1DTLA

Crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
149
Chain Sequence
YKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKKSEEELSDLFRMFDKNADGYIDLEELKIMLQATTITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords CARDIAC TROPONIN C
publication title Bepridil opens the regulatory N-terminal lobe of cardiac troponin C.
pubmed doi rcsb
source organism Gallus gallus
total genus 53
structure length 149
sequence length 156
ec nomenclature
pdb deposition date 2000-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dtlA02
4I5JA 1CMFA 1AJ5A 4FQOA 1QVIY 4NQGA 1RECA 3BXKA 3VRNA 2BL0C 2QACA 1IG5A 1KK7Y 2WCBA 4DUQA 2ZN8A 1TOPA 1JFJA 2M7LA 3WHUB 4AQJA 3PN7B 2WOSA 1FBVA 1XYDA 2M29A 3QRXA 1RJVA 4C0KA 5CPVA 1SL8A 3VROA 2FJUB 1MQ1A 4PALA 1AK8A 2AMIA 1CKKA 4MVFA 3JVTC 4FTGA 1J7RA 4OR9B 2NLNA 3MSEB 2LVJA 2KOTA 3HCMA 1BOCA 2KGRA 3WXAA 3LL8B 1TNXA 1LKJA 2H61C 1FW4A 2L5XB 2Q91A 1TCOB 1NX2A 2MA2A 1L7ZA 3DVKA 1M39A 4PE0A 4DS7A 2RGIA 2V53A 2KAVA 1OMDA 1BLQA 2LV7A 4AQIA 1SL7A 2JPTA 1K90D 1QLKA 3NXAA 2JOJA 1S3PA 4ORBB 1KFUS 1DTLA 1NUBA 2M97A 3O78A 3WNXB 1HT9A 5CSNA 3JTDC 5I2OA 3SG7A 2I7AA 2LLTA 1QX5B 2LP2A 1Q80A 1CDLA 3HX4A 5HKYA 1UWOA 1KWOB 2HQ8A 1XK4C 1KFXL 1UHIA 2K7OA 3AKAA 3FWBA 1XFXO 3NSLA 3PSRA 2O5GA 2IS9A 4MZKA 1IRJA 3VRQA 1UUSA 1BJFA 1S6CA 5DKQA 1TRFA 1OOJA 1AJ4A 1ZFSA 2G2BA 1CM1A 1KK8C 2JXLA 2KAYA 2KI6D 3CR5X 3I5HB 4QJ4B 3TUYC 1R2UA 1J7OA 1IQ3A 1RK9A 3NSOA 4JQ0D 1TNWA 2M1UA 4YBHB 1UHHA 1W7IB 2KDHA 1LVCD 2LMTA 2WNDA 1B9AA 2F3YA 1C7WA 1KCYA 1DJYA 1DJXA 1K8UA 2QPTA 4WRIA 1UHJA 1IKUA 4YI8A 1XK4A 1NIWA 4ORAB 1DJZA 3JVTB 4MEWA 4P2YB 4JPZB 4Q04A 2P6BB 4WQ2A 3GK2A 1F70A 3IQOA 2JT3A 4C0LA 1NCXA 1BT6A 1Y6WA 3CTNA 1GGWA 3PFVA 1M31A 4CPVA 2JNFA 3CLNA 1CTRA 1NP8A 1YTZC 4ORCB 5J3XA 5F6TA 2KFGA 2I94A 1ZMZA 2AUCA 1DJIA 2LVKA 1W7JB 2PASA 1B8LA 1QV0A 2BCAA 3K21A 4N5XA 1LA0A 2L51A 4XJKA 3SJSA 2L2EA 1WY9A 1PVBA 2CBLA 4YGAA 2LNKA 2WORA 3LLEA 2EHBA 3JTDB 3EK8A 2LMVA 3FS7A 4HRGA 1KQMC 2JNXA 2ZRTA 4WQ3A 3KEVA 4BY5A 5AERA 3TS5C 2K61A 4N1GA 5D7FA 1C7VA 1N2DA 5K89A 1CNPA 2L4HA 4PHNA 1KK8B 3ZNIA 2KYCA 3TUYB 1FF1A 1B1GA 1EH2A 4IL1A 1D1OA 4OCIA 1JBAA 2JT0A 1B7TZ 5AEQA 1N65A 1H8BA 2M9GA 3I5IC 2K7DA 1NX0A 4CIDA 4R1EA 2M1KB 2PMYA 4XJKB 4HSZA 2KQYA 3D0YB 3NSIA 1CMGA 2M8UA 1DGVA 2CT9A 3RLZA 1G8IA 2KYFA 1Y0VH 1Y1UA 1B8CA 1K93D 4C0JA 1B4CA 1AVSA 2BBNA 1K96A 1QASA 2LVVA 2OS8C 4YI9A 2NZ0A 1S5GZ 3E3RA 4GPLB 1SL9A 1A2XA 2OTGC 2JULA 1LXFC 2LANA 1QIWA 4PHMA 2LHIA 2GV5A 1JSAA 3I5FC 1QXPA 2JWWA 2F3ZA 4CLNA 1K94A 5TNCA 1JWDA 1YUTA 1EL4A 1EG4A 1OE9B 3GK4X 4PE4A 2BCBA 2LUCA 1KQVA 3WHTB 1SYMA 1V1FA 2MHHA 4MN0A 4OV2A 1A29A 2B1UA 3EK7A 2FCDA 2SASA 1SMGA 2MAZA 2MLFC 2L98A 2JRFA 3VRRA 3BUWB 3ICBA 1KQMB 2BECA 1WRLA 2NCPA 3A8RA 