1DTLA

Crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
149
Chain Sequence
YKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKKSEEELSDLFRMFDKNADGYIDLEELKIMLQATTITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bepridil opens the regulatory N-terminal lobe of cardiac troponin C.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords CARDIAC TROPONIN C
total genus 53
structure length 149
sequence length 156
ec nomenclature
pdb deposition date 2000-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA02
4PE4A 2BCAA 1DF0A 4MRYA 1JUOA 2KI4B 3FS7A 3GK2A 4PHJA 2LVKA 2KAYA 2L2EA 2WCBA 2LVIA 1LA3A 2PMYA 1J7RA 2M1UA 1TCOB 5AEQA 2O5GA 2K0JA 1JC2A 1FI6A 3KHEA 1OZOA 1PSBA 3I5FC 2F2PA 3OX5A 4A4CA 2KI6C 1N2DA 1HQVA 1U5IB 1V1GA 1Y0VH 1ZACA 1PSRA 1XFZO 4YBHB 3O78A 2JXCA 3DVJA 3SG7A 2F33A 2IS9A 4FTGA 2HETA 2NCPA 2I2RE 4P2YB 2LUCA 1EJ3A 3FWCA 2LMVA 4YGDB 3SIAA 2KBIA 1RK9A 3PALA 3F45A 4YGEB 2PRUA 1UHHA 1UP5A 4I5KA 3LK0A 4M2PA 1CLLA 2HPSA 2NZ0A 1QIVA 2JXLA 2K2AA 1KQMC 2KQ6A 2M9GA 2PALA 3H4SE 4OR9B 2JT3A 4JWQA 5K89A 4IL1A 1IWQA 2B1UA 1QV0A 1RWYA 4YGAA 1YVLA 2QACA 1CLMA 3JTDC 1FPWA 2CCMA 3VGOA 1R2UA 1ALWA 1SCMC 2G9BA 1KWOB 2JQ6A 1ZOTB 2KGBC 1WDCC 2K7BA 3CR4X 3ZNIA 4USLA 1F4QA 4XYNA 1PVBA 2JC2A 2WOSA 2KHNA 5CSJA 2PASA 4P5OE 2KSPA 2F3YA 1EG3A 1NWDA 1TRFA 4I5JA 4QJ3B 3SG6A 1DJGA 1SMGA 2FOTA 4F0ZB 1SBJA 1SL9A 4OKHA 1MXLC 1ALVA 2MLEC 1OMDA 3OB2B 1DMOA 1GQMA 2LAPA 1OZSA 1PALA 2A4JA 1XFUO 3NXAA 2KNEA 2LVVA 2LP3A 2H61A 2KFHA 2WORA 3C1VA 1FW4A 1TCFA 1A75B 2MA2A 3I5HB 3O4YA 1KSOA 4PHNA 1LXFC 1BT6A 2BE4A 3HX4A 1UHNA 1DJYA 5FYXA 5JOLA 4CLNA 3SG2A 2BBMA 4CIDA 2K7OA 4XJKB 3AKAA 1ZFSA 3CWGA 4MN0A 3ZWHA 1N65A 4E68A 4ZCUA 1CTRA 1GJYA 1M31A 1NCZA 1NP8A 3SJSA 1F71A 4MEWA 1EG4A 2M49B 2KYCA 1FBVA 1OMVA 1QVIZ 2F8PA 5I2LA 1IKUA 5CSIA 1WRKA 3EVVA 1KK7Z 2OPOA 1EH2A 2LVJA 4NDCA 3PM8A 4HREE 1S26D 2Y1MA 1GGWA 1NX0A 1AUIB 3D10A 1NYAA 2LUXA 1NIWA 2SCPA 3TS5C 3TS5B 1W7IB 1DGVA 4YI8A 2Q4UA 5AXIA 1YTZC 4ETOA 3CS1A 2JULA 2K2FA 2Y1NA 1MQ1A 2LHLA 2OTGC 2FJUB 2L50A 2BKHB 2JT8A 1XFVO 2M29A 4HRHA 1SK6D 2MHHA 2JT0A 3WHTB 2BE6A 5HKWA 1H4BA 1U5IA 1CMFA 3NSLA 5PALA 1YUSA 2JNFA 1S6JA 2KFGA 4ORCB 5HLOA 3KPXA 1DJZA 3E3RA 1W7JB 2BECA 3ICBA 3QRXA 3BUWB 1A2XA 2JWWA 2KAVA 2LHIA 1K9PA 2LLUA 4D1EA 1DJHA 2LANA 2EHBA 1QV1A 1YRTB 2BBNA 1AJ4A 1XK4A 3BOWA 4OV2A 3BUXB 1S36A 4AQJA 1KFXL 1TIZA 3KEVA 1JF0A 2BL0B 1XK4C 5HYDA 4L9MA 1UWOA 2K61A 3PN7C 3RM1A 4QJ5B 1F8HA 3JVTB 1EL4A 1MR8A 4M2QA 3GK4X 1RFJA 2CXJA 1BR1B 2KGRA 2NCOA 3I5FB 3TDZA 1KCYA 1ZMZA 3I5IB 3OX6A 3BXKA 1F70A 5B8IB 1WRZA 1X02A 2LMUA 1QX2A 4GPLB 3DF0B 1Y1UA 2KQYA 1B1GA 1IH0A 1CMGA 2L51A 3BUMB 2OS8C 5I2OA 2L0PA 1NX2A 4DUQA 2KI4C 2PVBA 1GGZA 1K2HA 4AOMA 5J3XA 1KQVA 1IRJA 4ORAB 3IF7A 1A4PA 1CNPA 3NSKA 2TN4A 1YURA 3AAKA 3CZTX 1G33A 2M8UA 2DOQA 3BOWB 3K21A 2GGZA 2BCBA 2WC8A 1UURA 1F55A 2COLB 4GUKA 2L5XB 1EXRA 2HF5A 1SY9A 1M63B 4NDBA 1S5GZ 3DVMA 2M1KB 4I5LB 1UHKA 1BODA 1TNPA 1SRAA 3GK1A 3CLNA 1QJTA 1DT7B 1MHOA 4DS7A 3TDUA 1MXEA 3PN7B 4GBAA 1QIWA 3NSOA 3PATA 4AQIA 1FI5A 2ISDA 1TN4A 1UHIA 1NX1A 4YI9A 1DF0B 2KAXA 1NCXA 1RJVA 3A8RA 1YX8A 1A03A 5DKNA 2LV7A 3FIAA 2LC5A 4BY4A 1YR5A 3TUYB 5HKYA 1IJ5A 1TNWA 4WQ2A 1C7VA 5CSNA 2CTNA 3CR2A 1QXPA 1QX7A 1CDLA 1KFUL 1SR6C 3OB1B 1QLSA 1CDNA 1K9KA 1C7WA 1QATA 2LE9B 2LCPA 5F6TA 1WY9A 2JRFA 3D0YB 2EGDA 2VRGA 3DVKA 2HQWA 4MBEA 1QASA 1NPQA 4NDDA 3KF9A 3LCPC 1BLQA 1MUXA 2JTTA 1K96A 2R2IA 1OMRA 3A4UB 1XO5A 1WRLA 3SG4A 2K7DA 2M0RA 2LM5A 1BR4B 5ER4X 1XFYO 2P6BB 3I5GC 1RECA 1RROA 2CNPA 3EKJA 1K94A 3IQOA 2OS8B 1G4YR 1OSAA 1S6IA 5D7FA 2I94A 4PALA 4BY5A 3EVUA 4MZJA 1SKTA 1QX5B 1OOJA 2HQ8A 2EC6B 1MWNA 2H2KA 4N1FA 2AAOA 3NSIA 4ZCVA 1B4CA 2E30A 1E8AA 3SG5A 1TNXA 1SL7A 1PRWA 1L2OB 1CKKA 1IQ5A 2BCXA 4HSZA 3I5HC 1CDPA 2WCFA 4DCKA 1B8RA 1H8BA 1WLMA 3JVTC 4CPVA 3VRPA 1AJ5A 1RTP1 3HCMA 1XFWO 1SNLA 3BYAA 4ORBB 2MBXA 1XYDA 1PVAA 1CFPA 1OQPA 1AK8A 1BJFA 2LLSA 2AMIA 2D8NA 1KFUS 3D0YA 4NQGA 4MLWA 2OTGB 1A75A 4I5NB 1AHRA 2LMTA 1XA5A 2MLFC 1F54A 1JFJA 3M0WA 2G2BA 5JJGA 1TOPA 2ZN8A 4PE0A 1LVCD 1J7PA 1FF1A 2MRDA 1SW8A 5G08A 2I7AA 4U8DA 3WHUB 2KYFA 2Y5IA 1B9AA 2BL0C 2BKIB 5KTYA 3DF0A 1NCYA 2JU0A 2ZFDA 1M39A 1S5GY 1CM4A 2CBLA 3SG3A 1VRKA 3I5IC 3WXAA 1Y6WA 1LKJA 5I8NA 3OHMB 1OE9B 1B8CA 1K8UA 1XFXO 3AAJA 2F2OA 1PK0D 2K8MB 2EC6C 1F4OA 4PCWA 4WRIA 1J7QA 2ZN9A 1HT9A 1BOCA 1DTLA 3VRNA 5BPJA 2F3ZA 3BUOB 4C0JA 1BU3A 2H61C 2ZRSA 1SL8A 3KO0A 2JNXA 3CGAA 1IGVA 4UPGA 1M45A 1MF8B 2O60A 3AKBA 2AUCA 1NSHA 2Q91A 5ER5A 1SPYA 2FCDA 2JPTA 5AFPA 4HRGA 1AP4A 2RGIA 2SASA 2ZKMX 5AERA 1YUUA 4GGNA 2I18A 3O6BA 1CLBA 1QS7A 2GGMA 1J1EA 1B47A 1DVIA 1WDCB 1J55A 4N5XA 3I5GB 2V53A 1TTXA 4C0KA 1QTXA 1IJ6A 2FCEA 4PE7A 2CT9A 1IQ3A 5GQQC 5KU1A 1K93D 1DJIA 4C0LA 2KI6D 1DGUA 1DJWA 1DJXA 1K95A 1KWOC 4GFTA 3TUYC 4MZLA 2M3WA 3GOFA 4M2OA 1Q80A 1L2OC 3O2PA 1CFDA 1BG1A 4XJKA 1Y1AA 3FWBA 1CFCA 3VROA 3LK1A 3WNXB 1K90D 2LP2A 1SCMB 5DKQA 1SR6B 3BUNB 4A4BA 2M7LA 1JF2A 2NLNA 1K9UA 2M7NA 1G8IA 3PLFB 1JFKA 5HKZA 5CPVA 1IG5A 1ODBA 1JBAA 4DIRA 4GGFC 3EKHA 3EK4A 5KSZA 1TNQA 1R6PA 1C07A 1NX3A 3EK8A 5D69A 4FQOA 3LL8B 4PHMA 3TZ1A 1J7OA 3VRQA 1KQMB 3JTDB 1N0YA 1LINA 4MZKA 3DVEA 5CSFA 4YRUA 2ZNEA 1V1FA 1J1DA 3TDIA 1BF5A 1KFXS 1Y1XA 3CR5X 4GNKB 4OVNF 1JWDA 2JTZA 1B7TZ 4Q04A 4ICBA 3SIBA 1L7ZA 3DD4A 4MVFA 5DKRA 2NXQA 1D1OA 1AVSA 4YGBB 4MSPA 5HLVA 3RLZA 2LNKA 2KBMA 4DRWA 2L4IA 2ZRTA 5AANA 2JZIA 1UHJA 1A29A 3LLEA 1S1EA 1M46A 2M97A 3IQQA 1SCVA 3VRRA 2WNDA 1ZUZA 1BMOA 4QJ4B 3MSEB 3BQ3A 4JQ0D 2Y4QA 3EVRA 3OP0A 2ZNDA 2KOTA 4YGCB 1XVJA 1SYMA 2GV5A 1YVHA 2K7CA 4MRXA 1B8LA 1LA0A 2L98A 2JOJA 2LLTA 2MJWB 1YX7A 3PSRA 4PE1A 4GAOA 4JPZB 4R1EA 5TNCA 5I2QA 1KK8B 1WLZA 4WQ3A 1B7TY 4N1GA 1NUBA 2E6WA 1YRUB 1S3PA 3EK7A 3PFVA 1QLKA 1CFFA 1CDMA 1KK7Y 1YUTA 2KFFA 1CB1A 1UUSA 4CFRA 3CTNA 2WCEA 4PHKA 1KK8C 2PSRA 4TNCA 5IBWA 1JSAA 4OCIA 1QVIY 2MAZA 4GGFA 1KSMA 2QPTA 1S6CA 1PULA 4PDZA 2L4HA 4CFQA 2KDHA 1CM1A
