1DTLA

Crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
149
Chain Sequence
YKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKKSEEELSDLFRMFDKNADGYIDLEELKIMLQATTITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC TROPONIN C
publication title Bepridil opens the regulatory N-terminal lobe of cardiac troponin C.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 53
structure length 149
sequence length 156
ec nomenclature
pdb deposition date 2000-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA02
2LE9B 2KFFA 4WRIA 4I5KA 2AAOA 3EKJA 2Q91A 3NXAA 1JSAA 1V1GA 2CTNA 5D7FA 3KHEA 5I2QA 1YX8A 1JWDA 1QS7A 4GBAA 4XJKB 1WY9A 4OR9B 2H61C 3O78A 3CWGA 4JQ0D 1NPQA 1LA3A 2BE6A 3DVMA 2FOTA 4N1GA 1HQVA 4ZCUA 4U8DA 2KAYA 2SCPA 2BCAA 1NIWA 5AEQA 3FWCA 3SIAA 1E8AA 1BU3A 4YBHB 1KK7Z 2Y1NA 2M7LA 2KYCA 1IG5A 1S36A 4CFRA 1M63B 4D1EA 1RECA 4MZJA 3NSOA 1B7TZ 2BKIB 1U5IA 1QASA 4PE4A 5AERA 1DJGA 3BUOB 2EC6B 3O2PA 5JJGA 2P6BB 4CLNA 4AOMA 3LK0A 1B1GA 2KBMA 1B47A 1XFXO 2KNEA 1S1EA 3GK4X 2NCPA 3D0YA 3K21A 2FCDA 1J7OA 2WC8A 3SIBA 5JOLA 2K61A 5CSFA 1F54A 1SYMA 2IS9A 1YUUA 2H2KA 2NZ0A 2R2IA 2Y4QA 3PLFB 3EK4A 4MRYA 1A4PA 3E3RA 3TDUA 2AMIA 3IF7A 4YGCB 2CNPA 1F71A 4M2OA 5TNCA 2MHHA 1KFUS 1VRKA 4DCKA 4MN0A 1KQMB 3I5GC 1OMVA 1LKJA 1M46A 1PVAA 1K9PA 1WDCC 1YURA 2COLB 2PSRA 4NQGA 4PHKA 4YGBB 3D10A 1MWNA 4WQ3A 1V1FA 2O5GA 1DMOA 2BBMA 3VRRA 1TOPA 3EK7A 1ZOTB 2NCOA 4DRWA 1J1EA 4YGEB 4GGFA 2JU0A 1J1DA 1K9UA 1K95A 2HPSA 2L51A 4HSZA 5HKWA 4IL1A 1MF8B 2PRUA 4XYNA 1RJVA 1F4QA 2LMUA 2L2EA 1EJ3A 1LA0A 1QX5B 2LVJA 3FS7A 5DKQA 2L4HA 4ORCB 4PE1A 1DJIA 1S5GZ 2ZKMX 3RM1A 3VGOA 2BBNA 5I2LA 3CZTX 3AKAA 4QJ4B 1WLZA 2Y5IA 5IBWA 1LINA 1YX7A 1SY9A 2G9BA 2CBLA 4Q04A 2ZN9A 4R1EA 1FI5A 3CGAA 3PFVA 4L9MA 2JULA 1UWOA 2F8PA 1MQ1A 2LUCA 1NX0A 1WRKA 2LM5A 2MJWB 1H8BA 1YVLA 3LLEA 1S6CA 1B9AA 2JC2A 2LVKA 1CTRA 5CSIA 5J3XA 2NLNA 4PE0A 2F2OA 1XVJA 1UHHA 4F0ZB 1DT7B 2K7OA 2LV7A 3VRPA 1CFCA 2F2PA 1B8LA 2EHBA 2KGRA 2L50A 5ER4X 1PSBA 3WHTB 2BKHB 1Y1AA 5AXIA 1QIVA 4HREE 1WLMA 3RLZA 4MRXA 2BE4A 4ORAB 4N5XA 2MLFC 2GGZA 2M1KB 1JC2A 1K8UA 3GK1A 3M0WA 1KSMA 1SW8A 2WCEA 3TDZA 1K2HA 2GV5A 1Y0VH 1XFWO 1AK8A 2LLUA 1MUXA 3DF0B 1L7ZA 2AUCA 3TDIA 1W7IB 3CR4X 1ALVA 1CB1A 4OVNF 1D1OA 5KU1A 3TUYB 1RWYA 3TS5C 1MHOA 2PVBA 1CFDA 3I5HB 3VRQA 2JTZA 1J55A 3CLNA 3OB1B 2HQWA 2OS8C 1XK4C 3AAKA 2K2AA 2KI4C 1TRFA 1NCZA 1TCOB 1IJ5A 1PALA 1WDCB 1CFPA 4C0KA 1F4OA 1QTXA 2ZRTA 4PHMA 3AKBA 3NSLA 2SASA 1K9KA 1K93D 1KK8C 1OOJA 2H61A 3PALA 3WNXB 1PK0D 1S26D 4I5LB 5PALA 3SG7A 4OKHA 3PATA 1WRZA 2E6WA 2CCMA 3DVEA 2BCXA 4YI8A 1DF0B 4USLA 5CSJA 2Q4UA 3KPXA 1C7WA 1DVIA 1L2OC 2I18A 2KOTA 3OX6A 4PHJA 2F3ZA 1IJ6A 3WXAA 2PASA 4MLWA 1S3PA 2ZNEA 2DOQA 2OTGC 1GJYA 2BECA 1XFVO 2L4IA 4DUQA 1JUOA 3BUMB 1CDMA 3FIAA 2GGMA 4GAOA 1AVSA 1DJHA 2KI6C 5CPVA 2M3WA 1KCYA 2KAXA 3DVKA 1XFYO 2M29A 1F70A 4GFTA 1NUBA 3DF0A 1TTXA 2ZFDA 5B8IB 2LVIA 1GQMA 1CFFA 1TNXA 3EVRA 1SCMC 1RFJA 4MEWA 1QATA 2M0RA 1B8CA 2V53A 1AUIB 1K96A 4CIDA 5HKYA 5D69A 2K8MB 4WQ2A 3EK8A 3PN7B 2M97A 2KQ6A 1AHRA 3SG3A 2LAPA 3I5IB 3SG5A 1YUTA 1IRJA 1QJTA 1QX2A 1XYDA 2LUXA 4MVFA 4YGDB 1BF5A 1JF2A 1CLBA 1AJ4A 2EGDA 2M8UA 3GOFA 1AJ5A 3SJSA 2QACA 1PSRA 1NWDA 1BOCA 1FPWA 1FW4A 4I5JA 1CDPA 1YRTB 1DF0A 1QLKA 1NX2A 3BYAA 2LNKA 3I5FC 3MSEB 3SG6A 1DJWA 4AQJA 1UHIA 2OS8B 1MXEA 1ZFSA 1KSOA 2KI4B 1YRUB 4P2YB 2LMVA 4YRUA 2K2FA 5KSZA 1PVBA 1EG4A 1N2DA 2ZN8A 3GK2A 1TIZA 1G33A 3HX4A 4ICBA 1CKKA 1J7PA 1FF1A 1KK8B 1LXFC 1CMGA 2MRDA 1IQ3A 5CSNA 3CR5X 4QJ5B 1C07A 1SMGA 2CT9A 1DJYA 1KFUL 3TZ1A 1QVIY 4C0JA 2JRFA 2LHIA 4YI9A 3EKHA 1KFXS 1DGVA 1X02A 4PALA 3LL8B 1SL7A 2CXJA 4PCWA 2JQ6A 2F3YA 1N65A 1PULA 3JVTC 2Y1MA 2K7DA 1NCYA 2LLSA 2KAVA 1SR6C 1OZOA 3BUXB 1MR8A 5HYDA 2D8NA 1A29A 2WCFA 1QV0A 1AP4A 2KHNA 1YVHA 4GNKB 3BQ3A 1R6PA 1UHKA 3QRXA 1K94A 2EC6C 2I7AA 1GGZA 1SKTA 1UURA 3VRNA 3WHUB 3BXKA 2WORA 2VRGA 1SCVA 1UP5A 3BUWB 4MZKA 2KFGA 4FQOA 3ICBA 2OPOA 2KSPA 3KF9A 1JF0A 3PM8A 1KFXL 3CS1A 3SG2A 4GGNA 1YTZC 4GUKA 4BY4A 1CLMA 1YR5A 1G8IA 1FI6A 1LVCD 1XO5A 2E30A 3KEVA 1XFUO 1G4YR 3F45A 1XFZO 1XK4A 5HLVA 2JZIA 2F33A 1SRAA 1DTLA 2K7BA 4ORBB 3HCMA 2FJUB 3I5GB 3A4UB 4N1FA 1KQMC 1BLQA 4ZCVA 2I2RE 1M45A 2A4JA 2WCBA 4PDZA 2LC5A 2WNDA 2KFHA 4A4BA 1A75B 2HF5A 4QJ3B 3IQQA 1KK7Y 2JNXA 1EXRA 4TNCA 1IQ5A 1EL4A 1IWQA 1TCFA 3BUNB 1W7JB 1HT9A 2JXLA 1BMOA 1B7TY 1OE9B 3FWBA 1Q80A 1JFJA 1XA5A 1F8HA 1NX1A 1PRWA 4UPGA 5HLOA 1OMRA 1SBJA 1S6JA 1UHNA 2LLTA 1R2UA 2G2BA 3ZWHA 1KQVA 1Y1UA 1CMFA 1Y1XA 1A03A 1CLLA 4E68A 4CFQA 1S6IA 1BODA 3JVTB 3JTDC 2KQYA 3NSIA 2KYFA 1SR6B 2BL0C 4OCIA 1RK9A 1DGUA 5ER5A 2M1UA 1ZUZA 1TNQA 4FTGA 1H4BA 1KWOC 1SL8A 3ZNIA 1BJFA 1UUSA 4P5OE 1SK6D 1DJZA 1BR4B 1TNPA 1YUSA 1SL9A 2M7NA 5FYXA 1A2XA 3NSKA 2JT8A 2LHLA 3EVUA 1NCXA 5F6TA 5HKZA 5AFPA 2JWWA 3BOWA 1SNLA 1ZMZA 1N0YA 4CPVA 1RTP1 1SPYA 3TS5B 2JOJA 3OP0A 4PE7A 3TUYC 1A75A 2JT0A 3SG4A 4C0LA 3CTNA 3I5HC 1K90D 2KDHA 1WRLA 1QV1A 1QLSA 2KGBC 1J7RA 2O60A 4MBEA 2BCBA 1S5GY 2JXCA 4MZLA 1FBVA 3OB2B 5BPJA 4M2PA 1B4CA 4A4CA 4JPZB 1JFKA 4XJKA 2TN4A 1EH2A 1IKUA 2I94A 2JTTA 2MA2A 2K0JA 1BT6A 2NXQA 2QPTA 5KTYA 1NX3A 5I8NA 1CDLA 5DKRA 1RROA 4GGFC 1CNPA 4GPLB 1L2OB 3EVVA 5AANA 1QXPA 3PSRA 5G08A 1DJXA 1TN4A 3O6BA 2LANA 2MBXA 2JT3A 2HQ8A 3LK1A 1EG3A 1NSHA 1NYAA 2KBIA 2MAZA 3KO0A 3O4YA 4NDDA 4DIRA 1ODBA 2L0PA 1ALWA 1MXLC 2OTGB 3DVJA 1UHJA 1GGWA 5I2OA 2MLEC 1OZSA 2PMYA 3VROA 2B1UA 2JNFA 5GQQC 2PALA 1QX7A 4NDCA 4OV2A 4I5NB 4M2QA 1IGVA 1BG1A 1QVIZ 1JBAA 1CM1A 1F55A 3A8RA 1CM4A 2LP3A 3JTDB 1IH0A 3C1VA 2BL0B 4PHNA 2WOSA 1SCMB 1CDNA 3H4SE 1C7VA 2LVVA 5K89A 1B8RA 4BY5A 4ETOA 1KWOB 1ZACA 2FCEA 2LP2A 3IQOA 2KI6D 2M49B 3AAJA 1U5IB 2LCPA 2M9GA 3LCPC 3DD4A 4AQIA 2ISDA 1M31A 3OHMB 1BR1B 3PN7C 2ZNDA 2RGIA 5DKNA 2ZRSA 1M39A 3CR2A 3I5IC 2LMTA 1J7QA 1OMDA 1Y6WA 2JPTA 4YGAA 3BOWB 1OSAA 2K7CA 3D0YB 1QIWA 4NDBA 1NP8A 4DS7A 3OX5A 4JWQA 4HRHA 4MSPA 3I5FB 1OQPA 4HRGA 2L5XB 2HETA 2L98A 1TNWA