1ZOTB 2ZNDA 2LLUA 4NDDA 5ER5A 2EGDA 4E68A 4OVNF 1TCFA 1SBJA 1KSOA 1QV1A 2NCOA 3BYAA 2BE4A 2LMUA 1G33A 1SRAA 2CXJA 1SNLA 4QJ5B 1BG1A 3OP0A 1KFUL 3OX6A 1YURA 1L2OC 3CWGA 5AANA 5HKWA 1MHOA 2H61A 2HQWA 1N0YA 1BF5A 1YUUA 2JTZA 4NDCA 3DD4A 3EKJA 3AAJA 1ALWA 1XFVO 2FOTA 1EG3A 3SIAA 1F4OA 1CFCA 3EVUA 1G4YR 1QVIZ 2BL0B 3CR2A 4GGNA 3RM1A 1CLMA 1RFJA 2K2FA 1V1GA 4CFRA 1KK7Z 2PRUA 1F54A 5DKNA 1RWYA 3EK4A 1VRKA 1CFPA 1XA5A 1UHKA 4PE1A 5KU1A 2F2OA 1S6JA 1S36A 4MBEA 3OHMB 1BR4B 2L0PA 1QX2A 3DVJA 1DT7B 4MSPA 3KF9A 2EC6C 5I2QA 1IQ5A 5JOLA 3A4UB 2KI6C 1NCYA 1JF2A 2FCEA 4QJ3B 1CFFA 3BUXB 1ZACA 1J55A 1JC2A 1NPQA 1IGVA 1AHRA 1EJ3A 2ZFDA 3EVRA 2BE6A 2K7BA 4JWQA 3TZ1A 1DGUA 4A4BA 1H4BA 3PM8A 4GGFC 4GUKA 3BUNB 3H4SE 4AOMA 1YX7A 2KBIA 2Y4QA 3PATA 1FI6A 3CR4X 2KNEA 2KGBC 2A4JA 2HETA 2KI4C 1AP4A 3TDIA 1GQMA 4MZLA 1GJYA 3SG3A 1OMRA 1TNPA 3KHEA 1S5GY 2L50A 1F55A 3I5GC 1J7QA 3PN7C 3GOFA 1U5IA 1L2OB 2BCXA 1WDCC 2BBMA 2HPSA 5HLVA 1PK0D 5AXIA 1B8RA 1PSRA 2I18A 1OMVA 3VGOA 1EXRA 3OX5A 4GGFA 2K0JA 1NSHA 2ZKMX 2E30A 1BODA 2JU0A 2CTNA 2LUXA 1CB1A 2BKIB 2LM5A 4I5NB 1M46A 1C07A 1K9PA 1SR6C 5GQQC 4BY4A 4ZCUA 1DMOA 2GGMA 1SKTA 4GFTA 1LINA 3KPXA 3OB2B 4DIRA 1CDNA 2KSPA 2WC8A 2BKHB 2MLEC 4MRYA 1MWNA 4MZJA 3C1VA 2NXQA 1XFYO 3GK1A 2D8NA 1IWQA 1WLZA 3KO0A 1NX1A 1OZSA 2LLSA 4M2PA 4TNCA 3CZTX 1YX8A 1MXLC 2GGZA 1NWDA 1SW8A 2LVIA 2VRGA 1WRKA 1B47A 1MR8A 2M0RA 4XYNA 3SIBA 1CM4A 2F2PA 1U5IB 2LC5A 4YGEB 5FYXA 2HF5A 2ZRSA 4DCKA 1DF0A 4D1EA 1E8AA 3VRPA 3FIAA 1A4PA 3DF0A 2H2KA 4MRXA 2KFHA 1IJ5A 1X02A 1A75A 2OPOA 3AKBA 4P5OE 3TDUA 2KI4B 2LHLA 4PHKA 3I5HC 4PE7A 5KTYA 3EKHA 1K95A 3LK1A 1PULA 2I2RE 4I5KA 4PHJA 2CCMA 5HLOA 1RROA 3SG2A 4A4CA 3I5GB 3O6BA 1YUSA 4NDBA 1SK6D 2JQ6A 1PVAA 1WDCB 2M3WA 3F45A 1M45A 4L9MA 3TS5B 2F8PA 1S1EA 1SPYA 1JF0A 1NX3A 5JJGA 2TN4A 2LCPA 1GGZA 1F8HA 4M2OA 2KBMA 3EVVA 1AUIB 1CLBA 2PALA 5G08A 3FWCA 1YVLA 1SR6B 3BOWA 3TDZA 2K2AA 1OQPA 1DF0B 2PSRA 2ISDA 1K2HA 1YRUB 1QTXA 3I5IB 4MLWA 1XFZO 3DF0B 2SCPA 2E6WA 3BUOB 2JT8A 1A75B 3DVEA 4F0ZB 2ZNEA 1LA3A 1ZUZA 5I2LA 5D69A 1JFKA 2LE9B 1OSAA 4OKHA 1R6PA 3IQQA 4GBAA 2WCEA 1WLMA 1QS7A 2OS8B 5DKRA 4ETOA 5KSZA 1Y1XA 1XO5A 1KFXS 1S6IA 2OTGB 3I5FB 3ZWHA 1XVJA 2WCFA 1JUOA 1YVHA 1J1EA 1TNQA 4ZCVA 1SCMC 1BR1B 1MF8B 1UURA 2ZN9A 2G9BA 4YGCB 3BOWB 5HYDA 3CS1A 1PRWA 2JZIA 4HREE 1B7TY 1DJWA 1SCVA 4N1FA 2MRDA 2AAOA 4HRHA 4YRUA 1MXEA 2KAXA 1CDPA 1K9KA 1XFWO 4GAOA 1OZOA 5I8NA 4YGBB 2KFFA 2K7CA 1QATA 3SG5A 1XFUO 4ICBA 4PCWA 5BPJA 1SY9A 3PLFB 1PSBA 4UPGA 4USLA 3IF7A 1CDMA 5IBWA 1TTXA 1HQVA 1NCZA 2COLB 1BMOA 2Y1MA 3O2PA 1UP5A 1CFDA 4U8DA 2MJWB 5CSFA 1ODBA 1Y1AA 1UHNA 1IJ6A 1BU3A 3M0WA 3PALA 1YRTB 2JTTA 3CGAA 1QIVA 4GNKB 1J7PA 1YR5A 1KSMA 5ER4X 1DJHA 3D0YA 1ALVA 1TIZA 4M2QA 1MUXA 2K8MB 1FI5A 1FPWA 1F4QA 2L4IA 3BQ3A 4PDZA 4I5LB 2JC2A 2M7NA 2Y5IA 1QX7A 3LCPC 1K9UA 1TN4A 1IH0A 2PVBA 2JXCA 2Q4UA 1J1DA 5HKZA 2KHNA 4YGDB 3AAKA 3NSKA 5B8IB 2Y1NA 3SG4A 2F33A 2KQ6A 2MBXA 5AFPA 1S26D 5CSJA 3LK0A 4CFQA 1F71A 1CLLA 3BUMB 1SCMB 2LP3A 1M63B 1A03A 2M49B 1DJGA 2EC6B 4DRWA 3OB1B 3D10A 2R2IA 1NYAA 3SG6A 2LAPA 1QLSA 1DVIA 1QJTA 2O60A 2DOQA 5PALA 1RTP1 1KWOC 5CSIA 1PALA 2CNPA 3O4YA 1WRZA 3DVMA
