1DTLA

Crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
149
Chain Sequence
b'YKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKKSEEELSDLFRMFDKNADGYIDLEELKIMLQATTITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC TROPONIN C
publication title Bepridil opens the regulatory N-terminal lobe of cardiac troponin C.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 53
structure length 149
sequence length 156
ec nomenclature
pdb deposition date 2000-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA02
1AUIB 1K96A 2KOTA 4CFQA 1MQ1A 1CLLA 1OE9B 2JWWA 2WORA 1PRWA 3D0YB 3PATA 1QVIZ 1KWOB 2OS8C 2M3WA 4PHNA 1IJ6A 4OCIA 2LMVA 1SCVA 1QLSA 2PRUA 1DF0A 3KPXA 4WRIA 1XYDA 1IJ5A 2NZ0A 1ZFSA 4NDCA 3KHEA 2JTZA 1F55A 4GGFC 1BMOA 4JQ0D 2KYFA 1GGZA 2JU0A 3KF9A 5I2QA 3FWBA 1J7PA 1YUTA 3I5FC 1QS7A 1GQMA 1JF0A 3BUXB 5DKRA 1XFWO 4MEWA 4MSPA 3BOWB 1K90D 4Q04A 1QLKA 3D0YA 3TDZA 5CSIA 1QVIY 2GV5A 2BE4A 3D10A 3JVTB 2BKHB 2K2AA 4ORCB 1JSAA 4XJKB 3VRNA 3GOFA 5AXIA 2MBXA 3TDUA 1KK8C 3MSEB 1ALVA 4MZKA 2DOQA 2JXLA 3BUMB 4BY5A 1FF1A 1KSMA 1G8IA 2KFFA 1U5IB 4PHKA 1DJGA 1A75A 1L2OC 2VRGA 2L2EA 1DMOA 4JWQA 3EVRA 1N65A 1S5GZ 2F33A 1J55A 5TNCA 1QIWA 1TRFA 1DGVA 1Y1UA 2KYCA 2L98A 3DVJA 1R6PA 2KGRA 4MBEA 2F2PA 1DGUA 3PALA 1SL8A 1CM4A 1CFPA 1B8RA 4YGAA 2JPTA 3SG5A 3I5FB 3SIBA 2FCEA 2K7OA 4N1FA 1HT9A 4HREE 2LMUA 1XK4A 5HKWA 4QJ4B 3OHMB 2LVKA 4USLA 1K2HA 4GUKA 3AAJA 2WCFA 3HX4A 2BBMA 1YVHA 1BLQA 1QIVA 1S5GY 2MA2A 1QXPA 3OX5A 3WNXB 4DUQA 2A4JA 1FW4A 4QJ3B 1J1EA 2E30A 4YI9A 1NCXA 2R2IA 1SCMC 1ZOTB 2K0JA 3AKAA 4ZCVA 2M0RA 3VRRA 3JTDC 4A4CA 3BUOB 2PSRA 5D69A 3GK4X 2LLTA 2M1UA 1S36A 4PCWA 1L2OB 1OZSA 4UPGA 4GFTA 4E68A 3EVUA 4BY4A 5J3XA 1D1OA 4PHMA 2JTTA 1OQPA 1YURA 3BUNB 4C0KA 1V1FA 1OZOA 1ZMZA 2MJWB 3I5IC 1PVAA 5GQQC 1NX1A 3AAKA 4PE7A 1SL9A 1IQ3A 2M1KB 1CM1A 1RK9A 1CMFA 4M2PA 1NSHA 2WOSA 1MR8A 1BT6A 1KSOA 4ZCUA 4FQOA 5DKNA 1B9AA 3BQ3A 2H61C 2K7DA 4TNCA 1BR1B 2ZN9A 2L51A 5AANA 1YUSA 1H4BA 2CBLA 5I8NA 3DD4A 1F54A 1S6CA 2WC8A 2OTGB 2P6BB 3GK2A 1N0YA 2ZNDA 4YI8A 4DCKA 1YVLA 4M2QA 2ZRSA 1M31A 1QX7A 5I2OA 4PE1A 1BG1A 1OOJA 1X02A 2M97A 3WHUB 4AOMA 3VRPA 1V1GA 2LUXA 3FS7A 1TNWA 2HF5A 2F3YA 4YBHB 2M49B 1ODBA 1TN4A 1TOPA 1K8UA 1WRKA 4P5OE 3JTDB 2OPOA 3EVVA 3QRXA 2L5XB 2KQ6A 4ETOA 1DJIA 2L0PA 4OV2A 1A4PA 2Q4UA 1IQ5A 1DJWA 1BODA 5D7FA 3I5IB 1UUSA 1CDPA 1XFYO 1Y1AA 5AFPA 5JJGA 5HYDA 1UHNA 4L9MA 3E3RA 1KFUS 2L4IA 2AAOA 4YGEB 2KGBC 1Q80A 2PALA 2V53A 3NSIA 1SMGA 1RECA 1XFVO 1OMVA 1QV0A 3EK4A 3EK8A 4F0ZB 1TNPA 3BYAA 2M8UA 1NCZA 2Y4QA 4MVFA 1WLZA 1JFJA 1M39A 1WDCC 5CPVA 5CSFA 5HLVA 2HETA 2I18A 3LL8B 2AMIA 1TIZA 2JQ6A 2Y1NA 3IF7A 1TNQA 5FYXA 4MLWA 3CR2A 4N1GA 2JXCA 2RGIA 1F70A 4NDBA 1K93D 3NSLA 1JC2A 2KI6D 3DVKA 1KFXS 3TDIA 1JBAA 1PSRA 1B4CA 1J1DA 1KQMC 1MXEA 5AEQA 2LLSA 2EHBA 2JOJA 2KDHA 3I5HC 4I5NB 1CTRA 4PE0A 3DF0B 1VRKA 1F8HA 2Y1MA 1ZUZA 1SR6C 1C7WA 1QX5B 2M29A 3DVMA 4PHJA 1LKJA 2KAXA 3OB1B 1DJZA 1NWDA 1IKUA 1B47A 1F4OA 2KFGA 1PALA 1DJYA 2LVJA 2OS8B 3TS5C 3BOWA 1QX2A 1CDLA 1K94A 2ZFDA 1UHJA 3OP0A 1YR5A 1BF5A 2BECA 1PULA 5HKYA 1BOCA 5HLOA 4XJKA 3OX6A 1RWYA 2JC2A 3CS1A 1L7ZA 1NPQA 1SNLA 3PN7C 1WDCB 2KHNA 3PM8A 2BL0C 1TTXA 4CIDA 1J7QA 1U5IA 1YX7A 5BPJA 4GGNA 1CFCA 2LC5A 1LA3A 2CNPA 1CNPA 1AVSA 2K7BA 4ICBA 2PVBA 2K61A 3EKHA 5JOLA 1NYAA 1E8AA 1FBVA 3C1VA 1KQMB 2CTNA 1GGWA 1UURA 2I94A 3I5HB 4GBAA 2G9BA 4OVNF 2LP2A 3O2PA 3O78A 1KK8B 4GGFA 1SR6B 1M63B 1OSAA 1NX3A 2F3ZA 1G4YR 1KQVA 2PMYA 2JT8A 3FIAA 1KK7Z 4CLNA 3NXAA 3PLFB 2H2KA 2GGZA 3CLNA 2SCPA 4M2OA 1A03A 1J7OA 4U8DA 1AJ5A 3TS5B 2ZKMX 4IL1A 4PALA 2HQ8A 3IQOA 2BCXA 4CPVA 5KTYA 2QPTA 3GK1A 3CWGA 3SJSA 1K9UA 2B1UA 2LM5A 2MRDA 3ZNIA 1RFJA 1SKTA 2E6WA 1AJ4A 3PN7B 1YRUB 2BL0B 2COLB 4WQ3A 1B1GA 1LINA 3M0WA 1A29A 1KK7Y 2F2OA 4MRYA 2TN4A 1CFDA 1WRLA 3WXAA 1CMGA 1F71A 3ZWHA 4FTGA 1GJYA 1ALWA 2KI4C 1SBJA 5KSZA 2JZIA 1DTLA 1IG5A 1PVBA 4AQIA 1W7IB 1JUOA 1SCMB 1KCYA 2NCOA 2G2BA 1EG3A 1FI5A 3CTNA 2HQWA 2KAYA 2KQYA 4JPZB 3A8RA 1EXRA 1TCFA 4ORBB 3TZ1A 4D1EA 5ER4X 4NQGA 1DF0B 2FOTA 2WNDA 2LE9B 2KSPA 1XVJA 3F45A 4PE4A 1H8BA 4MN0A 1EJ3A 4GPLB 5HKZA 4HSZA 2ZN8A 3LK1A 1QTXA 1S26D 2LVIA 3K21A 1RROA 4OKHA 1F4QA 1YRTB 2LLUA 1EL4A 1UHKA 1XFUO 2LCPA 2MLEC 5DKQA 3SG2A 3EKJA 4DRWA 3VRQA 3TUYC 1UHIA 1AHRA 2D8NA 2LHIA 3I5GC 4YGBB 3CZTX 1XK4C 2LUCA 1WLMA 1CLBA 3SG6A 1J7RA 3RM1A 3SIAA 2I2RE 2O5GA 3CGAA 1JFKA 1UP5A 1XFZO 2M9GA 2CCMA 2K7CA 3CR5X 3O4YA 4N5XA 2ISDA 2KI4B 2LMTA 1YX8A 2NCPA 1K95A 1K9KA 4I5LB 1BU3A 2F8PA 3BUWB 3H4SE 2KNEA 4HRGA 1ZACA 2IS9A 2MHHA 1CFFA 5AERA 1UHHA 1K9PA 2L50A 3OB2B 3PFVA 2H61A 2JT0A 1DJXA 1LXFC 1A75B 2JT3A 3BXKA 1DVIA 3DVEA 1NX2A 1UWOA 4WQ2A 4DS7A 5CSNA 2QACA 2O60A 3LK0A 4GAOA 2M7LA 2WCBA 1PSBA 1CKKA 2Y5IA 3SG3A 4DIRA 4AQJA 1EG4A 2SASA 2KAVA 2GGMA 2K8MB 1S3PA 3DF0A 1S6JA 2JULA 2LAPA 2KI6C 3TUYB 3FWCA 1QJTA 2M7NA 3I5GB 1TNXA 2BCBA 4OR9B 1CDMA 1XA5A 3EK7A 3CR4X 4C0LA 1N2DA 1RJVA 3A4UB 1S6IA 2I7AA 1BR4B 2LVVA 1JWDA 5I2LA 3WHTB 2Q91A 2AUCA 1PK0D 1EH2A 1MHOA 2BCAA 2FJUB 2K2FA 1B8LA 2PASA 1NIWA 1XO5A 3RLZA 4YRUA 3IQQA 4I5KA 2BBNA 1QATA 3HCMA 2EC6C 4ORAB 1IWQA 2KFHA 5K89A 1SW8A 2KBMA 5PALA 1R2UA 4XYNA 2JRFA 1FI6A 1OMRA 1FPWA 1SYMA 2FCDA 2ZNEA 3ICBA 1JF2A 3NSKA 1MF8B 4MRXA 4C0JA 2LANA 1LA0A 2CT9A 5ER5A 3SG4A 1KFUL 2L4HA 3SG7A 1QV1A 1SL7A 2OTGC 1CLMA 2MAZA 2NLNA 4HRHA 1B7TZ 1SRAA 2CXJA 1NX0A 4MZJA 2BE6A 1G33A 4R1EA 4CFRA 2MLFC 2EGDA 4NDDA 2JNXA 1IGVA 2HPSA 1RTP1 5CSJA 3PSRA 3LCPC 4MZLA 4YGDB 2ZRTA 1KFXL 5B8IB 1KWOC 1OMDA 2NXQA 4P2YB 1DT7B 1Y1XA 1A2XA 1XFXO 1C7VA 1IH0A 1SY9A 1AP4A 1HQVA 1MXLC 2LNKA 1B8CA 1NP8A 3VROA 1CDNA 1MWNA 1Y0VH 1IRJA 2LP3A 2EC6B 1B7TY 1CB1A 1SPYA 4YGCB 1W7JB 4I5JA 1QASA 4GNKB 2LHLA 3KEVA 1NCYA 1SK6D 1AK8A 1WRZA 5G08A 1M45A 1YTZC 2JNFA 2WCEA 2BKIB 2KBIA 3VGOA 4QJ5B 1BJFA 5IBWA 1WY9A 1YUUA 2LV7A 3O6BA 4A4BA 5F6TA 3JVTC 4PDZA 1S1EA 5KU1A 1MUXA 3LLEA 1NUBA 1M46A 3AKBA 1C07A 3NSOA 1Y6WA 1DJHA 1TCOB 1LVCD 3KO0A