chains in the Genus database with same CATH superfamily
2LE9B 2KFFA 4WRIA 4I5KA 2AAOA 2PQLA 2Q91A 3EKJA 3NXAA 1JSAA 1V1GA 3L4AA 2CTNA 5D7FA 3KHEA 3IVTA 1YX8A 5I2QA 1JWDA 1QS7A 3CDNA 4GBAA 4XJKB 1WY9A 4OR9B 2H61C 3O78A 3CWGA 4JQ0D 1NPQA 1LA3A 2BE6A 3DVMA 3BJHA 2FOTA 4N1GA 1HQVA 4ZCUA 4U8DA 2GTEA 2KAYA 2SCPA 2BCAA 1NIWA 5AEQA 3FWCA 3SIAA 3CABA 1E8AA 1BU3A 2P70A 4YBHB 1KK7Z 2Y1NA 2M7LA 2KYCA 1IG5A 1S36A 3S0GA 4CFRA 3FE6A 1M63B 3DXLA 4D1EA 1RECA 4MZJA 3NSOA 1B7TZ 2BKIB 1U5IA 1QASA 4PE4A 5AERA 1DJGA 3BUOB 2EC6B 3O2PA 5JJGA 3OGNA 2P6BB 4CLNA 5I94A 2WC5A 2KLDA 3S0AA 4AOMA 3LK0A 1B1GA 2KBMA 1B47A 1XFXO 2KNEA 1S1EA 3GK4X 2NCPA 3D0YA 3K21A 5FI2A 2FCDA 1J7OA 2WC8A 3SIBA 5JOLA 2K61A 5CSFA 2K60A 1F54A 1SYMA 2IS9A 1YUUA 2H2KA 2NZ0A 2KPHA 2R2IA 1Z2CB 1QWVA 2Y4QA 3PLFB 3EK4A 4MRYA 1A4PA 3CZ1A 3E3RA 3TDUA 2AMIA 3IF7A 4YGCB 2CNPA 1F71A 1C3YA 4M2OA 5TNCA 2MHHA 1KFUS 1VRKA 4DCKA 2WCLA 4MN0A 1KQMB 3I5GC 1OMVA 1LKJA 1M46A 1PVAA 1K9PA 1WDCC 1YURA 2COLB 2PSRA 4NQGA 4PHKA 3B87A 4YGBB 3D10A 1MWNA 4WQ3A 1V1FA 2O5GA 1DMOA 2BBMA 3VRRA 1TOPA 3EK7A 1ZOTB 2NCOA 4DRWA 1J1EA 4YGEB 4GGFA 2JU0A 2WCMA 1J1DA 1K9UA 1K95A 2HPSA 2L51A 4HSZA 5HKWA 4IL1A 1MF8B 2PRUA 1ORGA 4XYNA 1RJVA 1F4QA 2LMUA 2L2EA 1EJ3A 1LA0A 1QX5B 2LVJA 3FS7A 2P71A 4OZDA 3R72A 5DKQA 3SS3A 2L4HA 4ORCB 4PE1A 1DJIA 1S5GZ 2ZKMX 3RM1A 3VGOA 2BBNA 3NGVA 5I2LA 3CZTX 3AKAA 4QJ4B 1WLZA 2Y5IA 3S0DA 5IBWA 1LINA 1YX7A 1SY9A 3O4XA 5EL2A 2G9BA 1DQEA 1C3ZA 2CBLA 4Q04A 2ZN9A 4R1EA 1FI5A 3CGAA 3PFVA 4L9MA 2JULA 1UWOA 2F8PA 1MQ1A 2LUCA 1NX0A 1WRKA 2LM5A 2MJWB 2QEVA 1H8BA 1YVLA 3LLEA 2BNXA 1S6CA 1B9AA 2JC2A 2LVKA 1CTRA 5CSIA 5J3XA 2NLNA 4PE0A 2F2OA 1XVJA 1UHHA 5FI6A 4F0ZB 1DT7B 2K7OA 2LV7A 3VRPA 1CFCA 2F2PA 1B8LA 2EHBA 2KGRA 2L50A 5ER4X 1PSBA 3WHTB 2BKHB 1SSEB 1Y1AA 5AXIA 1QIVA 4HREE 1WLMA 3RLZA 4MRXA 2BE4A 4ORAB 4N5XA 2MLFC 1XFRA 2GGZA 2M1KB 1JC2A 1K8UA 3GK1A 3M0WA 1GM0A 1KSMA 1SW8A 2WCEA 3TDZA 1LS8A 1K2HA 2GV5A 1Y0VH 1XFWO 1AK8A 2LLUA 1MUXA 3DF0B 1L7ZA 2AUCA 3TDIA 1W7IB 3CR4X 1ALVA 1CB1A 4OVNF 1D1OA 5KU1A 3TUYB 1RWYA 3TS5C 1MHOA 2PVBA 1CFDA 3I5HB 4IJ7A 5D3OA 2JTZA 3VRQA 1J55A 3CLNA 1DELA 3OB1B 2ERBA 2HQWA 2OS8C 1XK4C 3AAKA 2K2AA 2KI4C 1TRFA 1NCZA 1TCOB 1IJ5A 1PALA 1WDCB 1CFPA 4C0KA 1F4OA 1QTXA 2ZRTA 4PHMA 3D74A 3AKBA 3NSLA 2SASA 1K9KA 1K93D 1KK8C 1OOJA 2H61A 3PALA 3WNXB 1PK0D 1S26D 4I5LB 1P28A 5PALA 3SG7A 4OKHA 3PATA 1WRZA 2E6WA 1OOIX 2CCMA 2BCXA 3DVEA 1DF0B 4YI8A 4USLA 3CZ2A 2QEOA 3D76A 2Q4UA 3KPXA 1C7WA 3L4LA 1DVIA 1L2OC 2I18A 2KOTA 5CSJA 3OX6A 4PHJA 2F3ZA 1IJ6A 4F7FA 3WXAA 2PASA 4MLWA 1S3PA 2ZNEA 2DOQA 2OTGC 1GJYA 2BECA 1XFVO 2L4IA 4DUQA 1JUOA 3BUMB 1CDMA 3FIAA 2GGMA 4GAOA 1AVSA 1DJHA 2KI6C 3B88A 5CPVA 2M3WA 3S0BA 1KCYA 2KAXA 3DVKA 1XFYO 2M29A 1F70A 4GFTA 3PJIA 1NUBA 3DF0A 1TTXA 2ZFDA 5B8IB 2LVIA 1GQMA 3Q8IA 1TNXA 3EVRA 1SCMC 1RFJA 1CFFA 4MEWA 1QATA 2M0RA 1B8CA 2V53A 1AUIB 1K96A 4CIDA 5HKYA 5D69A 2K8MB 4WQ2A 3EK8A 3PN7B 2M97A 2KQ6A 1AHRA 3SG3A 2LAPA 3I5IB 3B7AA 3SG5A 1YUTA 1IRJA 1QJTA 1XYDA 1QX2A 2LUXA 4MVFA 4YGDB 1BF5A 1JF2A 1CLBA 1IIOA 1AJ4A 2EGDA 2M8UA 3B6XA 3GOFA 5DICA 1AJ5A 3SJSA 2QACA 1PSRA 1NWDA 3D77A 1BOCA 1FW4A 1FPWA 4I5JA 1CDPA 1YRTB 1DF0A 1QLKA 1OOHA 1NX2A 2LNKA 3BYAA 3I5FC 3MSEB 1DJWA 3SG6A 1UHIA 2OS8B 2H8VA 3UO9A 4AQJA 3R1PA 1MXEA 2KLEA 1ZFSA 1KSOA 4KYNA 3SS5A 2KI4B 1YRUB 4P2YB 2LMVA 4YRUA 2K2FA 3B86A 5KSZA 1PVBA 1EG4A 1N2DA 2ZN8A 3GK2A 1TIZA 1G33A 3D78A 3HX4A 4ICBA 3DY9A 1CKKA 1KK8B 1LXFC 1CMGA 1J7PA 1FF1A 2MRDA 1IQ3A 5CSNA 3CR5X 3D73A 4QJ5B 1C07A 1SMGA 2CT9A 1DJYA 1KFUL 3TZ1A 1QVIY 4C0JA 2JRFA 2LHIA 4YI9A 3EKHA 2WCKA 1KFXS 1DGVA 1X02A 4PALA 3LL8B 1SL7A 2CXJA 4PCWA 2JQ6A 3K1EA 2F3YA 4PT1A 1N65A 1PULA 3JVTC 2Y1MA 4FQTA 2K7DA 2QDIA 1NCYA 2LLSA 2KAVA 1SR6C 1OZOA 3BUXB 1MR8A 5HYDA 2D8NA 1A29A 2WCFA 1QV0A 1AP4A 2KHNA 1YVHA 4GNKB 3BQ3A 3SS4A 1R6PA 1UHKA 1OW4A 3QRXA 1K94A 2EC6C 2I7AA 1GGZA 1SKTA 3PM2A 1UURA 3VRNA 3WHUB 3BXKA 2WORA 2VRGA 3V2LA 1SCVA 3QMEA 1UP5A 3BUWB 4MZKA 2KFGA 4FQOA 3ICBA 2OPOA 2KSPA 3KF9A 1JF0A 2WC6A 3PM8A 1KFXL 3CS1A 3SG2A 4GGNA 1YTZC 4GUKA 4BY4A 1CLMA 1YR5A 1G8IA 1FI6A 1LVCD 1XO5A 2E30A 3KEVA 1XFUO 1G4YR 1TUJA 3BFBA 3F45A 1XFZO 1XK4A 5HLVA 2JZIA 2F33A 1W9ZA 1SRAA 1DTLA 2K7BA 3BFAA 4ORBB 3HCMA 2FJUB 3I5GB 3A4UB 4N1FA 1KQMC 1BLQA 4ZCVA 3FE8A 2I2RE 1M45A 2A4JA 2WCBA 3CZ0A 4PDZA 2LC5A 2WNDA 2KFHA 4A4BA 1A75B 2HF5A 4QJ3B 3IQQA 1KK7Y 2JNXA 1EXRA 4TNCA 1IQ5A 1EL4A 1IWQA 1TCFA 3VB1A 3BUNB 1W7JB 1HT9A 2JXLA 3RZSA 1BMOA 1B7TY 1OE9B 3FWBA 1Q80A 1JFJA 1XA5A 1F8HA 4INXA 1NX1A 4JD9A 1PRWA 4UPGA 5HLOA 1OMRA 1SBJA 1S6JA 1UHNA 3NHTA 2LLTA 1R2UA 1DC1A 2G2BA 3ZWHA 1KQVA 1Y1UA 1CMFA 1Y1XA 1A03A 1TUZA 1CLLA 4E68A 4CFQA 1S6IA 1BODA 3JVTB 3JTDC 2KQYA 1TWOA 3NSIA 2KYFA 1SR6B 2BL0C 4OCIA 1RK9A 1DGUA 5ER5A 2M1UA 1ZUZA 1TNQA 4FTGA 3DYEA 1H4BA 1KWOC 1SL8A 3ZNIA 1T14A 1BJFA 1UUSA 3EG5B 4P5OE 2QEBA 1SK6D 1DJZA 1BR4B 1TNPA 1YUSA 1SL9A 2M7NA 4INWA 1A2XA 5FYXA 