chains in the Genus database with same CATH superfamily
4INWA 4I5JA 1CMFA 1AJ5A 4FQOA 1QVIY 4NQGA 1RECA 3Q8IA 4JD9A 3BXKA 3VRNA 2BL0C 3CZ1A 2QACA 1IG5A 5FI6A 1KK7Y 2WCBA 4DUQA 2ZN8A 1TOPA 1JFJA 2M7LA 3WHUB 4AQJA 3PN7B 2WOSA 1FBVA 1XYDA 2M29A 3QRXA 1RJVA 4C0KA 5CPVA 1SL8A 3VROA 2FJUB 1MQ1A 4PALA 1AK8A 2AMIA 4FQTA 1CKKA 4MVFA 1OOHA 3JVTC 4FTGA 1J7RA 3K1EA 4OR9B 2NLNA 3MSEB 2LVJA 2KOTA 2WC5A 3HCMA 1BOCA 2KGRA 3WXAA 3LL8B 1TNXA 1LKJA 2H61C 1FW4A 2L5XB 1OOGA 2Q91A 1TCOB 1NX2A 2MA2A 4OZDA 1L7ZA 3DVKA 1M39A 4PE0A 4DS7A 3DYEA 2RGIA 2V53A 2KAVA 1OMDA 1BLQA 2LV7A 2P70A 4INXA 4AQIA 1SL7A 2JPTA 1K90D 1QLKA 3NXAA 2JOJA 1S3PA 3D77A 4ORBB 1KFUS 1DTLA 1NUBA 2M97A 3O78A 3WNXB 3DY9A 1HT9A 5CSNA 3JTDC 5I2OA 3SG7A 2I7AA 2LLTA 1QX5B 2LP2A 1Q80A 1CDLA 1XFRA 3HX4A 5HKYA 3UNWA 1UWOA 1KWOB 2HQ8A 1XK4C 1KFXL 1UHIA 2K7OA 3AKAA 3FWBA 1XFXO 3NSLA 3PSRA 2O5GA 2IS9A 4MZKA 1IRJA 3VRQA 1UUSA 1BJFA 1S6CA 5DKQA 1TRFA 1OOJA 1ZFSA 1AJ4A 2G2BA 1CM1A 1KK8C 2JXLA 2KAYA 2KI6D 3CR5X 3I5HB 4QJ4B 3RZSA 3TUYC 1R2UA 1J7OA 1IQ3A 1RK9A 3NSOA 4JKTA 1TNWA 2M1UA 1C3ZA 4JQ0D 4YBHB 1C3YA 1UHHA 1W7IB 2KDHA 1LVCD 2LMTA 3NHTA 2WNDA 1B9AA 2F3YA 2P71A 1C7WA 1DQEA 1DJYA 1DJXA 1KCYA 1K8UA 2QPTA 4WRIA 1UHJA 1IKUA 4YI8A 1XK4A 1NIWA 4ORAB 1DJZA 3JVTB 4MEWA 4P2YB 4JPZB 4Q04A 2P6BB 4WQ2A 3GK2A 1F70A 3IQOA 2JT3A 4C0LA 1NCXA 1BT6A 1Y6WA 3CTNA 1GGWA 2QEVA 3PFVA 1M31A 3V2LA 2JNFA 3CLNA 4CPVA 1CTRA 1NP8A 1YTZC 4ORCB 5J3XA 5F6TA 2KFGA 3S0DA 2I94A 3B88A 1ZMZA 2AUCA 5FI2A 1DJIA 2LVKA 3OGNA 1W7JB 2PASA 1B8LA 1QV0A 2BCAA 3K21A 4N5XA 1LA0A 2L51A 4XJKA 3SJSA 2L2EA 1WY9A 1PVBA 2CBLA 4YGAA 1W9ZA 2LNKA 2WORA 3LLEA 2EHBA 3JTDB 3EK8A 2LMVA 3FS7A 4HRGA 1KQMC 2JNXA 2ZRTA 4WQ3A 3KEVA 4BY5A 5AERA 3TS5C 2K61A 4N1GA 5D7FA 1C7VA 1N2DA 5K89A 1CNPA 2L4HA 4PHNA 1KK8B 3ZNIA 2KYCA 3TUYB 1FF1A 3FE6A 1B1GA 1EH2A 4IL1A 1D1OA 4OCIA 1JBAA 2JT0A 1B7TZ 5AEQA 1N65A 1H8BA 2M9GA 3I5IC 3VB1A 2K7DA 1NX0A 4CIDA 2JPOA 4R1EA 3BJHA 2M1KB 2PMYA 4XJKB 4HSZA 2KQYA 3D0YB 3NSIA 1CMGA 2QEHA 2M8UA 1DGVA 2CT9A 3RLZA 1G8IA 2KYFA 1Y0VH 1Y1UA 1B8CA 1K93D 4C0JA 1B4CA 1AVSA 3B87A 2BBNA 1K96A 1QASA 2LVVA 2OS8C 3L4LA 2NZ0A 4YI9A 1S5GZ 2PYQA 3E3RA 4GPLB 1SL9A 1A2XA 2OTGC 2JULA 1LXFC 2LANA 1QIWA 4PHMA 2LHIA 2GV5A 1JSAA 3I5FC 1QXPA 2JWWA 2F3ZA 4CLNA 1K94A 5TNCA 1JWDA 1YUTA 5DICA 1EL4A 3S0AA 1EG4A 3BFBA 1OE9B 3GK4X 4PE4A 2BCBA 