chains in the Genus database with same CATH superfamily
4PE4A 2BCAA 5DICA 1DF0A 3D76A 4MRYA 3SS4A 1JUOA 2KI4B 3FS7A 3GK2A 4PHJA 2LVKA 2KAYA 2L2EA 2WCBA 1TUZA 1QWVA 2LVIA 3B86A 1LA3A 2PMYA 1J7RA 2M1UA 1TCOB 5AEQA 2O5GA 2K0JA 1JC2A 1FI6A 2L2CA 3KHEA 1OZOA 1PSBA 3I5FC 2F2PA 3OX5A 4A4CA 2KI6C 1N2DA 1HQVA 1U5IB 1V1GA 1Y0VH 1ZACA 1PSRA 1XFZO 4YBHB 3O78A 3CZ1A 2JXCA 3R1PA 3DVJA 4FQTA 3SG7A 2F33A 2IS9A 4FTGA 2HETA 2NCPA 1Z2CB 2I2RE 2LUCA 1EJ3A 3FWCA 4P2YB 1IIOA 2LMVA 4YGDB 3SIAA 2KBIA 1RK9A 3PALA 3F45A 4YGEB 2PRUA 3RZSA 1UHHA 1UP5A 4I5KA 3LK0A 4M2PA 1CLLA 4KYNA 2HPSA 2NZ0A 1QIVA 2JXLA 2K2AA 1KQMC 2KQ6A 2M9GA 2PALA 2WCJA 2QEBA 2JT3A 4JWQA 4OR9B 5K89A 4IL1A 1C3ZA 1IWQA 2B1UA 1QV0A 1LS8A 1RWYA 3PM2A 4YGAA 1YVLA 2QACA 1CLMA 3JTDC 1FPWA 2CCMA 3VGOA 1R2UA 1ALWA 1SCMC 2G9BA 1KWOB 2JQ6A 3D73A 1ZOTB 2KGBC 1WDCC 2K7BA 3CR4X 3ZNIA 4USLA 1F4QA 4XYNA 3SS3A 1PVBA 2JC2A 2WOSA 2KHNA 5CSJA 2PASA 4P5OE 3BFBA 2KSPA 2F3YA 1EG3A 1NWDA 1TRFA 4I5JA 4QJ3B 3SG6A 1DJGA 1SMGA 2FOTA 4F0ZB 1SBJA 1SL9A 4OKHA 1MXLC 1ALVA 2MLEC 1OMDA 3OB2B 1DMOA 1GQMA 2LAPA 1OZSA 2JPOA 1PALA 2A4JA 1XFUO 3NXAA 2KNEA 2LVVA 2LP3A 2H61A 2KFHA 2WORA 3C1VA 3NGVA 5FI2A 1FW4A 1TCFA 5EL2A 1A75B 2MA2A 2KPHA 3I5HB 3O4YA 1KSOA 4PHNA 1LXFC 1BT6A 2BE4A 3HX4A 1UHNA 1DJYA 3CYZA 5FYXA 5JOLA 4CLNA 3SG2A 3S0DA 1OOHA 2BBMA 4CIDA 2K7OA 4XJKB 3AKAA 1ZFSA 3CWGA 4MN0A 3ZWHA 1N65A 4E68A 4ZCUA 1CTRA 1GJYA 1M31A 1NCZA 1NP8A 3SJSA 3FE8A 1F71A 4MEWA 1EG4A 2M49B 2KYCA 1FBVA 1OMVA 1QVIZ 2F8PA 2WC6A 5I2LA 1IKUA 5CSIA 1WRKA 3EVVA 4PT1A 1KK7Z 2OPOA 1EH2A 2LVJA 4NDCA 3PM8A 4HREE 1S26D 2Y1MA 1GGWA 1NX0A 1AUIB 3D10A 1NYAA 2LUXA 1NIWA 2SCPA 3TS5C 3TS5B 1W7IB 1DGVA 4YI8A 2Q4UA 5AXIA 1YTZC 4ETOA 3CS1A 2JULA 2K2FA 2Y1NA 1MQ1A 2LHLA 2OTGC 2FJUB 3IVTA 2L50A 2BKHB 2JT8A 1XFVO 2M29A 4HRHA 1SK6D 3R1OA 2MHHA 2JT0A 3SS5A 3S0AA 3WHTB 2BE6A 1DEKA 1Z4HA 5HKWA 1H4BA 1U5IA 1CMFA 3NSLA 2QEVA 5PALA 3O4XA 1YUSA 2JNFA 1S6JA 3CDNA 2KFGA 4ORCB 5HLOA 3KPXA 1DJZA 3E3RA 1W7JB 2BECA 3ICBA 3QRXA 3BUWB 1A2XA 2JWWA 2KAVA 2LHIA 1K9PA 2LLUA 4D1EA 1DJHA 2QEOA 2LANA 2EHBA 1QV1A 1YRTB 2BBNA 1AJ4A 1XK4A 3BOWA 4OV2A 3BUXB 1S36A 4AQJA 1KFXL 1TIZA 3KEVA 1JF0A 2BL0B 1XK4C 4JKTA 4L9MA 5D3OA 5HYDA 1XFRA 1UWOA 2K61A 3PN7C 4INWA 3RM1A 4QJ5B 1F8HA 3JVTB 1EL4A 1MR8A 4M2QA 3GK4X 1RFJA 1GM0A 2CXJA 1BR1B 2KGRA 2NCOA 3I5FB 3TDZA 1KCYA 1ZMZA 3I5IB 3D78A 3OX6A 3BXKA 1F70A 5B8IB 1WRZA 1X02A 2LMUA 1QX2A 4GPLB 4JD9A 3DF0B 2YGUA 1Y1UA 2KQYA 5I94A 1B1GA 1CMGA 1IH0A 2L51A 3BUMB 2OS8C 1OOIX 5I2OA 2L0PA 1NX2A 4DUQA 2KI4C 1SSEB 2PVBA 1GGZA 1K2HA 4AOMA 5J3XA 1KQVA 1IRJA 3VB1A 4ORAB 3IF7A 1A4PA 1CNPA 3NSKA 2QEHA 2TN4A 1YURA 3CABA 3AAKA 3CZTX 1G33A 2M8UA 2DOQA 3BOWB 3K21A 4IJ7A 2PYQA 2GGZA 2BCBA 2WC8A 1UURA 1F55A 2COLB 4GUKA 2L5XB 1EXRA 2HF5A 2KLDA 1TWOA 1SY9A 1M63B 4NDBA 1S5GZ 3DVMA 2M1KB 4I5LB 1UHKA 1BODA 1TNPA 1SRAA 3GK1A 3CLNA 1QJTA 1DT7B 1MHOA 1DQEA 3TDUA 1MXEA 3PN7B 4GBAA 1QIWA 3NSOA 4DS7A 3PATA 3BFHA 4AQIA 3Q8IA 1FI5A 2ISDA 1TN4A 1UHIA 3OGNA 1NX1A 4YI9A 1DF0B 3DYEA 2KAXA 1NCXA 1RJVA 3A8RA 1YX8A 1A03A 5DKNA 3BJHA 2LV7A 5FI7A 3FIAA 2LC5A 4BY4A 1YR5A 3TUYB 5HKYA 1IJ5A 1TNWA 3L4AA 4WQ2A 1C7VA 5CSNA 2CTNA 3CR2A 1QXPA 1QX7A 1CDLA 1KFUL 1SR6C 3OB1B 3QMEA 1QLSA 3V2LA 1CDNA 1K9KA 1C7WA 1QATA 2LE9B 2LCPA 5F6TA 1WY9A 2JRFA 3D0YB 2EGDA 2L5YA 2VRGA 3DVKA 2HQWA 4MBEA 1QASA 3B88A 1NPQA 4NDDA 3KF9A 3LCPC 1BLQA 2WCMA 2FJYA 1MUXA 2JTTA 1K96A 2R2IA 1OMRA 3A4UB 1XO5A 1WRLA 3SG4A 2K7DA 2M0RA 1W9ZA 2LM5A 1BR4B 5ER4X 1XFYO 1P28A 2P6BB 3I5GC 1RECA 1RROA 2CNPA 3EKJA 1K94A 3IQOA 2OS8B 1G4YR 1OSAA 1S6IA 5D7FA 2I94A 4PALA 4BY5A 3EVUA 4MZJA 1SKTA 1QX5B 1OOJA 2HQ8A 2EC6B 1MWNA 2H2KA 4N1FA 2AAOA 3NSIA 4ZCVA 1B4CA 2E30A 1E8AA 3SG5A 1TNXA 1SL7A 1PRWA 1L2OB 1CKKA 1IQ5A 2BCXA 4HSZA 3I5HC 1CDPA 2WCFA 4DCKA 1B8RA 4F7FA 1H8BA 1WLMA 3JVTC 4CPVA 3VRPA 1AJ5A 1RTP1 3HCMA 1XFWO 1SNLA 3BYAA 4ORBB 2MBXA 1XYDA 1PVAA 1CFPA 1OQPA 1AK8A 1BJFA 2LLSA 5FI6A 2AMIA 2D8NA 1KFUS 3D0YA 4NQGA 2H8VA 4MLWA 2OTGB 1ORGA 1A75A 3PJIA 4I5NB 1AHRA 2LMTA 1XA5A 2MLFC 1F54A 1JFJA 3M0WA 3EG5B 2G2BA 5JJGA 1TOPA 2ZN8A 4PE0A 1LVCD 1J7PA 1FF1A 2MRDA 1SW8A 5G08A 2I7AA 4U8DA 3S0BA 3WHUB 2KYFA 2Y5IA 1B9AA 2BL0C 5HKZA 2BKIB 5KTYA 3B6XA 2ERBA 3DF0A 1C3YA 1NCYA 2JU0A 2ZFDA 1M39A 1S5GY 1CM4A 2CBLA 3D75A 3SG3A 1VRKA 3I5IC 2K60A 3WXAA 1Y6WA 1LKJA 5I8NA 3OHMB 1OE9B 1B8CA 1K8UA 1XFXO 3AAJA 2F2OA 1PK0D 2K8MB 2EC6C 1F4OA 1OOFA 4PCWA 4WRIA 2ZN9A 1HT9A 1BOCA 1J7QA 1DTLA 3VRNA 5BPJA 3K1EA 2F3ZA 3BUOB 4C0JA 1BU3A 2H61C 3L47A 2ZRSA 1SL8A 3KO0A 2JNXA 3CGAA 1IGVA 4UPGA 1M45A 1MF8B 2O60A 3AKBA 2AUCA 1NSHA 2Q91A 5ER5A 1SPYA 2FCDA 2JPTA 5AFPA 1DELA 4HRGA 1AP4A 3UNWA 2RGIA 2SASA 2ZKMX 5AERA 1YUUA 4GGNA 2I18A 3O6BA 1CLBA 1QS7A 4PDZA 2GGMA 1J1EA 1B47A 1DVIA 1WDCB 1J55A 3DZTA 4N5XA 3I5GB 2V53A 1TTXA 4C0KA 1QTXA 1IJ6A 2FCEA 4PE7A 2CT9A 1IQ3A 5GQQC 5KU1A 1K93D 1DJIA 4C0LA 2KI6D 1DGUA 1DJWA 1DJXA 1K95A 1KWOC 4GFTA 3TUYC 