3NSKA 2JT8A 2LHLA 3EVUA 1NCXA 5F6TA 5HKZA 2YGUA 3FE9A 5AFPA 2JWWA 3BOWA 1SNLA 1ZMZA 1N0YA 3S0FA 4CPVA 1RTP1 1SPYA 3TS5B 2JOJA 5HL1A 3OP0A 4PE7A 3TUYC 1A75A 2JT0A 3SG4A 4C0LA 3CTNA 3I5HC 1K90D 2KDHA 1WRLA 1QV1A 1QLSA 2KGBC 1J7RA 2O60A 3OBVA 4MBEA 2JPOA 2BCBA 1S5GY 2JXCA 3L47A 1FBVA 3NHIA 4MZLA 3OB2B 5BPJA 4M2PA 1B4CA 4A4CA 4JPZB 1JFKA 4XJKA 2TN4A 1EH2A 1IKUA 3D75A 2I94A 2JTTA 2MA2A 2K0JA 1BT6A 2NXQA 2QPTA 5KTYA 1NX3A 5I8NA 2WCHA 1CDLA 5DKRA 1RROA 4GGFC 3DZTA 5FI7A 4GPLB 1L2OB 4JKTA 1CNPA 3EVVA 3UNWA 5AANA 1QXPA 3N7HA 3PSRA 5G08A 1DJXA 1TN4A 3O6BA 2LANA 2MBXA 2L2CA 2JT3A 2HQ8A 3LK1A 1OOFA 1EG3A 1NSHA 1NYAA 2KBIA 2MAZA 3KO0A 3O4YA 4NDDA 4DIRA 1ODBA 2L0PA 1ALWA 1MXLC 2OTGB 3DVJA 1UHJA 1GGWA 3CYZA 5I2OA 2MLEC 3R1VA 1OZSA 2PMYA 3VROA 2B1UA 2JNFA 5GQQC 2PALA 1QX7A 4NDCA 4OV2A 1DEKA 4I5NB 4M2QA 1IGVA 1BG1A 1QVIZ 1JBAA 1CM1A 1F55A 3A8RA 1CM4A 2LP3A 3JTDB 1IH0A 3R1OA 3C1VA 1OOGA 2BL0B 4PHNA 2WOSA 1SCMB 1CDNA 3H4SE 1C7VA 2LVVA 5K89A 1B8RA 4BY5A 3S0EA 1KWOB 4ETOA 1ZACA 2FCEA 2LP2A 3IQOA 2KI6D 2M49B 3AAJA 1U5IB 2LCPA 2M9GA 3LCPC 2L5YA 3DD4A 4AQIA 2ISDA 1M31A 3OHMB 1BR1B 2WCJA 3PN7C 2ZNDA 2RGIA 5DKNA 2ZRSA 1M39A 3CR2A 3I5IC 2LMTA 1J7QA 1Y6WA 1OMDA 2JPTA 2QEHA 3BFHA 2FJYA 4YGAA 3BOWB 1OSAA 1Z4HA 2K7CA 1QIWA 3D0YB 4NDBA 1NP8A 2BAPA 3OX5A 4DS7A 4JWQA 2PYQA 4HRHA 4MSPA 3I5FB 1OQPA 4HRGA 2L5XB 2HETA 2L98A 1TNWA
chains in the Genus database with same CATH topology
2LE9B 2KFFA 4WRIA 4I5KA 2AAOA 3EKJA 2Q91A 3NXAA 1JSAA 1V1GA 2CTNA 5D7FA 3KHEA 5I2QA 1YX8A 1JWDA 1QS7A 4GBAA 4XJKB 1WY9A 4OR9B 2H61C 3O78A 3CWGA 4JQ0D 1NPQA 1LA3A 2BE6A 3DVMA 2FOTA 4N1GA 1HQVA 4ZCUA 4U8DA 2KAYA 2SCPA 2BCAA 1NIWA 5AEQA 3FWCA 3SIAA 1E8AA 1BU3A 4YBHB 1KK7Z 2Y1NA 2M7LA 2KYCA 1IG5A 1S36A 4CFRA 1M63B 4D1EA 1RECA 4MZJA 3NSOA 1B7TZ 2BKIB 1U5IA 1QASA 4PE4A 5AERA 1DJGA 3BUOB 2EC6B 3O2PA 5JJGA 2P6BB 4CLNA 4AOMA 3LK0A 1B1GA 2KBMA 1B47A 1XFXO 2KNEA 1S1EA 3GK4X 2NCPA 3D0YA 3K21A 2FCDA 1J7OA 2WC8A 3SIBA 5JOLA 2K61A 5CSFA 1F54A 1SYMA 2IS9A 1YUUA 2H2KA 2NZ0A 2R2IA 2Y4QA 3PLFB 3EK4A 4MRYA 1A4PA 3E3RA 3TDUA 2AMIA 3IF7A 4YGCB 2CNPA 1F71A 4M2OA 5TNCA 2MHHA 1KFUS 1VRKA 4DCKA 4MN0A 1KQMB 3I5GC 1OMVA 1LKJA 1M46A 1PVAA 1K9PA 1WDCC 1YURA 2COLB 2PSRA 4NQGA 4PHKA 4YGBB 3D10A 1MWNA 4WQ3A 1V1FA 2O5GA 1DMOA 2BBMA 3VRRA 1TOPA 3EK7A 1ZOTB 2NCOA 4DRWA 1J1EA 4YGEB 4GGFA 2JU0A 1J1DA 1K9UA 1K95A 2HPSA 2L51A 4HSZA 5HKWA 4IL1A 1MF8B 2PRUA 4XYNA 1RJVA 1F4QA 2LMUA 2L2EA 1EJ3A 1LA0A 1QX5B 2LVJA 3FS7A 5DKQA 2L4HA 4ORCB 4PE1A 1DJIA 1S5GZ 2ZKMX 3RM1A 3VGOA 2BBNA 5I2LA 3CZTX 3AKAA 4QJ4B 1WLZA 2Y5IA 5IBWA 1LINA 1YX7A 1SY9A 2G9BA 2CBLA 4Q04A 2ZN9A 4R1EA 1FI5A 3CGAA 3PFVA 4L9MA 2JULA 1UWOA 2F8PA 1MQ1A 2LUCA 1NX0A 1WRKA 2LM5A 2MJWB 1H8BA 1YVLA 3LLEA 1S6CA 1B9AA 2JC2A 2LVKA 1CTRA 5CSIA 5J3XA 2NLNA 4PE0A 2F2OA 1XVJA 1UHHA 4F0ZB 1DT7B 2K7OA 2LV7A 3VRPA 1CFCA 2F2PA 1B8LA 2EHBA 2KGRA 2L50A 5ER4X 1PSBA 3WHTB 2BKHB 1Y1AA 5AXIA 1QIVA 4HREE 1WLMA 3RLZA 4MRXA 2BE4A 4ORAB 4N5XA 2MLFC 2GGZA 2M1KB 1JC2A 1K8UA 3GK1A 3M0WA 1KSMA 1SW8A 2WCEA 3TDZA 1K2HA 2GV5A 1Y0VH 1XFWO 1AK8A 2LLUA 1MUXA 3DF0B 1L7ZA 2AUCA 3TDIA 1W7IB 3CR4X 1ALVA 1CB1A 4OVNF 1D1OA 5KU1A 3TUYB 1RWYA 3TS5C 1MHOA 2PVBA 1CFDA 3I5HB 3VRQA 2JTZA 1J55A 3CLNA 3OB1B 2HQWA 2OS8C 1XK4C 3AAKA 2K2AA 2KI4C 1TRFA 1NCZA 1TCOB 1IJ5A 1PALA 1WDCB 1CFPA 4C0KA 1F4OA 1QTXA 2ZRTA 4PHMA 3AKBA 3NSLA 2SASA 1K9KA 1K93D 1KK8C 1OOJA 2H61A 3PALA 3WNXB 1PK0D 1S26D 4I5LB 5PALA 3SG7A 4OKHA 3PATA 1WRZA 2E6WA 2CCMA 3DVEA 2BCXA 4YI8A 1DF0B 4USLA 5CSJA 2Q4UA 3KPXA 1C7WA 1DVIA 1L2OC 2I18A 2KOTA 3OX6A 4PHJA 2F3ZA 1IJ6A 3WXAA 2PASA 4MLWA 1S3PA 2ZNEA 2DOQA 2OTGC 1GJYA 2BECA 1XFVO 2L4IA 4DUQA 1JUOA 3BUMB 1CDMA 3FIAA 2GGMA 4GAOA 1AVSA 1DJHA 2KI6C 5CPVA 2M3WA 1KCYA 2KAXA 3DVKA 1XFYO 2M29A 1F70A 4GFTA 1NUBA 3DF0A 1TTXA 2ZFDA 5B8IB 2LVIA 1GQMA 1CFFA 1TNXA 3EVRA 1SCMC 1RFJA 4MEWA 1QATA 2M0RA 1B8CA 2V53A 1AUIB 1K96A 4CIDA 5HKYA 5D69A 2K8MB 4WQ2A 3EK8A 3PN7B 2M97A 2KQ6A 1AHRA 3SG3A 2LAPA 3I5IB 3SG5A 1YUTA 1IRJA 1QJTA 1QX2A 1XYDA 2LUXA 4MVFA 4YGDB 1BF5A 1JF2A 1CLBA 1AJ4A 2EGDA 2M8UA 3GOFA 1AJ5A 3SJSA 2QACA 1PSRA 1NWDA 1BOCA 1FPWA 1FW4A 4I5JA 1CDPA 1YRTB 1DF0A 1QLKA 1NX2A 3BYAA 2LNKA 3I5FC 3MSEB 3SG6A 1DJWA 4AQJA 1UHIA 2OS8B 1MXEA 1ZFSA 1KSOA 2KI4B 1YRUB 4P2YB 2LMVA 4YRUA 2K2FA 5KSZA 1PVBA 1EG4A 1N2DA 2ZN8A 3GK2A 1TIZA 1G33A 3HX4A 4ICBA 1CKKA 1J7PA 1FF1A 1KK8B 1LXFC 1CMGA 2MRDA 1IQ3A 5CSNA 3CR5X 4QJ5B 1C07A 1SMGA 2CT9A 1DJYA 1KFUL 3TZ1A 1QVIY 4C0JA 2JRFA 2LHIA 4YI9A 3EKHA 1KFXS 1DGVA 1X02A 4PALA 3LL8B 1SL7A 2CXJA 4PCWA 2JQ6A 2F3YA 1N65A 1PULA 3JVTC 2Y1MA 2K7DA 1NCYA 2LLSA 2KAVA 1SR6C 1OZOA 3BUXB 1MR8A 5HYDA 2D8NA 1A29A 2WCFA 1QV0A 1AP4A 2KHNA 1YVHA 4GNKB 3BQ3A 1R6PA 1UHKA 3QRXA 1K94A 2EC6C 2I7AA 1GGZA 1SKTA 1UURA 3VRNA 3WHUB 3BXKA 2WORA 2VRGA 1SCVA 1UP5A 3BUWB 4MZKA 2KFGA 4FQOA 3ICBA 2OPOA 2KSPA 3KF9A 1JF0A 3PM8A 1KFXL 3CS1A 3SG2A 4GGNA 1YTZC 4GUKA 4BY4A 1CLMA 1YR5A 1G8IA 1FI6A 1LVCD 1XO5A 2E30A 3KEVA 1XFUO 1G4YR 3F45A 1XFZO 1XK4A 5HLVA 2JZIA 2F33A 1SRAA 1DTLA 2K7BA 4ORBB 3HCMA 2FJUB 3I5GB 3A4UB 4N1FA 1KQMC 1BLQA 4ZCVA 2I2RE 1M45A 2A4JA 2WCBA 4PDZA 2LC5A 2WNDA 2KFHA 4A4BA 1A75B 2HF5A 4QJ3B 3IQQA 1KK7Y 2JNXA 1EXRA 4TNCA 1IQ5A 1EL4A 1IWQA 1TCFA 3BUNB 1W7JB 1HT9A 2JXLA 1BMOA 1B7TY 1OE9B 3FWBA 1Q80A 1JFJA 1XA5A 1F8HA 1NX1A 1PRWA 4UPGA 5HLOA 1OMRA 1SBJA 1S6JA 1UHNA 2LLTA 1R2UA 2G2BA 3ZWHA 1KQVA 1Y1UA 1CMFA 1Y1XA 1A03A 1CLLA 4E68A 4CFQA 1S6IA 