2LUCA 1KQVA 3WHTB 1SYMA 1V1FA 2MHHA 4MN0A 4OV2A 1A29A 2B1UA 3EK7A 2FCDA 2SASA 1SMGA 3O4XA 2MAZA 2MLFC 3R1PA 2L98A 2JRFA 3VRRA 3BUWB 3ICBA 1KQMB 2BECA 1WRLA 2NCPA 3N7HA 3A8RA 3SS5A 1ZOTB 2ZNDA 2LLUA 4NDDA 5ER5A 2EGDA 4E68A 4OVNF 1TCFA 1SBJA 1KSOA 1QV1A 2NCOA 3BYAA 4IJ7A 1T14A 2BE4A 3CYZA 3SS4A 2LMUA 1TUZA 1G33A 1SRAA 2CXJA 1SNLA 4QJ5B 1BG1A 3OP0A 1QWVA 1KFUL 3OX6A 1YURA 1L2OC 3CWGA 5AANA 3S0FA 5HKWA 1MHOA 2H61A 2HQWA 1N0YA 1BF5A 1YUUA 2JTZA 4NDCA 3DD4A 3EKJA 3AAJA 1ALWA 1XFVO 2FOTA 1EG3A 3SIAA 1F4OA 1CFCA 3EVUA 1G4YR 1QVIZ 2BL0B 3CR2A 3S0GA 4GGNA 3RM1A 1CLMA 1RFJA 2K2FA 2WCMA 3PM2A 1V1GA 1OOIX 4CFRA 3B86A 1KK7Z 2PRUA 1ORGA 5DKNA 1RWYA 1Z2CB 1VRKA 2YGUA 3EK4A 1CFPA 1F54A 1XA5A 1UHKA 4PE1A 3R1OA 2F2OA 1S6JA 1S36A 4MBEA 3OHMB 5KU1A 1BR4B 2L0PA 1QX2A 3DVJA 1DT7B 1P28A 4MSPA 2WCJA 3KF9A 2EC6C 5I2QA 1IQ5A 5JOLA 3A4UB 2KI6C 1NCYA 1JF2A 2FCEA 3EG5B 4QJ3B 1CFFA 3BUXB 1ZACA 1J55A 1JC2A 1NPQA 1IGVA 1AHRA 1EJ3A 2ZFDA 3BFAA 2BE6A 2K7BA 3EVRA 3CABA 1DGUA 4JWQA 3TZ1A 4A4BA 1H4BA 3PM8A 2WC6A 4GGFC 4GUKA 3BUNB 3H4SE 4AOMA 1YX7A 2WCHA 2KBIA 2Y4QA 3PATA 1FI6A 3CR4X 2KNEA 3CDNA 2KGBC 2A4JA 2HETA 2KI4C 1AP4A 3TDIA 1GQMA 4MZLA 1GJYA 3SG3A 1OMRA 1TNPA 3KHEA 1S5GY 2L50A 1F55A 3I5GC 1J7QA 3PN7C 3GOFA 1U5IA 1L2OB 2BCXA 1WDCC 2BBMA 2HPSA 5HLVA 1DEKA 1PK0D 5AXIA 1B8RA 1PSRA 2I18A 1OMVA 3VGOA 1EXRA 3OX5A 4GGFA 2K0JA 1NSHA 2ZKMX 2E30A 1BODA 2JU0A 3PJIA 2CTNA 2LUXA 1CB1A 2BKIB 2LM5A 4I5NB 1M46A 1C07A 1K9PA 1SR6C 3DZTA 5GQQC 4BY4A 4ZCUA 1DMOA 2GGMA 1SKTA 2WCKA 4GFTA 3NGVA 1LINA 3KPXA 3OB2B 4DIRA 1CDNA 2KSPA 2WC8A 2BKHB 2MLEC 4MRYA 1MWNA 4MZJA 3C1VA 2NXQA 1XFYO 3GK1A 1DELA 2D8NA 1IWQA 1WLZA 3KO0A 4PT1A 1NX1A 1OZSA 2LLSA 4M2PA 4TNCA 3CZTX 2K60A 1YX8A 1MXLC 3BFHA 2GGZA 1NWDA 1SW8A 2LVIA 2VRGA 1WRKA 1B47A 2WCLA 1MR8A 2FJYA 2GTEA 2M0RA 4XYNA 2ERBA 3SIBA 1CM4A 2F2PA 1U5IB 2QEBA 2LC5A 4YGEB 5FYXA 2HF5A 3SS3A 2ZRSA 4DCKA 1DF0A 3UO9A 1E8AA 4D1EA 3CZ2A 3VRPA 3FIAA 1A4PA 3DF0A 2H2KA 3QMEA 4MRXA 2KFHA 1IJ5A 1X02A 1A75A 2OPOA 3AKBA 4P5OE 3TDUA 1Z4HA 2KI4B 2LHLA 4PHKA 3I5HC 4PE7A 5KTYA 3B7AA 1K95A 3EKHA 3LK1A 1PULA 2QEOA 2I2RE 4I5KA 4PHJA 2CCMA 5HLOA 1RROA 3SG2A 4A4CA 3I5GB 3O6BA 1YUSA 4NDBA 5EL2A 1SK6D 2JQ6A 1PVAA 1OW4A 1WDCB 2M3WA 3F45A 1M45A 4L9MA 3TS5B 2F8PA 1S1EA 1SPYA 1JF0A 1NX3A 5D3OA 5JJGA 2KPHA 2TN4A 1OOFA 2LCPA 4F7FA 1GGZA 1F8HA 4M2OA 2KBMA 3EVVA 1AUIB 1CLBA 2PALA 5G08A 3FWCA 1YVLA 1SR6B 3BOWA 3TDZA 2K2AA 1OQPA 3NHIA 1DF0B 2L5YA 2PSRA 2ISDA 1K2HA 1YRUB 1QTXA 3I5IB 3FE9A 1XFZO 3DF0B 2BAPA 4MLWA 1GM0A 2SCPA 2E6WA 3BUOB 2JT8A 1A75B 3DVEA 3B6XA 4F0ZB 2ZNEA 3R1VA 2BNXA 2L2CA 1LA3A 5HL1A 1ZUZA 5I2LA 5D69A 1JFKA 3D78A 2LE9B 1OSAA 4OKHA 3D74A 1R6PA 3IQQA 4GBAA 3CZ0A 1TUJA 1TWOA 1WLMA 2WCEA 1QS7A 2OS8B 5DKRA 4ETOA 5KSZA 1Y1XA 