4MZLA 2M3WA 3GOFA 1OW4A 2P71A 3R72A 4M2OA 1Q80A 1L2OC 3O2PA 1CFDA 1BG1A 4XJKA 1Y1AA 3FWBA 5HL1A 1CFCA 3VROA 3LK1A 3WNXB 1K90D 3DY9A 3S0GA 2LP2A 1T14A 3H4SE 1SCMB 5DKQA 1SR6B 3BUNB 4A4BA 2M7LA 1JF2A 2NLNA 1K9UA 2M7NA 1G8IA 3PLFB 1JFKA 2KLEA 2WCKA 4INXA 5CPVA 1IG5A 1ODBA 2P70A 3D74A 1JBAA 4DIRA 4GGFC 3EKHA 3EK4A 5KSZA 1TNQA 1DC1A 1R6PA 1C07A 1NX3A 3EK8A 5D69A 4FQOA 3LL8B 4PHMA 3TZ1A 1J7OA 3VRQA 1KQMB 3JTDB 1N0YA 1LINA 4MZKA 3N7HA 3DVEA 5CSFA 4YRUA 2ZNEA 1V1FA 1J1DA 3TDIA 1BF5A 1KFXS 1Y1XA 3CR5X 1TUJA 3CZ2A 4GNKB 4OVNF 1JWDA 3UO9A 2JTZA 1B7TZ 4Q04A 4ICBA 3SIBA 1L7ZA 3DD4A 4MVFA 5DKRA 2NXQA 1D1OA 1AVSA 4YGBB 4MSPA 5HLVA 3RLZA 2LNKA 2KBMA 4DRWA 2L4IA 2ZRTA 5AANA 3OBVA 2JZIA 1UHJA 1A29A 3LLEA 1S1EA 2WCHA 2GTEA 1M46A 2M97A 3IQQA 4OZDA 1SCVA 3VRRA 2WNDA 1ZUZA 1BMOA 3S0EA 4QJ4B 3MSEB 3L4LA 3BQ3A 4JQ0D 2Y4QA 3EVRA 3OP0A 2ZNDA 2KOTA 3S0FA 4YGCB 1XVJA 2QDIA 1SYMA 2GV5A 3B87A 3FE6A 1YVHA 3NHTA 3D77A 2K7CA 4MRXA 3BFAA 1B8LA 1LA0A 2L98A 2JOJA 2LLTA 2MJWB 1YX7A 3PSRA 4PE1A 4GAOA 4JPZB 4R1EA 5TNCA 2WC5A 5I2QA 1KK8B 1WLZA 3NHIA 4WQ3A 1B7TY 4N1GA 1NUBA 2E6WA 1YRUB 1S3PA 3EK7A 3PFVA 3FE9A 1QLKA 1CFFA 1CDMA 1KK7Y 1OOGA 1YUTA 2KFFA 1CB1A 1UUSA 3DXLA 3CTNA 2WCEA 3R1VA 4PHKA 1KK8C 2PSRA 4TNCA 4CFRA 5IBWA 4OCIA 1QVIY 2MAZA 1JSAA 3B7AA 3CZ0A 2WCLA 2PQLA 4GGFA 1KSMA 2BNXA 2QPTA 1S6CA 1PULA 2BAPA 2L4HA 4CFQA 2KDHA 1CM1A
chains in the Genus database with same CATH topology
4PE4A 2BCAA 1DF0A 4MRYA 1JUOA 2KI4B 3FS7A 3GK2A 4PHJA 2LVKA 2KAYA 2L2EA 2WCBA 2LVIA 1LA3A 2PMYA 1J7RA 2M1UA 1TCOB 5AEQA 2O5GA 2K0JA 1JC2A 1FI6A 3KHEA 1OZOA 1PSBA 3I5FC 2F2PA 3OX5A 4A4CA 2KI6C 1N2DA 1HQVA 1U5IB 1V1GA 1Y0VH 1ZACA 1PSRA 1XFZO 4YBHB 3O78A 2JXCA 3DVJA 3SG7A 2F33A 2IS9A 4FTGA 2HETA 2NCPA 2I2RE 4P2YB 2LUCA 1EJ3A 3FWCA 2LMVA 4YGDB 3SIAA 2KBIA 1RK9A 3PALA 3F45A 4YGEB 2PRUA 1UHHA 1UP5A 4I5KA 3LK0A 4M2PA 1CLLA 2HPSA 2NZ0A 1QIVA 2JXLA 2K2AA 1KQMC 2KQ6A 2M9GA 2PALA 3H4SE 4OR9B 2JT3A 4JWQA 5K89A 4IL1A 1IWQA 2B1UA 1QV0A 1RWYA 4YGAA 1YVLA 2QACA 1CLMA 3JTDC 1FPWA 2CCMA 3VGOA 1R2UA 1ALWA 1SCMC 2G9BA 1KWOB 2JQ6A 1ZOTB 2KGBC 1WDCC 2K7BA 3CR4X 3ZNIA 4USLA 1F4QA 4XYNA 1PVBA 2JC2A 2WOSA 2KHNA 5CSJA 2PASA 4P5OE 2KSPA 2F3YA 1EG3A 1NWDA 1TRFA 4I5JA 4QJ3B 3SG6A 1DJGA 1SMGA 2FOTA 4F0ZB 1SBJA 1SL9A 4OKHA 1MXLC 1ALVA 2MLEC 1OMDA 3OB2B 1DMOA 1GQMA 2LAPA 1OZSA 1PALA 2A4JA 1XFUO 3NXAA 2KNEA 2LVVA 2LP3A 2H61A 2KFHA 2WORA 3C1VA 1FW4A 1TCFA 1A75B 2MA2A 3I5HB 3O4YA 1KSOA 4PHNA 1LXFC 1BT6A 2BE4A 3HX4A 1UHNA 1DJYA 5FYXA 5JOLA 4CLNA 3SG2A 2BBMA 4CIDA 2K7OA 4XJKB 3AKAA 1ZFSA 3CWGA 4MN0A 3ZWHA 1N65A 4E68A 4ZCUA 1CTRA 1GJYA 1M31A 1NCZA 1NP8A 3SJSA 1F71A 4MEWA 1EG4A 2M49B 2KYCA 1FBVA 1OMVA 1QVIZ 2F8PA 5I2LA 1IKUA 5CSIA 1WRKA 3EVVA 1KK7Z 2OPOA 1EH2A 2LVJA 4NDCA 3PM8A 4HREE 1S26D 2Y1MA 1GGWA 1NX0A 1AUIB 3D10A 1NYAA 2LUXA 1NIWA 2SCPA 3TS5C 3TS5B 1W7IB 1DGVA 4YI8A 2Q4UA 5AXIA 1YTZC 4ETOA 3CS1A 2JULA 2K2FA 2Y1NA 1MQ1A 2LHLA 2OTGC 2FJUB 2L50A 2BKHB 2JT8A 1XFVO 2M29A 4HRHA 1SK6D 2MHHA 2JT0A 3WHTB 2BE6A 5HKWA 1H4BA 1U5IA 1CMFA 3NSLA 5PALA 1YUSA 2JNFA 1S6JA 2KFGA 4ORCB 5HLOA 3KPXA 1DJZA 3E3RA 1W7JB 2BECA 3ICBA 3QRXA 3BUWB 1A2XA 2JWWA 2KAVA 2LHIA 1K9PA 2LLUA 4D1EA 1DJHA 2LANA 2EHBA 1QV1A 1YRTB 2BBNA 1AJ4A 1XK4A 3BOWA 4OV2A 3BUXB 1S36A 4AQJA 1KFXL 1TIZA 3KEVA 1JF0A 2BL0B 1XK4C 5HYDA 4L9MA 1UWOA 2K61A 3PN7C 3RM1A 4QJ5B 1F8HA 3JVTB 1EL4A 1MR8A 4M2QA 3GK4X 1RFJA 2CXJA 1BR1B 2KGRA 2NCOA 3I5FB 3TDZA 1KCYA 1ZMZA 3I5IB 3OX6A 3BXKA 1F70A 5B8IB 1WRZA 1X02A 2LMUA 1QX2A 4GPLB 3DF0B 1Y1UA 2KQYA 1B1GA 1IH0A 1CMGA 2L51A 3BUMB 2OS8C 5I2OA 2L0PA 1NX2A 4DUQA 2KI4C 2PVBA 1GGZA 1K2HA 4AOMA 5J3XA 1KQVA 1IRJA 4ORAB 3IF7A 1A4PA 1CNPA 3NSKA 2TN4A 1YURA 3AAKA 3CZTX 1G33A 2M8UA 2DOQA 3BOWB 3K21A 2GGZA 2BCBA 2WC8A 1UURA 1F55A 2COLB 4GUKA 2L5XB 1EXRA 2HF5A 1SY9A 1M63B 4NDBA 1S5GZ 3DVMA 2M1KB 4I5LB 1UHKA 1BODA 1TNPA 1SRAA 3GK1A 3CLNA 1QJTA 1DT7B 1MHOA 4DS7A 3TDUA 1MXEA 3PN7B 4GBAA 1QIWA 3NSOA 3PATA 4AQIA 1FI5A 2ISDA 1TN4A 1UHIA 1NX1A 4YI9A 1DF0B 2KAXA 1NCXA 1RJVA 3A8RA 1YX8A 1A03A 5DKNA 2LV7A 3FIAA 2LC5A 4BY4A 1YR5A 3TUYB 5HKYA 1IJ5A 1TNWA 4WQ2A 1C7VA 5CSNA 2CTNA 3CR2A 1QXPA 1QX7A 1CDLA 1KFUL 1SR6C 3OB1B 1QLSA 1CDNA 1K9KA 1C7WA 1QATA 2LE9B 2LCPA 5F6TA 1WY9A 2JRFA 3D0YB 2EGDA 2VRGA 3DVKA 2HQWA 4MBEA 1QASA 1NPQA 4NDDA 3KF9A 3LCPC 1BLQA 1MUXA 2JTTA 1K96A 2R2IA 1OMRA 3A4UB 1XO5A 1WRLA 3SG4A 2K7DA 2M0RA 2LM5A 1BR4B 5ER4X 1XFYO 2P6BB 3I5GC 1RECA 1RROA 2CNPA 3EKJA 1K94A 3IQOA 2OS8B 1G4YR 1OSAA 1S6IA 5D7FA 2I94A 4PALA 4BY5A 3EVUA 4MZJA 1SKTA 1QX5B 1OOJA 2HQ8A 2EC6B 1MWNA 2H2KA 4N1FA 2AAOA 3NSIA 4ZCVA 1B4CA 2E30A 1E8AA 3SG5A 1TNXA 1SL7A 1PRWA 1L2OB 1CKKA 1IQ5A 2BCXA 4HSZA 3I5HC 1CDPA 2WCFA 4DCKA 1B8RA 1H8BA 1WLMA 3JVTC 4CPVA 3VRPA 1AJ5A 1RTP1 3HCMA 1XFWO 1SNLA 3BYAA 4ORBB 2MBXA 1XYDA 1PVAA 1CFPA 1OQPA 1AK8A 1BJFA 2LLSA 2AMIA 2D8NA 1KFUS 3D0YA 4NQGA 4MLWA 2OTGB 1A75A 4I5NB 1AHRA 2LMTA 1XA5A 2MLFC 1F54A 1JFJA 3M0WA 2G2BA 5JJGA 1TOPA 2ZN8A 4PE0A 1LVCD 1J7PA 1FF1A 2MRDA 1SW8A 5G08A 2I7AA 4U8DA 3WHUB 2KYFA 2Y5IA 1B9AA 2BL0C 2BKIB 5KTYA 3DF0A 1NCYA 2JU0A 2ZFDA 1M39A 1S5GY 1CM4A 2CBLA 3SG3A 1VRKA 3I5IC 3WXAA 1Y6WA 1LKJA 5I8NA 3OHMB 1OE9B 1B8CA 1K8UA 1XFXO 3AAJA 2F2OA 1PK0D 2K8MB 2EC6C 1F4OA 4PCWA 4WRIA 1J7QA 2ZN9A 1HT9A 1BOCA 1DTLA 3VRNA 5BPJA 2F3ZA 3BUOB 4C0JA 1BU3A 2H61C 2ZRSA 1SL8A 3KO0A 2JNXA 3CGAA 1IGVA 4UPGA 1M45A 1MF8B 2O60A 3AKBA 2AUCA 1NSHA 2Q91A 5ER5A 1SPYA 2FCDA 2JPTA 