1BODA 3JVTB 3JTDC 2KQYA 3NSIA 2KYFA 1SR6B 2BL0C 4OCIA 1RK9A 1DGUA 5ER5A 2M1UA 1ZUZA 1TNQA 4FTGA 1H4BA 1KWOC 1SL8A 3ZNIA 1BJFA 1UUSA 4P5OE 1SK6D 1DJZA 1BR4B 1TNPA 1YUSA 1SL9A 2M7NA 5FYXA 1A2XA 3NSKA 2JT8A 2LHLA 3EVUA 1NCXA 5F6TA 5HKZA 5AFPA 2JWWA 3BOWA 1SNLA 1ZMZA 1N0YA 4CPVA 1RTP1 1SPYA 3TS5B 2JOJA 3OP0A 4PE7A 3TUYC 1A75A 2JT0A 3SG4A 4C0LA 3CTNA 3I5HC 1K90D 2KDHA 1WRLA 1QV1A 1QLSA 2KGBC 1J7RA 2O60A 4MBEA 2BCBA 1S5GY 2JXCA 4MZLA 1FBVA 3OB2B 5BPJA 4M2PA 1B4CA 4A4CA 4JPZB 1JFKA 4XJKA 2TN4A 1EH2A 1IKUA 2I94A 2JTTA 2MA2A 2K0JA 1BT6A 2NXQA 2QPTA 5KTYA 1NX3A 5I8NA 1CDLA 5DKRA 1RROA 4GGFC 1CNPA 4GPLB 1L2OB 3EVVA 5AANA 1QXPA 3PSRA 5G08A 1DJXA 1TN4A 3O6BA 2LANA 2MBXA 2JT3A 2HQ8A 3LK1A 1EG3A 1NSHA 1NYAA 2KBIA 2MAZA 3KO0A 3O4YA 4NDDA 4DIRA 1ODBA 2L0PA 1ALWA 1MXLC 2OTGB 3DVJA 1UHJA 1GGWA 5I2OA 2MLEC 1OZSA 2PMYA 3VROA 2B1UA 2JNFA 5GQQC 2PALA 1QX7A 4NDCA 4OV2A 4I5NB 4M2QA 1IGVA 1BG1A 1QVIZ 1JBAA 1CM1A 1F55A 3A8RA 1CM4A 2LP3A 3JTDB 1IH0A 3C1VA 2BL0B 4PHNA 2WOSA 1SCMB 1CDNA 3H4SE 1C7VA 2LVVA 5K89A 1B8RA 4BY5A 4ETOA 1KWOB 1ZACA 2FCEA 2LP2A 3IQOA 2KI6D 2M49B 3AAJA 1U5IB 2LCPA 2M9GA 3LCPC 3DD4A 4AQIA 2ISDA 1M31A 3OHMB 1BR1B 3PN7C 2ZNDA 2RGIA 5DKNA 2ZRSA 1M39A 3CR2A 3I5IC 2LMTA 1J7QA 1OMDA 1Y6WA 2JPTA 4YGAA 3BOWB 1OSAA 2K7CA 3D0YB 1QIWA 4NDBA 1NP8A 4DS7A 3OX5A 4JWQA 4HRHA 4MSPA 3I5FB 1OQPA 4HRGA 2L5XB 2HETA 2L98A 1TNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE9 B;  2KFF A;  4WRI A;  4I5K A;  2AAO A;  3EKJ A;  2Q91 A;  3NXA A;  1JSA A;  1V1G A;  2CTN A;  5D7F A;  3KHE A;  5I2Q A;  1YX8 A;  1JWD A;  1QS7 A;  4GBA A;  4XJK B;  1WY9 A;  4OR9 B;  2H61 C;  3O78 A;  3CWG A;  4JQ0 D;  1NPQ A;  1LA3 A;  2BE6 A;  3DVM A;  2FOT A;  4N1G A;  1HQV A;  4ZCU A;  4U8D A;  2KAY A;  2SCP A;  2BCA A;  1NIW A;  5AEQ A;  3FWC A;  3SIA A;  1E8A A;  1BU3 A;  4YBH B;  1KK7 Z;  2Y1N A;  2M7L A;  2KYC A;  1IG5 A;  1S36 A;  4CFR A;  1M63 B;  4D1E A;  1REC A;  4MZJ A;  3NSO A;  1B7T Z;  2BKI B;  1U5I A;  1QAS A;  4PE4 A;  5AER A;  1DJG A;  3BUO B;  2EC6 B;  3O2P A;  5JJG A;  2P6B B;  4CLN A;  4AOM A;  3LK0 A;  1B1G A;  2KBM A;  1B47 A;  1XFX O;  2KNE A;  1S1E A;  3GK4 X;  2NCP A;  3D0Y A;  3K21 A;  2FCD A;  1J7O A;  2WC8 A;  3SIB A;  5JOL A;  2K61 A;  5CSF A;  1F54 A;  1SYM A;  2IS9 A;  1YUU A;  2H2K A;  2NZ0 A;  2R2I A;  2Y4Q A;  3PLF B;  3EK4 A;  4MRY A;  1A4P A;  3E3R A;  3TDU A;  2AMI A;  3IF7 A;  4YGC B;  2CNP A;  1F71 A;  4M2O A;  5TNC A;  2MHH A;  1KFU S;  1VRK A;  4DCK A;  4MN0 A;  1KQM B;  3I5G C;  1OMV A;  1LKJ A;  1M46 A;  1PVA A;  1K9P A;  1WDC C;  1YUR A;  2COL B;  2PSR A;  4NQG A;  4PHK A;  4YGB B;  3D10 A;  1MWN A;  4WQ3 A;  1V1F A;  2O5G A;  1DMO A;  2BBM A;  3VRR A;  1TOP A;  3EK7 A;  1ZOT B;  2NCO A;  4DRW A;  1J1E A;  4YGE B;  4GGF A;  2JU0 A;  1J1D A;  1K9U A;  1K95 A;  2HPS A;  2L51 A;  4HSZ A;  5HKW A;  4IL1 A;  1MF8 B;  2PRU A;  4XYN A;  1RJV A;  1F4Q A;  2LMU A;  2L2E A;  1EJ3 A;  1LA0 A;  1QX5 B;  2LVJ A;  3FS7 A;  5DKQ A;  2L4H A;  4ORC B;  4PE1 A;  1DJI A;  1S5G Z;  2ZKM X;  3RM1 A;  3VGO A;  2BBN A;  5I2L A;  3CZT X;  3AKA A;  4QJ4 B;  1WLZ A;  2Y5I A;  5IBW A;  1LIN A;  1YX7 A;  1SY9 A;  2G9B A;  2CBL A;  4Q04 A;  2ZN9 A;  4R1E A;  1FI5 A;  3CGA A;  3PFV A;  4L9M A;  2JUL A;  1UWO A;  2F8P A;  1MQ1 A;  2LUC A;  1NX0 A;  1WRK A;  2LM5 A;  2MJW B;  1H8B A;  1YVL A;  3LLE A;  1S6C A;  1B9A A;  2JC2 A;  2LVK A;  1CTR A;  5CSI A;  5J3X A;  2NLN A;  4PE0 A;  2F2O A;  1XVJ A;  1UHH A;  4F0Z B;  1DT7 B;  2K7O A;  2LV7 A;  3VRP A;  1CFC A;  2F2P A;  1B8L A;  2EHB A;  2KGR A;  2L50 A;  5ER4 X;  1PSB A;  3WHT B;  2BKH B;  1Y1A A;  5AXI A;  1QIV A;  4HRE E;  1WLM A;  3RLZ A;  4MRX A;  2BE4 A;  4ORA B;  4N5X A;  2MLF C;  2GGZ A;  2M1K B;  1JC2 A;  1K8U A;  3GK1 A;  3M0W A;  1KSM A;  1SW8 A;  2WCE A;  3TDZ A;  1K2H A;  2GV5 A;  1Y0V H;  1XFW O;  1AK8 A;  2LLU A;  1MUX A;  3DF0 B;  1L7Z A;  2AUC A;  3TDI A;  1W7I B;  3CR4 X;  1ALV A;  1CB1 A;  4OVN F;  1D1O A;  5KU1 A;  3TUY B;  1RWY A;  3TS5 C;  1MHO A;  2PVB A;  1CFD A;  3I5H B;  3VRQ A;  2JTZ A;  1J55 A;  3CLN A;  3OB1 B;  2HQW A;  2OS8 C;  1XK4 C;  3AAK A;  2K2A A;  2KI4 C;  1TRF A;  1NCZ A;  1TCO B;  1IJ5 A;  1PAL A;  1WDC B;  1CFP A;  4C0K A;  1F4O A;  1QTX A;  2ZRT A;  4PHM A;  3AKB A;  3NSL A;  2SAS A;  1K9K A;  1K93 D;  1KK8 C;  1OOJ A;  2H61 A;  3PAL A;  3WNX B;  1PK0 D;  1S26 D;  4I5L B;  5PAL A;  3SG7 A;  4OKH A;  3PAT A;  1WRZ A;  2E6W A;  2CCM A;  3DVE A;  2BCX A;  4YI8 A;  1DF0 B;  4USL A;  5CSJ A;  2Q4U A;  3KPX A;  1C7W A;  1DVI A;  1L2O C;  2I18 A;  2KOT A;  3OX6 A;  4PHJ A;  2F3Z A;  1IJ6 A;  3WXA A;  2PAS A;  4MLW A;  1S3P A;  2ZNE A;  2DOQ A;  2OTG C;  1GJY A;  2BEC A;  1XFV O;  2L4I A;  4DUQ A;  1JUO A;  3BUM B;  1CDM A;  3FIA A;  2GGM A;  4GAO A;  1AVS A;  1DJH A;  2KI6 C;  5CPV A;  2M3W A;  1KCY A;  2KAX A;  3DVK A;  1XFY O;  2M29 A;  1F70 A;  4GFT A;  1NUB A;  3DF0 A;  1TTX A;  2ZFD A;  5B8I B;  2LVI A;  1GQM A;  1CFF A;  1TNX A;  3EVR A;  1SCM C;  1RFJ A;  4MEW A;  1QAT A;  2M0R A;  1B8C A;  2V53 A;  1AUI B;  1K96 A;  4CID A;  5HKY A;  5D69 A;  2K8M B;  4WQ2 A;  3EK8 A;  3PN7 B;  2M97 A;  2KQ6 A;  1AHR A;  3SG3 A;  2LAP A;  3I5I B;  3SG5 A;  1YUT A;  1IRJ A;  1QJT A;  1QX2 A;  1XYD A;  2LUX A;  4MVF A;  4YGD B;  1BF5 A;  1JF2 A;  1CLB A;  1AJ4 A;  2EGD A;  2M8U A;  3GOF A;  1AJ5 A;  3SJS