1XO5A 1KFXS 1S6IA 2OTGB 3I5FB 3ZWHA 1XVJA 2WCFA 2KLEA 1JUOA 1YVHA 1J1EA 1TNQA 1LS8A 1SCMC 4ZCVA 1BR1B 1MF8B 1UURA 2ZN9A 2G9BA 4YGCB 3BOWB 5HYDA 3CS1A 1IIOA 1PRWA 2JZIA 4HREE 1B7TY 1DJWA 1SCVA 4N1FA 2MRDA 2AAOA 2KLDA 4HRHA 4YRUA 1MXEA 2KAXA 1CDPA 1K9KA 1XFWO 4GAOA 1OZOA 5I8NA 4YGBB 2KFFA 2K7CA 1QATA 3SG5A 1XFUO 4ICBA 4PCWA 5I94A 3DXLA 1SY9A 3PLFB 1PSBA 4UPGA 5BPJA 4USLA 3IF7A 3R72A 1CDMA 5IBWA 1TTXA 1HQVA 1NCZA 2COLB 1BMOA 2Y1MA 3O2PA 1UP5A 2PQLA 1CFDA 3L4AA 4U8DA 2MJWB 5CSFA 1ODBA 1Y1AA 1UHNA 1IJ6A 1BU3A 3M0WA 3PALA 1YRTB 1SSEB 2JTTA 3CGAA 1QIVA 4GNKB 1J7PA 1YR5A 4KYNA 3D76A 1KSMA 3IVTA 1DJHA 5ER4X 3D0YA 3S0BA 1ALVA 1TIZA 4M2QA 1MUXA 2K8MB 1FI5A 1FPWA 1F4QA 2L4IA 3BQ3A 4PDZA 4I5LB 2JC2A 2M7NA 2Y5IA 1QX7A 3LCPC 1K9UA 1TN4A 1IH0A 2PVBA 2JXCA 2Q4UA 1J1DA 5HKZA 2KHNA 4YGDB 3AAKA 3NSKA 5B8IB 2Y1NA 3OBVA 3SG4A 2F33A 2KQ6A 2MBXA 5AFPA 1DC1A 2QDIA 1S26D 5CSJA 3LK0A 4CFQA 1F71A 1CLLA 3BUMB 1SCMB 2LP3A 1M63B 1A03A 2M49B 1DJGA 3L47A 2EC6B 3S0EA 4DRWA 3OB1B 3D10A 2R2IA 1NYAA 3SG6A 2LAPA 1QLSA 1DVIA 1QJTA 5FI7A 2O60A 2DOQA 5PALA 1RTP1 3D73A 3D75A 1KWOC 5CSIA 1PALA 2CNPA 2H8VA 3O4YA 1WRZA 3DVMA 3FE8A
chains in the Genus database with same CATH topology
4I5JA 1CMFA 1AJ5A 4FQOA 1QVIY 4NQGA 1RECA 3BXKA 3VRNA 2BL0C 2QACA 1IG5A 1KK7Y 2WCBA 4DUQA 2ZN8A 1TOPA 1JFJA 2M7LA 3WHUB 4AQJA 3PN7B 2WOSA 1FBVA 1XYDA 2M29A 3QRXA 1RJVA 4C0KA 5CPVA 1SL8A 3VROA 2FJUB 1MQ1A 4PALA 1AK8A 2AMIA 1CKKA 4MVFA 3JVTC 4FTGA 1J7RA 4OR9B 2NLNA 3MSEB 2LVJA 2KOTA 3HCMA 1BOCA 2KGRA 3WXAA 3LL8B 1TNXA 1LKJA 2H61C 1FW4A 2L5XB 2Q91A 1TCOB 1NX2A 2MA2A 1L7ZA 3DVKA 1M39A 4PE0A 4DS7A 2RGIA 2V53A 2KAVA 1OMDA 1BLQA 2LV7A 4AQIA 1SL7A 2JPTA 1K90D 1QLKA 3NXAA 2JOJA 1S3PA 4ORBB 1KFUS 1DTLA 1NUBA 2M97A 3O78A 3WNXB 1HT9A 5CSNA 3JTDC 5I2OA 3SG7A 2I7AA 2LLTA 1QX5B 2LP2A 1Q80A 1CDLA 3HX4A 5HKYA 1UWOA 1KWOB 2HQ8A 1XK4C 1KFXL 1UHIA 2K7OA 3AKAA 3FWBA 1XFXO 3NSLA 3PSRA 2O5GA 2IS9A 4MZKA 1IRJA 3VRQA 1UUSA 1BJFA 1S6CA 5DKQA 1TRFA 1OOJA 1AJ4A 1ZFSA 2G2BA 1CM1A 1KK8C 2JXLA 2KAYA 2KI6D 3CR5X 3I5HB 4QJ4B 3TUYC 1R2UA 1J7OA 1IQ3A 1RK9A 3NSOA 4JQ0D 1TNWA 2M1UA 4YBHB 1UHHA 1W7IB 2KDHA 1LVCD 2LMTA 2WNDA 1B9AA 2F3YA 1C7WA 1KCYA 1DJYA 1DJXA 1K8UA 2QPTA 4WRIA 1UHJA 1IKUA 4YI8A 1XK4A 1NIWA 4ORAB 1DJZA 3JVTB 4MEWA 4P2YB 4JPZB 4Q04A 2P6BB 4WQ2A 3GK2A 1F70A 3IQOA 2JT3A 4C0LA 1NCXA 1BT6A 1Y6WA 3CTNA 1GGWA 3PFVA 1M31A 4CPVA 2JNFA 3CLNA 1CTRA 1NP8A 1YTZC 4ORCB 5J3XA 5F6TA 2KFGA 2I94A 1ZMZA 2AUCA 1DJIA 2LVKA 1W7JB 2PASA 1B8LA 1QV0A 2BCAA 3K21A 4N5XA 1LA0A 2L51A 4XJKA 3SJSA 2L2EA 1WY9A 1PVBA 2CBLA 4YGAA 2LNKA 2WORA 3LLEA 2EHBA 3JTDB 3EK8A 2LMVA 3FS7A 4HRGA 1KQMC 2JNXA 2ZRTA 4WQ3A 3KEVA 4BY5A 5AERA 3TS5C 2K61A 4N1GA 5D7FA 1C7VA 1N2DA 5K89A 1CNPA 2L4HA 4PHNA 1KK8B 3ZNIA 2KYCA 