5AFPA 4HRGA 1AP4A 2RGIA 2SASA 2ZKMX 5AERA 1YUUA 4GGNA 2I18A 3O6BA 1CLBA 1QS7A 2GGMA 1J1EA 1B47A 1DVIA 1WDCB 1J55A 4N5XA 3I5GB 2V53A 1TTXA 4C0KA 1QTXA 1IJ6A 2FCEA 4PE7A 2CT9A 1IQ3A 5GQQC 5KU1A 1K93D 1DJIA 4C0LA 2KI6D 1DGUA 1DJWA 1DJXA 1K95A 1KWOC 4GFTA 3TUYC 4MZLA 2M3WA 3GOFA 4M2OA 1Q80A 1L2OC 3O2PA 1CFDA 1BG1A 4XJKA 1Y1AA 3FWBA 1CFCA 3VROA 3LK1A 3WNXB 1K90D 2LP2A 1SCMB 5DKQA 1SR6B 3BUNB 4A4BA 2M7LA 1JF2A 2NLNA 1K9UA 2M7NA 1G8IA 3PLFB 1JFKA 5HKZA 5CPVA 1IG5A 1ODBA 1JBAA 4DIRA 4GGFC 3EKHA 3EK4A 5KSZA 1TNQA 1R6PA 1C07A 1NX3A 3EK8A 5D69A 4FQOA 3LL8B 4PHMA 3TZ1A 1J7OA 3VRQA 1KQMB 3JTDB 1N0YA 1LINA 4MZKA 3DVEA 5CSFA 4YRUA 2ZNEA 1V1FA 1J1DA 3TDIA 1BF5A 1KFXS 1Y1XA 3CR5X 4GNKB 4OVNF 1JWDA 2JTZA 1B7TZ 4Q04A 4ICBA 3SIBA 1L7ZA 3DD4A 4MVFA 5DKRA 2NXQA 1D1OA 1AVSA 4YGBB 4MSPA 5HLVA 3RLZA 2LNKA 2KBMA 4DRWA 2L4IA 2ZRTA 5AANA 2JZIA 1UHJA 1A29A 3LLEA 1S1EA 1M46A 2M97A 3IQQA 1SCVA 3VRRA 2WNDA 1ZUZA 1BMOA 4QJ4B 3MSEB 3BQ3A 4JQ0D 2Y4QA 3EVRA 3OP0A 2ZNDA 2KOTA 4YGCB 1XVJA 1SYMA 2GV5A 1YVHA 2K7CA 4MRXA 1B8LA 1LA0A 2L98A 2JOJA 2LLTA 2MJWB 1YX7A 3PSRA 4PE1A 4GAOA 4JPZB 4R1EA 5TNCA 5I2QA 1KK8B 1WLZA 4WQ3A 1B7TY 4N1GA 1NUBA 2E6WA 1YRUB 1S3PA 3EK7A 3PFVA 1QLKA 1CFFA 1CDMA 1KK7Y 1YUTA 2KFFA 1CB1A 1UUSA 4CFRA 3CTNA 2WCEA 4PHKA 1KK8C 2PSRA 4TNCA 5IBWA 1JSAA 4OCIA 1QVIY 2MAZA 4GGFA 1KSMA 2QPTA 1S6CA 1PULA 4PDZA 2L4HA 4CFQA 2KDHA 1CM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE4 A;  2BCA A;  1DF0 A;  4MRY A;  1JUO A;  2KI4 B;  3FS7 A;  3GK2 A;  4PHJ A;  2LVK A;  2KAY A;  2L2E A;  2WCB A;  2LVI A;  1LA3 A;  2PMY A;  1J7R A;  2M1U A;  1TCO B;  5AEQ A;  2O5G A;  2K0J A;  1JC2 A;  1FI6 A;  3KHE A;  1OZO A;  1PSB A;  3I5F C;  2F2P A;  3OX5 A;  4A4C A;  2KI6 C;  1N2D A;  1HQV A;  1U5I B;  1V1G A;  1Y0V H;  1ZAC A;  1PSR A;  1XFZ O;  4YBH B;  3O78 A;  2JXC A;  3DVJ A;  3SG7 A;  2F33 A;  2IS9 A;  4FTG A;  2HET A;  2NCP A;  2I2R E;  4P2Y B;  2LUC A;  1EJ3 A;  3FWC A;  2LMV A;  4YGD B;  3SIA A;  2KBI A;  1RK9 A;  3PAL A;  3F45 A;  4YGE B;  2PRU A;  1UHH A;  1UP5 A;  4I5K A;  3LK0 A;  4M2P A;  1CLL A;  2HPS A;  2NZ0 A;  1QIV A;  2JXL A;  2K2A A;  1KQM C;  2KQ6 A;  2M9G A;  2PAL A;  3H4S E;  4OR9 B;  2JT3 A;  4JWQ A;  5K89 A;  4IL1 A;  1IWQ A;  2B1U A;  1QV0 A;  1RWY A;  4YGA A;  1YVL A;  2QAC A;  1CLM A;  3JTD C;  1FPW A;  2CCM A;  3VGO A;  1R2U A;  1ALW A;  1SCM C;  2G9B A;  1KWO B;  2JQ6 A;  1ZOT B;  2KGB C;  1WDC C;  2K7B A;  3CR4 X;  3ZNI A;  4USL A;  1F4Q A;  4XYN A;  1PVB A;  2JC2 A;  2WOS A;  2KHN A;  5CSJ A;  2PAS A;  4P5O E;  2KSP A;  2F3Y A;  1EG3 A;  1NWD A;  1TRF A;  4I5J A;  4QJ3 B;  3SG6 A;  1DJG A;  1SMG A;  2FOT A;  4F0Z B;  1SBJ A;  1SL9 A;  4OKH A;  1MXL C;  1ALV A;  2MLE C;  1OMD A;  3OB2 B;  1DMO A;  1GQM A;  2LAP A;  1OZS A;  1PAL A;  2A4J A;  1XFU O;  3NXA A;  2KNE A;  2LVV A;  2LP3 A;  2H61 A;  2KFH A;  2WOR A;  3C1V A;  1FW4 A;  1TCF A;  1A75 B;  2MA2 A;  3I5H B;  3O4Y A;  1KSO A;  4PHN A;  1LXF C;  1BT6 A;  2BE4 A;  3HX4 A;  1UHN A;  1DJY A;  5FYX A;  5JOL A;  4CLN A;  3SG2 A;  2BBM A;  4CID A;  2K7O A;  4XJK B;  3AKA A;  1ZFS A;  3CWG A;  4MN0 A;  3ZWH A;  1N65 A;  4E68 A;  4ZCU A;  1CTR A;  1GJY A;  1M31 A;  1NCZ A;  1NP8 A;  3SJS A;  1F71 A;  4MEW A;  1EG4 A;  2M49 B;  2KYC A;  1FBV A;  1OMV A;  1QVI Z;  2F8P A;  5I2L A;  1IKU A;  5CSI A;  1WRK A;  3EVV A;  1KK7 Z;  2OPO A;  1EH2 A;  2LVJ A;  4NDC A;  3PM8 A;  4HRE E;  1S26 D;  2Y1M A;  1GGW A;  1NX0 A;  1AUI B;  3D10 A;  1NYA A;  2LUX A;  1NIW A;  2SCP A;  3TS5 C;  3TS5 B;  1W7I B;  1DGV A;  4YI8 A;  2Q4U A;  5AXI A;  1YTZ C;  4ETO A;  3CS1 A;  2JUL A;  2K2F A;  2Y1N A;  1MQ1 A;  2LHL A;  2OTG C;  2FJU B;  2L50 A;  2BKH B;  2JT8 A;  1XFV O;  2M29 A;  4HRH A;  1SK6 D;  2MHH A;  2JT0 A;  3WHT B;  2BE6 A;  5HKW A;  1H4B A;  1U5I A;  1CMF A;  3NSL A;  5PAL A;  1YUS A;  2JNF A;  1S6J A;  2KFG A;  4ORC B;  5HLO A;  3KPX A;  1DJZ A;  3E3R A;  1W7J B;  2BEC A;  3ICB A;  3QRX A;  3BUW B;  1A2X A;  2JWW A;  2KAV A;  2LHI A;  1K9P A;  2LLU A;  4D1E A;  1DJH A;  2LAN A;  2EHB A;  1QV1 A;  1YRT B;  2BBN A;  1AJ4 A;  1XK4 A;  3BOW A;  4OV2 A;  3BUX B;  1S36 A;  4AQJ A;  1KFX L;  1TIZ A;  3KEV A;  1JF0 A;  2BL0 B;  1XK4 C;  5HYD A;  4L9M A;  1UWO A;  2K61 A;  3PN7 C;  3RM1 A;  4QJ5 B;  1F8H A;  3JVT B;  1EL4 A;  1MR8 A;  4M2Q A;  3GK4 X;  1RFJ A;  2CXJ A;  1BR1 B;  2KGR A;  2NCO A;  3I5F B;  3TDZ A;  1KCY A;  1ZMZ A;  3I5I B;  3OX6 A;  3BXK A;  1F70 A;  5B8I B;  1WRZ A;  1X02 A;  2LMU A;  1QX2 A;  4GPL B;  3DF0 B;  1Y1U A;  2KQY A;  1B1G A;  1IH0 A;  1CMG A;  2L51 A;  3BUM B;  2OS8 C;  5I2O A;  2L0P A;  1NX2 A;  4DUQ A;  2KI4 C;  2PVB A;  1GGZ A;  1K2H A;  4AOM A;  5J3X A;  1KQV A;  1IRJ A;  4ORA B;  3IF7 A;  1A4P A;  1CNP A;  3NSK A;  2TN4 A;  1YUR A;  3AAK A;  3CZT X;  1G33 A;  2M8U A;  2DOQ A;  3BOW B;  3K21 A;  2GGZ A;  2BCB A;  2WC8 A;  1UUR A;  1F55 A;  2COL B;  4GUK A;  2L5X B;  1EXR A;  2HF5 A;  1SY9 A;  1M63 B;  4NDB A;  1S5G Z;  3DVM A;  2M1K B;  4I5L B;  1UHK A;  1BOD A;  1TNP A;  1SRA A;  3GK1 A;  3CLN A;  1QJT A;  1DT7 B;  1MHO A;  4DS7 A;  3TDU A;  1MXE A;  3PN7 B;  4GBA A;  1QIW A;  3NSO A;  3PAT A;  4AQI A;  1FI5 A;  2ISD A;  1TN4 A;  1UHI A;  1NX1 A;  4YI9 A;  1DF0 B;  2KAX A;  1NCX A;  1RJV A;  3A8R A;  1YX8 A;  1A03 A;  5DKN A;  2LV7 A;  3FIA A;  2LC5 A;  4BY4 A;  1YR5 A;  3TUY B;  5HKY A;  