HLO A;  4ORB B;  4BY4 A;  1SR6 B;  2MA2 A;  2BCX A;  1S26 D;  2WCB A;  1KWO C;  1PVA A;  2WCE A;  1BT6 A;  2V53 A;  4FQO A;  2K2A A;  4L9M A;  3IF7 A;  1NCZ A;  1LA0 A;  1QLK A;  4ETO A;  2M1K B;  2HF5 A;  4MLW A;  1IJ6 A;  1JBA A;  3DVK A;  3I5F B;  1NIW A;  1SCV A;  2LAN A;  4E68 A;  4C0L A;  1BU3 A;  1QS7 A;  1K8U A;  2WCF A;  3CLN A;  3FWC A;  1CMF A;  1MHO A;  1CFD A;  2F2P A;  2L0P A;  4MVF A;  3EKH A;  4OVN F;  3LCP C;  1TNP A;  3BYA A;  1K2H A;  3D0Y B;  3BUM B;  2K7O A;  1SRA A;  4WQ2 A;  1PSB A;  5AEQ A;  1YX7 A;  1B7T Z;  1M46 A;  2I94 A;  1BLQ A;  2L5X B;  4U8D A;  1K95 A;  2MRD A;  2F3Y A;  3TDZ A;  1QLS A;  1KSO A;  3SG6 A;  2KGR A;  2WOS A;  4NDC A;  4DRW A;  4XYN A;  4ORA B;  4PCW A;  1B8L A;  1B1G A;  3CGA A;  1IH0 A;  1MQ1 A;  4OV2 A;  1EL4 A;  4CPV A;  2L51 A;  2EHB A;  3SJS A;  2E6W A;  3SIB A;  5CSJ A;  2JU0 A;  1BOC A;  4GAO A;  5JOL A;  3AAK A;  2JZI A;  2BBN A;  1CTR A;  4HSZ A;  4PE1 A;  5FYX A;  1J1D A;  2TN4 A;  1YTZ C;  3OHM B;  5HKZ A;  1SK6 D;  2JUL A;  2NXQ A;  2QPT A;  4XJK A;  2HQW A;  2A4J A;  1OQP A;  1F4Q A;  2M8U A;  2E30 A;  4CLN A;  5CSF A;  2ZRS A;  1A2X A;  2ZRT A;  4DIR A;  4BY5 A;  1MUX A;  3BQ3 A;  3PFV A;  2NCO A;  1B9A A;  1IJ5 A;  1CLL A;  1SNL A;  1XA5 A;  2BCA A;  4GPL B;  1C7V A;  3SG3 A;  3DVJ A;  1JFJ A;  1DJX A;  2L50 A;  1U5I A;  1FBV A;  1XFY O;  1BOD A;  1PRW A;  4MZL A;  5HKW A;  1WRZ A;  2BKH B;  2AMI A;  5DKN A;  4QJ5 B;  5AFP A;  1KSM A;  1K9P A;  2G2B A;  1V1F A;  1DJW A;  4ICB A;  3SG5 A;  1F71 A;  1NPQ A;  3LLE A;  4AQI A;  1J7Q A;  1FW4 A;  2LMT A;  3GK4 X;  1OOJ A;  3K21 A;  1F54 A;  2L4I A;  1OSA A;  2M9G A;  3CTN A;  2KI6 D;  1DMO A;  1EXR A;  1REC A;  2BCB A;  5G08 A;  1TN4 A;  1R6P A;  3FIA A;  2KAV A;  1K9U A;  2HQ8 A;  2ZKM X;  1XK4 C;  4FTG A;  4YI9 A;  2I2R E;  1A75 B;  2KBM A;  1IQ5 A;  2CNP A;  1NX2 A;  2JTT A;  3IQO A;  4OKH A;  1NYA A;  4PE7 A;  3NSI A;  1CKK A;  3GK2 A;  3NSL A;  2MAZ A;  1H8B A;  3BXK A;  4NQG A;  2COL B;  3O2P A;  2FOT A;  1EG4 A;  1JWD A;  1LXF C;  3PAT A;  2KOT A;  3MSE B;  1EG3 A;  1S6J A;  1QAT A;  2LCP A;  2M49 B;  1ZAC A;  1YUT A;  1M63 B;  1Y1X A;  5I2O A;  1F8H A;  3AKA A;  4PHN A;  1UHJ A;  5CPV A;  3JVT C;  1SBJ A;  1Y0V H;  2M1U A;  2LNK A;  2KFG A;  4NDD A;  2Y5I A;  1WDC C;  5D7F A;  1MR8 A;  2LHI A;  2KDH A;  3DF0 B;  3EK4 A;  1QX2 A;  2LP3 A;  1CDP A;  4CID A;  1PVB A;  1N0Y A;  3JTD C;  1CDM A;  1FI5 A;  4GUK A;  3CR4 X;  1R2U A;  3D0Y A;  2FCD A;  1YR5 A;  3TUY C;  1TNX A;  1A03 A;  3I5F C;  2JT0 A;  1ALW A;  2F3Z A;  3JVT B;  1GGW A;  1FPW A;  2M7L A;  