A;  2QAC A;  1PSR A;  1NWD A;  1BOC A;  1FPW A;  1FW4 A;  4I5J A;  1CDP A;  1YRT B;  1DF0 A;  1QLK A;  1NX2 A;  3BYA A;  2LNK A;  3I5F C;  3MSE B;  3SG6 A;  1DJW A;  4AQJ A;  1UHI A;  2OS8 B;  1MXE A;  1ZFS A;  1KSO A;  2KI4 B;  1YRU B;  4P2Y B;  2LMV A;  4YRU A;  2K2F A;  5KSZ A;  1PVB A;  1EG4 A;  1N2D A;  2ZN8 A;  3GK2 A;  1TIZ A;  1G33 A;  3HX4 A;  4ICB A;  1CKK A;  1J7P A;  1FF1 A;  1KK8 B;  1LXF C;  1CMG A;  2MRD A;  1IQ3 A;  5CSN A;  3CR5 X;  4QJ5 B;  1C07 A;  1SMG A;  2CT9 A;  1DJY A;  1KFU L;  3TZ1 A;  1QVI Y;  4C0J A;  2JRF A;  2LHI A;  4YI9 A;  3EKH A;  1KFX S;  1DGV A;  1X02 A;  4PAL A;  3LL8 B;  1SL7 A;  2CXJ A;  4PCW A;  2JQ6 A;  2F3Y A;  1N65 A;  1PUL A;  3JVT C;  2Y1M A;  2K7D A;  1NCY A;  2LLS A;  2KAV A;  1SR6 C;  1OZO A;  3BUX B;  1MR8 A;  5HYD A;  2D8N A;  1A29 A;  2WCF A;  1QV0 A;  1AP4 A;  2KHN A;  1YVH A;  4GNK B;  3BQ3 A;  1R6P A;  1UHK A;  3QRX A;  1K94 A;  2EC6 C;  2I7A A;  1GGZ A;  1SKT A;  1UUR A;  3VRN A;  3WHU B;  3BXK A;  2WOR A;  2VRG A;  1SCV A;  1UP5 A;  3BUW B;  4MZK A;  2KFG A;  4FQO A;  3ICB A;  2OPO A;  2KSP A;  3KF9 A;  1JF0 A;  3PM8 A;  1KFX L;  3CS1 A;  3SG2 A;  4GGN A;  1YTZ C;  4GUK A;  4BY4 A;  1CLM A;  1YR5 A;  1G8I A;  1FI6 A;  1LVC D;  1XO5 A;  2E30 A;  3KEV A;  1XFU O;  1G4Y R;  3F45 A;  1XFZ O;  1XK4 A;  5HLV A;  2JZI A;  2F33 A;  1SRA A;  1DTL A;  2K7B A;  4ORB B;  3HCM A;  2FJU B;  3I5G B;  3A4U B;  4N1F A;  1KQM C;  1BLQ A;  4ZCV A;  2I2R E;  1M45 A;  2A4J A;  2WCB A;  4PDZ A;  2LC5 A;  2WND A;  2KFH A;  4A4B A;  1A75 B;  2HF5 A;  4QJ3 B;  3IQQ A;  1KK7 Y;  2JNX A;  1EXR A;  4TNC A;  1IQ5 A;  1EL4 A;  1IWQ A;  1TCF A;  3BUN B;  1W7J B;  1HT9 A;  2JXL A;  1BMO A;  1B7T Y;  1OE9 B;  3FWB A;  1Q80 A;  1JFJ A;  1XA5 A;  1F8H A;  1NX1 A;  1PRW A;  4UPG A;  5HLO A;  1OMR A;  1SBJ A;  1S6J A;  1UHN A;  2LLT A;  1R2U A;  2G2B A;  3ZWH A;  1KQV A;  1Y1U A;  1CMF A;  1Y1X A;  1A03 A;  1CLL A;  4E68 A;  4CFQ A;  1S6I A;  1BOD A;  3JVT B;  3JTD C;  2KQY A;  3NSI A;  2KYF A;  1SR6 B;  2BL0 C;  4OCI A;  1RK9 A;  1DGU A;  5ER5 A;  2M1U A;  1ZUZ A;  1TNQ A;  4FTG A;  1H4B A;  1KWO C;  1SL8 A;  3ZNI A;  1BJF A;  1UUS A;  4P5O E;  1SK6 D;  1DJZ A;  1BR4 B;  1TNP A;  1YUS A;  1SL9 A;  2M7N A;  5FYX A;  1A2X A;  3NSK A;  2JT8 A;  2LHL A;  3EVU A;  1NCX A;  5F6T A;  5HKZ A;  5AFP A;  2JWW A;  3BOW A;  1SNL A;  1ZMZ A;  1N0Y A;  4CPV A;  1RTP 1;  1SPY A;  3TS5 B;  2JOJ A;  3OP0 A;  4PE7 A;  3TUY C;  1A75 A;  2JT0 A;  3SG4 A;  4C0L A;  3CTN A;  3I5H C;  1K90 D;  2KDH A;  1WRL A;  1QV1 A;  1QLS A;  2KGB C;  1J7R A;  2O60 A;  4MBE A;  2BCB A;  1S5G Y;  2JXC A;  4MZL A;  1FBV A;  3OB2 B;  5BPJ A;  4M2P A;  1B4C A;  4A4C A;  4JPZ B;  1JFK A;  4XJK A;  2TN4 A;  1EH2 A;  1IKU A;  2I94 A;  2JTT A;  2MA2 A;  2K0J A;  1BT6 A;  2NXQ A;  2QPT A;  5KTY A;  1NX3 A;  5I8N A;  1CDL A;  5DKR A;  1RRO A;  4GGF C;  1CNP A;  4GPL B;  1L2O B;  3EVV A;  5AAN A;  1QXP A;  3PSR A;  5G08 A;  1DJX A;  1TN4 A;  3O6B A;  2LAN A;  2MBX A;  2JT3 A;  2HQ8 A;  3LK1 A;  1EG3 A;  1NSH A;  1NYA A;  2KBI A;  2MAZ A;  3KO0 A;  3O4Y A;  4NDD A;  4DIR A;  1ODB A;  2L0P A;  1ALW A;  1MXL C;  2OTG B;  3DVJ A;  1UHJ A;  1GGW A;  5I2O A;  2MLE C;  1OZS A;  2PMY A;  3VRO A;  2B1U A;  2JNF A;  5GQQ C;  2PAL A;  1QX7 A;  4NDC A;  4OV2 A;  4I5N B;  4M2Q A;  1IGV A;  1BG1 A;  1QVI Z;  1JBA A;  1CM1 A;  1F55 A;  3A8R A;  1CM4 A;  2LP3 A;  3JTD B;  1IH0 A;  3C1V A;  2BL0 B;  4PHN A;  2WOS A;  1SCM B;  1CDN A;  3H4S E;  1C7V A;  2LVV A;  5K89 A;  1B8R A;  4BY5 A;  4ETO A;  1KWO B;  1ZAC A;  2FCE A;  2LP2 A;  3IQO A;  2KI6 D;  2M49 B;  3AAJ A;  1U5I B;  2LCP A;  2M9G A;  3LCP C;  3DD4 A;  4AQI A;  2ISD A;  1M31 A;  3OHM B;  1BR1 B;  3PN7 C;  2ZND A;  2RGI A;  5DKN A;  2ZRS A;  1M39 A;  3CR2 A;  3I5I C;  2LMT A;  1J7Q A;  1OMD A;  1Y6W A;  2JPT A;  4YGA A;  3BOW B;  1OSA A;  2K7C A;  3D0Y B;  1QIW A;  4NDB A;  1NP8 A;  4DS7 A;  3OX5 A;  4JWQ A;  4HRH A;  4MSP A;  3I5F B;  1OQP A;  4HRG A;  2L5X B;  2HET A;  2L98 A;  1TNW A; 
#chains in the Genus database with same CATH topology
 2LE9 B;  2KFF A;  4WRI A;  4I5K A;  2AAO A;  2PQL A;  2Q91 A;  3EKJ A;  3NXA A;  1JSA A;  1V1G A;  3L4A A;  2CTN A;  5D7F A;  3KHE A;  3IVT A;  1YX8 A;  5I2Q A;  1JWD A;  1QS7 A;  3CDN A;  4GBA A;  4XJK B;  1WY9 A;  4OR9 B;  2H61 C;  3O78 A;  3CWG A;  4JQ0 D;  1NPQ A;  1LA3 A;  2BE6 A;  3DVM A;  3BJH A;  2FOT A;  4N1G A;  1HQV A;  4ZCU A;  4U8D A;  2GTE A;  2KAY A;  2SCP A;  2BCA A;  1NIW A;  5AEQ A;  3FWC A;  3SIA A;  3CAB A;  1E8A A;  1BU3 A;  2P70 A;  4YBH B;  1KK7 Z;  2Y1N A;  2M7L A;  2KYC A;  1IG5 A;  1S36 A;  3S0G A;  4CFR A;  3FE6 A;  1M63 B;  3DXL A;  4D1E A;  1REC A;  4MZJ A;  3NSO A;  1B7T Z;  2BKI B;  1U5I A;  1QAS A;  4PE4 A;  5AER A;  1DJG A;  3BUO B;  2EC6 B;  3O2P A;  5JJG A;  3OGN A;  2P6B B;  4CLN A;  5I94 A;  2WC5 A;  2KLD A;  3S0A A;  4AOM A;  3LK0 A;  1B1G A;  2KBM A;  1B47 A;  1XFX O;  2KNE A;  1S1E A;  3GK4 X;  2NCP A;  3D0Y A;  3K21 A;  5FI2 A;  2FCD A;  1J7O A;  2WC8 A;  3SIB A;  5JOL A;  2K61 A;  5CSF A;  2K60 A;  1F54 A;  1SYM A;  2IS9 A;  1YUU A;  2H2K A;  2NZ0 A;  2KPH A;  2R2I A;  1Z2C B;  1QWV A;  2Y4Q A;  3PLF B;  3EK4 A;  4MRY A;  1A4P A;  3CZ1 A;  3E3R A;  3TDU A;  2AMI A;  3IF7 A;  4YGC B;  2CNP A;  1F71 A;  1C3Y A;  4M2O A;  5TNC A;  2MHH A;  1KFU S;  