1IJ5 A;  1TNW A;  4WQ2 A;  1C7V A;  5CSN A;  2CTN A;  3CR2 A;  1QXP A;  1QX7 A;  1CDL A;  1KFU L;  1SR6 C;  3OB1 B;  1QLS A;  1CDN A;  1K9K A;  1C7W A;  1QAT A;  2LE9 B;  2LCP A;  5F6T A;  1WY9 A;  2JRF A;  3D0Y B;  2EGD A;  2VRG A;  3DVK A;  2HQW A;  4MBE A;  1QAS A;  1NPQ A;  4NDD A;  3KF9 A;  3LCP C;  1BLQ A;  1MUX A;  2JTT A;  1K96 A;  2R2I A;  1OMR A;  3A4U B;  1XO5 A;  1WRL A;  3SG4 A;  2K7D A;  2M0R A;  2LM5 A;  1BR4 B;  5ER4 X;  1XFY O;  2P6B B;  3I5G C;  1REC A;  1RRO A;  2CNP A;  3EKJ A;  1K94 A;  3IQO A;  2OS8 B;  1G4Y R;  1OSA A;  1S6I A;  5D7F A;  2I94 A;  4PAL A;  4BY5 A;  3EVU A;  4MZJ A;  1SKT A;  1QX5 B;  1OOJ A;  2HQ8 A;  2EC6 B;  1MWN A;  2H2K A;  4N1F A;  2AAO A;  3NSI A;  4ZCV A;  1B4C A;  2E30 A;  1E8A A;  3SG5 A;  1TNX A;  1SL7 A;  1PRW A;  1L2O B;  1CKK A;  1IQ5 A;  2BCX A;  4HSZ A;  3I5H C;  1CDP A;  2WCF A;  4DCK A;  1B8R A;  1H8B A;  1WLM A;  3JVT C;  4CPV A;  3VRP A;  1AJ5 A;  1RTP 1;  3HCM A;  1XFW O;  1SNL A;  3BYA A;  4ORB B;  2MBX A;  1XYD A;  1PVA A;  1CFP A;  1OQP A;  1AK8 A;  1BJF A;  2LLS A;  2AMI A;  2D8N A;  1KFU S;  3D0Y A;  4NQG A;  4MLW A;  2OTG B;  1A75 A;  4I5N B;  1AHR A;  2LMT A;  1XA5 A;  2MLF C;  1F54 A;  1JFJ A;  3M0W A;  2G2B A;  5JJG A;  1TOP A;  2ZN8 A;  4PE0 A;  1LVC D;  1J7P A;  1FF1 A;  2MRD A;  1SW8 A;  5G08 A;  2I7A A;  4U8D A;  3WHU B;  2KYF A;  2Y5I A;  1B9A A;  2BL0 C;  2BKI B;  5KTY A;  3DF0 A;  1NCY A;  2JU0 A;  2ZFD A;  1M39 A;  1S5G Y;  1CM4 A;  2CBL A;  3SG3 A;  1VRK A;  3I5I C;  3WXA A;  1Y6W A;  1LKJ A;  5I8N A;  3OHM B;  1OE9 B;  1B8C A;  1K8U A;  1XFX O;  3AAJ A;  2F2O A;  1PK0 D;  2K8M B;  2EC6 C;  1F4O A;  4PCW A;  4WRI A;  1J7Q A;  2ZN9 A;  1HT9 A;  1BOC A;  1DTL A;  3VRN A;  5BPJ A;  2F3Z A;  3BUO B;  4C0J A;  1BU3 A;  2H61 C;  2ZRS A;  1SL8 A;  3KO0 A;  2JNX A;  3CGA A;  1IGV A;  4UPG A;  1M45 A;  1MF8 B;  2O60 A;  3AKB A;  2AUC A;  1NSH A;  2Q91 A;  5ER5 A;  1SPY A;  2FCD A;  2JPT A;  5AFP A;  4HRG A;  1AP4 A;  2RGI A;  2SAS A;  2ZKM X;  5AER A;  1YUU A;  4GGN A;  2I18 A;  3O6B A;  1CLB A;  1QS7 A;  2GGM A;  1J1E A;  1B47 A;  1DVI A;  1WDC B;  1J55 A;  4N5X A;  3I5G B;  2V53 A;  1TTX A;  4C0K A;  1QTX A;  1IJ6 A;  2FCE A;  4PE7 A;  2CT9 A;  1IQ3 A;  5GQQ C;  5KU1 A;  1K93 D;  1DJI A;  4C0L A;  2KI6 D;  1DGU A;  1DJW A;  1DJX A;  1K95 A;  1KWO C;  4GFT A;  3TUY C;  4MZL A;  2M3W A;  3GOF A;  4M2O A;  1Q80 A;  1L2O C;  3O2P A;  1CFD A;  1BG1 A;  4XJK A;  1Y1A A;  3FWB A;  1CFC A;  3VRO A;  3LK1 A;  3WNX B;  1K90 D;  2LP2 A;  1SCM B;  5DKQ A;  1SR6 B;  3BUN B;  4A4B A;  2M7L A;  1JF2 A;  2NLN A;  1K9U A;  2M7N A;  1G8I A;  3PLF B;  1JFK A;  5HKZ A;  5CPV A;  1IG5 A;  1ODB A;  1JBA A;  4DIR A;  4GGF C;  3EKH A;  3EK4 A;  5KSZ A;  1TNQ A;  1R6P A;  1C07 A;  1NX3 A;  3EK8 A;  5D69 A;  4FQO A;  3LL8 B;  4PHM A;  3TZ1 A;  1J7O A;  3VRQ A;  1KQM B;  3JTD B;  1N0Y A;  1LIN A;  4MZK A;  3DVE A;  5CSF A;  4YRU A;  2ZNE A;  1V1F A;  1J1D A;  3TDI A;  1BF5 A;  1KFX S;  1Y1X A;  3CR5 X;  4GNK B;  4OVN F;  1JWD A;  2JTZ A;  1B7T Z;  4Q04 A;  4ICB A;  3SIB A;  1L7Z A;  3DD4 A;  4MVF A;  5DKR A;  2NXQ A;  1D1O A;  1AVS A;  4YGB B;  4MSP A;  5HLV A;  3RLZ A;  2LNK A;  2KBM A;  4DRW A;  2L4I A;  2ZRT A;  5AAN A;  2JZI A;  1UHJ A;  1A29 A;  3LLE A;  1S1E A;  1M46 A;  2M97 A;  3IQQ A;  1SCV A;  3VRR A;  2WND A;  1ZUZ A;  1BMO A;  4QJ4 B;  3MSE B;  3BQ3 A;  4JQ0 D;  2Y4Q A;  3EVR A;  3OP0 A;  2ZND A;  2KOT A;  4YGC B;  1XVJ A;  1SYM A;  2GV5 A;  1YVH A;  2K7C A;  4MRX A;  1B8L A;  1LA0 A;  2L98 A;  2JOJ A;  2LLT A;  2MJW B;  1YX7 A;  3PSR A;  4PE1 A;  4GAO A;  4JPZ B;  4R1E A;  5TNC A;  5I2Q A;  1KK8 B;  1WLZ A;  4WQ3 A;  1B7T Y;  4N1G A;  1NUB A;  2E6W A;  1YRU B;  1S3P A;  3EK7 A;  3PFV A;  1QLK A;  1CFF A;  1CDM A;  1KK7 Y;  1YUT A;  2KFF A;  1CB1 A;  1UUS A;  4CFR A;  3CTN A;  2WCE A;  4PHK A;  1KK8 C;  2PSR A;  4TNC A;  5IBW A;  1JSA A;  4OCI A;  1QVI Y;  2MAZ A;  4GGF A;  1KSM A;  2QPT A;  1S6C A;  1PUL A;  4PDZ A;  2L4H A;  4CFQ A;  2KDH A;  1CM1 A; 
#chains in the Genus database with same CATH topology
 4PE4 A;  2BCA A;  5DIC A;  1DF0 A;  3D76 A;  4MRY A;  3SS4 A;  1JUO A;  2KI4 B;  3FS7 A;  3GK2 A;  4PHJ A;  2LVK A;  2KAY A;  2L2E A;  2WCB A;  1TUZ A;  1QWV A;  2LVI A;  3B86 A;  1LA3 A;  2PMY A;  1J7R A;  2M1U A;  1TCO B;  5AEQ A;  2O5G A;  2K0J A;  1JC2 A;  1FI6 A;  2L2C A;  3KHE A;  1OZO A;  1PSB A;  3I5F C;  2F2P A;  3OX5 A;  4A4C A;  2KI6 C;  1N2D A;  1HQV A;  1U5I B;  1V1G A;  1Y0V H;  1ZAC A;  1PSR A;  1XFZ O;  4YBH B;  3O78 A;  3CZ1 A;  2JXC A;  3R1P A;  3DVJ A;  4FQT A;  3SG7 A;  2F33 A;  2IS9 A;  4FTG A;  2HET A;  2NCP A;  1Z2C B;  2I2R E;  2LUC A;  1EJ3 A;  3FWC A;  4P2Y B;  1IIO A;  2LMV A;  4YGD B;  3SIA A;  2KBI A;  1RK9 A;  3PAL A;  3F45 A;  4YGE B;  2PRU A;  3RZS A;  1UHH A;  1UP5 A;  4I5K A;  3LK0 A;  4M2P A;  1CLL A;  4KYN A;  2HPS A;  2NZ0 A;  1QIV A;  2JXL A;  2K2A A;  1KQM C;  2KQ6 A;  2M9G A;  2PAL A;  2WCJ A;  2QEB A;  2JT3 A;  4JWQ A;  4OR9 B;  5K89 A;  4IL1 A;  1C3Z A;  1IWQ A;  2B1U A;  1QV0 A;  1LS8 A;  1RWY A;  3PM2 A;  4YGA A;  1YVL A;  2QAC A;  1CLM A;  3JTD C;  1FPW A;  2CCM A;  3VGO A;  1R2U A;  1ALW A;  1SCM C;  2G9B A;  1KWO B;  2JQ6 A;  3D73 A;  1ZOT B;  2KGB C;  1WDC C;  2K7B A;  3CR4 X;  3ZNI A;  4USL A;  1F4Q A;  4XYN A;  3SS3 A;  1PVB A;  2JC2 A;  