1TCF A;  1JF0 A;  3OB1 B;  1WDC B;  1SL9 A;  4M2O A;  1K93 D;  1UUR A;  2EC6 B;  4MZK A;  2D8N A;  2GGM A;  2PSR A;  1QVI Y;  3O4Y A;  4CFR A;  3JTD B;  2KYC A;  4D1E A;  5KTY A;  2JRF A;  3BOW B;  5B8I B;  2CXJ A;  1NWD A;  2LUX A;  3TUY B;  2KSP A;  2JXL A;  1DJG A;  4ORC B;  2M7N A;  1XFX O;  4OCI A;  1L7Z A;  5K89 A;  4YGE B;  5J3X A;  2I7A A;  2MLE C;  1CMG A;  1DF0 B;  2OS8 B;  1WLZ A;  3IQQ A;  1YRU B;  5PAL A;  5BPJ A;  1BJF A;  4PHJ A;  3OX5 A;  1YUR A;  1JC2 A;  1DT7 B;  1LVC D;  2JT8 A;  3VGO A;  4YRU A;  1XYD A;  3GK1 A;  4YGC B;  3GOF A;  3I5H C;  1B47 A;  2M97 A;  1N2D A;  3WHU B;  3F45 A;  1XFV O;  1E8A A;  4M2P A;  4YGA A;  5HKY A;  1S6I A;  4ZCV A;  1AHR A;  2MLF C;  5AAN A;  3D10 A;  1S6C A;  1V1G A;  1B7T Y;  1J7P A;  1IG5 A;  2K2F A;  5AER A;  2KAX A;  1M31 A;  4NDB A;  2OPO A;  3TS5 B;  1ZUZ A;  2BEC A;  1UHK A;  3EVR A;  1C07 A;  1UHN A;  2BE4 A;  3VRO A;  1KK8 C;  2F2O A; 
#chains in the Genus database with same CATH topology
 1G33 A;  2KI6 C;  2R2I A;  3I5H B;  3LL8 B;  5FI7 A;  2L2E A;  2I18 A;  5I94 A;  2GGZ A;  2LMV A;  1KFX S;  4TNC A;  4DS7 A;  1CM1 A;  1QV0 A;  2CTN A;  1OMD A;  5JJG A;  2JPO A;  3M0W A;  3PN7 B;  3D77 A;  4DUQ A;  1G4Y R;  1W9Z A;  3EKJ A;  2M0R A;  4I5L B;  1OOI X;  1QIV A;  2BL0 C;  2GV5 A;  1XVJ A;  4AOM A;  2QEB A;  1SL8 A;  3BFA A;  3CAB A;  3OX6 A;  1KQV A;  1KK8 B;  1TOP A;  2H61 C;  2CT9 A;  3RM1 A;  4OR9 B;  4JQ0 D;  1A75 A;  3PSR A;  3NHI A;  3D75 A;  2O5G A;  2LMU A;  1KFU S;  1Y6W A;  2FJU B;  2F33 A;  4JD9 A;  1ZMZ A;  1B8C A;  1Q80 A;  2KGB C;  3OB2 B;  3S0B A;  2KQ6 A;  2MBX A;  5HL1 A;  4I5J A;  3V2L A;  4INW A;  1M45 A;  3SS5 A;  2BL0 B;  2LM5 A;  1OOG A;  4INX A;  1CFC A;  1IGV A;  2JNX A;  2L4H A;  2KHN A;  4P2Y B;  4P5O E;  1XK4 A;  2KFH A;  1LIN A;  1QWV A;  1DEL A;  1OW4 A;  1OMR A;  4HRG A;  1UHI A;  1QTX A;  1GQM A;  2FCE A;  3ZWH A;  3BUN B;  2Y1N A;  4YGB B;  1NX3 A;  1RJV A;  3PLF B;  4QJ4 B;  2SAS A;  1AK8 A;  4GGF C;  3B7A A;  4MN0 A;  1J7R A;  1KK7 Z;  1JUO A;  1QXP A;  2KLD A;  2JC2 A;  3FS7 A;  1KQM C;  1TNQ A;  2LVI A;  4GFT A;  3NXA A;  2JOJ A;  3LK0 A;  1W7I B;  4R1E A;  1DEK A;  1FF1 A;  2JTZ A;  2HET A;  2KBI A;  3L47 A;  4MSP A;  2WCK A;  3LK1 A;  1KFX L;  1YX8 A;  2Y4Q A;  3L4A A;  3BUO B;  4IL1 A;  1B8R A;  1JFK A;  1VRK A;  2WC8 A;  3O78 A;  3B88 A;  2WND A;  3DZT A;  2K7B A;  2IS9 A;  3CZT X;  2JXC A;  1G8I A;  2K7C A;  1NSH A;  2LLT A;  3PM2 A;  4MZJ A;  1XFZ O;  2NCP A;  5AXI A;  1IWQ A;  1KQM B;  2LV7 A;  4N5X A;  4PAL A;  4YBH B;  1AP4 A;  2EC6 C;  1PSR A;  4PHK A;  5IBW A;  