3TUYB 1FF1A 1B1GA 1EH2A 4IL1A 1D1OA 4OCIA 1JBAA 2JT0A 1B7TZ 5AEQA 1N65A 1H8BA 2M9GA 3I5IC 2K7DA 1NX0A 4CIDA 4R1EA 2M1KB 2PMYA 4XJKB 4HSZA 2KQYA 3D0YB 3NSIA 1CMGA 2M8UA 1DGVA 2CT9A 3RLZA 1G8IA 2KYFA 1Y0VH 1Y1UA 1B8CA 1K93D 4C0JA 1B4CA 1AVSA 2BBNA 1K96A 1QASA 2LVVA 2OS8C 4YI9A 2NZ0A 1S5GZ 3E3RA 4GPLB 1SL9A 1A2XA 2OTGC 2JULA 1LXFC 2LANA 1QIWA 4PHMA 2LHIA 2GV5A 1JSAA 3I5FC 1QXPA 2JWWA 2F3ZA 4CLNA 1K94A 5TNCA 1JWDA 1YUTA 1EL4A 1EG4A 1OE9B 3GK4X 4PE4A 2BCBA 2LUCA 1KQVA 3WHTB 1SYMA 1V1FA 2MHHA 4MN0A 4OV2A 1A29A 2B1UA 3EK7A 2FCDA 2SASA 1SMGA 2MAZA 2MLFC 2L98A 2JRFA 3VRRA 3BUWB 3ICBA 1KQMB 2BECA 1WRLA 2NCPA 3A8RA 1ZOTB 2ZNDA 2LLUA 4NDDA 5ER5A 2EGDA 4E68A 4OVNF 1TCFA 1SBJA 1KSOA 1QV1A 2NCOA 3BYAA 2BE4A 2LMUA 1G33A 1SRAA 2CXJA 1SNLA 4QJ5B 1BG1A 3OP0A 1KFUL 3OX6A 1YURA 1L2OC 3CWGA 5AANA 5HKWA 1MHOA 2H61A 2HQWA 1N0YA 1BF5A 1YUUA 2JTZA 4NDCA 3DD4A 3EKJA 3AAJA 1ALWA 1XFVO 2FOTA 1EG3A 3SIAA 1F4OA 1CFCA 3EVUA 1G4YR 1QVIZ 2BL0B 3CR2A 4GGNA 3RM1A 1CLMA 1RFJA 2K2FA 1V1GA 4CFRA 1KK7Z 2PRUA 1F54A 5DKNA 1RWYA 3EK4A 1VRKA 1CFPA 1XA5A 1UHKA 4PE1A 5KU1A 2F2OA 1S6JA 1S36A 4MBEA 3OHMB 1BR4B 2L0PA 1QX2A 3DVJA 1DT7B 4MSPA 3KF9A 2EC6C 5I2QA 1IQ5A 5JOLA 3A4UB 2KI6C 1NCYA 1JF2A 2FCEA 4QJ3B 1CFFA 3BUXB 1ZACA 1J55A 1JC2A 1NPQA 1IGVA 1AHRA 1EJ3A 2ZFDA 3EVRA 2BE6A 2K7BA 4JWQA 3TZ1A 1DGUA 4A4BA 1H4BA 3PM8A 4GGFC 4GUKA 3BUNB 3H4SE 4AOMA 1YX7A 2KBIA 2Y4QA 3PATA 1FI6A 3CR4X 2KNEA 2KGBC 2A4JA 2HETA 2KI4C 1AP4A 3TDIA 1GQMA 4MZLA 1GJYA 3SG3A 1OMRA 1TNPA 3KHEA 1S5GY 2L50A 1F55A 3I5GC 1J7QA 3PN7C 3GOFA 1U5IA 1L2OB 2BCXA 1WDCC 2BBMA 2HPSA 5HLVA 1PK0D 5AXIA 1B8RA 1PSRA 2I18A 1OMVA 3VGOA 1EXRA 3OX5A 4GGFA 2K0JA 1NSHA 2ZKMX 2E30A 1BODA 2JU0A 2CTNA 2LUXA 1CB1A 2BKIB 2LM5A 4I5NB 1M46A 1C07A 1K9PA 1SR6C 5GQQC 4BY4A 4ZCUA 1DMOA 2GGMA 1SKTA 4GFTA 1LINA 3KPXA 3OB2B 4DIRA 1CDNA 2KSPA 2WC8A 2BKHB 2MLEC 4MRYA 1MWNA 4MZJA 3C1VA 2NXQA 1XFYO 3GK1A 2D8NA 1IWQA 1WLZA 3KO0A 1NX1A 1OZSA 2LLSA 4M2PA 4TNCA 3CZTX 1YX8A 1MXLC 2GGZA 1NWDA 1SW8A 2LVIA 2VRGA 1WRKA 1B47A 1MR8A 2M0RA 4XYNA 3SIBA 1CM4A 2F2PA 1U5IB 2LC5A 4YGEB 5FYXA 2HF5A 2ZRSA 4DCKA 1DF0A 4D1EA 1E8AA 3VRPA 3FIAA 1A4PA 3DF0A 2H2KA 4MRXA 2KFHA 1IJ5A 1X02A 1A75A 2OPOA 3AKBA 4P5OE 3TDUA 2KI4B 2LHLA 4PHKA 3I5HC 4PE7A 5KTYA 3EKHA 1K95A 3LK1A 1PULA 2I2RE 4I5KA 4PHJA 2CCMA 5HLOA 1RROA 3SG2A 4A4CA 3I5GB 3O6BA 1YUSA 4NDBA 1SK6D 2JQ6A 1PVAA 1WDCB 2M3WA 3F45A 1M45A 4L9MA 3TS5B 2F8PA 1S1EA 1SPYA 1JF0A 1NX3A 5JJGA 2TN4A 2LCPA 1GGZA 1F8HA 4M2OA 2KBMA 3EVVA 1AUIB 1CLBA 2PALA 5G08A 3FWCA 1YVLA 1SR6B 3BOWA 3TDZA 2K2AA 1OQPA 1DF0B 2PSRA 2ISDA 1K2HA 1YRUB 1QTXA 3I5IB 4MLWA 1XFZO 3DF0B 2SCPA 2E6WA 3BUOB 2JT8A 1A75B 3DVEA 4F0ZB 2ZNEA 1LA3A 1ZUZA 5I2LA 5D69A 1JFKA 2LE9B 1OSAA 4OKHA 1R6PA 3IQQA 4GBAA 2WCEA 