2WOS A;  2KHN A;  5CSJ A;  2PAS A;  4P5O E;  3BFB A;  2KSP A;  2F3Y A;  1EG3 A;  1NWD A;  1TRF A;  4I5J A;  4QJ3 B;  3SG6 A;  1DJG A;  1SMG A;  2FOT A;  4F0Z B;  1SBJ A;  1SL9 A;  4OKH A;  1MXL C;  1ALV A;  2MLE C;  1OMD A;  3OB2 B;  1DMO A;  1GQM A;  2LAP A;  1OZS A;  2JPO A;  1PAL A;  2A4J A;  1XFU O;  3NXA A;  2KNE A;  2LVV A;  2LP3 A;  2H61 A;  2KFH A;  2WOR A;  3C1V A;  3NGV A;  5FI2 A;  1FW4 A;  1TCF A;  5EL2 A;  1A75 B;  2MA2 A;  2KPH A;  3I5H B;  3O4Y A;  1KSO A;  4PHN A;  1LXF C;  1BT6 A;  2BE4 A;  3HX4 A;  1UHN A;  1DJY A;  3CYZ A;  5FYX A;  5JOL A;  4CLN A;  3SG2 A;  3S0D A;  1OOH A;  2BBM A;  4CID A;  2K7O A;  4XJK B;  3AKA A;  1ZFS A;  3CWG A;  4MN0 A;  3ZWH A;  1N65 A;  4E68 A;  4ZCU A;  1CTR A;  1GJY A;  1M31 A;  1NCZ A;  1NP8 A;  3SJS A;  3FE8 A;  1F71 A;  4MEW A;  1EG4 A;  2M49 B;  2KYC A;  1FBV A;  1OMV A;  1QVI Z;  2F8P A;  2WC6 A;  5I2L A;  1IKU A;  5CSI A;  1WRK A;  3EVV A;  4PT1 A;  1KK7 Z;  2OPO A;  1EH2 A;  2LVJ A;  4NDC A;  3PM8 A;  4HRE E;  1S26 D;  2Y1M A;  1GGW A;  1NX0 A;  1AUI B;  3D10 A;  1NYA A;  2LUX A;  1NIW A;  2SCP A;  3TS5 C;  3TS5 B;  1W7I B;  1DGV A;  4YI8 A;  2Q4U A;  5AXI A;  1YTZ C;  4ETO A;  3CS1 A;  2JUL A;  2K2F A;  2Y1N A;  1MQ1 A;  2LHL A;  2OTG C;  2FJU B;  3IVT A;  2L50 A;  2BKH B;  2JT8 A;  1XFV O;  2M29 A;  4HRH A;  1SK6 D;  3R1O A;  2MHH A;  2JT0 A;  3SS5 A;  3S0A A;  3WHT B;  2BE6 A;  1DEK A;  1Z4H A;  5HKW A;  1H4B A;  1U5I A;  1CMF A;  3NSL A;  2QEV A;  5PAL A;  3O4X A;  1YUS A;  2JNF A;  1S6J A;  3CDN A;  2KFG A;  4ORC B;  5HLO A;  3KPX A;  1DJZ A;  3E3R A;  1W7J B;  2BEC A;  3ICB A;  3QRX A;  3BUW B;  1A2X A;  2JWW A;  2KAV A;  2LHI A;  1K9P A;  2LLU A;  4D1E A;  1DJH A;  2QEO A;  2LAN A;  2EHB A;  1QV1 A;  1YRT B;  2BBN A;  1AJ4 A;  1XK4 A;  3BOW A;  4OV2 A;  3BUX B;  1S36 A;  4AQJ A;  1KFX L;  1TIZ A;  3KEV A;  1JF0 A;  2BL0 B;  1XK4 C;  4JKT A;  4L9M A;  5D3O A;  5HYD A;  1XFR A;  1UWO A;  2K61 A;  3PN7 C;  4INW A;  3RM1 A;  4QJ5 B;  1F8H A;  3JVT B;  1EL4 A;  1MR8 A;  4M2Q A;  3GK4 X;  1RFJ A;  1GM0 A;  2CXJ A;  1BR1 B;  2KGR A;  2NCO A;  3I5F B;  3TDZ A;  1KCY A;  1ZMZ A;  3I5I B;  3D78 A;  3OX6 A;  3BXK A;  1F70 A;  5B8I B;  1WRZ A;  1X02 A;  2LMU A;  1QX2 A;  4GPL B;  4JD9 A;  3DF0 B;  2YGU A;  1Y1U A;  2KQY A;  5I94 A;  1B1G A;  1CMG A;  1IH0 A;  2L51 A;  3BUM B;  2OS8 C;  1OOI X;  5I2O A;  2L0P A;  1NX2 A;  4DUQ A;  2KI4 C;  1SSE B;  2PVB A;  1GGZ A;  1K2H A;  4AOM A;  5J3X A;  1KQV A;  1IRJ A;  3VB1 A;  4ORA B;  3IF7 A;  1A4P A;  1CNP A;  3NSK A;  2QEH A;  2TN4 A;  1YUR A;  3CAB A;  3AAK A;  3CZT X;  1G33 A;  2M8U A;  2DOQ A;  3BOW B;  3K21 A;  4IJ7 A;  2PYQ A;  2GGZ A;  2BCB A;  2WC8 A;  1UUR A;  1F55 A;  2COL B;  4GUK A;  2L5X B;  1EXR A;  2HF5 A;  2KLD A;  1TWO A;  1SY9 A;  1M63 B;  4NDB A;  1S5G Z;  3DVM A;  2M1K B;  4I5L B;  1UHK A;  1BOD A;  1TNP A;  1SRA A;  3GK1 A;  3CLN A;  1QJT A;  1DT7 B;  1MHO A;  1DQE A;  3TDU A;  1MXE A;  3PN7 B;  4GBA A;  1QIW A;  3NSO A;  4DS7 A;  3PAT A;  3BFH A;  4AQI A;  3Q8I A;  1FI5 A;  2ISD A;  1TN4 A;  1UHI A;  3OGN A;  1NX1 A;  4YI9 A;  1DF0 B;  3DYE A;  2KAX A;  1NCX A;  1RJV A;  3A8R A;  1YX8 A;  1A03 A;  5DKN A;  3BJH A;  2LV7 A;  5FI7 A;  3FIA A;  2LC5 A;  4BY4 A;  1YR5 A;  3TUY B;  5HKY A;  1IJ5 A;  1TNW A;  3L4A A;  4WQ2 A;  1C7V A;  5CSN A;  2CTN A;  3CR2 A;  1QXP A;  1QX7 A;  1CDL A;  1KFU L;  1SR6 C;  3OB1 B;  3QME A;  1QLS A;  3V2L A;  1CDN A;  1K9K A;  1C7W A;  1QAT A;  2LE9 B;  2LCP A;  5F6T A;  1WY9 A;  2JRF A;  3D0Y B;  2EGD A;  2L5Y A;  2VRG A;  3DVK A;  2HQW A;  4MBE A;  1QAS A;  3B88 A;  1NPQ A;  4NDD A;  3KF9 A;  3LCP C;  1BLQ A;  2WCM A;  2FJY A;  1MUX A;  2JTT A;  1K96 A;  2R2I A;  1OMR A;  3A4U B;  1XO5 A;  1WRL A;  3SG4 A;  2K7D A;  2M0R A;  1W9Z A;  2LM5 A;  1BR4 B;  5ER4 X;  1XFY O;  1P28 A;  2P6B B;  3I5G C;  1REC A;  1RRO A;  2CNP A;  3EKJ A;  1K94 A;  3IQO A;  2OS8 B;  1G4Y R;  1OSA A;  1S6I A;  5D7F A;  2I94 A;  4PAL A;  4BY5 A;  3EVU A;  4MZJ A;  1SKT A;  1QX5 B;  1OOJ A;  2HQ8 A;  2EC6 B;  1MWN A;  2H2K A;  4N1F A;  2AAO A;  3NSI A;  4ZCV A;  1B4C A;  2E30 A;  1E8A A;  3SG5 A;  1TNX A;  1SL7 A;  1PRW A;  1L2O B;  1CKK A;  1IQ5 A;  2BCX A;  4HSZ A;  3I5H C;  1CDP A;  2WCF A;  4DCK A;  1B8R A;  4F7F A;  1H8B A;  1WLM A;  3JVT C;  4CPV A;  3VRP A;  1AJ5 A;  1RTP 1;  3HCM A;  1XFW O;  1SNL A;  3BYA A;  4ORB B;  2MBX A;  1XYD A;  1PVA A;  1CFP A;  1OQP A;  1AK8 A;  1BJF A;  2LLS A;  5FI6 A;  2AMI A;  2D8N A;  1KFU S;  3D0Y A;  4NQG A;  2H8V A;  4MLW A;  2OTG B;  1ORG A;  1A75 A;  3PJI A;  4I5N B;  1AHR A;  2LMT A;  1XA5 A;  2MLF C;  1F54 A;  1JFJ A;  3M0W A;  3EG5 B;  2G2B A;  5JJG A;  1TOP A;  2ZN8 A;  4PE0 A;  1LVC D;  1J7P A;  1FF1 A;  2MRD A;  1SW8 A;  5G08 A;  2I7A A;  4U8D A;  3S0B A;  3WHU B;  2KYF A;  2Y5I A;  1B9A A;  2BL0 C;  5HKZ A;  2BKI B;  5KTY A;  3B6X A;  2ERB A;  3DF0 A;  1C3Y A;  1NCY A;  2JU0 A;  2ZFD A;  1M39 A;  1S5G Y;  1CM4 A;  2CBL A;  3D75 A;  3SG3 A;  1VRK A;  3I5I C;  2K60 A;  3WXA A;  1Y6W A;  1LKJ A;  5I8N A;  3OHM B;  1OE9 B;  1B8C A;  1K8U A;  1XFX O;  3AAJ A;  2F2O A;  1PK0 D;  2K8M B;  2EC6 C;  1F4O A;  1OOF A;  4PCW A;  4WRI A;  2ZN9 A;  1HT9 A;  1BOC A;  1J7Q A;  1DTL A;  3VRN A;  5BPJ A;  3K1E A;  2F3Z A;  3BUO B;  4C0J A;  1BU3 A;  2H61 C;  3L47 A;  2ZRS A;  1SL8 A;  3KO0 A;  