chains in the Genus database with same CATH superfamily
1AUIB 1K96A 1W9ZA 2KOTA 4CFQA 1MQ1A 1CLLA 1OE9B 2JWWA 2WORA 1PRWA 3D0YB 3PATA 5FI2A 1QVIZ 1KWOB 2OS8C 2M3WA 4PHNA 1IJ6A 2PQLA 4OCIA 2LMVA 1SCVA 1QLSA 2PRUA 1DF0A 3FE8A 3KPXA 4WRIA 1XYDA 1IJ5A 1QWVA 2NZ0A 1ZFSA 4NDCA 2FJYA 3KHEA 2JTZA 1F55A 4GGFC 1BMOA 4JQ0D 2KYFA 1GGZA 2JU0A 3KF9A 5I2QA 2L2CA 3FWBA 1J7PA 3D74A 1YUTA 3I5FC 1QS7A 1GQMA 1JF0A 3BUXB 5DKRA 1XFWO 4MEWA 4MSPA 3CZ1A 3UNWA 3BOWB 1K90D 4Q04A 1QLKA 3D0YA 3NHIA 2BAPA 3BFBA 3TDZA 2ERBA 5CSIA 3CZ2A 1QVIY 2GV5A 2BE4A 3D10A 3D73A 3JVTB 2BKHB 2K2AA 2QEBA 4IJ7A 4ORCB 1JSAA 1LS8A 4XJKB 3VRNA 3GOFA 5AXIA 2MBXA 3TDUA 3R72A 1KK8C 3MSEB 1ALVA 4MZKA 2DOQA 2JXLA 3NGVA 3BUMB 4BY5A 1FF1A 1KSMA 1G8IA 2KFFA 1U5IB 4PHKA 1DJGA 1A75A 1L2OC 2VRGA 2L2EA 3L47A 4JWQA 1DMOA 3EVRA 1N65A 1S5GZ 1TUZA 2F33A 1J55A 4JKTA 1QIWA 1TRFA 5TNCA 1DGVA 1Y1UA 2KYCA 3OGNA 2L98A 2BNXA 2QEOA 3DVJA 1R6PA 2KGRA 3D78A 4MBEA 2F2PA 1DGUA 3PALA 1SL8A 1CM4A 3PM2A 1B8RA 1CFPA 4YGAA 2JPTA 3SG5A 3D77A 3I5FB 3CDNA 3SIBA 2KPHA 2FCEA 2K7OA 4N1FA 1HT9A 4HREE 2LMUA 1XK4A 5HKWA 4QJ4B 3OHMB 2LVKA 4USLA 1K2HA 4GUKA 3AAJA 2WCFA 3HX4A 2BBMA 1YVHA 1BLQA 1QIVA 1S5GY 2MA2A 1QXPA 3OX5A 3WNXB 4DUQA 2A4JA 1FW4A 4QJ3B 2YGUA 1J1EA 2E30A 4YI9A 2WCKA 1NCXA 2R2IA 3VB1A 1SCMC 1ZOTB 2K0JA 3AKAA 3BFHA 4ZCVA 2M0RA 3VRRA 3JTDC 4A4CA 3BUOB 2PSRA 5D69A 3GK4X 2LLTA 2M1UA 1S36A 4PCWA 1L2OB 1OZSA 4UPGA 4GFTA 2GTEA 3EVUA 4BY4A 4E68A 5J3XA 1D1OA 4PHMA 2JTTA 1OQPA 1YURA 3BUNB 4C0KA 1V1FA 1OZOA 1ZMZA 2MJWB 3I5IC 1PVAA 5GQQC 1NX1A 3N7HA 3AAKA 4PE7A 1SL9A 1IQ3A 2M1KB 1CM1A 3CYZA 1RK9A 1CMFA 4M2PA 1NSHA 2WOSA 1MR8A 1DEKA 1BT6A 1KSOA 4ZCUA 3SS4A 4FQOA 5DKNA 1B9AA 3BQ3A 2H61C 2K7DA 4TNCA 3S0EA 3D76A 3R1OA 1BR1B 2ZN9A 2L51A 5AANA 1YUSA 1IIOA 1H4BA 2CBLA 5I8NA 1P28A 3DD4A 1F54A 1S6CA 2WC8A 2OTGB 2P6BB 3GK2A 1N0YA 2ZNDA 4YI8A 4DCKA 1OOFA 1YVLA 3DY9A 2ZRSA 1M31A 1QX7A 4M2QA 3SS5A 4PE1A 5I2OA 1BG1A 1OOJA 1X02A 2M97A 3WHUB 4AOMA 3VRPA 1V1GA 2LUXA 3FS7A 1TNWA 2HF5A 2F3YA 5D3OA 4YBHB 2M49B 1ODBA 1TN4A 1TOPA 1K8UA 1WRKA 3PJIA 4P5OE 3JTDB 2OPOA 3EVVA 3QRXA 2L5XB 2KQ6A 2L5YA 4ETOA 1DJIA 2L0PA 4OV2A 1A4PA 2Q4UA 1T14A 1IQ5A 1DJWA 1BODA 5D7FA 3I5IB 1UUSA 1CDPA 1XFYO 1Y1AA 5AFPA 5JJGA 5HYDA 1XFRA 1UHNA 4L9MA 3E3RA 1KFUS 2L4IA 2AAOA 4YGEB 2KGBC 1Q80A 2PALA 2V53A 3NSIA 1SMGA 1RECA 1XFVO 1OMVA 1QV0A 3EK4A 3EK8A 4F0ZB 3S0BA 3S0AA 1TNPA 3BYAA 2M8UA 1NCZA 2Y4QA 4MVFA 1WLZA 1JFJA 1M39A 1WDCC 3EG5B 5CPVA 5CSFA 5HLVA 3K1EA 2HETA 2I18A 3LL8B 2AMIA 1TIZA 2JQ6A 2Y1NA 3IF7A 1TNQA 3L4LA 5FYXA 4MLWA 3CR2A 4N1GA 2JXCA 2RGIA 1F70A 4NDBA 1K93D 3NSLA 1C3YA 2KI6D 3DVKA 1KFXS 3TDIA 1JC2A 1JBAA 1PSRA 3DYEA 1B4CA 1C3ZA 1J1DA 1KQMC 1MXEA 2LLSA 2EHBA 2JOJA 2QEVA 5AEQA 5HL1A 2KDHA 3I5HC 4I5NB 1CTRA 4PE0A 3DF0B 1VRKA 1F8HA 2Y1MA 1ZUZA 1SR6C 1C7WA 1QX5B 2M29A 3DVMA 4PHJA 1LKJA 2KAXA 3OB1B 1DJZA 1NWDA 1IKUA 1B47A 1F4OA 2KFGA 1PALA 3D75A 3FE9A 1DJYA 2KLEA 2LVJA 2OS8B 3TS5C 3BOWA 1QX2A 1CDLA 1K94A 1TUJA 2ZFDA 1UHJA 3NHTA 3OP0A 1YR5A 1BF5A 2BECA 2P71A 1PULA 5HKYA 1BOCA 5HLOA 4XJKA 3OX6A 1RWYA 3DZTA 2JC2A 3CS1A 1L7ZA 1NPQA 1SNLA 3PN7C 1WDCB 2KHNA 3PM8A 2BL0C 3R1PA 4INXA 3OBVA 1SSEB 1TTXA 1DC1A 4CIDA 1J7QA 5EL2A 1U5IA 1YX7A 5BPJA 4GGNA 5I94A 1CFCA 2LC5A 1LA3A 2CNPA 1CNPA 1AVSA 2K7BA 4ICBA 2KLDA 2PVBA 2K61A 3EKHA 5JOLA 1NYAA 1E8AA 1FBVA 3C1VA 1KQMB 2CTNA 1GGWA 1UURA 2I94A 3I5HB 4GBAA 2G9BA 4OVNF 4FQTA 2LP2A 3O2PA 3O78A 1KK8B 4GGFA 1SR6B 1TWOA 1M63B 1OSAA 3S0DA 1NX3A 2F3ZA 1G4YR 3BJHA 1KQVA 2PMYA 3BFAA 2JT8A 3FIAA 1KK7Z 3DXLA 3CABA 4CLNA 3NXAA 3PLFB 2H2KA 2GGZA 3CLNA 2SCPA 4M2OA 1A03A 1J7OA 4U8DA 1AJ5A 3TS5B 2ZKMX 5DICA 4IL1A 4PALA 2HQ8A 3IQOA 4JD9A 4PT1A 2BCXA 3FE6A 4CPVA 2H8VA 5KTYA 2QPTA 3GK1A 3CWGA 3SJSA 1K9UA 2B1UA 2LM5A 2MRDA 3ZNIA 1RFJA 1SKTA 2E6WA 1AJ4A 3PN7B 1YRUB 2BL0B 2COLB 4WQ3A 1B1GA 1LINA 3M0WA 1DQEA 2JPOA 1A29A 1KK7Y 2F2OA 4MRYA 2TN4A 1CFDA 1WRLA 3WXAA 1CMGA 1F71A 3ZWHA 2WCJA 1OW4A 4FTGA 1GJYA 1ALWA 5FI7A 2KI4C 1SBJA 5KSZA 2JZIA 2WC5A 3SS3A 1DTLA 1IG5A 2WCHA 1PVBA 4AQIA 1W7IB 1JUOA 1SCMB 1KCYA 2NCOA 2G2BA 1EG3A 1FI5A 3Q8IA 3CTNA 2HQWA 2KAYA 2KQYA 4JPZB 3A8RA 1EXRA 1TCFA 4ORBB 3TZ1A 4D1EA 5ER4X 4NQGA 1DF0B 2FOTA 2WNDA 2LE9B 2KSPA 1XVJA 3F45A 1ORGA 4PE4A 1H8BA 3B88A 4MN0A 1EJ3A 4GPLB 5HKZA 4HSZA 2ZN8A 3LK1A 1QTXA 1S26D 2LVIA 3K21A 1RROA 4OKHA 1F4QA 1YRTB 2LLUA 1EL4A 2K60A 1UHKA 1XFUO 2LCPA 2MLEC 5DKQA 3SG2A 3EKJA 4DRWA 3VRQA 3TUYC 1UHIA 1AHRA 2D8NA 2LHIA 3I5GC 4YGBB 3CZTX 1XK4C 2LUCA 1WLMA 1CLBA 3SG6A 1J7RA 3RM1A 3SIAA 2I2RE 2O5GA 3CGAA 1JFKA 1UP5A 1XFZO 2M9GA 1OOHA 4INWA 2CCMA 2K7CA 3CR5X 3O4YA 3CZ0A 4N5XA 2ISDA 2KI4B 2LMTA 1YX8A 2NCPA 1K95A 1K9KA 4I5LB 1BU3A 3O4XA 2F8PA 3BUWB 3H4SE 2KNEA 4HRGA 1ZACA 2IS9A 2MHHA 1CFFA 5AERA 1UHHA 1K9PA 2L50A 3OB2B 3PFVA 2H61A 2JT0A 1DJXA 1LXFC 1A75B 1DELA 2JT3A 3BXKA 1DVIA 3DVEA 3S0FA 1NX2A 1UWOA 4WQ2A 4DS7A 5CSNA 2QACA 2O60A 3LK0A 4GAOA 2M7LA 2WCBA 1PSBA 