1WLMA 1QS7A 2OS8B 5DKRA 4ETOA 5KSZA 1Y1XA 1XO5A 1KFXS 1S6IA 2OTGB 3I5FB 3ZWHA 1XVJA 2WCFA 1JUOA 1YVHA 1J1EA 1TNQA 4ZCVA 1SCMC 1BR1B 1MF8B 1UURA 2ZN9A 2G9BA 4YGCB 3BOWB 5HYDA 3CS1A 1PRWA 2JZIA 4HREE 1B7TY 1DJWA 1SCVA 4N1FA 2MRDA 2AAOA 4HRHA 4YRUA 1MXEA 2KAXA 1CDPA 1K9KA 1XFWO 4GAOA 1OZOA 5I8NA 4YGBB 2KFFA 2K7CA 1QATA 3SG5A 1XFUO 4ICBA 4PCWA 5BPJA 1SY9A 3PLFB 1PSBA 4UPGA 4USLA 3IF7A 1CDMA 5IBWA 1TTXA 1HQVA 1NCZA 2COLB 1BMOA 2Y1MA 3O2PA 1UP5A 1CFDA 4U8DA 2MJWB 5CSFA 1ODBA 1Y1AA 1UHNA 1IJ6A 1BU3A 3M0WA 3PALA 1YRTB 2JTTA 3CGAA 1QIVA 4GNKB 1J7PA 1YR5A 1KSMA 5ER4X 1DJHA 3D0YA 1ALVA 1TIZA 4M2QA 1MUXA 2K8MB 1FI5A 1FPWA 1F4QA 2L4IA 3BQ3A 4PDZA 4I5LB 2JC2A 2M7NA 2Y5IA 1QX7A 3LCPC 1K9UA 1TN4A 1IH0A 2PVBA 2JXCA 2Q4UA 1J1DA 5HKZA 2KHNA 4YGDB 3AAKA 3NSKA 5B8IB 2Y1NA 3SG4A 2F33A 2KQ6A 2MBXA 5AFPA 1S26D 5CSJA 3LK0A 4CFQA 1F71A 1CLLA 3BUMB 1SCMB 2LP3A 1M63B 1A03A 2M49B 1DJGA 2EC6B 4DRWA 3OB1B 3D10A 2R2IA 1NYAA 3SG6A 2LAPA 1QLSA 1DVIA 1QJTA 2O60A 2DOQA 5PALA 1RTP1 1KWOC 5CSIA 1PALA 2CNPA 3O4YA 1WRZA 3DVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5J A;  1CMF A;  1AJ5 A;  4FQO A;  1QVI Y;  4NQG A;  1REC A;  3BXK A;  3VRN A;  2BL0 C;  2QAC A;  1IG5 A;  1KK7 Y;  2WCB A;  4DUQ A;  2ZN8 A;  1TOP A;  1JFJ A;  2M7L A;  3WHU B;  4AQJ A;  3PN7 B;  2WOS A;  1FBV A;  1XYD A;  2M29 A;  3QRX A;  1RJV A;  4C0K A;  5CPV A;  1SL8 A;  3VRO A;  2FJU B;  1MQ1 A;  4PAL A;  1AK8 A;  2AMI A;  1CKK A;  4MVF A;  3JVT C;  4FTG A;  1J7R A;  4OR9 B;  2NLN A;  3MSE B;  2LVJ A;  2KOT A;  3HCM A;  1BOC A;  2KGR A;  3WXA A;  3LL8 B;  1TNX A;  1LKJ A;  2H61 C;  1FW4 A;  2L5X B;  2Q91 A;  1TCO B;  1NX2 A;  2MA2 A;  1L7Z A;  3DVK A;  1M39 A;  4PE0 A;  4DS7 A;  2RGI A;  2V53 A;  2KAV A;  1OMD A;  1BLQ A;  2LV7 A;  4AQI A;  1SL7 A;  2JPT A;  1K90 D;  1QLK A;  3NXA A;  2JOJ A;  1S3P A;  4ORB B;  1KFU S;  1DTL A;  1NUB A;  2M97 A;  3O78 A;  3WNX B;  1HT9 A;  5CSN A;  3JTD C;  5I2O A;  3SG7 A;  2I7A A;  2LLT A;  1QX5 B;  2LP2 A;  1Q80 A;  1CDL A;  3HX4 A;  5HKY A;  1UWO A;  1KWO B;  2HQ8 A;  1XK4 C;  1KFX L;  1UHI A;  2K7O A;  3AKA A;  3FWB A;  1XFX O;  3NSL A;  3PSR A;  2O5G A;  2IS9 A;  4MZK A;  1IRJ A;  3VRQ A;  1UUS A;  1BJF A;  1S6C A;  5DKQ A;  1TRF A;  1OOJ A;  1AJ4 A;  1ZFS A;  2G2B A;  1CM1 A;  1KK8 C;  2JXL A;  2KAY A;  2KI6 D;  3CR5 X;  3I5H B;  4QJ4 B;  3TUY C;  1R2U A;  1J7O A;  1IQ3 A;  1RK9 A;  3NSO A;  4JQ0 D;  1TNW A;  2M1U A;  4YBH B;  1UHH A;  1W7I B;  2KDH A;  1LVC D;  2LMT A;  2WND A;  1B9A A;  2F3Y A;  1C7W A;  1KCY A;  1DJY A;  1DJX A;  1K8U A;  2QPT A;  4WRI A;  1UHJ A;  1IKU A;  4YI8 A;  1XK4 A;  1NIW A;  4ORA B;  1DJZ A;  3JVT B;  4MEW A;  4P2Y B;  4JPZ B;  4Q04 A;  2P6B B;  4WQ2 A;  3GK2 A;  1F70 A;  3IQO