1F55 A;  2OTG B;  3D76 A;  1WRL A;  2LHL A;  1S5G Z;  1UUS A;  3EG5 B;  4PE4 A;  3OBV A;  3I5I C;  3DYE A;  3FE8 A;  3PAL A;  1UHH A;  4C0K A;  2BAP A;  2K0J A;  3EK7 A;  4MBE A;  4FQT A;  1OOH A;  2KYF A;  4YGD B;  2OS8 C;  3SIA A;  3SG4 A;  4HRH A;  5DKQ A;  1F4O A;  1TTX A;  4Q04 A;  4YI8 A;  2F8P A;  3CR2 A;  1IRJ A;  4JWQ A;  1AVS A;  1HQV A;  5CSI A;  2KFF A;  2G9B A;  3OP0 A;  1FI6 A;  1K94 A;  2KNE A;  3CZ1 A;  3TZ1 A;  2BE6 A;  3UO9 A;  1CM4 A;  4WRI A;  2LP2 A;  2ISD A;  3KHE A;  1LA3 A;  2KAY A;  1RFJ A;  1RRO A;  2PAL A;  3I5I B;  3ICB A;  1PK0 D;  3PJI A;  4ZCU A;  4I5N B;  2P71 A;  1XFW O;  2PQL A;  3KO0 A;  1CNP A;  3TS5 C;  2MJW B;  1NUB A;  1L2O C;  2B1U A;  1JSA A;  1NCX A;  1SPY A;  3CZ2 A;  1XO5 A;  3E3R A;  1ZFS A;  1PUL A;  1NX1 A;  3VRP A;  5KU1 A;  2QEO A;  1JF2 A;  2ZN9 A;  1W7J B;  2JWW A;  2K8M B;  2LLS A;  3TDI A;  2HPS A;  5F6T A;  3WHT B;  3CWG A;  2BKI B;  1P28 A;  4CFQ A;  1YVL A;  3AKB A;  3TDU A;  1MXE A;  1HT9 A;  3PN7 C;  4PHM A;  1AJ4 A;  3AAJ A;  1GGZ A;  1QJT A;  3DVM A;  3NHT A;  1GM0 A;  2O60 A;  1OZS A;  3KEV A;  1BMO A;  1L2O B;  1UP5 A;  3HX4 A;  3KPX A;  3RLZ A;  1DJI A;  3S0A A;  2KPH A;  4F0Z B;  5TNC A;  3S0F A;  2JQ6 A;  1A29 A;  2PVB A;  3OGN A;  1KWO B;  4GNK B;  1LKJ A;  1ALV A;  1SW8 A;  1YUS A;  2PYQ A;  2WC6 A;  3NGV A;  4AQJ A;  1A4P A;  1YUU A;  3VB1 A;  3ZNI A;  2PRU A;  2H61 A;  1TUZ A;  2ZND A;  1AUI B;  2VRG A;  1BR4 B;  3O6B A;  1SKT A;  2QDI A;  3BJH A;  4F7F A;  1DTL A;  1K96 A;  2YGU A;  1B4C A;  3BUW B;  1Y1A A;  4DCK A;  3VRR A;  1CLB A;  1S1E A;  4JKT A;  1RK9 A;  2ZN8 A;  4WQ3 A;  3B86 A;  3CS1 A;  2BNX A;  1S3P A;  4MRY A;  2FJY A;  4UPG A;  2MHH A;  2JNF A;  1WLM A;  1OE9 B;  2PMY A;  1OMV A;  1M39 A;  1CLM A;  5GQQ C;  2ERB A;  1ZOT B;  5HLV A;  4GGN A;  1WY9 A;  2CBL A;  1AJ5 A;  1SMG A;  2AUC A;  1J1E A;  2L98 A;  1QIW A;  1MWN A;  1KCY A;  2M3W A;  1D1O A;  3VRQ A;  3QRX A;  2ZFD A;  2LVV A;  1TRF A;  1IIO A;  2ZNE A;  2LAP A;  1NP8 A;  2PAS A;  2P6B B;  1Z4H A;  4GGF A;  3NSK A;  4QJ3 B;  3BUX B;  1QX7 A;  1MF8 B;  2AAO A;  3D74 A;  3DY9 A;  5I2L A;  3R1V A;  3DF0 A;  2DOQ A;  3CYZ A;  4USL A;  2LVJ A;  1CDL A;  1IQ3 A;  1TCO B;  2QAC A;  1CFP A;  1DJY A;  1SCM C;  2CCM A;  1QX5 B;  3L4L A;  3I5G C;  4PT1 A;  1J7O A;  1RTP 1;  4A4C A;  1KK7 Y;  2M29 A;  5ER5 A;  3B6X A;  3A8R A;  4JPZ B;  3DVE A;  1ODB A;  1DJH A;  3H4S E;  2OTG C;  2Q4U A;  2RGI A;  3EVV A;  1K9K A;  1S36 A;  2Y1M A;  3DD4 A;  1J55 A;  1SL7 A;  2LUC A;  1PAL A;  4GBA A;  5CSN A;  2KQY A;  2LE9 B;  4XJK B;  5D69 A;  4I5K A;  