1CKKA 2Y5IA 3SG3A 4DIRA 4AQJA 1EG4A 3R1VA 2SASA 2KAVA 2GGMA 2K8MB 1S3PA 3B7AA 3DF0A 1S6JA 2JULA 2LAPA 2KI6C 3QMEA 3TUYB 3FWCA 1QJTA 2M7NA 3I5GB 1TNXA 2BCBA 4OR9B 1CDMA 1XA5A 2QDIA 2WCMA 3CR4X 3EK7A 4C0LA 1GM0A 1N2DA 1RJVA 3A4UB 1S6IA 2I7AA 1BR4B 2LVVA 1JWDA 5I2LA 3WHTB 2Q91A 2AUCA 1PK0D 1EH2A 1MHOA 2BCAA 2FJUB 2K2FA 1B8LA 2PASA 1NIWA 5FI6A 1XO5A 2WC6A 3RZSA 3RLZA 3S0GA 4YRUA 3IQQA 4I5KA 2BBNA 1QATA 3HCMA 2EC6C 4ORAB 1IWQA 2KFHA 4F7FA 5K89A 1SW8A 2PYQA 2KBMA 5PALA 1R2UA 4XYNA 3V2LA 2JRFA 1FI6A 1OMRA 1FPWA 1SYMA 2FCDA 2ZNEA 3ICBA 1JF2A 3NSKA 1MF8B 4MRXA 4C0JA 2LANA 1LA0A 2CT9A 5ER5A 3SG4A 1KFUL 2L4HA 3SG7A 1QV1A 1SL7A 2OTGC 1CLMA 2MAZA 1Z4HA 2NLNA 4HRHA 1B7TZ 1SRAA 2CXJA 1NX0A 4MZJA 2BE6A 1G33A 4R1EA 4CFRA 2MLFC 2QEHA 2EGDA 3B86A 4NDDA 2JNXA 1IGVA 2HPSA 1RTP1 5CSJA 3PSRA 3LCPC 4MZLA 3UO9A 4YGDB 2ZRTA 1KFXL 5B8IB 1KWOC 1OMDA 2NXQA 2WCLA 4P2YB 1OOIX 1A2XA 1Y1XA 1DT7B 1OOGA 1XFXO 3L4AA 2P70A 1C7VA 1IH0A 1SY9A 1AP4A 1HQVA 1MXLC 2LNKA 1B8CA 1NP8A 3VROA 1CDNA 1MWNA 1Y0VH 1IRJA 2LP3A 2EC6B 1B7TY 3B87A 1CB1A 1SPYA 1Z2CB 4YGCB 1W7JB 4I5JA 1QASA 4GNKB 2LHLA 3KEVA 1NCYA 1SK6D 1AK8A 1WRZA 5G08A 3B6XA 1M45A 1YTZC 2JNFA 2WCEA 2BKIB 2KBIA 3VGOA 4QJ5B 1BJFA 5IBWA 1WY9A 1YUUA 2LV7A 3O6BA 4A4BA 5F6TA 3JVTC 4OZDA 4PDZA 1S1EA 4KYNA 5KU1A 3IVTA 1MUXA 3LLEA 1NUBA 1M46A 3AKBA 1C07A 3NSOA 1Y6WA 1DJHA 1TCOB 1LVCD 3KO0A
chains in the Genus database with same CATH topology
1AUIB 1K96A 2KOTA 4CFQA 1MQ1A 1CLLA 1OE9B 2JWWA 2WORA 1PRWA 3D0YB 3PATA 1QVIZ 1KWOB 2OS8C 2M3WA 4PHNA 1IJ6A 4OCIA 2LMVA 1SCVA 1QLSA 2PRUA 1DF0A 3KPXA 4WRIA 1XYDA 1IJ5A 2NZ0A 1ZFSA 4NDCA 3KHEA 2JTZA 1F55A 4GGFC 1BMOA 4JQ0D 2KYFA 1GGZA 2JU0A 3KF9A 5I2QA 3FWBA 1J7PA 1YUTA 3I5FC 1QS7A 1GQMA 1JF0A 3BUXB 5DKRA 1XFWO 4MEWA 4MSPA 3BOWB 1K90D 4Q04A 1QLKA 3D0YA 3TDZA 5CSIA 1QVIY 2GV5A 2BE4A 3D10A 3JVTB 2BKHB 2K2AA 4ORCB 1JSAA 4XJKB 3VRNA 3GOFA 5AXIA 2MBXA 3TDUA 1KK8C 3MSEB 1ALVA 4MZKA 2DOQA 2JXLA 3BUMB 4BY5A 1FF1A 1KSMA 1G8IA 2KFFA 1U5IB 4PHKA 1DJGA 1A75A 1L2OC 2VRGA 2L2EA 1DMOA 4JWQA 3EVRA 1N65A 1S5GZ 2F33A 1J55A 5TNCA 1QIWA 1TRFA 1DGVA 1Y1UA 2KYCA 2L98A 3DVJA 1R6PA 2KGRA 4MBEA 2F2PA 1DGUA 3PALA 1SL8A 1CM4A 1CFPA 1B8RA 4YGAA 2JPTA 3SG5A 3I5FB 3SIBA 2FCEA 2K7OA 4N1FA 1HT9A 4HREE 2LMUA 1XK4A 5HKWA 4QJ4B 3OHMB 2LVKA 4USLA 1K2HA 4GUKA 3AAJA 2WCFA 3HX4A 2BBMA 1YVHA 1BLQA 1QIVA 1S5GY 2MA2A 1QXPA 3OX5A 3WNXB 4DUQA 2A4JA 1FW4A 4QJ3B 1J1EA 2E30A 4YI9A 1NCXA 2R2IA 1SCMC 1ZOTB 2K0JA 3AKAA 4ZCVA 2M0RA 3VRRA 3JTDC 4A4CA 3BUOB 2PSRA 5D69A 3GK4X 2LLTA 2M1UA 1S36A 4PCWA 1L2OB 1OZSA 4UPGA 4GFTA 4E68A 3EVUA 4BY4A 5J3XA 1D1OA 4PHMA 2JTTA 1OQPA 1YURA 3BUNB 4C0KA 1V1FA 1OZOA 1ZMZA 2MJWB 3I5IC 1PVAA 5GQQC 1NX1A 3AAKA 4PE7A 1SL9A 1IQ3A 2M1KB 1CM1A 1RK9A 1CMFA 4M2PA 1NSHA 2WOSA 1MR8A 1BT6A 1KSOA 4ZCUA 4FQOA 5DKNA 1B9AA 3BQ3A 2H61C 2K7DA 4TNCA 1BR1B 2ZN9A 2L51A 5AANA 1YUSA 1H4BA 2CBLA 5I8NA 3DD4A 1F54A 1S6CA 2WC8A 2OTGB 2P6BB 3GK2A 1N0YA 2ZNDA 4YI8A 4DCKA 1YVLA 4M2QA 2ZRSA 1M31A 1QX7A 5I2OA 4PE1A 1BG1A 1OOJA 1X02A 2M97A 3WHUB 4AOMA 3VRPA 1V1GA 2LUXA 3FS7A 1TNWA 2HF5A 2F3YA 4YBHB 2M49B 1ODBA 1TN4A 1TOPA 1K8UA 1WRKA 4P5OE 3JTDB 2OPOA 3EVVA 3QRXA 2L5XB 2KQ6A 4ETOA 1DJIA 2L0PA 4OV2A 1A4PA 2Q4UA 1IQ5A 1DJWA 1BODA 5D7FA 3I5IB 1UUSA 1CDPA 1XFYO 1Y1AA 5AFPA 5JJGA 5HYDA 1UHNA 4L9MA 3E3RA 1KFUS 2L4IA 2AAOA 4YGEB 2KGBC 1Q80A 2PALA 2V53A 3NSIA 1SMGA 1RECA 1XFVO 1OMVA 1QV0A 3EK4A 3EK8A 4F0ZB 1TNPA 3BYAA 2M8UA 1NCZA 2Y4QA 4MVFA 1WLZA 1JFJA 1M39A 1WDCC 5CPVA 5CSFA 5HLVA 2HETA 2I18A 3LL8B 2AMIA 1TIZA 2JQ6A 2Y1NA 3IF7A 1TNQA 5FYXA 4MLWA 3CR2A 4N1GA 2JXCA 2RGIA 1F70A 4NDBA 1K93D 3NSLA 1JC2A 2KI6D 3DVKA 1KFXS 3TDIA 1JBAA 1PSRA 1B4CA 1J1DA 1KQMC 1MXEA 5AEQA 2LLSA 2EHBA 2JOJA 2KDHA 3I5HC 4I5NB 1CTRA 4PE0A 3DF0B 1VRKA 1F8HA 2Y1MA 1ZUZA 1SR6C 1C7WA 1QX5B 2M29A 3DVMA 4PHJA 1LKJA 2KAXA 3OB1B 1DJZA 1NWDA 1IKUA 1B47A 1F4OA 2KFGA 1PALA 1DJYA 2LVJA 2OS8B 3TS5C 3BOWA 1QX2A 1CDLA 1K94A 2ZFDA 1UHJA 3OP0A 1YR5A 1BF5A 2BECA 1PULA 5HKYA 1BOCA 5HLOA 4XJKA 3OX6A 1RWYA 2JC2A 3CS1A 1L7ZA 1NPQA 1SNLA 3PN7C 1WDCB 2KHNA 3PM8A 2BL0C 1TTXA 4CIDA 1J7QA 1U5IA 1YX7A 5BPJA 4GGNA 1CFCA 2LC5A 1LA3A 2CNPA 1CNPA 1AVSA 2K7BA 4ICBA 2PVBA 2K61A 3EKHA 5JOLA 1NYAA 1E8AA 1FBVA 3C1VA 1KQMB 2CTNA 1GGWA 1UURA 2I94A 3I5HB 4GBAA 2G9BA 4OVNF 2LP2A 3O2PA 3O78A 1KK8B 4GGFA 1SR6B 1M63B 1OSAA 1NX3A 2F3ZA 1G4YR 1KQVA 2PMYA 2JT8A 3FIAA 1KK7Z 4CLNA 3NXAA 3PLFB 2H2KA 2GGZA 3CLNA 2SCPA 4M2OA 1A03A 1J7OA 4U8DA 1AJ5A 3TS5B 2ZKMX 4IL1A 4PALA 2HQ8A 3IQOA 2BCXA 4CPVA 5KTYA 2QPTA 3GK1A 3CWGA 3SJSA 1K9UA 2B1UA 2LM5A 2MRDA 3ZNIA 1RFJA 1SKTA 2E6WA 1AJ4A 3PN7B 1YRUB 2BL0B 2COLB 4WQ3A 1B1GA 1LINA 3M0WA 1A29A 1KK7Y 2F2OA 4MRYA 2TN4A 1CFDA 1WRLA 3WXAA 1CMGA 1F71A 3ZWHA 4FTGA 1GJYA 1ALWA 2KI4C 1SBJA 5KSZA 2JZIA 1DTLA 1IG5A 1PVBA 4AQIA 1W7IB 1JUOA 1SCMB 1KCYA 2NCOA 2G2BA 1EG3A 1FI5A 3CTNA 2HQWA 2KAYA 2KQYA 4JPZB 3A8RA 1EXRA 1TCFA 4ORBB 3TZ1A 4D1EA 5ER4X 4NQGA 1DF0B 2FOTA 2WNDA 2LE9B 2KSPA 1XVJA 3F45A 4PE4A 1H8BA 4MN0A 1EJ3A 4GPLB 5HKZA 4HSZA 2ZN8A 3LK1A 1QTXA 1S26D 2LVIA 3K21A 1RROA 4OKHA 1F4QA 1YRTB 2LLUA 1EL4A 1UHKA 1XFUO 2LCPA 2MLEC 5DKQA 3SG2A 3EKJA 4DRWA 3VRQA 3TUYC 1UHIA 1AHRA 2D8NA 2LHIA 3I5GC 4YGBB 3CZTX 1XK4C 2LUCA 1WLMA 1CLBA 3SG6A 1J7RA 3RM1A 3SIAA 2I2RE 2O5GA 3CGAA 1JFKA 1UP5A 1XFZO 2M9GA 2CCMA 2K7CA 3CR5X 3O4YA 4N5XA 2ISDA 2KI4B 2LMTA 1YX8A 2NCPA 1K95A 1K9KA 4I5LB 1BU3A 2F8PA 3BUWB 3H4SE 2KNEA 4HRGA 1ZACA 