2JNX A;  3CGA A;  1IGV A;  4UPG A;  1M45 A;  1MF8 B;  2O60 A;  3AKB A;  2AUC A;  1NSH A;  2Q91 A;  5ER5 A;  1SPY A;  2FCD A;  2JPT A;  5AFP A;  1DEL A;  4HRG A;  1AP4 A;  3UNW A;  2RGI A;  2SAS A;  2ZKM X;  5AER A;  1YUU A;  4GGN A;  2I18 A;  3O6B A;  1CLB A;  1QS7 A;  4PDZ A;  2GGM A;  1J1E A;  1B47 A;  1DVI A;  1WDC B;  1J55 A;  3DZT A;  4N5X A;  3I5G B;  2V53 A;  1TTX A;  4C0K A;  1QTX A;  1IJ6 A;  2FCE A;  4PE7 A;  2CT9 A;  1IQ3 A;  5GQQ C;  5KU1 A;  1K93 D;  1DJI A;  4C0L A;  2KI6 D;  1DGU A;  1DJW A;  1DJX A;  1K95 A;  1KWO C;  4GFT A;  3TUY C;  4MZL A;  2M3W A;  3GOF A;  1OW4 A;  2P71 A;  3R72 A;  4M2O A;  1Q80 A;  1L2O C;  3O2P A;  1CFD A;  1BG1 A;  4XJK A;  1Y1A A;  3FWB A;  5HL1 A;  1CFC A;  3VRO A;  3LK1 A;  3WNX B;  1K90 D;  3DY9 A;  3S0G A;  2LP2 A;  1T14 A;  3H4S E;  1SCM B;  5DKQ A;  1SR6 B;  3BUN B;  4A4B A;  2M7L A;  1JF2 A;  2NLN A;  1K9U A;  2M7N A;  1G8I A;  3PLF B;  1JFK A;  2KLE A;  2WCK A;  4INX A;  5CPV A;  1IG5 A;  1ODB A;  2P70 A;  3D74 A;  1JBA A;  4DIR A;  4GGF C;  3EKH A;  3EK4 A;  5KSZ A;  1TNQ A;  1DC1 A;  1R6P A;  1C07 A;  1NX3 A;  3EK8 A;  5D69 A;  4FQO A;  3LL8 B;  4PHM A;  3TZ1 A;  1J7O A;  3VRQ A;  1KQM B;  3JTD B;  1N0Y A;  1LIN A;  4MZK A;  3N7H A;  3DVE A;  5CSF A;  4YRU A;  2ZNE A;  1V1F A;  1J1D A;  3TDI A;  1BF5 A;  1KFX S;  1Y1X A;  3CR5 X;  1TUJ A;  3CZ2 A;  4GNK B;  4OVN F;  1JWD A;  3UO9 A;  2JTZ A;  1B7T Z;  4Q04 A;  4ICB A;  3SIB A;  1L7Z A;  3DD4 A;  4MVF A;  5DKR A;  2NXQ A;  1D1O A;  1AVS A;  4YGB B;  4MSP A;  5HLV A;  3RLZ A;  2LNK A;  2KBM A;  4DRW A;  2L4I A;  2ZRT A;  5AAN A;  3OBV A;  2JZI A;  1UHJ A;  1A29 A;  3LLE A;  1S1E A;  2WCH A;  2GTE A;  1M46 A;  2M97 A;  3IQQ A;  4OZD A;  1SCV A;  3VRR A;  2WND A;  1ZUZ A;  1BMO A;  3S0E A;  4QJ4 B;  3MSE B;  3L4L A;  3BQ3 A;  4JQ0 D;  2Y4Q A;  3EVR A;  3OP0 A;  2ZND A;  2KOT A;  3S0F A;  4YGC B;  1XVJ A;  2QDI A;  1SYM A;  2GV5 A;  3B87 A;  3FE6 A;  1YVH A;  3NHT A;  3D77 A;  2K7C A;  4MRX A;  3BFA A;  1B8L A;  1LA0 A;  2L98 A;  2JOJ A;  2LLT A;  2MJW B;  1YX7 A;  3PSR A;  4PE1 A;  4GAO A;  4JPZ B;  4R1E A;  5TNC A;  2WC5 A;  5I2Q A;  1KK8 B;  1WLZ A;  3NHI A;  4WQ3 A;  1B7T Y;  4N1G A;  1NUB A;  2E6W A;  1YRU B;  1S3P A;  3EK7 A;  3PFV A;  3FE9 A;  1QLK A;  1CFF A;  1CDM A;  1KK7 Y;  1OOG A;  1YUT A;  2KFF A;  1CB1 A;  1UUS A;  3DXL A;  3CTN A;  2WCE A;  3R1V A;  4PHK A;  1KK8 C;  2PSR A;  4TNC A;  4CFR A;  5IBW A;  4OCI A;  1QVI Y;  2MAZ A;  1JSA A;  3B7A A;  3CZ0 A;  2WCL A;  2PQL A;  4GGF A;  1KSM A;  2BNX A;  2QPT A;  1S6C A;  1PUL A;  2BAP A;  2L4H A;  4CFQ A;  2KDH A;  1CM1 A; 
#chains in the Genus database with same CATH homology
 4PE4 A;  2BCA A;  1DF0 A;  4MRY A;  1JUO A;  2KI4 B;  3FS7 A;  3GK2 A;  4PHJ A;  2LVK A;  2KAY A;  2L2E A;  2WCB A;  2LVI A;  1LA3 A;  2PMY A;  1J7R A;  2M1U A;  1TCO B;  5AEQ A;  2O5G A;  2K0J A;  1JC2 A;  1FI6 A;  3KHE A;  1OZO A;  1PSB A;  3I5F C;  2F2P A;  3OX5 A;  4A4C A;  2KI6 C;  1N2D A;  1HQV A;  1U5I B;  1V1G A;  1Y0V H;  1ZAC A;  1PSR A;  1XFZ O;  4YBH B;  3O78 A;  2JXC A;  3DVJ A;  3SG7 A;  2F33 A;  2IS9 A;  4FTG A;  2HET A;  2NCP A;  2I2R E;  4P2Y B;  2LUC A;  1EJ3 A;  3FWC A;  2LMV A;  4YGD B;  3SIA A;  2KBI A;  1RK9 A;  3PAL A;  3F45 A;  4YGE B;  2PRU A;  1UHH A;  1UP5 A;  4I5K A;  3LK0 A;  4M2P A;  1CLL A;  2HPS A;  2NZ0 A;  1QIV A;  2JXL A;  2K2A A;  1KQM C;  2KQ6 A;  2M9G A;  2PAL A;  3H4S E;  4OR9 B;  2JT3 A;  4JWQ A;  5K89 A;  4IL1 A;  1IWQ A;  2B1U A;  1QV0 A;  1RWY A;  4YGA A;  1YVL A;  2QAC A;  1CLM A;  3JTD C;  1FPW A;  2CCM A;  3VGO A;  1R2U A;  1ALW A;  1SCM C;  2G9B A;  1KWO B;  2JQ6 A;  1ZOT B;  2KGB C;  1WDC C;  2K7B A;  3CR4 X;  3ZNI A;  4USL A;  1F4Q A;  4XYN A;  1PVB A;  2JC2 A;  2WOS A;  2KHN A;  5CSJ A;  2PAS A;  4P5O E;  2KSP A;  2F3Y A;  1EG3 A;  1NWD A;  1TRF A;  4I5J A;  4QJ3 B;  3SG6 A;  1DJG A;  1SMG A;  2FOT A;  4F0Z B;  1SBJ A;  1SL9 A;  4OKH A;  1MXL C;  1ALV A;  2MLE C;  1OMD A;  3OB2 B;  1DMO A;  1GQM A;  2LAP A;  1OZS A;  1PAL A;  2A4J A;  1XFU O;  3NXA A;  2KNE A;  2LVV A;  2LP3 A;  2H61 A;  2KFH A;  2WOR A;  3C1V A;  1FW4 A;  1TCF A;  1A75 B;  2MA2 A;  3I5H B;  3O4Y A;  1KSO A;  4PHN A;  1LXF C;  1BT6 A;  2BE4 A;  3HX4 A;  1UHN A;  1DJY A;  5FYX A;  5JOL A;  4CLN A;  3SG2 A;  2BBM A;  4CID A;  2K7O A;  4XJK B;  3AKA A;  1ZFS A;  3CWG A;  4MN0 A;  3ZWH A;  1N65 A;  4E68 A;  4ZCU A;  1CTR A;  1GJY A;  1M31 A;  1NCZ A;  1NP8 A;  3SJS A;  1F71 A;  4MEW A;  1EG4 A;  2M49 B;  2KYC A;  1FBV A;  1OMV A;  1QVI Z;  2F8P A;  5I2L A;  1IKU A;  5CSI A;  1WRK A;  3EVV A;  1KK7 Z;  2OPO A;  1EH2 A;  2LVJ A;  4NDC A;  3PM8 A;  4HRE E;  1S26 D;  2Y1M A;  1GGW A;  1NX0 A;  1AUI B;  3D10 A;  1NYA A;  2LUX A;  1NIW A;  2SCP A;  3TS5 C;  3TS5 B;  1W7I B;  1DGV A;  4YI8 A;  2Q4U A;  5AXI A;  1YTZ C;  4ETO A;  3CS1 A;  2JUL A;  2K2F A;  2Y1N A;  1MQ1 A;  2LHL A;  2OTG C;  2FJU B;  2L50 A;  2BKH B;  2JT8 A;  1XFV O;  2M29 A;  4HRH A;  1SK6 D;  2MHH A;  2JT0 A;  3WHT B;  2BE6 A;  5HKW A;  1H4B A;  1U5I A;  1CMF A;  3NSL A;  5PAL A;  1YUS A;  2JNF A;  1S6J A;  2KFG A;  4ORC B;  5HLO A;  3KPX A;  1DJZ A;  3E3R A;  1W7J B;  2BEC A;  3ICB A;  3QRX A;  3BUW B;  1A2X A;  2JWW A;  2KAV A;  2LHI A;  1K9P A;  2LLU A;  4D1E A;  1DJH A;  2LAN A;  2EHB A;  1QV1 A;  1YRT B;  2BBN A;  1AJ4 A;  1XK4 