2JT3 A;  1TIZ A;  3BOW A;  3PM8 A;  1CB1 A;  1YVH A;  3FE6 A;  1SCM B;  1NX0 A;  3WNX B;  1SYM A;  1GJY A;  4N1G A;  3I5G B;  1DVI A;  2LC5 A;  1DJZ A;  2BBM A;  1WRK A;  1SY9 A;  1DF0 A;  2K61 A;  3WXA A;  1CFF A;  1TNW A;  4MEW A;  4HRE E;  1U5I B;  1BR1 B;  3EVU A;  3SG2 A;  1C3Z A;  4M2Q A;  1KFU L;  2KI4 C;  4MRX A;  2JPT A;  3EK8 A;  2SCP A;  3CR5 X;  1LS8 A;  3R1P A;  1OZO A;  1DGV A;  1S5G Y;  1RWY A;  1K90 D;  3SG7 A;  1EH2 A;  2Q91 A;  3KF9 A;  3VRN A;  1UWO A;  2NLN A;  1BF5 A;  5DKR A;  4N1F A;  2QEH A;  3HCM A;  2K7D A;  1X02 A;  3SS3 A;  5HYD A;  5I8N A;  1IKU A;  2NZ0 A;  1SR6 C;  1QAS A;  1NCY A;  1QV1 A;  2LVK A;  5ER4 X;  3FWB A;  3S0G A;  2KI4 B;  1Y1U A;  4PE0 A;  1N65 A;  1MXL C;  1C7W A;  1BG1 A;  1DGU A;  2WCH A;  1OOF A;  3C1V A;  5KSZ A;  1F70 A;  1H4B A;  1CDN A;  4A4B A;  1TUJ A;  2WOR A;  1YRT B;  4PDZ A;  3IVT A;  1XFU O;  2LLU A;  3A4U B;  5D3O A;  2EGD A;  2H2K A;  1EJ3 A;  3NSO A;  5I2Q A;  1QVI Z;  5HLO A;  4ORB B;  4BY4 A;  1SR6 B;  2MA2 A;  4IJ7 A;  2BCX A;  1S26 D;  2WCB A;  1KWO C;  1PVA A;  2WCE A;  1BT6 A;  2V53 A;  4FQO A;  2K2A A;  4L9M A;  1SSE B;  1NCZ A;  1LA0 A;  1QLK A;  3IF7 A;  4ETO A;  2M1K B;  2HF5 A;  4MLW A;  1IJ6 A;  1JBA A;  3DVK A;  3I5F B;  1NIW A;  1SCV A;  2LAN A;  4E68 A;  2P70 A;  4C0L A;  1BU3 A;  1QS7 A;  1K8U A;  3BFB A;  2WCF A;  3CLN A;  3FWC A;  1CMF A;  1MHO A;  1CFD A;  2F2P A;  2L0P A;  4MVF A;  3EKH A;  4OVN F;  3LCP C;  1TNP A;  3BYA A;  1K2H A;  3D0Y B;  3BUM B;  2K7O A;  1SRA A;  4WQ2 A;  1PSB A;  5AEQ A;  1YX7 A;  1B7T Z;  1M46 A;  2I94 A;  1BLQ A;  2L5X B;  4U8D A;  1K95 A;  3K1E A;  3D78 A;  2MRD A;  2F3Y A;  3TDZ A;  3N7H A;  1QLS A;  1KSO A;  3CDN A;  3SG6 A;  2KGR A;  2WOS A;  4NDC A;  4DRW A;  4XYN A;  4ORA B;  4KYN A;  4PCW A;  1B8L A;  1B1G A;  3CGA A;  1IH0 A;  1MQ1 A;  4OV2 A;  1EL4 A;  4CPV A;  2L51 A;  1ORG A;  2EHB A;  3B87 A;  2E6W A;  3SJS A;  3SIB A;  5CSJ A;  2JU0 A;  1BOC A;  4GAO A;  3CZ0 A;  5JOL A;  3AAK A;  2JZI A;  2BBN A;  1CTR A;  4HSZ A;  4PE1 A;  5FYX A;  1J1D A;  2TN4 A;  2WCM A;  1YTZ C;  3OHM B;  5HKZ A;  1SK6 D;  2JUL A;  2NXQ A;  2QEV A;  2QPT A;  4XJK A;  2HQW A;  2A4J A;  1OQP A;  3BFH A;  1F4Q A;  2M8U A;  2E30 A;  3O4X A;  5CSF A;  2ZRS A;  4CLN A;  1A2X A;  2ZRT A;  4DIR A;  4BY5 A;  1MUX A;  3BQ3 A;  3PFV A;  2NCO A;  1B9A A;  1IJ5 A;  1CLL A;  1SNL A;  1XA5 A;  2BCA A;  4GPL B;  1C7V A;  3SG3 A;  3DVJ A;  1JFJ A;  1DJX A;  2L50 A;  1U5I A;  5EL2 A;  1FBV A;  1XFY O;  1BOD A;  1PRW A;  3FE9 A;  4MZL A;  5HKW A;  1WRZ A;  2BKH B;  2AMI A;  5DKN A;  4QJ5 B;  5AFP