2IS9A 2MHHA 1CFFA 5AERA 1UHHA 1K9PA 2L50A 3OB2B 3PFVA 2H61A 2JT0A 1DJXA 1LXFC 1A75B 2JT3A 3BXKA 1DVIA 3DVEA 1NX2A 1UWOA 4WQ2A 4DS7A 5CSNA 2QACA 2O60A 3LK0A 4GAOA 2M7LA 2WCBA 1PSBA 1CKKA 2Y5IA 3SG3A 4DIRA 4AQJA 1EG4A 2SASA 2KAVA 2GGMA 2K8MB 1S3PA 3DF0A 1S6JA 2JULA 2LAPA 2KI6C 3TUYB 3FWCA 1QJTA 2M7NA 3I5GB 1TNXA 2BCBA 4OR9B 1CDMA 1XA5A 3EK7A 3CR4X 4C0LA 1N2DA 1RJVA 3A4UB 1S6IA 2I7AA 1BR4B 2LVVA 1JWDA 5I2LA 3WHTB 2Q91A 2AUCA 1PK0D 1EH2A 1MHOA 2BCAA 2FJUB 2K2FA 1B8LA 2PASA 1NIWA 1XO5A 3RLZA 4YRUA 3IQQA 4I5KA 2BBNA 1QATA 3HCMA 2EC6C 4ORAB 1IWQA 2KFHA 5K89A 1SW8A 2KBMA 5PALA 1R2UA 4XYNA 2JRFA 1FI6A 1OMRA 1FPWA 1SYMA 2FCDA 2ZNEA 3ICBA 1JF2A 3NSKA 1MF8B 4MRXA 4C0JA 2LANA 1LA0A 2CT9A 5ER5A 3SG4A 1KFUL 2L4HA 3SG7A 1QV1A 1SL7A 2OTGC 1CLMA 2MAZA 2NLNA 4HRHA 1B7TZ 1SRAA 2CXJA 1NX0A 4MZJA 2BE6A 1G33A 4R1EA 4CFRA 2MLFC 2EGDA 4NDDA 2JNXA 1IGVA 2HPSA 1RTP1 5CSJA 3PSRA 3LCPC 4MZLA 4YGDB 2ZRTA 1KFXL 5B8IB 1KWOC 1OMDA 2NXQA 4P2YB 1DT7B 1Y1XA 1A2XA 1XFXO 1C7VA 1IH0A 1SY9A 1AP4A 1HQVA 1MXLC 2LNKA 1B8CA 1NP8A 3VROA 1CDNA 1MWNA 1Y0VH 1IRJA 2LP3A 2EC6B 1B7TY 1CB1A 1SPYA 4YGCB 1W7JB 4I5JA 1QASA 4GNKB 2LHLA 3KEVA 1NCYA 1SK6D 1AK8A 1WRZA 5G08A 1M45A 1YTZC 2JNFA 2WCEA 2BKIB 2KBIA 3VGOA 4QJ5B 1BJFA 5IBWA 1WY9A 1YUUA 2LV7A 3O6BA 4A4BA 5F6TA 3JVTC 4PDZA 1S1EA 5KU1A 1MUXA 3LLEA 1NUBA 1M46A 3AKBA 1C07A 3NSOA 1Y6WA 1DJHA 1TCOB 1LVCD 3KO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUI B;  1K96 A;  2KOT A;  4CFQ A;  1MQ1 A;  1CLL A;  1OE9 B;  2JWW A;  2WOR A;  1PRW A;  3D0Y B;  3PAT A;  1QVI Z;  1KWO B;  2OS8 C;  2M3W A;  4PHN A;  1IJ6 A;  4OCI A;  2LMV A;  1SCV A;  1QLS A;  2PRU A;  1DF0 A;  3KPX A;  4WRI A;  1XYD A;  1IJ5 A;  2NZ0 A;  1ZFS A;  4NDC A;  3KHE A;  2JTZ A;  1F55 A;  4GGF C;  1BMO A;  4JQ0 D;  2KYF A;  1GGZ A;  2JU0 A;  3KF9 A;  5I2Q A;  3FWB A;  1J7P A;  1YUT A;  3I5F C;  1QS7 A;  1GQM A;  1JF0 A;  3BUX B;  5DKR A;  1XFW O;  4MEW A;  4MSP A;  3BOW B;  1K90 D;  4Q04 A;  1QLK A;  3D0Y A;  3TDZ A;  5CSI A;  1QVI Y;  2GV5 A;  2BE4 A;  3D10 A;  3JVT B;  2BKH B;  2K2A A;  4ORC B;  1JSA A;  4XJK B;  3VRN A;  3GOF A;  5AXI A;  2MBX A;  3TDU A;  1KK8 C;  3MSE B;  1ALV A;  4MZK A;  2DOQ A;  2JXL A;  3BUM B;  4BY5 A;  1FF1 A;  1KSM A;  1G8I A;  2KFF A;  1U5I B;  4PHK A;  1DJG A;  1A75 A;  1L2O C;  2VRG A;  2L2E A;  1DMO A;  4JWQ A;  3EVR A;  1N65 A;  1S5G Z;  2F33 A;  1J55 A;  5TNC A;  1QIW A;  1TRF A;  1DGV A;  1Y1U A;  2KYC A;  2L98 A;  3DVJ A;  1R6P A;  2KGR A;  4MBE A;  2F2P A;  1DGU A;  3PAL A;  1SL8 A;  1CM4 A;  1CFP A;  1B8R A;  4YGA A;  2JPT A;  3SG5 A;  3I5F B;  3SIB A;  2FCE A;  2K7O A;  4N1F A;  1HT9 A;  4HRE E;  2LMU A;  1XK4 A;  5HKW A;  4QJ4 B;  3OHM B;  2LVK A;  4USL A;  1K2H A;  4GUK A;  3AAJ A;  2WCF A;  3HX4 A;  2BBM A;  1YVH A;  1BLQ A;  1QIV A;  1S5G Y;  2MA2 A;  1QXP A;  3OX5 A;  3WNX B;  4DUQ A;  2A4J A;  1FW4 A;  4QJ3 B;  1J1E A;  2E30 A;  4YI9 A;  1NCX A;  2R2I A;  1SCM C;  1ZOT B;  2K0J A;  3AKA A;  4ZCV A;  2M0R A;  3VRR A;  3JTD C;  4A4C A;  3BUO B;  2PSR A;  5D69 A;  3GK4 X;  2LLT A;  2M1U A;  1S36 A;  4PCW A;  1L2O B;  1OZS A;  4UPG A;  4GFT A;  4E68 A;  3EVU A;  4BY4 A;  5J3X A;  1D1O A;  4PHM A;  2JTT A;  1OQP A;  1YUR A;  3BUN B;  4C0K A;  1V1F A;  1OZO A;  1ZMZ A;  2MJW B;  3I5I C;  1PVA A;  5GQQ C;  1NX1 A;  3AAK A;  4PE7 A;  1SL9 A;  1IQ3 A;  2M1K B;  1CM1 A;  1RK9 A;  1CMF A;  4M2P A;  1NSH A;  2WOS A;  1MR8 A;  1BT6 A;  1KSO A;  4ZCU A;  4FQO A;  5DKN A;  1B9A A;  3BQ3 A;  2H61 C;  2K7D A;  4TNC A;  1BR1 B;  2ZN9 A;  2L51 A;  5AAN A;  1YUS A;  1H4B A;  2CBL A;  5I8N A;  3DD4 A;  1F54 A;  1S6C A;  2WC8 A;  2OTG B;  2P6B B;  3GK2 A;  1N0Y A;  2ZND A;  4YI8 A;  4DCK A;  1YVL A;  4M2Q A;  2ZRS A;  1M31 A;  1QX7 A;  5I2O A;  4PE1 A;  1BG1 A;  1OOJ A;  1X02 A;  2M97 A;  3WHU B;  4AOM A;  3VRP A;  1V1G A;  2LUX A;  3FS7 A;  1TNW A;  2HF5 A;  2F3Y A;  4YBH B;  2M49 B;  1ODB A;  1TN4 A;  1TOP A;  1K8U A;  1WRK A;  4P5O E;  3JTD B;  2OPO A;  3EVV A;  3QRX A;  2L5X B;  2KQ6 A;  4ETO A;  1DJI A;  2L0P A;  4OV2 A;  1A4P A;  2Q4U A;  1IQ5 A;  1DJW A;  1BOD A;  5D7F A;  3I5I B;  1UUS A;  1CDP A;  1XFY O;  1Y1A A;  5AFP A;  5JJG A;  5HYD A;  1UHN A;  4L9M A;  3E3R A;  1KFU S;  2L4I A;  2AAO A;  4YGE B;  2KGB C;  1Q80 A;  2PAL A;  2V53 A;  3NSI A;  1SMG A;  1REC A;  1XFV O;  1OMV A;  1QV0 A;  3EK4 A;  3EK8 A;  4F0Z B;  1TNP A;  3BYA A;  2M8U A;  1NCZ A;  2Y4Q A;  4MVF A;  1WLZ A;  1JFJ A;  1M39 A;  1WDC C;  5CPV A;  5CSF A;  5HLV A;  2HET A;  2I18 A;  3LL8 B;  2AMI A;  1TIZ A;  2JQ6 A;  2Y1N A;  3IF7 A;  1TNQ A;  5FYX A;  4MLW A;  3CR2 A;  4N1G A;  2JXC A;  2RGI A;  1F70 A;  4NDB A;  1K93 D;  3NSL A;  1JC2 A;  2KI6 D;  3DVK A;  1KFX S;  3TDI A;  1JBA A;  1PSR A;  1B4C A;  1J1D A;  1KQM C;  1MXE A;  5AEQ A;  2LLS A;  2EHB A;  2JOJ A;  2KDH A;  3I5H C;  4I5N B;  1CTR A;  4PE0 A;  3DF0 B;  1VRK A;  1F8H A;  2Y1M A;  1ZUZ A;  1SR6 C;  1C7W A;  1QX5 B;  2M29 A;  3DVM A;  4PHJ A;  1LKJ A;  2KAX A;  3OB1 B;  1DJZ A;  1NWD A;  1IKU A;  1B47 A;  1F4O A;  2KFG A;  1PAL A;  1DJY A;  2LVJ A;  2OS8 B;  3TS5 C;  3BOW A;  1QX2 A;  1CDL A;  1K94 A;  2ZFD A;  1UHJ A;  3OP0 A;  1YR5 A;  1BF5 A;  2BEC A;  1PUL A;  5HKY A;  1BOC A;  5HLO A;  4XJK A;  3OX6 A;  1RWY A;  2JC2 A;  3CS1 A;  1L7Z A;  1NPQ A;  1SNL A;  3PN7 C;  1WDC B;  2KHN A;  3PM8 A;  2BL0 C;  1TTX A;  4CID