1VRK A;  4DCK A;  2WCL A;  4MN0 A;  1KQM B;  3I5G C;  1OMV A;  1LKJ A;  1M46 A;  1PVA A;  1K9P A;  1WDC C;  1YUR A;  2COL B;  2PSR A;  4NQG A;  4PHK A;  3B87 A;  4YGB B;  3D10 A;  1MWN A;  4WQ3 A;  1V1F A;  2O5G A;  1DMO A;  2BBM A;  3VRR A;  1TOP A;  3EK7 A;  1ZOT B;  2NCO A;  4DRW A;  1J1E A;  4YGE B;  4GGF A;  2JU0 A;  2WCM A;  1J1D A;  1K9U A;  1K95 A;  2HPS A;  2L51 A;  4HSZ A;  5HKW A;  4IL1 A;  1MF8 B;  2PRU A;  1ORG A;  4XYN A;  1RJV A;  1F4Q A;  2LMU A;  2L2E A;  1EJ3 A;  1LA0 A;  1QX5 B;  2LVJ A;  3FS7 A;  2P71 A;  4OZD A;  3R72 A;  5DKQ A;  3SS3 A;  2L4H A;  4ORC B;  4PE1 A;  1DJI A;  1S5G Z;  2ZKM X;  3RM1 A;  3VGO A;  2BBN A;  3NGV A;  5I2L A;  3CZT X;  3AKA A;  4QJ4 B;  1WLZ A;  2Y5I A;  3S0D A;  5IBW A;  1LIN A;  1YX7 A;  1SY9 A;  3O4X A;  5EL2 A;  2G9B A;  1DQE A;  1C3Z A;  2CBL A;  4Q04 A;  2ZN9 A;  4R1E A;  1FI5 A;  3CGA A;  3PFV A;  4L9M A;  2JUL A;  1UWO A;  2F8P A;  1MQ1 A;  2LUC A;  1NX0 A;  1WRK A;  2LM5 A;  2MJW B;  2QEV A;  1H8B A;  1YVL A;  3LLE A;  2BNX A;  1S6C A;  1B9A A;  2JC2 A;  2LVK A;  1CTR A;  5CSI A;  5J3X A;  2NLN A;  4PE0 A;  2F2O A;  1XVJ A;  1UHH A;  5FI6 A;  4F0Z B;  1DT7 B;  2K7O A;  2LV7 A;  3VRP A;  1CFC A;  2F2P A;  1B8L A;  2EHB A;  2KGR A;  2L50 A;  5ER4 X;  1PSB A;  3WHT B;  2BKH B;  1SSE B;  1Y1A A;  5AXI A;  1QIV A;  4HRE E;  1WLM A;  3RLZ A;  4MRX A;  2BE4 A;  4ORA B;  4N5X A;  2MLF C;  1XFR A;  2GGZ A;  2M1K B;  1JC2 A;  1K8U A;  3GK1 A;  3M0W A;  1GM0 A;  1KSM A;  1SW8 A;  2WCE A;  3TDZ A;  1LS8 A;  1K2H A;  2GV5 A;  1Y0V H;  1XFW O;  1AK8 A;  2LLU A;  1MUX A;  3DF0 B;  1L7Z A;  2AUC A;  3TDI A;  1W7I B;  3CR4 X;  1ALV A;  1CB1 A;  4OVN F;  1D1O A;  5KU1 A;  3TUY B;  1RWY A;  3TS5 C;  1MHO A;  2PVB A;  1CFD A;  3I5H B;  4IJ7 A;  5D3O A;  2JTZ A;  3VRQ A;  1J55 A;  3CLN A;  1DEL A;  3OB1 B;  2ERB A;  2HQW A;  2OS8 C;  1XK4 C;  3AAK A;  2K2A A;  2KI4 C;  1TRF A;  1NCZ A;  1TCO B;  1IJ5 A;  1PAL A;  1WDC B;  1CFP A;  4C0K A;  1F4O A;  1QTX A;  2ZRT A;  4PHM A;  3D74 A;  3AKB A;  3NSL A;  2SAS A;  1K9K A;  1K93 D;  1KK8 C;  1OOJ A;  2H61 A;  3PAL A;  3WNX B;  1PK0 D;  1S26 D;  4I5L B;  1P28 A;  5PAL A;  3SG7 A;  4OKH A;  3PAT A;  1WRZ A;  2E6W A;  1OOI X;  2CCM A;  2BCX A;  3DVE A;  1DF0 B;  4YI8 A;  4USL A;  3CZ2 A;  2QEO A;  3D76 A;  2Q4U A;  3KPX A;  1C7W A;  3L4L A;  1DVI A;  1L2O C;  2I18 A;  2KOT A;  5CSJ A;  3OX6 A;  4PHJ A;  2F3Z A;  1IJ6 A;  4F7F A;  3WXA A;  2PAS A;  4MLW A;  1S3P A;  2ZNE A;  2DOQ A;  2OTG C;  1GJY A;  2BEC A;  1XFV O;  2L4I A;  4DUQ A;  1JUO A;  3BUM B;  1CDM A;  3FIA A;  2GGM A;  4GAO A;  1AVS A;  1DJH A;  2KI6 C;  3B88 A;  5CPV A;  2M3W A;  3S0B A;  1KCY A;  2KAX A;  3DVK A;  1XFY O;  2M29 A;  1F70 A;  4GFT A;  3PJI A;  1NUB A;  3DF0 A;  1TTX A;  2ZFD A;  5B8I B;  2LVI A;  1GQM A;  3Q8I A;  1TNX A;  3EVR A;  1SCM C;  1RFJ A;  1CFF A;  4MEW A;  1QAT A;  2M0R A;  1B8C A;  2V53 A;  1AUI B;  1K96 A;  4CID A;  5HKY A;  5D69 A;  2K8M B;  4WQ2 A;  3EK8 A;  3PN7 B;  2M97 A;  2KQ6 A;  1AHR A;  3SG3 A;  2LAP A;  3I5I B;  3B7A A;  3SG5 A;  1YUT A;  1IRJ A;  1QJT A;  1XYD A;  1QX2 A;  2LUX A;  4MVF A;  4YGD B;  1BF5 A;  1JF2 A;  1CLB A;  1IIO A;  1AJ4 A;  2EGD A;  2M8U A;  3B6X A;  3GOF A;  5DIC A;  1AJ5 A;  3SJS A;  2QAC A;  1PSR A;  1NWD A;  3D77 A;  1BOC A;  1FW4 A;  1FPW A;  4I5J A;  1CDP A;  1YRT B;  1DF0 A;  1QLK A;  1OOH A;  1NX2 A;  2LNK A;  3BYA A;  3I5F C;  3MSE B;  1DJW A;  3SG6 A;  1UHI A;  2OS8 B;  2H8V A;  3UO9 A;  4AQJ A;  3R1P A;  1MXE A;  2KLE A;  1ZFS A;  1KSO A;  4KYN A;  3SS5 A;  2KI4 B;  1YRU B;  4P2Y B;  2LMV A;  4YRU A;  2K2F A;  3B86 A;  5KSZ A;  1PVB A;  1EG4 A;  1N2D A;  2ZN8 A;  3GK2 A;  1TIZ A;  1G33 A;  3D78 A;  3HX4 A;  4ICB A;  3DY9 A;  1CKK A;  1KK8 B;  1LXF C;  1CMG A;  1J7P A;  1FF1 A;  2MRD A;  1IQ3 A;  5CSN A;  3CR5 X;  3D73 A;  4QJ5 B;  1C07 A;  1SMG A;  2CT9 A;  1DJY A;  1KFU L;  3TZ1 A;  1QVI Y;  4C0J A;  2JRF A;  2LHI A;  4YI9 A;  3EKH A;  2WCK A;  1KFX S;  1DGV A;  1X02 A;  4PAL A;  3LL8 B;  1SL7 A;  2CXJ A;  4PCW A;  2JQ6 A;  3K1E A;  2F3Y A;  4PT1 A;  1N65 A;  1PUL A;  3JVT C;  2Y1M A;  4FQT A;  2K7D A;  2QDI A;  1NCY A;  2LLS A;  2KAV A;  1SR6 C;  1OZO A;  3BUX B;  1MR8 A;  5HYD A;  2D8N A;  1A29 A;  2WCF A;  1QV0 A;  1AP4 A;  2KHN A;  1YVH A;  4GNK B;  3BQ3 A;  3SS4 A;  1R6P A;  1UHK A;  1OW4 A;  3QRX A;  1K94 A;  2EC6 C;  2I7A A;  1GGZ A;  1SKT A;  3PM2 A;  1UUR A;  3VRN A;  3WHU B;  3BXK A;  2WOR A;  2VRG A;  3V2L A;  1SCV A;  3QME A;  1UP5 A;  3BUW B;  4MZK A;  2KFG A;  4FQO A;  3ICB A;  2OPO A;  2KSP A;  3KF9 A;  1JF0 A;  2WC6 A;  3PM8 A;  1KFX L;  3CS1 A;  3SG2 A;  4GGN A;  1YTZ C;  4GUK A;  4BY4 A;  1CLM A;  1YR5 A;  1G8I A;  1FI6 A;  1LVC D;  1XO5 A;  2E30 A;  3KEV A;  1XFU O;  1G4Y R;  1TUJ A;  3BFB A;  3F45 A;  1XFZ O;  1XK4 A;  5HLV A;  2JZI A;  2F33 A;  1W9Z A;  1SRA A;  1DTL A;  2K7B A;  3BFA A;  4ORB B;  3HCM A;  2FJU B;  3I5G B;  3A4U B;  4N1F A;  1KQM C;  1BLQ A;  4ZCV A;  3FE8 A;  2I2R E;  1M45 A;  2A4J A;  2WCB A;  3CZ0 A;  4PDZ A;  2LC5 A;  2WND A;  2KFH A;  4A4B A;  1A75 B;  2HF5 A;  4QJ3 B;  3IQQ A;  1KK7 Y;  2JNX A;  1EXR A;  4TNC A;  1IQ5 A;  1EL4 A;  1IWQ A;  1TCF A;  3VB1 A;  3BUN B;  1W7J B;  1HT9 A;  2JXL A;  3RZS A;  1BMO A;  1B7T Y;  1OE9 B;  3FWB A;  1Q80 A;  1JFJ A;  1XA5 A;  1F8H A;  4INX A;  1NX1 A;  