A;  1KSM A;  1K9P A;  2G2B A;  1V1F A;  1DJW A;  4ICB A;  3SG5 A;  1F71 A;  1NPQ A;  3LLE A;  4AQI A;  1J7Q A;  1FW4 A;  2LMT A;  3GK4 X;  1OOJ A;  3DXL A;  3K21 A;  2L4I A;  1OSA A;  1F54 A;  2M9G A;  3CTN A;  2KI6 D;  1C3Y A;  1DMO A;  1EXR A;  1REC A;  2BCB A;  5G08 A;  2L5Y A;  1TN4 A;  1R6P A;  3FIA A;  1TWO A;  2KAV A;  1K9U A;  2WCL A;  2HQ8 A;  2ZKM X;  1XK4 C;  4FTG A;  4YI9 A;  2I2R E;  1A75 B;  2KBM A;  4C0J A;  1IQ5 A;  2CNP A;  1NX2 A;  2JTT A;  3IQO A;  4OKH A;  1NYA A;  4PE7 A;  3NSI A;  1CKK A;  3GK2 A;  2WCJ A;  2MAZ A;  3NSL A;  3S0E A;  1H8B A;  3BXK A;  4NQG A;  2COL B;  3O2P A;  2FOT A;  1EG4 A;  1JWD A;  1LXF C;  3PAT A;  3SS4 A;  2KOT A;  3MSE B;  1EG3 A;  1S6J A;  1QAT A;  2LCP A;  2M49 B;  1ZAC A;  1YUT A;  1T14 A;  1M63 B;  1Y1X A;  5I2O A;  1F8H A;  3AKA A;  4PHN A;  1UHJ A;  5CPV A;  3JVT C;  1SBJ A;  1Y0V H;  2M1U A;  2L2C A;  2KFG A;  2LNK A;  4NDD A;  5FI2 A;  2Y5I A;  3S0D A;  1WDC C;  5D7F A;  1MR8 A;  2LHI A;  2KDH A;  3DF0 B;  3EK4 A;  1QX2 A;  2LP3 A;  1CDP A;  4CID A;  1PVB A;  1N0Y A;  3JTD C;  3UNW A;  1DC1 A;  1CDM A;  1FI5 A;  4GUK A;  3CR4 X;  1R2U A;  3D0Y A;  2FCD A;  1YR5 A;  3TUY C;  5FI6 A;  1TNX A;  1A03 A;  3I5F C;  2JT0 A;  2H8V A;  1ALW A;  2F3Z A;  1DQE A;  3Q8I A;  3JVT B;  1GGW A;  1FPW A;  2M7L A;  1TCF A;  1JF0 A;  3OB1 B;  1WDC B;  1SL9 A;  4M2O A;  1K93 D;  5DIC A;  1UUR A;  2EC6 B;  4MZK A;  2D8N A;  2GGM A;  2PSR A;  1QVI Y;  3O4Y A;  4CFR A;  3JTD B;  2KYC A;  4D1E A;  5KTY A;  2JRF A;  3BOW B;  3R1O A;  2WC5 A;  5B8I B;  2CXJ A;  1NWD A;  2GTE A;  2LUX A;  3TUY B;  2KSP A;  2JXL A;  1DJG A;  4ORC B;  2M7N A;  1XFX O;  4OCI A;  1L7Z A;  5K89 A;  4OZD A;  4YGE B;  5J3X A;  2I7A A;  2MLE C;  1CMG A;  1DF0 B;  2OS8 B;  1WLZ A;  3IQQ A;  1YRU B;  5PAL A;  5BPJ A;  3QME A;  1BJF A;  4PHJ A;  1Z2C B;  3OX5 A;  1YUR A;  3D73 A;  1JC2 A;  1DT7 B;  1LVC D;  2JT8 A;  3VGO A;  4YRU A;  1XYD A;  3GK1 A;  4YGC B;  3GOF A;  3I5H C;  1B47 A;  2M97 A;  1N2D A;  3WHU B;  2KLE A;  1XFV O;  1E8A A;  2K60 A;  3F45 A;  3R72 A;  4M2P A;  4YGA A;  5HKY A;  1S6I A;  4ZCV A;  1AHR A;  2MLF C;  5AAN A;  3D10 A;  1S6C A;  1V1G A;  1B7T Y;  1J7P A;  1IG5 A;  2K2F A;  5AER A;  2KAX A;  1M31 A;  4NDB A;  3RZS A;  2OPO A;  3TS5 B;  1ZUZ A;  2BEC A;  1UHK A;  1XFR A;  3EVR A;  1C07 A;  1UHN A;  2BE4 A;  3VRO A;  1KK8 C;  2F2O A; 
#chains in the Genus database with same CATH homology