A;  1J7Q A;  1U5I A;  1YX7 A;  5BPJ A;  4GGN A;  1CFC A;  2LC5 A;  1LA3 A;  2CNP A;  1CNP A;  1AVS A;  2K7B A;  4ICB A;  2PVB A;  2K61 A;  3EKH A;  5JOL A;  1NYA A;  1E8A A;  1FBV A;  3C1V A;  1KQM B;  2CTN A;  1GGW A;  1UUR A;  2I94 A;  3I5H B;  4GBA A;  2G9B A;  4OVN F;  2LP2 A;  3O2P A;  3O78 A;  1KK8 B;  4GGF A;  1SR6 B;  1M63 B;  1OSA A;  1NX3 A;  2F3Z A;  1G4Y R;  1KQV A;  2PMY A;  2JT8 A;  3FIA A;  1KK7 Z;  4CLN A;  3NXA A;  3PLF B;  2H2K A;  2GGZ A;  3CLN A;  2SCP A;  4M2O A;  1A03 A;  1J7O A;  4U8D A;  1AJ5 A;  3TS5 B;  2ZKM X;  4IL1 A;  4PAL A;  2HQ8 A;  3IQO A;  2BCX A;  4CPV A;  5KTY A;  2QPT A;  3GK1 A;  3CWG A;  3SJS A;  1K9U A;  2B1U A;  2LM5 A;  2MRD A;  3ZNI A;  1RFJ A;  1SKT A;  2E6W A;  1AJ4 A;  3PN7 B;  1YRU B;  2BL0 B;  2COL B;  4WQ3 A;  1B1G A;  1LIN A;  3M0W A;  1A29 A;  1KK7 Y;  2F2O A;  4MRY A;  2TN4 A;  1CFD A;  1WRL A;  3WXA A;  1CMG A;  1F71 A;  3ZWH A;  4FTG A;  1GJY A;  1ALW A;  2KI4 C;  1SBJ A;  5KSZ A;  2JZI A;  1DTL A;  1IG5 A;  1PVB A;  4AQI A;  1W7I B;  1JUO A;  1SCM B;  1KCY A;  2NCO A;  2G2B A;  1EG3 A;  1FI5 A;  3CTN A;  2HQW A;  2KAY A;  2KQY A;  4JPZ B;  3A8R A;  1EXR A;  1TCF A;  4ORB B;  3TZ1 A;  4D1E A;  5ER4 X;  4NQG A;  1DF0 B;  2FOT A;  2WND A;  2LE9 B;  2KSP A;  1XVJ A;  3F45 A;  4PE4 A;  1H8B A;  4MN0 A;  1EJ3 A;  4GPL B;  5HKZ A;  4HSZ A;  2ZN8 A;  3LK1 A;  1QTX A;  1S26 D;  2LVI A;  3K21 A;  1RRO A;  4OKH A;  1F4Q A;  1YRT B;  2LLU A;  1EL4 A;  1UHK A;  1XFU O;  2LCP A;  2MLE C;  5DKQ A;  3SG2 A;  3EKJ A;  4DRW A;  3VRQ A;  3TUY C;  1UHI A;  1AHR A;  2D8N A;  2LHI A;  3I5G C;  4YGB B;  3CZT X;  1XK4 C;  2LUC A;  1WLM A;  1CLB A;  3SG6 A;  1J7R A;  3RM1 A;  3SIA A;  2I2R E;  2O5G A;  3CGA A;  1JFK A;  1UP5 A;  1XFZ O;  2M9G A;  2CCM A;  2K7C A;  3CR5 X;  3O4Y A;  4N5X A;  2ISD A;  2KI4 B;  2LMT A;  1YX8 A;  2NCP A;  1K95 A;  1K9K A;  4I5L B;  1BU3 A;  2F8P A;  3BUW B;  3H4S E;  2KNE A;  4HRG A;  1ZAC A;  2IS9 A;  2MHH A;  1CFF A;  5AER A;  1UHH A;  1K9P A;  2L50 A;  3OB2 B;  3PFV A;  2H61 A;  2JT0 A;  1DJX A;  1LXF C;  1A75 B;  2JT3 A;  3BXK A;  1DVI A;  3DVE A;  1NX2 A;  1UWO A;  4WQ2 A;  4DS7 A;  5CSN A;  2QAC A;  2O60 A;  3LK0 A;  4GAO A;  2M7L A;  2WCB A;  1PSB A;  1CKK A;  2Y5I A;  3SG3 A;  4DIR A;  4AQJ A;  1EG4 A;  2SAS A;  2KAV A;  2GGM A;  2K8M B;  1S3P A;  3DF0 A;  1S6J A;  2JUL A;  2LAP A;  2KI6 C;  3TUY B;  3FWC A;  1QJT A;  2M7N A;  3I5G B;  1TNX A;  2BCB A;  4OR9 B;  1CDM A;  1XA5 A;  3EK7 A;  3CR4 X;  4C0L A;  1N2D A;  1RJV A;  3A4U B;  1S6I A;  2I7A A;  1BR4 B;  2LVV A;  1JWD A;  5I2L A;  3WHT B;  2Q91 A;  2AUC A;  1PK0 D;  1EH2 A;  1MHO A;  2BCA A;  2FJU B;  2K2F A;  1B8L A;  2PAS A;  1NIW A;  1XO5 A;  3RLZ A;  4YRU A;  3IQQ A;  4I5K A;  2BBN A;  1QAT A;  3HCM A;  2EC6 C;  4ORA B;  1IWQ A;  2KFH A;  5K89 A;  1SW8 A;  2KBM A;  5PAL A;  1R2U A;  4XYN A;  2JRF A;  1FI6 A;  1OMR A;  1FPW A;  1SYM A;  2FCD A;  2ZNE A;  3ICB A;  1JF2 A;  3NSK A;  1MF8 B;  4MRX A;  4C0J A;  2LAN A;  1LA0 A;  2CT9 A;  5ER5 A;  3SG4 A;  1KFU L;  2L4H A;  3SG7 A;  1QV1 A;  1SL7 A;  2OTG C;  1CLM A;  2MAZ A;  2NLN A;  4HRH A;  1B7T Z;  1SRA A;  2CXJ A;  1NX0 A;  4MZJ A;  2BE6 A;  1G33 A;  4R1E A;  4CFR A;  2MLF C;  2EGD A;  4NDD A;  2JNX A;  1IGV A;  2HPS A;  1RTP 1;  5CSJ A;  3PSR A;  3LCP C;  4MZL A;  4YGD B;  2ZRT A;  1KFX L;  5B8I B;  1KWO C;  1OMD A;  2NXQ A;  4P2Y B;  1DT7 B;  1Y1X A;  1A2X A;  1XFX O;  1C7V A;  1IH0 A;  1SY9 A;  1AP4 A;  1HQV A;  1MXL C;  2LNK A;  1B8C A;  1NP8 A;  3VRO A;  1CDN A;  1MWN A;  1Y0V H;  1IRJ A;  2LP3 A;  2EC6 B;  1B7T Y;  1CB1 A;  1SPY A;  4YGC B;  1W7J B;  4I5J A;  1QAS A;  4GNK B;  2LHL A;  3KEV A;  1NCY A;  1SK6 D;  1AK8 A;  1WRZ A;  5G08 A;  1M45 A;  1YTZ C;  2JNF A;  2WCE A;  2BKI B;  2KBI A;  3VGO A;  4QJ5 B;  1BJF A;  5IBW A;  1WY9 A;  1YUU A;  2LV7 A;  3O6B A;  4A4B A;  5F6T A;  3JVT C;  4PDZ A;  1S1E A;  5KU1 A;  1MUX A;  3LLE A;  1NUB A;  1M46 A;  3AKB A;  1C07 A;  3NSO A;  1Y6W A;  1DJH A;  1TCO B;  1LVC D;  3KO0 A; 
#chains in the Genus database with same CATH topology
 1AUI B;  1K96 A;  1W9Z A;  2KOT A;  4CFQ A;  1MQ1 A;  1CLL A;  1OE9 B;  2JWW A;  2WOR A;  1PRW A;  3D0Y B;  3PAT A;  5FI2 A;  1QVI Z;  1KWO B;  2OS8 C;  2M3W A;  4PHN A;  1IJ6 A;  2PQL A;  4OCI A;  2LMV A;  1SCV A;  1QLS A;  2PRU A;  1DF0 A;  3FE8 A;  3KPX A;  4WRI A;  1XYD A;  1IJ5 A;  1QWV A;  2NZ0 A;  1ZFS A;  4NDC A;  2FJY A;  3KHE A;  2JTZ A;  1F55 A;  4GGF C;  1BMO A;  4JQ0 D;  2KYF A;  1GGZ A;  2JU0 A;  3KF9 A;  5I2Q A;  2L2C A;  3FWB A;  1J7P A;  3D74 A;  1YUT A;  3I5F C;  1QS7 A;  1GQM A;  1JF0 A;  3BUX B;  5DKR A;  1XFW O;  4MEW A;  4MSP A;  3CZ1 A;  3UNW A;  3BOW B;  1K90 D;  4Q04 A;  1QLK A;  3D0Y A;  3NHI A;  2BAP A;  3BFB A;  3TDZ A;  2ERB A;  5CSI A;  3CZ2 A;  1QVI Y;  2GV5 A;  2BE4 A;  3D10 A;  3D73 A;  3JVT B;  2BKH B;  2K2A A;  2QEB A;  4IJ7 A;  4ORC B;  1JSA A;  1LS8 A;  4XJK B;  3VRN A;  3GOF A;  5AXI A;  2MBX A;  3TDU A;  3R72 A;  1KK8 C;  3MSE B;  1ALV A;  4MZK A;  2DOQ A;  2JXL A;  3NGV A;  3BUM B;  4BY5 A;  1FF1 A;  1KSM A;  1G8I A;  2KFF A;  1U5I B;  4PHK A;  1DJG A;  1A75 A;  1L2O C;  2VRG A;  2L2E A;  3L47 A;  4JWQ A;  1DMO A;  3EVR A;  1N65 A;  1S5G Z;  1TUZ A;  2F33 A;  1J55 A;  4JKT A;  1QIW A;  1TRF A;  5TNC A;  1DGV A;  1Y1U A;  2KYC A;  3OGN A;  2L98 A;  