A;  3BOW A;  4OV2 A;  3BUX B;  1S36 A;  4AQJ A;  1KFX L;  1TIZ A;  3KEV A;  1JF0 A;  2BL0 B;  1XK4 C;  5HYD A;  4L9M A;  1UWO A;  2K61 A;  3PN7 C;  3RM1 A;  4QJ5 B;  1F8H A;  3JVT B;  1EL4 A;  1MR8 A;  4M2Q A;  3GK4 X;  1RFJ A;  2CXJ A;  1BR1 B;  2KGR A;  2NCO A;  3I5F B;  3TDZ A;  1KCY A;  1ZMZ A;  3I5I B;  3OX6 A;  3BXK A;  1F70 A;  5B8I B;  1WRZ A;  1X02 A;  2LMU A;  1QX2 A;  4GPL B;  3DF0 B;  1Y1U A;  2KQY A;  1B1G A;  1IH0 A;  1CMG A;  2L51 A;  3BUM B;  2OS8 C;  5I2O A;  2L0P A;  1NX2 A;  4DUQ A;  2KI4 C;  2PVB A;  1GGZ A;  1K2H A;  4AOM A;  5J3X A;  1KQV A;  1IRJ A;  4ORA B;  3IF7 A;  1A4P A;  1CNP A;  3NSK A;  2TN4 A;  1YUR A;  3AAK A;  3CZT X;  1G33 A;  2M8U A;  2DOQ A;  3BOW B;  3K21 A;  2GGZ A;  2BCB A;  2WC8 A;  1UUR A;  1F55 A;  2COL B;  4GUK A;  2L5X B;  1EXR A;  2HF5 A;  1SY9 A;  1M63 B;  4NDB A;  1S5G Z;  3DVM A;  2M1K B;  4I5L B;  1UHK A;  1BOD A;  1TNP A;  1SRA A;  3GK1 A;  3CLN A;  1QJT A;  1DT7 B;  1MHO A;  4DS7 A;  3TDU A;  1MXE A;  3PN7 B;  4GBA A;  1QIW A;  3NSO A;  3PAT A;  4AQI A;  1FI5 A;  2ISD A;  1TN4 A;  1UHI A;  1NX1 A;  4YI9 A;  1DF0 B;  2KAX A;  1NCX A;  1RJV A;  3A8R A;  1YX8 A;  1A03 A;  5DKN A;  2LV7 A;  3FIA A;  2LC5 A;  4BY4 A;  1YR5 A;  3TUY B;  5HKY A;  1IJ5 A;  1TNW A;  4WQ2 A;  1C7V A;  5CSN A;  2CTN A;  3CR2 A;  1QXP A;  1QX7 A;  1CDL A;  1KFU L;  1SR6 C;  3OB1 B;  1QLS A;  1CDN A;  1K9K A;  1C7W A;  1QAT A;  2LE9 B;  2LCP A;  5F6T A;  1WY9 A;  2JRF A;  3D0Y B;  2EGD A;  2VRG A;  3DVK A;  2HQW A;  4MBE A;  1QAS A;  1NPQ A;  4NDD A;  3KF9 A;  3LCP C;  1BLQ A;  1MUX A;  2JTT A;  1K96 A;  2R2I A;  1OMR A;  3A4U B;  1XO5 A;  1WRL A;  3SG4 A;  2K7D A;  2M0R A;  2LM5 A;  1BR4 B;  5ER4 X;  1XFY O;  2P6B B;  3I5G C;  1REC A;  1RRO A;  2CNP A;  3EKJ A;  1K94 A;  3IQO A;  2OS8 B;  1G4Y R;  1OSA A;  1S6I A;  5D7F A;  2I94 A;  4PAL A;  4BY5 A;  3EVU A;  4MZJ A;  1SKT A;  1QX5 B;  1OOJ A;  2HQ8 A;  2EC6 B;  1MWN A;  2H2K A;  4N1F A;  2AAO A;  3NSI A;  4ZCV A;  1B4C A;  2E30 A;  1E8A A;  3SG5 A;  1TNX A;  1SL7 A;  1PRW A;  1L2O B;  1CKK A;  1IQ5 A;  2BCX A;  4HSZ A;  3I5H C;  1CDP A;  2WCF A;  4DCK A;  1B8R A;  1H8B A;  1WLM A;  3JVT C;  4CPV A;  3VRP A;  1AJ5 A;  1RTP 1;  3HCM A;  1XFW O;  1SNL A;  3BYA A;  4ORB B;  2MBX A;  1XYD A;  1PVA A;  1CFP A;  1OQP A;  1AK8 A;  1BJF A;  2LLS A;  2AMI A;  2D8N A;  1KFU S;  3D0Y A;  4NQG A;  4MLW A;  2OTG B;  1A75 A;  4I5N B;  1AHR A;  2LMT A;  1XA5 A;  2MLF C;  1F54 A;  1JFJ A;  3M0W A;  2G2B A;  5JJG A;  1TOP A;  2ZN8 A;  4PE0 A;  1LVC D;  1J7P A;  1FF1 A;  2MRD A;  1SW8 A;  5G08 A;  2I7A A;  4U8D A;  3WHU B;  2KYF A;  2Y5I A;  1B9A A;  2BL0 C;  2BKI B;  5KTY A;  3DF0 A;  1NCY A;  2JU0 A;  2ZFD A;  1M39 A;  1S5G Y;  1CM4 A;  2CBL A;  3SG3 A;  1VRK A;  3I5I C;  3WXA A;  1Y6W A;  1LKJ A;  5I8N A;  3OHM B;  1OE9 B;  1B8C A;  1K8U A;  1XFX O;  3AAJ A;  2F2O A;  1PK0 D;  2K8M B;  2EC6 C;  1F4O A;  4PCW A;  4WRI A;  1J7Q A;  2ZN9 A;  1HT9 A;  1BOC A;  1DTL A;  3VRN A;  5BPJ A;  2F3Z A;  3BUO B;  4C0J A;  1BU3 A;  2H61 C;  2ZRS A;  1SL8 A;  3KO0 A;  2JNX A;  3CGA A;  1IGV A;  4UPG A;  1M45 A;  1MF8 B;  2O60 A;  3AKB A;  2AUC A;  1NSH A;  2Q91 A;  5ER5 A;  1SPY A;  2FCD A;  2JPT A;  5AFP A;  4HRG A;  1AP4 A;  2RGI A;  2SAS A;  2ZKM X;  5AER A;  1YUU A;  4GGN A;  2I18 A;  3O6B A;  1CLB A;  1QS7 A;  2GGM A;  1J1E A;  1B47 A;  1DVI A;  1WDC B;  1J55 A;  4N5X A;  3I5G B;  2V53 A;  1TTX A;  4C0K A;  1QTX A;  1IJ6 A;  2FCE A;  4PE7 A;  2CT9 A;  1IQ3 A;  5GQQ C;  5KU1 A;  1K93 D;  1DJI A;  4C0L A;  2KI6 D;  1DGU A;  1DJW A;  1DJX A;  1K95 A;  1KWO C;  4GFT A;  3TUY C;  4MZL A;  2M3W A;  3GOF A;  4M2O A;  1Q80 A;  1L2O C;  3O2P A;  1CFD A;  1BG1 A;  4XJK A;  1Y1A A;  3FWB A;  1CFC A;  3VRO A;  3LK1 A;  3WNX B;  1K90 D;  2LP2 A;  1SCM B;  5DKQ A;  1SR6 B;  3BUN B;  4A4B A;  2M7L A;  1JF2 A;  2NLN A;  1K9U A;  2M7N A;  1G8I A;  3PLF B;  1JFK A;  5HKZ A;  5CPV A;  1IG5 A;  1ODB A;  1JBA A;  4DIR A;  4GGF C;  3EKH A;  3EK4 A;  5KSZ A;  1TNQ A;  1R6P A;  1C07 A;  1NX3 A;  3EK8 A;  5D69 A;  4FQO A;  3LL8 B;  4PHM A;  3TZ1 A;  1J7O A;  3VRQ A;  1KQM B;  3JTD B;  1N0Y A;  1LIN A;  4MZK A;  3DVE A;  5CSF A;  4YRU A;  2ZNE A;  1V1F A;  1J1D A;  3TDI A;  1BF5 A;  1KFX S;  1Y1X A;  3CR5 X;  4GNK B;  4OVN F;  1JWD A;  2JTZ A;  1B7T Z;  4Q04 A;  4ICB A;  3SIB A;  1L7Z A;  3DD4 A;  4MVF A;  5DKR A;  2NXQ A;  1D1O A;  1AVS A;  4YGB B;  4MSP A;  5HLV A;  3RLZ A;  2LNK A;  2KBM A;  4DRW A;  2L4I A;  2ZRT A;  5AAN A;  2JZI A;  1UHJ A;  1A29 A;  3LLE A;  1S1E A;  1M46 A;  2M97 A;  3IQQ A;  1SCV A;  3VRR A;  2WND A;  1ZUZ A;  1BMO A;  4QJ4 B;  3MSE B;  3BQ3 A;  4JQ0 D;  2Y4Q A;  3EVR A;  3OP0 A;  2ZND A;  2KOT A;  4YGC B;  1XVJ A;  1SYM A;  2GV5 A;  1YVH A;  2K7C A;  4MRX A;  1B8L A;  1LA0 A;  2L98 A;  2JOJ A;  2LLT A;  2MJW B;  1YX7 A;  3PSR A;  4PE1 A;  4GAO A;  4JPZ B;  4R1E A;  5TNC A;  5I2Q A;  1KK8 B;  1WLZ A;  4WQ3 A;  1B7T Y;  4N1G A;  1NUB A;  2E6W A;  1YRU B;  1S3P A;  3EK7 A;  3PFV A;  1QLK A;  1CFF A;  1CDM A;  1KK7 Y;  1YUT A;  2KFF A;  1CB1 A;  1UUS A;  4CFR A;  3CTN A;  2WCE A;  4PHK A;  1KK8 C;  2PSR A;  4TNC A;  5IBW A;  1JSA A;  4OCI A;  1QVI Y;  2MAZ A;  4GGF A;  1KSM A;  2QPT A;  1S6C A;  1PUL A;  4PDZ A;  2L4H A;  4CFQ A;  2KDH A;  1CM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...