4JD9 A;  1PRW A;  4UPG A;  5HLO A;  1OMR A;  1SBJ A;  1S6J A;  1UHN A;  3NHT A;  2LLT A;  1R2U A;  1DC1 A;  2G2B A;  3ZWH A;  1KQV A;  1Y1U A;  1CMF A;  1Y1X A;  1A03 A;  1TUZ A;  1CLL A;  4E68 A;  4CFQ A;  1S6I A;  1BOD A;  3JVT B;  3JTD C;  2KQY A;  1TWO A;  3NSI A;  2KYF A;  1SR6 B;  2BL0 C;  4OCI A;  1RK9 A;  1DGU A;  5ER5 A;  2M1U A;  1ZUZ A;  1TNQ A;  4FTG A;  3DYE A;  1H4B A;  1KWO C;  1SL8 A;  3ZNI A;  1T14 A;  1BJF A;  1UUS A;  3EG5 B;  4P5O E;  2QEB A;  1SK6 D;  1DJZ A;  1BR4 B;  1TNP A;  1YUS A;  1SL9 A;  2M7N A;  4INW A;  1A2X A;  5FYX A;  3NSK A;  2JT8 A;  2LHL A;  3EVU A;  1NCX A;  5F6T A;  5HKZ A;  2YGU A;  3FE9 A;  5AFP A;  2JWW A;  3BOW A;  1SNL A;  1ZMZ A;  1N0Y A;  3S0F A;  4CPV A;  1RTP 1;  1SPY A;  3TS5 B;  2JOJ A;  5HL1 A;  3OP0 A;  4PE7 A;  3TUY C;  1A75 A;  2JT0 A;  3SG4 A;  4C0L A;  3CTN A;  3I5H C;  1K90 D;  2KDH A;  1WRL A;  1QV1 A;  1QLS A;  2KGB C;  1J7R A;  2O60 A;  3OBV A;  4MBE A;  2JPO A;  2BCB A;  1S5G Y;  2JXC A;  3L47 A;  1FBV A;  3NHI A;  4MZL A;  3OB2 B;  5BPJ A;  4M2P A;  1B4C A;  4A4C A;  4JPZ B;  1JFK A;  4XJK A;  2TN4 A;  1EH2 A;  1IKU A;  3D75 A;  2I94 A;  2JTT A;  2MA2 A;  2K0J A;  1BT6 A;  2NXQ A;  2QPT A;  5KTY A;  1NX3 A;  5I8N A;  2WCH A;  1CDL A;  5DKR A;  1RRO A;  4GGF C;  3DZT A;  5FI7 A;  4GPL B;  1L2O B;  4JKT A;  1CNP A;  3EVV A;  3UNW A;  5AAN A;  1QXP A;  3N7H A;  3PSR A;  5G08 A;  1DJX A;  1TN4 A;  3O6B A;  2LAN A;  2MBX A;  2L2C A;  2JT3 A;  2HQ8 A;  3LK1 A;  1OOF A;  1EG3 A;  1NSH A;  1NYA A;  2KBI A;  2MAZ A;  3KO0 A;  3O4Y A;  4NDD A;  4DIR A;  1ODB A;  2L0P A;  1ALW A;  1MXL C;  2OTG B;  3DVJ A;  1UHJ A;  1GGW A;  3CYZ A;  5I2O A;  2MLE C;  3R1V A;  1OZS A;  2PMY A;  3VRO A;  2B1U A;  2JNF A;  5GQQ C;  2PAL A;  1QX7 A;  4NDC A;  4OV2 A;  1DEK A;  4I5N B;  4M2Q A;  1IGV A;  1BG1 A;  1QVI Z;  1JBA A;  1CM1 A;  1F55 A;  3A8R A;  1CM4 A;  2LP3 A;  3JTD B;  1IH0 A;  3R1O A;  3C1V A;  1OOG A;  2BL0 B;  4PHN A;  2WOS A;  1SCM B;  1CDN A;  3H4S E;  1C7V A;  2LVV A;  5K89 A;  1B8R A;  4BY5 A;  3S0E A;  1KWO B;  4ETO A;  1ZAC A;  2FCE A;  2LP2 A;  3IQO A;  2KI6 D;  2M49 B;  3AAJ A;  1U5I B;  2LCP A;  2M9G A;  3LCP C;  2L5Y A;  3DD4 A;  4AQI A;  2ISD A;  1M31 A;  3OHM B;  1BR1 B;  2WCJ A;  3PN7 C;  2ZND A;  2RGI A;  5DKN A;  2ZRS A;  1M39 A;  3CR2 A;  3I5I C;  2LMT A;  1J7Q A;  1Y6W A;  1OMD A;  2JPT A;  2QEH A;  3BFH A;  2FJY A;  4YGA A;  3BOW B;  1OSA A;  1Z4H A;  2K7C A;  1QIW A;  3D0Y B;  4NDB A;  1NP8 A;  2BAP A;  3OX5 A;  4DS7 A;  4JWQ A;  2PYQ A;  4HRH A;  4MSP A;  3I5F B;  1OQP A;  4HRG A;  2L5X B;  2HET A;  2L98 A;  1TNW A; 
#chains in the Genus database with same CATH homology
 2LE9 B;  2KFF A;  4WRI A;  4I5K A;  2AAO A;  3EKJ A;  2Q91 A;  3NXA A;  1JSA A;  1V1G A;  2CTN A;  5D7F A;  3KHE A;  5I2Q A;  1YX8 A;  1JWD A;  1QS7 A;  4GBA A;  4XJK B;  1WY9 A;  4OR9 B;  2H61 C;  3O78 A;  3CWG A;  4JQ0 D;  1NPQ A;  1LA3 A;  2BE6 A;  3DVM A;  2FOT A;  4N1G A;  1HQV A;  4ZCU A;  4U8D A;  2KAY A;  2SCP A;  2BCA A;  1NIW A;  5AEQ A;  3FWC A;  3SIA A;  1E8A A;  1BU3 A;  4YBH B;  1KK7 Z;  2Y1N A;  2M7L A;  2KYC A;  1IG5 A;  1S36 A;  4CFR A;  1M63 B;  4D1E A;  1REC A;  4MZJ A;  3NSO A;  1B7T Z;  2BKI B;  1U5I A;  1QAS A;  4PE4 A;  5AER A;  1DJG A;  3BUO B;  2EC6 B;  3O2P A;  5JJG A;  2P6B B;  4CLN A;  4AOM A;  3LK0 A;  1B1G A;  2KBM A;  1B47 A;  1XFX O;  2KNE A;  1S1E A;  3GK4 X;  2NCP A;  3D0Y A;  3K21 A;  2FCD A;  1J7O A;  2WC8 A;  3SIB A;  5JOL A;  2K61 A;  5CSF A;  1F54 A;  1SYM A;  2IS9 A;  1YUU A;  2H2K A;  2NZ0 A;  2R2I A;  2Y4Q A;  3PLF B;  3EK4 A;  4MRY A;  1A4P A;  3E3R A;  3TDU A;  2AMI A;  3IF7 A;  4YGC B;  2CNP A;  1F71 A;  4M2O A;  5TNC A;  2MHH A;  1KFU S;  1VRK A;  4DCK A;  4MN0 A;  1KQM B;  3I5G C;  1OMV A;  1LKJ A;  1M46 A;  1PVA A;  1K9P A;  1WDC C;  1YUR A;  2COL B;  2PSR A;  4NQG A;  4PHK A;  4YGB B;  3D10 A;  1MWN A;  4WQ3 A;  1V1F A;  2O5G A;  1DMO A;  2BBM A;  3VRR A;  1TOP A;  3EK7 A;  1ZOT B;  2NCO A;  4DRW A;  1J1E A;  4YGE B;  4GGF A;  2JU0 A;  1J1D A;  1K9U A;  1K95 A;  2HPS A;  2L51 A;  4HSZ A;  5HKW A;  4IL1 A;  1MF8 B;  2PRU A;  4XYN A;  1RJV A;  1F4Q A;  2LMU A;  2L2E A;  1EJ3 A;  1LA0 A;  1QX5 B;  2LVJ A;  3FS7 A;  5DKQ A;  2L4H A;  4ORC B;  4PE1 A;  1DJI A;  1S5G Z;  2ZKM X;  3RM1 A;  3VGO A;  2BBN A;  5I2L A;  3CZT X;  3AKA A;  4QJ4 B;  1WLZ A;  2Y5I A;  5IBW A;  1LIN A;  1YX7 A;  1SY9 A;  2G9B A;  2CBL A;  4Q04 A;  2ZN9 A;  4R1E A;  1FI5 A;  3CGA A;  3PFV A;  4L9M A;  2JUL A;  1UWO A;  2F8P A;  1MQ1 A;  2LUC A;  1NX0 A;  1WRK A;  2LM5 A;  2MJW B;  1H8B A;  1YVL A;  3LLE A;  1S6C A;  1B9A A;  2JC2 A;  2LVK A;  1CTR A;  5CSI A;  5J3X A;  2NLN A;  4PE0 A;  2F2O A;  1XVJ A;  1UHH A;  4F0Z B;  1DT7 B;  2K7O A;  2LV7 A;  3VRP A;  1CFC A;  2F2P A;  1B8L A;  2EHB A;  2KGR A;  2L50 A;  5ER4 X;  1PSB A;  3WHT B;  2BKH B;  1Y1A A;  5AXI A;  1QIV A;  4HRE E;  1WLM A;  3RLZ A;  4MRX A;  2BE4 A;  4ORA B;  4N5X A;  2MLF C;  2GGZ A;  2M1K B;  1JC2 A;  1K8U A;  3GK1 A;  3M0W A;  1KSM A;  1SW8 A;  2WCE A;  3TDZ A;  1K2H A;  2GV5 A;  1Y0V H;  1XFW O;  1AK8 A;  2LLU A;  1MUX A;  3DF0 B;  1L7Z A;  2AUC A;  3TDI A;  1W7I B;  3CR4 X;  1ALV A;  1CB1 A;  4OVN F;  1D1O A;  5KU1 A;  3TUY B;  1RWY A;  3TS5 C;  1MHO A;  2PVB A;  1CFD A;  3I5H B;  3VRQ A;  2JTZ A;  1J55 A;  3CLN A;  3OB1 