2BNX A;  2QEO A;  3DVJ A;  1R6P A;  2KGR A;  3D78 A;  4MBE A;  2F2P A;  1DGU A;  3PAL A;  1SL8 A;  1CM4 A;  3PM2 A;  1B8R A;  1CFP A;  4YGA A;  2JPT A;  3SG5 A;  3D77 A;  3I5F B;  3CDN A;  3SIB A;  2KPH A;  2FCE A;  2K7O A;  4N1F A;  1HT9 A;  4HRE E;  2LMU A;  1XK4 A;  5HKW A;  4QJ4 B;  3OHM B;  2LVK A;  4USL A;  1K2H A;  4GUK A;  3AAJ A;  2WCF A;  3HX4 A;  2BBM A;  1YVH A;  1BLQ A;  1QIV A;  1S5G Y;  2MA2 A;  1QXP A;  3OX5 A;  3WNX B;  4DUQ A;  2A4J A;  1FW4 A;  4QJ3 B;  2YGU A;  1J1E A;  2E30 A;  4YI9 A;  2WCK A;  1NCX A;  2R2I A;  3VB1 A;  1SCM C;  1ZOT B;  2K0J A;  3AKA A;  3BFH A;  4ZCV A;  2M0R A;  3VRR A;  3JTD C;  4A4C A;  3BUO B;  2PSR A;  5D69 A;  3GK4 X;  2LLT A;  2M1U A;  1S36 A;  4PCW A;  1L2O B;  1OZS A;  4UPG A;  4GFT A;  2GTE A;  3EVU A;  4BY4 A;  4E68 A;  5J3X A;  1D1O A;  4PHM A;  2JTT A;  1OQP A;  1YUR A;  3BUN B;  4C0K A;  1V1F A;  1OZO A;  1ZMZ A;  2MJW B;  3I5I C;  1PVA A;  5GQQ C;  1NX1 A;  3N7H A;  3AAK A;  4PE7 A;  1SL9 A;  1IQ3 A;  2M1K B;  1CM1 A;  3CYZ A;  1RK9 A;  1CMF A;  4M2P A;  1NSH A;  2WOS A;  1MR8 A;  1DEK A;  1BT6 A;  1KSO A;  4ZCU A;  3SS4 A;  4FQO A;  5DKN A;  1B9A A;  3BQ3 A;  2H61 C;  2K7D A;  4TNC A;  3S0E A;  3D76 A;  3R1O A;  1BR1 B;  2ZN9 A;  2L51 A;  5AAN A;  1YUS A;  1IIO A;  1H4B A;  2CBL A;  5I8N A;  1P28 A;  3DD4 A;  1F54 A;  1S6C A;  2WC8 A;  2OTG B;  2P6B B;  3GK2 A;  1N0Y A;  2ZND A;  4YI8 A;  4DCK A;  1OOF A;  1YVL A;  3DY9 A;  2ZRS A;  1M31 A;  1QX7 A;  4M2Q A;  3SS5 A;  4PE1 A;  5I2O A;  1BG1 A;  1OOJ A;  1X02 A;  2M97 A;  3WHU B;  4AOM A;  3VRP A;  1V1G A;  2LUX A;  3FS7 A;  1TNW A;  2HF5 A;  2F3Y A;  5D3O A;  4YBH B;  2M49 B;  1ODB A;  1TN4 A;  1TOP A;  1K8U A;  1WRK A;  3PJI A;  4P5O E;  3JTD B;  2OPO A;  3EVV A;  3QRX A;  2L5X B;  2KQ6 A;  2L5Y A;  4ETO A;  1DJI A;  2L0P A;  4OV2 A;  1A4P A;  2Q4U A;  1T14 A;  1IQ5 A;  1DJW A;  1BOD A;  5D7F A;  3I5I B;  1UUS A;  1CDP A;  1XFY O;  1Y1A A;  5AFP A;  5JJG A;  5HYD A;  1XFR A;  1UHN A;  4L9M A;  3E3R A;  1KFU S;  2L4I A;  2AAO A;  4YGE B;  2KGB C;  1Q80 A;  2PAL A;  2V53 A;  3NSI A;  1SMG A;  1REC A;  1XFV O;  1OMV A;  1QV0 A;  3EK4 A;  3EK8 A;  4F0Z B;  3S0B A;  3S0A A;  1TNP A;  3BYA A;  2M8U A;  1NCZ A;  2Y4Q A;  4MVF A;  1WLZ A;  1JFJ A;  1M39 A;  1WDC C;  3EG5 B;  5CPV A;  5CSF A;  5HLV A;  3K1E A;  2HET A;  2I18 A;  3LL8 B;  2AMI A;  1TIZ A;  2JQ6 A;  2Y1N A;  3IF7 A;  1TNQ A;  3L4L A;  5FYX A;  4MLW A;  3CR2 A;  4N1G A;  2JXC A;  2RGI A;  1F70 A;  4NDB A;  1K93 D;  3NSL A;  1C3Y A;  2KI6 D;  3DVK A;  1KFX S;  3TDI A;  1JC2 A;  1JBA A;  1PSR A;  3DYE A;  1B4C A;  1C3Z A;  1J1D A;  1KQM C;  1MXE A;  2LLS A;  2EHB A;  2JOJ A;  2QEV A;  5AEQ A;  5HL1 A;  2KDH A;  3I5H C;  4I5N B;  1CTR A;  4PE0 A;  3DF0 B;  1VRK A;  1F8H A;  2Y1M A;  1ZUZ A;  1SR6 C;  1C7W A;  1QX5 B;  2M29 A;  3DVM A;  4PHJ A;  1LKJ A;  2KAX A;  3OB1 B;  1DJZ A;  1NWD A;  1IKU A;  1B47 A;  1F4O A;  2KFG A;  1PAL A;  3D75 A;  3FE9 A;  1DJY A;  2KLE A;  2LVJ A;  2OS8 B;  3TS5 C;  3BOW A;  1QX2 A;  1CDL A;  1K94 A;  1TUJ A;  2ZFD A;  1UHJ A;  3NHT A;  3OP0 A;  1YR5 A;  1BF5 A;  2BEC A;  2P71 A;  1PUL A;  5HKY A;  1BOC A;  5HLO A;  4XJK A;  3OX6 A;  1RWY A;  3DZT A;  2JC2 A;  3CS1 A;  1L7Z A;  1NPQ A;  1SNL A;  3PN7 C;  1WDC B;  2KHN A;  3PM8 A;  2BL0 C;  3R1P A;  4INX A;  3OBV A;  1SSE B;  1TTX A;  1DC1 A;  4CID A;  1J7Q A;  5EL2 A;  1U5I A;  1YX7 A;  5BPJ A;  4GGN A;  5I94 A;  1CFC A;  2LC5 A;  1LA3 A;  2CNP A;  1CNP A;  1AVS A;  2K7B A;  4ICB A;  2KLD A;  2PVB A;  2K61 A;  3EKH A;  5JOL A;  1NYA A;  1E8A A;  1FBV A;  3C1V A;  1KQM B;  2CTN A;  1GGW A;  1UUR A;  2I94 A;  3I5H B;  4GBA A;  2G9B A;  4OVN F;  4FQT A;  2LP2 A;  3O2P A;  3O78 A;  1KK8 B;  4GGF A;  1SR6 B;  1TWO A;  1M63 B;  1OSA A;  3S0D A;  1NX3 A;  2F3Z A;  1G4Y R;  3BJH A;  1KQV A;  2PMY A;  3BFA A;  2JT8 A;  3FIA A;  1KK7 Z;  3DXL A;  3CAB A;  4CLN A;  3NXA A;  3PLF B;  2H2K A;  2GGZ A;  3CLN A;  2SCP A;  4M2O A;  1A03 A;  1J7O A;  4U8D A;  1AJ5 A;  3TS5 B;  2ZKM X;  5DIC A;  4IL1 A;  4PAL A;  2HQ8 A;  3IQO A;  4JD9 A;  4PT1 A;  2BCX A;  3FE6 A;  4CPV A;  2H8V A;  5KTY A;  2QPT A;  3GK1 A;  3CWG A;  3SJS A;  1K9U A;  2B1U A;  2LM5 A;  2MRD A;  3ZNI A;  1RFJ A;  1SKT A;  2E6W A;  1AJ4 A;  3PN7 B;  1YRU B;  2BL0 B;  2COL B;  4WQ3 A;  1B1G A;  1LIN A;  3M0W A;  1DQE A;  2JPO A;  1A29 A;  1KK7 Y;  2F2O A;  4MRY A;  2TN4 A;  1CFD A;  1WRL A;  3WXA A;  1CMG A;  1F71 A;  3ZWH A;  2WCJ A;  1OW4 A;  4FTG A;  1GJY A;  1ALW A;  5FI7 A;  2KI4 C;  1SBJ A;  5KSZ A;  2JZI A;  2WC5 A;  3SS3 A;  1DTL A;  1IG5 A;  2WCH A;  1PVB A;  4AQI A;  1W7I B;  1JUO A;  1SCM B;  1KCY A;  2NCO A;  2G2B A;  1EG3 A;  1FI5 A;  3Q8I A;  3CTN A;  2HQW A;  2KAY A;  2KQY A;  4JPZ B;  3A8R A;  1EXR A;  1TCF A;  4ORB B;  3TZ1 A;  4D1E A;  5ER4 X;  4NQG A;  1DF0 B;  2FOT A;  2WND A;  2LE9 B;  2KSP A;  1XVJ A;  3F45 A;  1ORG A;  4PE4 A;  1H8B A;  3B88 A;  4MN0 A;  1EJ3 A;  4GPL B;  5HKZ A;  4HSZ A;  2ZN8 A;  3LK1 A;  1QTX A;  1S26 D;  2LVI A;  3K21 A;  1RRO A;  4OKH A;  1F4Q A;  1YRT B;  2LLU A;  1EL4 A;  2K60 A;  1UHK A;  1XFU O;  2LCP A;  2MLE C;  5DKQ A;  3SG2 A;  3EKJ A;  4DRW A;  3VRQ A;  3TUY C;  1UHI A;  1AHR A;  2D8N A;  2LHI A;  3I5G C;  4YGB B;  3CZT X;  1XK4 C;  2LUC A;  1WLM A;  1CLB A;  3SG6 A;  1J7R A;  3RM1 A;  3SIA A;  2I2R E;  2O5G A;  3CGA A;  1JFK A;  1UP5 A;  1XFZ O;  2M9G A;  1OOH A;  4INW A;  2CCM A;  2K7C A;  3CR5 X;  3O4Y A;  3CZ0 A;  4N5X A;  2ISD A;  2KI4 B;  2LMT A;  1YX8 A;  2NCP A;  1K95 A;  1K9K A;  4I5L B;  1BU3 A;  3O4X A;  2F8P A;  3BUW B;  3H4S E;  2KNE A;  4HRG A;  1ZAC A;  2IS9 A;  2MHH A;  1CFF A;  5AER A;  1UHH A;  1K9P A;  2L50 A;  3OB2 B;  3PFV A;  2H61 A;  2JT0 A;  1DJX A;  1LXF C;  1A75 B;  1DEL A;  2JT3 A;  3BXK A;  1DVI A;  3DVE A;  3S0F A;  1NX2 A;  1UWO A;  4WQ2 A;  4DS7 A;  5CSN A;  2QAC A;  2O60 A;  3LK0 A;  4GAO A;  2M7L A;  2WCB A;  1PSB A;  1CKK A;  2Y5I A;  3SG3 A;  4DIR A;  4AQJ A;  1EG4 A;  3R1V A;  2SAS A;  2KAV A;  2GGM A;  2K8M B;  1S3P A;  3B7A A;  3DF0 A;  1S6J A;  2JUL A;  2LAP A;  2KI6 C;  3QME A;  3TUY B;  3FWC A;  1QJT A;  2M7N A;  3I5G B;  1TNX A;  2BCB A;  4OR9 B;  1CDM A;  1XA5 A;  2QDI A;  2WCM A;  3CR4 X;  3EK7 A;  4C0L A;  1GM0 A;  1N2D A;  1RJV A;  3A4U B;  1S6I A;  2I7A A;  1BR4 B;  2LVV A;  1JWD A;  5I2L A;  3WHT B;  2Q91 A;  2AUC A;  1PK0 D;  1EH2 A;  1MHO A;  2BCA A;  2FJU B;  2K2F A;  1B8L A;  2PAS A;  1NIW A;  5FI6 A;  1XO5 A;  2WC6 A;  3RZS A;  3RLZ A;  3S0G A;  4YRU A;  3IQQ A;  4I5K A;  2BBN A;  1QAT A;  3HCM A;  2EC6 C;  4ORA B;  1IWQ A;  2KFH A;  4F7F A;  5K89 A;  1SW8 A;  2PYQ A;  2KBM A;  5PAL A;  1R2U A;  4XYN A;  3V2L A;  2JRF A;  1FI6 A;  1OMR A;  1FPW A;  1SYM A;  2FCD A;  2ZNE A;  3ICB A;  1JF2 A;  3NSK A;  1MF8 B;  4MRX A;  4C0J A;  2LAN A;  1LA0 A;  2CT9 A;  5ER5 A;  3SG4 A;  1KFU L;  2L4H A;  3SG7 A;  1QV1 A;  1SL7 A;  2OTG C;  1CLM A;  2MAZ A;  1Z4H A;  2NLN A;  4HRH A;  1B7T Z;  1SRA A;  2CXJ A;  1NX0 A;  4MZJ A;  2BE6 A;  1G33 A;  4R1E A;  4CFR A;  2MLF C;  2QEH A;  2EGD A;  3B86 A;  4NDD A;  2JNX A;  1IGV A;  2HPS A;  1RTP 1;  5CSJ A;  3PSR A;  3LCP C;  4MZL A;  3UO9 A;  4YGD B;  2ZRT A;  1KFX L;  5B8I B;  1KWO C;  1OMD A;  2NXQ A;  2WCL A;  4P2Y B;  1OOI X;  1A2X A;  1Y1X A;  1DT7 B;  1OOG A;  1XFX O;  3L4A A;  2P70 A;  1C7V A;  1IH0 A;  1SY9 A;  1AP4 A;  1HQV A;  1MXL C;  2LNK A;  1B8C A;  1NP8 A;  3VRO A;  1CDN A;  1MWN A;  1Y0V H;  1IRJ A;  2LP3 A;  2EC6 B;  1B7T Y;  3B87 A;  1CB1 A;  1SPY A;  1Z2C B;  4YGC B;  1W7J B;  4I5J A;  1QAS A;  4GNK B;  2LHL A;  3KEV A;  1NCY A;  1SK6 D;  1AK8 A;  1WRZ A;  5G08 A;  3B6X A;  1M45 A;  1YTZ C;  2JNF A;  2WCE A;  2BKI B;  2KBI A;  3VGO A;  4QJ5 B;  1BJF A;  5IBW A;  1WY9 A;  1YUU A;  2LV7 A;  3O6B A;  4A4B A;  5F6T A;  3JVT C;  4OZD A;  4PDZ A;  1S1E A;  4KYN A;  5KU1 A;  3IVT A;  1MUX A;  3LLE A;  1NUB A;  1M46 A;  3AKB A;  1C07 A;  3NSO A;  1Y6W A;  1DJH A;  1TCO B;  1LVC D;  3KO0 A; 
#chains in the Genus database with same CATH homology
 1AUI B;  1K96 A;  2KOT A;  4CFQ A;  1MQ1 A;  1CLL A;  1OE9 B;  2JWW A;  2WOR A;  1PRW A;  3D0Y B;  3PAT A;  1QVI Z;  1KWO B;  2OS8 C;  2M3W A;  4PHN A;  1IJ6 A;  4OCI A;  2LMV A;  1SCV A;  1QLS A;  2PRU A;  1DF0 A;  3KPX A;  4WRI A;  1XYD A;  1IJ5 A;  2NZ0 A;  1ZFS A;  4NDC A;  3KHE A;  2JTZ A;  1F55 A;  4GGF C;  1BMO A;  4JQ0 D;  2KYF A;  1GGZ A;  2JU0 A;  3KF9 A;  5I2Q A;  3FWB A;  1J7P A;  1YUT A;  3I5F C;  1QS7 A;  1GQM A;  1JF0 A;  3BUX B;  5DKR A;  1XFW O;  4MEW A;  4MSP A;  3BOW B;  1K90 D;  4Q04 A;  1QLK A;  3D0Y A;  3TDZ A;  5CSI A;  1QVI Y;  2GV5 A;  2BE4 A;  3D10 A;  3JVT B;  2BKH B;  2K2A A;  4ORC B;  1JSA A;  4XJK B;  3VRN A;  3GOF A;  5AXI A;  2MBX A;  3TDU A;  1KK8 C;  3MSE B;  1ALV A;  4MZK A;  2DOQ A;  2JXL A;  3BUM B;  4BY5 A;  1FF1 A;  1KSM A;  1G8I A;  2KFF A;  1U5I B;  4PHK A;  1DJG A;  1A75 A;  1L2O C;  2VRG A;  2L2E A;  1DMO A;  4JWQ A;  3EVR A;  1N65 A;  1S5G Z;  2F33 A;  1J55 A;  5TNC A;  1QIW A;  1TRF A;  1DGV A;  1Y1U A;  2KYC A;  2L98 A;  3DVJ A;  1R6P A;  2KGR A;  4MBE A;  2F2P A;  1DGU A;  3PAL A;  1SL8 A;  1CM4 A;  1CFP A;  1B8R A;  4YGA A;  2JPT A;  3SG5 A;  3I5F B;  3SIB A;  2FCE A;  2K7O A;  4N1F A;  1HT9 A;  4HRE E;  2LMU A;  1XK4 A;  5HKW A;  4QJ4 B;  3OHM B;  2LVK A;  4USL A;  1K2H A;  4GUK A;  3AAJ A;  2WCF A;  3HX4 A;  2BBM A;  1YVH A;  1BLQ A;  1QIV A;  1S5G Y;  2MA2 A;  1QXP A;  3OX5 A;  3WNX B;  4DUQ A;  2A4J A;  1FW4 A;  4QJ3 B;  1J1E A;  2E30 A;  4YI9 A;  1NCX A;  2R2I A;  1SCM C;  1ZOT B;  2K0J A;  3AKA A;  4ZCV A;  2M0R A;  3VRR A;  3JTD C;  4A4C A;  3BUO B;  2PSR A;  5D69 A;  3GK4 X;  2LLT A;  2M1U A;  1S36 A;  4PCW A;  1L2O B;  1OZS A;  4UPG A;  4GFT A;  4E68 A;  3EVU A;  4BY4 A;  5J3X A;  1D1O A;  4PHM A;  2JTT A;  1OQP A;  1YUR A;  3BUN B;  4C0K A;  1V1F A;  1OZO A;  1ZMZ A;  2MJW B;  3I5I C;  1PVA A;  5GQQ C;  1NX1 A;  3AAK A;  4PE7 A;  1SL9 A;  1IQ3 A;  2M1K B;  1CM1 A;  1RK9 A;  1CMF A;  4M2P A;  1NSH A;  2WOS A;  1MR8 A;  1BT6 A;  1KSO A;  4ZCU A;  4FQO A;  5DKN A;  1B9A A;  3BQ3 A;  2H61 C;  2K7D A;  4TNC A;  1BR1 B;  2ZN9 A;  2L51 A;  5AAN A;  1YUS A;  1H4B A;  2CBL A;  5I8N A;  3DD4 A;  1F54 A;  1S6C A;  2WC8 A;  2OTG B;  2P6B B;  3GK2 A;  1N0Y A;  2ZND A;  4YI8 A;  4DCK A;  1YVL A;  4M2Q A;  2ZRS A;  1M31 A;  1QX7 A;  5I2O A;  4PE1 A;  1BG1 A;  1OOJ A;  1X02 A;  2M97 A;  3WHU B;  4AOM A;  3VRP A;  1V1G A;  2LUX A;  3FS7 A;  1TNW A;  2HF5 A;  2F3Y A;  4YBH B;  2M49 B;  1ODB A;  1TN4 A;  1TOP A;  1K8U A;  1WRK A;  4P5O E;  3JTD B;  2OPO A;  3EVV A;  3QRX A;  2L5X B;  2KQ6 A;  4ETO A;  1DJI A;  2L0P A;  4OV2 A;  1A4P A;  2Q4U A;  1IQ5 A;  1DJW A;  1BOD