 1G33 A;  2KI6 C;  2R2I A;  3I5H B;  3LL8 B;  2L2E A;  2I18 A;  2GGZ A;  2LMV A;  1KFX S;  4TNC A;  4DS7 A;  1CM1 A;  1QV0 A;  2CTN A;  1OMD A;  5JJG A;  3M0W A;  3PN7 B;  4DUQ A;  1G4Y R;  3EKJ A;  2M0R A;  4I5L B;  1QIV A;  2BL0 C;  2GV5 A;  1XVJ A;  4AOM A;  1SL8 A;  3OX6 A;  1KQV A;  1KK8 B;  1TOP A;  2H61 C;  2CT9 A;  3RM1 A;  4OR9 B;  4JQ0 D;  1A75 A;  3PSR A;  2O5G A;  2LMU A;  1KFU S;  1Y6W A;  2FJU B;  2F33 A;  1BG1 A;  1ZMZ A;  1B8C A;  1Q80 A;  2KGB C;  3OB2 B;  2KQ6 A;  2MBX A;  4I5J A;  1M45 A;  2BL0 B;  2LM5 A;  1CFC A;  1IGV A;  2JNX A;  2L4H A;  2KHN A;  4P2Y B;  4P5O E;  1XK4 A;  2KFH A;  1LIN A;  1OMR A;  4HRG A;  1UHI A;  1QTX A;  1GQM A;  2FCE A;  3ZWH A;  3BUN B;  2Y1N A;  4YGB B;  1NX3 A;  1RJV A;  3PLF B;  4QJ4 B;  2SAS A;  1AK8 A;  4GGF C;  4MN0 A;  1J7R A;  1KK7 Z;  1JUO A;  1QXP A;  2JC2 A;  3FS7 A;  1KQM C;  1TNQ A;  2LVI A;  4GFT A;  3NXA A;  2JOJ A;  3LK0 A;  1W7I B;  4R1E A;  1FF1 A;  2JTZ A;  2HET A;  2KBI A;  4MSP A;  3LK1 A;  1KFX L;  1YX8 A;  2Y4Q A;  3BUO B;  4IL1 A;  1B8R A;  1JFK A;  1VRK A;  2WC8 A;  3O78 A;  2WND A;  2K7B A;  2IS9 A;  3CZT X;  2JXC A;  1G8I A;  2K7C A;  1NSH A;  2LLT A;  4MZJ A;  1XFZ O;  2NCP A;  5AXI A;  1IWQ A;  1KQM B;  2LV7 A;  4N5X A;  4PAL A;  4YBH B;  1AP4 A;  2EC6 C;  1PSR A;  4PHK A;  5IBW A;  1F55 A;  2OTG B;  1WRL A;  2LHL A;  1S5G Z;  1UUS A;  4PE4 A;  3I5I C;  3PAL A;  1UHH A;  4C0K A;  3EK7 A;  2K0J A;  4MBE A;  2KYF A;  4YGD B;  2OS8 C;  3SIA A;  3SG4 A;  4HRH A;  5DKQ A;  1F4O A;  1TTX A;  4Q04 A;  4YI8 A;  2F8P A;  3CR2 A;  1IRJ A;  4JWQ A;  1AVS A;  1HQV A;  5CSI A;  2KFF A;  2G9B A;  3OP0 A;  1FI6 A;  1K94 A;  2KNE A;  3TZ1 A;  2BE6 A;  1CM4 A;  4WRI A;  2LP2 A;  2ISD A;  3KHE A;  1LA3 A;  2KAY A;  1RFJ A;  1RRO A;  2PAL A;  3I5I B;  3ICB A;  1PK0 D;  4ZCU A;  4I5N B;  1XFW O;  3KO0 A;  1CNP A;  3TS5 C;  2MJW B;  1NUB A;  1L2O C;  2B1U A;  1JSA A;  1NCX A;  1SPY A;  1XO5 A;  3E3R A;  1ZFS A;  1PUL A;  1NX1 A;  3VRP A;  5KU1 A;  1JF2 A;  2ZN9 A;  1W7J B;  2JWW A;  2K8M B;  2LLS A;  3TDI A;  2HPS A;  5F6T A;  3WHT B;  3CWG A;  2BKI B;  4CFQ A;  1YVL A;  3AKB A;  3TDU A;  1MXE A;  1HT9 A;  3PN7 C;  4PHM A;  1AJ4 A;  3AAJ A;  1GGZ A;  1QJT A;  3DVM A;  2O60 A;  1OZS A;  3KEV A;  1BMO A;  1L2O B;  1UP5 A;  3HX4 A;  3KPX A;  3RLZ A;  1DJI A;  4F0Z B;  5TNC A;  2JQ6 A;  1A29 A;  2PVB A;  1KWO B;  4GNK B;  1LKJ A;  1ALV A;  1SW8 A;  1YUS A;  4AQJ A;  1A4P A;  1YUU A;  3ZNI A;  2PRU A;  2H61 A;  4C0J A;  2ZND A;  1AUI B;  2VRG A;  1BR4 B;  3O6B A;  1SKT A;  1CFF A;  1DTL A;  1K96 A;  1B4C A;  3BUW B;  1Y1A A;  4DCK A;  3VRR A;  1CLB A;  1S1E A;  1RK9 A;  2ZN8 A;  4WQ3 A;  3CS1 A;  1S3P A;  4MRY A;  4UPG A;  2MHH A;  2JNF A;  1WLM A;  1OE9 B;  2PMY A;  1OMV