B;  2HQW A;  2OS8 C;  1XK4 C;  3AAK A;  2K2A A;  2KI4 C;  1TRF A;  1NCZ A;  1TCO B;  1IJ5 A;  1PAL A;  1WDC B;  1CFP A;  4C0K A;  1F4O A;  1QTX A;  2ZRT A;  4PHM A;  3AKB A;  3NSL A;  2SAS A;  1K9K A;  1K93 D;  1KK8 C;  1OOJ A;  2H61 A;  3PAL A;  3WNX B;  1PK0 D;  1S26 D;  4I5L B;  5PAL A;  3SG7 A;  4OKH A;  3PAT A;  1WRZ A;  2E6W A;  2CCM A;  3DVE A;  2BCX A;  4YI8 A;  1DF0 B;  4USL A;  5CSJ A;  2Q4U A;  3KPX A;  1C7W A;  1DVI A;  1L2O C;  2I18 A;  2KOT A;  3OX6 A;  4PHJ A;  2F3Z A;  1IJ6 A;  3WXA A;  2PAS A;  4MLW A;  1S3P A;  2ZNE A;  2DOQ A;  2OTG C;  1GJY A;  2BEC A;  1XFV O;  2L4I A;  4DUQ A;  1JUO A;  3BUM B;  1CDM A;  3FIA A;  2GGM A;  4GAO A;  1AVS A;  1DJH A;  2KI6 C;  5CPV A;  2M3W A;  1KCY A;  2KAX A;  3DVK A;  1XFY O;  2M29 A;  1F70 A;  4GFT A;  1NUB A;  3DF0 A;  1TTX A;  2ZFD A;  5B8I B;  2LVI A;  1GQM A;  1CFF A;  1TNX A;  3EVR A;  1SCM C;  1RFJ A;  4MEW A;  1QAT A;  2M0R A;  1B8C A;  2V53 A;  1AUI B;  1K96 A;  4CID A;  5HKY A;  5D69 A;  2K8M B;  4WQ2 A;  3EK8 A;  3PN7 B;  2M97 A;  2KQ6 A;  1AHR A;  3SG3 A;  2LAP A;  3I5I B;  3SG5 A;  1YUT A;  1IRJ A;  1QJT A;  1QX2 A;  1XYD A;  2LUX A;  4MVF A;  4YGD B;  1BF5 A;  1JF2 A;  1CLB A;  1AJ4 A;  2EGD A;  2M8U A;  3GOF A;  1AJ5 A;  3SJS A;  2QAC A;  1PSR A;  1NWD A;  1BOC A;  1FPW A;  1FW4 A;  4I5J A;  1CDP A;  1YRT B;  1DF0 A;  1QLK A;  1NX2 A;  3BYA A;  2LNK A;  3I5F C;  3MSE B;  3SG6 A;  1DJW A;  4AQJ A;  1UHI A;  2OS8 B;  1MXE A;  1ZFS A;  1KSO A;  2KI4 B;  1YRU B;  4P2Y B;  2LMV A;  4YRU A;  2K2F A;  5KSZ A;  1PVB A;  1EG4 A;  1N2D A;  2ZN8 A;  3GK2 A;  1TIZ A;  1G33 A;  3HX4 A;  4ICB A;  1CKK A;  1J7P A;  1FF1 A;  1KK8 B;  1LXF C;  1CMG A;  2MRD A;  1IQ3 A;  5CSN A;  3CR5 X;  4QJ5 B;  1C07 A;  1SMG A;  2CT9 A;  1DJY A;  1KFU L;  3TZ1 A;  1QVI Y;  4C0J A;  2JRF A;  2LHI A;  4YI9 A;  3EKH A;  1KFX S;  1DGV A;  1X02 A;  4PAL A;  3LL8 B;  1SL7 A;  2CXJ A;  4PCW A;  2JQ6 A;  2F3Y A;  1N65 A;  1PUL A;  3JVT C;  2Y1M A;  2K7D A;  1NCY A;  2LLS A;  2KAV A;  1SR6 C;  1OZO A;  3BUX B;  1MR8 A;  5HYD A;  2D8N A;  1A29 A;  2WCF A;  1QV0 A;  1AP4 A;  2KHN A;  1YVH A;  4GNK B;  3BQ3 A;  1R6P A;  1UHK A;  3QRX A;  1K94 A;  2EC6 C;  2I7A A;  1GGZ A;  1SKT A;  1UUR A;  3VRN A;  3WHU B;  3BXK A;  2WOR A;  2VRG A;  1SCV A;  1UP5 A;  3BUW B;  4MZK A;  2KFG A;  4FQO A;  3ICB A;  2OPO A;  2KSP A;  3KF9 A;  1JF0 A;  3PM8 A;  1KFX L;  3CS1 A;  3SG2 A;  4GGN A;  1YTZ C;  4GUK A;  4BY4 A;  1CLM A;  1YR5 A;  1G8I A;  1FI6 A;  1LVC D;  1XO5 A;  2E30 A;  3KEV A;  1XFU O;  1G4Y R;  3F45 A;  1XFZ O;  1XK4 A;  5HLV A;  2JZI A;  2F33 A;  1SRA A;  1DTL A;  2K7B A;  4ORB B;  3HCM A;  2FJU B;  3I5G B;  3A4U B;  4N1F A;  1KQM C;  1BLQ A;  4ZCV A;  2I2R E;  1M45 A;  2A4J A;  2WCB A;  4PDZ A;  2LC5 A;  2WND A;  2KFH A;  4A4B A;  1A75 B;  2HF5 A;  4QJ3 B;  3IQQ A;  1KK7 Y;  2JNX A;  1EXR A;  4TNC A;  1IQ5 A;  1EL4 A;  1IWQ A;  1TCF A;  3BUN B;  1W7J B;  1HT9 A;  2JXL A;  1BMO A;  1B7T Y;  1OE9 B;  3FWB A;  1Q80 A;  1JFJ A;  1XA5 A;  1F8H A;  1NX1 A;  1PRW A;  4UPG A;  5HLO A;  1OMR A;  1SBJ A;  1S6J A;  1UHN A;  2LLT A;  1R2U A;  2G2B A;  3ZWH A;  1KQV A;  1Y1U A;  1CMF A;  1Y1X A;  1A03 A;  1CLL A;  4E68 A;  4CFQ A;  1S6I A;  1BOD A;  3JVT B;  3JTD C;  2KQY A;  3NSI A;  2KYF A;  1SR6 B;  2BL0 C;  4OCI A;  1RK9 A;  1DGU A;  5ER5 A;  2M1U A;  1ZUZ A;  1TNQ A;  4FTG A;  1H4B A;  1KWO C;  1SL8 A;  3ZNI A;  1BJF A;  1UUS A;  4P5O E;  1SK6 D;  1DJZ A;  1BR4 B;  1TNP A;  1YUS A;  1SL9 A;  2M7N A;  5FYX A;  1A2X A;  3NSK A;  2JT8 A;  2LHL A;  3EVU A;  1NCX A;  5F6T A;  5HKZ A;  5AFP A;  2JWW A;  3BOW A;  1SNL A;  1ZMZ A;  1N0Y A;  4CPV A;  1RTP 1;  1SPY A;  3TS5 B;  2JOJ A;  3OP0 A;  4PE7 A;  3TUY C;  1A75 A;  2JT0 A;  3SG4 A;  4C0L A;  3CTN A;  3I5H C;  1K90 D;  2KDH A;  1WRL A;  1QV1 A;  1QLS A;  2KGB C;  1J7R A;  2O60 A;  4MBE A;  2BCB A;  1S5G Y;  2JXC A;  4MZL A;  1FBV A;  3OB2 B;  5BPJ A;  4M2P A;  1B4C A;  4A4C A;  4JPZ B;  1JFK A;  4XJK A;  2TN4 A;  1EH2 A;  1IKU A;  2I94 A;  2JTT A;  2MA2 A;  2K0J A;  1BT6 A;  2NXQ A;  2QPT A;  5KTY A;  1NX3 A;  5I8N A;  1CDL A;  5DKR A;  1RRO A;  4GGF C;  1CNP A;  4GPL B;  1L2O B;  3EVV A;  5AAN A;  1QXP A;  3PSR A;  5G08 A;  1DJX A;  1TN4 A;  3O6B A;  2LAN A;  2MBX A;  2JT3 A;  2HQ8 A;  3LK1 A;  1EG3 A;  1NSH A;  1NYA A;  2KBI A;  2MAZ A;  3KO0 A;  3O4Y A;  4NDD A;  4DIR A;  1ODB A;  2L0P A;  1ALW A;  1MXL C;  2OTG B;  3DVJ A;  1UHJ A;  1GGW A;  5I2O A;  2MLE C;  1OZS A;  2PMY A;  3VRO A;  2B1U A;  2JNF A;  5GQQ C;  2PAL A;  1QX7 A;  4NDC A;  4OV2 A;  4I5N B;  4M2Q A;  1IGV A;  1BG1 A;  1QVI Z;  1JBA A;  1CM1 A;  1F55 A;  3A8R A;  1CM4 A;  2LP3 A;  3JTD B;  1IH0 A;  3C1V A;  2BL0 B;  4PHN A;  2WOS A;  1SCM B;  1CDN A;  3H4S E;  1C7V A;  2LVV A;  5K89 A;  1B8R A;  4BY5 A;  4ETO A;  1KWO B;  1ZAC A;  2FCE A;  2LP2 A;  3IQO A;  2KI6 D;  2M49 B;  3AAJ A;  1U5I B;  2LCP A;  2M9G A;  3LCP C;  3DD4 A;  4AQI A;  2ISD A;  1M31 A;  3OHM B;  1BR1 B;  3PN7 C;  2ZND A;  2RGI A;  5DKN A;  2ZRS A;  1M39 A;  3CR2 A;  3I5I C;  2LMT A;  1J7Q A;  1OMD A;  1Y6W A;  2JPT A;  4YGA A;  3BOW B;  1OSA A;  2K7C A;  3D0Y B;  1QIW A;  4NDB A;  1NP8 A;  4DS7 A;  3OX5 A;  4JWQ A;  4HRH A;  4MSP A;  3I5F B;  1OQP A;  4HRG A;  2L5X B;  2HET A;  2L98 A;  1TNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...