A;  5D7F A;  3I5I B;  1UUS A;  1CDP A;  1XFY O;  1Y1A A;  5AFP A;  5JJG A;  5HYD A;  1UHN A;  4L9M A;  3E3R A;  1KFU S;  2L4I A;  2AAO A;  4YGE B;  2KGB C;  1Q80 A;  2PAL A;  2V53 A;  3NSI A;  1SMG A;  1REC A;  1XFV O;  1OMV A;  1QV0 A;  3EK4 A;  3EK8 A;  4F0Z B;  1TNP A;  3BYA A;  2M8U A;  1NCZ A;  2Y4Q A;  4MVF A;  1WLZ A;  1JFJ A;  1M39 A;  1WDC C;  5CPV A;  5CSF A;  5HLV A;  2HET A;  2I18 A;  3LL8 B;  2AMI A;  1TIZ A;  2JQ6 A;  2Y1N A;  3IF7 A;  1TNQ A;  5FYX A;  4MLW A;  3CR2 A;  4N1G A;  2JXC A;  2RGI A;  1F70 A;  4NDB A;  1K93 D;  3NSL A;  1JC2 A;  2KI6 D;  3DVK A;  1KFX S;  3TDI A;  1JBA A;  1PSR A;  1B4C A;  1J1D A;  1KQM C;  1MXE A;  5AEQ A;  2LLS A;  2EHB A;  2JOJ A;  2KDH A;  3I5H C;  4I5N B;  1CTR A;  4PE0 A;  3DF0 B;  1VRK A;  1F8H A;  2Y1M A;  1ZUZ A;  1SR6 C;  1C7W A;  1QX5 B;  2M29 A;  3DVM A;  4PHJ A;  1LKJ A;  2KAX A;  3OB1 B;  1DJZ A;  1NWD A;  1IKU A;  1B47 A;  1F4O A;  2KFG A;  1PAL A;  1DJY A;  2LVJ A;  2OS8 B;  3TS5 C;  3BOW A;  1QX2 A;  1CDL A;  1K94 A;  2ZFD A;  1UHJ A;  3OP0 A;  1YR5 A;  1BF5 A;  2BEC A;  1PUL A;  5HKY A;  1BOC A;  5HLO A;  4XJK A;  3OX6 A;  1RWY A;  2JC2 A;  3CS1 A;  1L7Z A;  1NPQ A;  1SNL A;  3PN7 C;  1WDC B;  2KHN A;  3PM8 A;  2BL0 C;  1TTX A;  4CID A;  1J7Q A;  1U5I A;  1YX7 A;  5BPJ A;  4GGN A;  1CFC A;  2LC5 A;  1LA3 A;  2CNP A;  1CNP A;  1AVS A;  2K7B A;  4ICB A;  2PVB A;  2K61 A;  3EKH A;  5JOL A;  1NYA A;  1E8A A;  1FBV A;  3C1V A;  1KQM B;  2CTN A;  1GGW A;  1UUR A;  2I94 A;  3I5H B;  4GBA A;  2G9B A;  4OVN F;  2LP2 A;  3O2P A;  3O78 A;  1KK8 B;  4GGF A;  1SR6 B;  1M63 B;  1OSA A;  1NX3 A;  2F3Z A;  1G4Y R;  1KQV A;  2PMY A;  2JT8 A;  3FIA A;  1KK7 Z;  4CLN A;  3NXA A;  3PLF B;  2H2K A;  2GGZ A;  3CLN A;  2SCP A;  4M2O A;  1A03 A;  1J7O A;  4U8D A;  1AJ5 A;  3TS5 B;  2ZKM X;  4IL1 A;  4PAL A;  2HQ8 A;  3IQO A;  2BCX A;  4CPV A;  5KTY A;  2QPT A;  3GK1 A;  3CWG A;  3SJS A;  1K9U A;  2B1U A;  2LM5 A;  2MRD A;  3ZNI A;  1RFJ A;  1SKT A;  2E6W A;  1AJ4 A;  3PN7 B;  1YRU B;  2BL0 B;  2COL B;  4WQ3 A;  1B1G A;  1LIN A;  3M0W A;  1A29 A;  1KK7 Y;  2F2O A;  4MRY A;  2TN4 A;  1CFD A;  1WRL A;  3WXA A;  1CMG A;  1F71 A;  3ZWH A;  4FTG A;  1GJY A;  1ALW A;  2KI4 C;  1SBJ A;  5KSZ A;  2JZI A;  1DTL A;  1IG5 A;  1PVB A;  4AQI A;  1W7I B;  1JUO A;  1SCM B;  1KCY A;  2NCO A;  2G2B A;  1EG3 A;  1FI5 A;  3CTN A;  2HQW A;  2KAY A;  2KQY A;  4JPZ B;  3A8R A;  1EXR A;  1TCF A;  4ORB B;  3TZ1 A;  4D1E A;  5ER4 X;  4NQG A;  1DF0 B;  2FOT A;  2WND A;  2LE9 B;  2KSP A;  1XVJ A;  3F45 A;  4PE4 A;  1H8B A;  4MN0 A;  1EJ3 A;  4GPL B;  5HKZ A;  4HSZ A;  2ZN8 A;  3LK1 A;  1QTX A;  1S26 D;  2LVI A;  3K21 A;  1RRO A;  4OKH A;  1F4Q A;  1YRT B;  2LLU A;  1EL4 A;  1UHK A;  1XFU O;  2LCP A;  2MLE C;  5DKQ A;  3SG2 A;  3EKJ A;  4DRW A;  3VRQ A;  3TUY C;  1UHI A;  1AHR A;  2D8N A;  2LHI A;  3I5G C;  4YGB B;  3CZT X;  1XK4 C;  2LUC A;  1WLM A;  1CLB A;  3SG6 A;  1J7R A;  3RM1 A;  3SIA A;  2I2R E;  2O5G A;  3CGA A;  1JFK A;  1UP5 A;  1XFZ O;  2M9G A;  2CCM A;  2K7C A;  3CR5 X;  3O4Y A;  4N5X A;  2ISD A;  2KI4 B;  2LMT A;  1YX8 A;  2NCP A;  1K95 A;  1K9K A;  4I5L B;  1BU3 A;  2F8P A;  3BUW B;  3H4S E;  2KNE A;  4HRG A;  1ZAC A;  2IS9 A;  2MHH A;  1CFF A;  5AER A;  1UHH A;  1K9P A;  2L50 A;  3OB2 B;  3PFV A;  2H61 A;  2JT0 A;  1DJX A;  1LXF C;  1A75 B;  2JT3 A;  3BXK A;  1DVI A;  3DVE A;  1NX2 A;  1UWO A;  4WQ2 A;  4DS7 A;  5CSN A;  2QAC A;  2O60 A;  3LK0 A;  4GAO A;  2M7L A;  2WCB A;  1PSB A;  1CKK A;  2Y5I A;  3SG3 A;  4DIR A;  4AQJ A;  1EG4 A;  2SAS A;  2KAV A;  2GGM A;  2K8M B;  1S3P A;  3DF0 A;  1S6J A;  2JUL A;  2LAP A;  2KI6 C;  3TUY B;  3FWC A;  1QJT A;  2M7N A;  3I5G B;  1TNX A;  2BCB A;  4OR9 B;  1CDM A;  1XA5 A;  3EK7 A;  3CR4 X;  4C0L A;  1N2D A;  1RJV A;  3A4U B;  1S6I A;  2I7A A;  1BR4 B;  2LVV A;  1JWD A;  5I2L A;  3WHT B;  2Q91 A;  2AUC A;  1PK0 D;  1EH2 A;  1MHO A;  2BCA A;  2FJU B;  2K2F A;  1B8L A;  2PAS A;  1NIW A;  1XO5 A;  3RLZ A;  4YRU A;  3IQQ A;  4I5K A;  2BBN A;  1QAT A;  3HCM A;  2EC6 C;  4ORA B;  1IWQ A;  2KFH A;  5K89 A;  1SW8 A;  2KBM A;  5PAL A;  1R2U A;  4XYN A;  2JRF A;  1FI6 A;  1OMR A;  1FPW A;  1SYM A;  2FCD A;  2ZNE A;  3ICB A;  1JF2 A;  3NSK A;  1MF8 B;  4MRX A;  4C0J A;  2LAN A;  1LA0 A;  2CT9 A;  5ER5 A;  3SG4 A;  1KFU L;  2L4H A;  3SG7 A;  1QV1 A;  1SL7 A;  2OTG C;  1CLM A;  2MAZ A;  2NLN A;  4HRH A;  1B7T Z;  1SRA A;  2CXJ A;  1NX0 A;  4MZJ A;  2BE6 A;  1G33 A;  4R1E A;  4CFR A;  2MLF C;  2EGD A;  4NDD A;  2JNX A;  1IGV A;  2HPS A;  1RTP 1;  5CSJ A;  3PSR A;  3LCP C;  4MZL A;  4YGD B;  2ZRT A;  1KFX L;  5B8I B;  1KWO C;  1OMD A;  2NXQ A;  4P2Y B;  1DT7 B;  1Y1X A;  1A2X A;  1XFX O;  1C7V A;  1IH0 A;  1SY9 A;  1AP4 A;  1HQV A;  1MXL C;  2LNK A;  1B8C A;  1NP8 A;  3VRO A;  1CDN A;  1MWN A;  1Y0V H;  1IRJ A;  2LP3 A;  2EC6 B;  1B7T Y;  1CB1 A;  1SPY A;  4YGC B;  1W7J B;  4I5J A;  1QAS A;  4GNK B;  2LHL A;  3KEV A;  1NCY A;  1SK6 D;  1AK8 A;  1WRZ A;  5G08 A;  1M45 A;  1YTZ C;  2JNF A;  2WCE A;  2BKI B;  2KBI A;  3VGO A;  4QJ5 B;  1BJF A;  5IBW A;  1WY9 A;  1YUU A;  2LV7 A;  3O6B A;  4A4B A;  5F6T A;  3JVT C;  4PDZ A;  1S1E A;  5KU1 A;  1MUX A;  3LLE A;  1NUB A;  1M46 A;  3AKB A;  1C07 A;  3NSO A;  1Y6W A;  1DJH A;  1TCO B;  1LVC D;  3KO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...