A;  1M39 A;  1CLM A;  5GQQ C;  1ZOT B;  5HLV A;  4GGN A;  1WY9 A;  2CBL A;  1AJ5 A;  1SMG A;  2AUC A;  1J1E A;  2L98 A;  1QIW A;  1MWN A;  1KCY A;  2M3W A;  1D1O A;  3VRQ A;  3QRX A;  2ZFD A;  2LVV A;  1TRF A;  2ZNE A;  2LAP A;  1NP8 A;  2PAS A;  2P6B B;  4GGF A;  3NSK A;  4QJ3 B;  3BUX B;  1QX7 A;  1MF8 B;  2AAO A;  5I2L A;  3DF0 A;  2DOQ A;  4USL A;  2LVJ A;  1CDL A;  1IQ3 A;  1TCO B;  2QAC A;  1CFP A;  1DJY A;  1SCM C;  2CCM A;  1QX5 B;  3I5G C;  1J7O A;  1RTP 1;  4A4C A;  1KK7 Y;  2M29 A;  5ER5 A;  3A8R A;  4JPZ B;  3DVE A;  1ODB A;  1DJH A;  3H4S E;  2OTG C;  2Q4U A;  2RGI A;  3EVV A;  1K9K A;  1S36 A;  2Y1M A;  3DD4 A;  1J55 A;  1SL7 A;  2LUC A;  1PAL A;  4GBA A;  5CSN A;  2KQY A;  2LE9 B;  4XJK B;  5D69 A;  4I5K A;  2JT3 A;  1TIZ A;  3BOW A;  3PM8 A;  1CB1 A;  1YVH A;  1SCM B;  1NX0 A;  3WNX B;  1SYM A;  1GJY A;  4N1G A;  3I5G B;  1DVI A;  2LC5 A;  1DJZ A;  2BBM A;  1WRK A;  1SY9 A;  1DF0 A;  2K61 A;  3WXA A;  1TNW A;  4MEW A;  4HRE E;  1U5I B;  1BR1 B;  3EVU A;  3SG2 A;  4M2Q A;  1KFU L;  2KI4 C;  4MRX A;  2JPT A;  3EK8 A;  2SCP A;  3CR5 X;  1OZO A;  1DGV A;  1S5G Y;  1RWY A;  1K90 D;  3SG7 A;  1EH2 A;  2Q91 A;  3KF9 A;  3VRN A;  1UWO A;  2NLN A;  1BF5 A;  5DKR A;  4N1F A;  3HCM A;  2K7D A;  1X02 A;  5I8N A;  5HYD A;  1IKU A;  2NZ0 A;  1SR6 C;  1QAS A;  1NCY A;  1QV1 A;  2LVK A;  5ER4 X;  3FWB A;  2KI4 B;  1Y1U A;  4PE0 A;  1N65 A;  1MXL C;  1C7W A;  1DGU A;  5KSZ A;  3C1V A;  1F70 A;  1H4B A;  1CDN A;  4A4B A;  2WOR A;  1YRT B;  4PDZ A;  1XFU O;  2LLU A;  3A4U B;  2EGD A;  2H2K A;  1EJ3 A;  3NSO A;  5I2Q A;  1QVI Z;  5HLO A;  4ORB B;  4BY4 A;  1SR6 B;  2MA2 A;  2BCX A;  1S26 D;  2WCB A;  1KWO C;  1PVA A;  2WCE A;  1BT6 A;  2V53 A;  4FQO A;  2K2A A;  4L9M A;  3IF7 A;  1NCZ A;  1LA0 A;  1QLK A;  4ETO A;  2M1K B;  2HF5 A;  4MLW A;  1IJ6 A;  1JBA A;  3DVK A;  3I5F B;  1NIW A;  1SCV A;  2LAN A;  4E68 A;  4C0L A;  1BU3 A;  1QS7 A;  1K8U A;  2WCF A;  3CLN A;  3FWC A;  1CMF A;  1MHO A;  1CFD A;  2F2P A;  2L0P A;  4MVF A;  3EKH A;  4OVN F;  3LCP C;  1TNP A;  3BYA A;  1K2H A;  3D0Y B;  3BUM B;  2K7O A;  1SRA A;  4WQ2 A;  1PSB A;  5AEQ A;  1YX7 A;  1B7T Z;  1M46 A;  2I94 A;  1BLQ A;  2L5X B;  4U8D A;  1K95 A;  2MRD A;  2F3Y A;  3TDZ A;  1QLS A;  1KSO A;  3SG6 A;  2KGR A;  2WOS A;  4NDC A;  4DRW A;  4XYN A;  4ORA B;  4PCW A;  1B8L A;  1B1G A;  3CGA A;  1IH0 A;  1MQ1 A;  4OV2 A;  1EL4 A;  4CPV A;  2L51 A;  2EHB A;  3SJS A;  2E6W A;  3SIB A;  5CSJ A;  2JU0 A;  1BOC A;  4GAO A;  5JOL A;  3AAK A;  2JZI A;  2BBN A;  1CTR A;  4HSZ A;  4PE1 A;  5FYX A;  1J1D A;  2TN4 A;  1YTZ C;  3OHM B;  5HKZ A;  1SK6 D;  2JUL A;  2NXQ A;  2QPT A;  4XJK A;  2HQW A;  2A4J A;  1OQP A;  1F4Q A;  2M8U A;  2E30 A;  4CLN A;  5CSF A;  2ZRS A;  1A2X A;  2ZRT A;  4DIR A;  4BY5 A;  1MUX A;  3BQ3 A;  3PFV A;  2NCO A;  1B9A A;  1IJ5 A;  1CLL A;  1SNL A;  1XA5 A;  2BCA A;  4GPL B;  1C7V A;  3SG3 A;  3DVJ A;  1JFJ A;  1DJX A;  2L50 A;  1U5I A;  1FBV A;  1XFY O;  1BOD A;  1PRW A;  4MZL A;  5HKW A;  1WRZ A;  2BKH B;  2AMI A;  5DKN A;  4QJ5 B;  5AFP A;  1KSM A;  1K9P A;  2G2B A;  1V1F A;  1DJW A;  4ICB A;  3SG5 A;  1F71 A;  1NPQ A;  3LLE A;  4AQI A;  1J7Q A;  1FW4 A;  2LMT A;  3GK4 X;  1OOJ A;  3K21 A;  1F54 A;  2L4I A;  1OSA A;  2M9G A;  3CTN A;  2KI6 D;  1DMO A;  1EXR A;  1REC A;  2BCB A;  5G08 A;  1TN4 A;  1R6P A;  3FIA A;  2KAV A;  1K9U A;  2HQ8 A;  2ZKM X;  1XK4 C;  4FTG A;  4YI9 A;  2I2R E;  1A75 B;  2KBM A;  1IQ5 A;  2CNP A;  1NX2 A;  2JTT A;  3IQO A;  4OKH A;  1NYA A;  4PE7 A;  3NSI A;  1CKK A;  3GK2 A;  3NSL A;  2MAZ A;  1H8B A;  3BXK A;  4NQG A;  2COL B;  3O2P A;  2FOT A;  1EG4 A;  1JWD A;  1LXF C;  3PAT A;  2KOT A;  3MSE B;  1EG3 A;  1S6J A;  1QAT A;  2LCP A;  2M49 B;  1ZAC A;  1YUT A;  1M63 B;  1Y1X A;  5I2O A;  1F8H A;  3AKA A;  4PHN A;  1UHJ A;  5CPV A;  3JVT C;  1SBJ A;  1Y0V H;  2M1U A;  2LNK A;  2KFG A;  4NDD A;  2Y5I A;  1WDC C;  5D7F A;  1MR8 A;  2LHI A;  2KDH A;  3DF0 B;  3EK4 A;  1QX2 A;  2LP3 A;  1CDP A;  4CID A;  1PVB A;  1N0Y A;  3JTD C;  1CDM A;  1FI5 A;  4GUK A;  3CR4 X;  1R2U A;  3D0Y A;  2FCD A;  1YR5 A;  3TUY C;  1TNX A;  1A03 A;  3I5F C;  2JT0 A;  1ALW A;  2F3Z A;  3JVT B;  1GGW A;  1FPW A;  2M7L A;  1TCF A;  1JF0 A;  3OB1 B;  1WDC B;  1SL9 A;  4M2O A;  1K93 D;  1UUR A;  2EC6 B;  4MZK A;  2D8N A;  2GGM A;  2PSR A;  1QVI Y;  3O4Y A;  4CFR A;  3JTD B;  2KYC A;  4D1E A;  5KTY A;  2JRF A;  3BOW B;  5B8I B;  2CXJ A;  1NWD A;  2LUX A;  3TUY B;  2KSP A;  2JXL A;  1DJG A;  4ORC B;  2M7N A;  1XFX O;  4OCI A;  1L7Z A;  5K89 A;  4YGE B;  5J3X A;  2I7A A;  2MLE C;  1CMG A;  1DF0 B;  2OS8 B;  1WLZ A;  3IQQ A;  1YRU B;  5PAL A;  5BPJ A;  1BJF A;  4PHJ A;  3OX5 A;  1YUR A;  1JC2 A;  1DT7 B;  1LVC D;  2JT8 A;  3VGO A;  4YRU A;  1XYD A;  3GK1 A;  4YGC B;  3GOF A;  3I5H C;  1B47 A;  2M97 A;  1N2D A;  3WHU B;  3F45 A;  1XFV O;  1E8A A;  4M2P A;  4YGA A;  5HKY A;  1S6I A;  4ZCV A;  1AHR A;  2MLF C;  5AAN A;  3D10 A;  1S6C A;  1V1G A;  1B7T Y;  1J7P A;  1IG5 A;  2K2F A;  5AER A;  2KAX A;  1M31 A;  4NDB A;  2OPO A;  3TS5 B;  1ZUZ A;  2BEC A;  1UHK A;  3EVR A;  1C07 A;  1UHN A;  2BE4 A;  3VRO A;  1KK8 C;  2F2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...