A;  2JT3 A;  4C0L A;  1NCX A;  1BT6 A;  1Y6W A;  3CTN A;  1GGW A;  3PFV A;  1M31 A;  4CPV A;  2JNF A;  3CLN A;  1CTR A;  1NP8 A;  1YTZ C;  4ORC B;  5J3X A;  5F6T A;  2KFG A;  2I94 A;  1ZMZ A;  2AUC A;  1DJI A;  2LVK A;  1W7J B;  2PAS A;  1B8L A;  1QV0 A;  2BCA A;  3K21 A;  4N5X A;  1LA0 A;  2L51 A;  4XJK A;  3SJS A;  2L2E A;  1WY9 A;  1PVB A;  2CBL A;  4YGA A;  2LNK A;  2WOR A;  3LLE A;  2EHB A;  3JTD B;  3EK8 A;  2LMV A;  3FS7 A;  4HRG A;  1KQM C;  2JNX A;  2ZRT A;  4WQ3 A;  3KEV A;  4BY5 A;  5AER A;  3TS5 C;  2K61 A;  4N1G A;  5D7F A;  1C7V A;  1N2D A;  5K89 A;  1CNP A;  2L4H A;  4PHN A;  1KK8 B;  3ZNI A;  2KYC A;  3TUY B;  1FF1 A;  1B1G A;  1EH2 A;  4IL1 A;  1D1O A;  4OCI A;  1JBA A;  2JT0 A;  1B7T Z;  5AEQ A;  1N65 A;  1H8B A;  2M9G A;  3I5I C;  2K7D A;  1NX0 A;  4CID A;  4R1E A;  2M1K B;  2PMY A;  4XJK B;  4HSZ A;  2KQY A;  3D0Y B;  3NSI A;  1CMG A;  2M8U A;  1DGV A;  2CT9 A;  3RLZ A;  1G8I A;  2KYF A;  1Y0V H;  1Y1U A;  1B8C A;  1K93 D;  4C0J A;  1B4C A;  1AVS A;  2BBN A;  1K96 A;  1QAS A;  2LVV A;  2OS8 C;  4YI9 A;  2NZ0 A;  1S5G Z;  3E3R A;  4GPL B;  1SL9 A;  1A2X A;  2OTG C;  2JUL A;  1LXF C;  2LAN A;  1QIW A;  4PHM A;  2LHI A;  2GV5 A;  1JSA A;  3I5F C;  1QXP A;  2JWW A;  2F3Z A;  4CLN A;  1K94 A;  5TNC A;  1JWD A;  1YUT A;  1EL4 A;  1EG4 A;  1OE9 B;  3GK4 X;  4PE4 A;  2BCB A;  2LUC A;  1KQV A;  3WHT B;  1SYM A;  1V1F A;  2MHH A;  4MN0 A;  4OV2 A;  1A29 A;  2B1U A;  3EK7 A;  2FCD A;  2SAS A;  1SMG A;  2MAZ A;  2MLF C;  2L98 A;  2JRF A;  3VRR A;  3BUW B;  3ICB A;  1KQM B;  2BEC A;  1WRL A;  2NCP A;  3A8R A;  1ZOT B;  2ZND A;  2LLU A;  4NDD A;  5ER5 A;  2EGD A;  4E68 A;  4OVN F;  1TCF A;  1SBJ A;  1KSO A;  1QV1 A;  2NCO A;  3BYA A;  2BE4 A;  2LMU A;  1G33 A;  1SRA A;  2CXJ A;  1SNL A;  4QJ5 B;  1BG1 A;  3OP0 A;  1KFU L;  3OX6 A;  1YUR A;  1L2O C;  3CWG A;  5AAN A;  5HKW A;  1MHO A;  2H61 A;  2HQW A;  1N0Y A;  1BF5 A;  1YUU A;  2JTZ A;  4NDC A;  3DD4 A;  3EKJ A;  3AAJ A;  1ALW A;  1XFV O;  2FOT A;  1EG3 A;  3SIA A;  1F4O A;  1CFC A;  3EVU A;  1G4Y R;  1QVI Z;  2BL0 B;  3CR2 A;  4GGN A;  3RM1 A;  1CLM A;  1RFJ A;  2K2F A;  1V1G A;  4CFR A;  1KK7 Z;  2PRU A;  1F54 A;  5DKN A;  1RWY A;  3EK4 A;  1VRK A;  1CFP A;  1XA5 A;  1UHK A;  4PE1 A;  5KU1 A;  2F2O A;  1S6J A;  1S36 A;  4MBE A;  3OHM B;  1BR4 B;  2L0P A;  1QX2 A;  3DVJ A;  1DT7 B;  4MSP A;  3KF9 A;  2EC6 C;  5I2Q A;  1IQ5 A;  5JOL A;  3A4U B;  2KI6 C;  1NCY A;  1JF2 A;  2FCE A;  4QJ3 B;  1CFF A;  3BUX B;  1ZAC A;  1J55 A;  1JC2 A;  1NPQ A;  1IGV A;  1AHR A;  1EJ3 A;  2ZFD A;  3EVR A;  2BE6 A;  2K7B A;  4JWQ A;  3TZ1 A;  1DGU A;  4A4B A;  1H4B A;  3PM8 A;  4GGF C;  4GUK A;  3BUN B;  3H4S E;  4AOM A;  1YX7 A;  2KBI A;  2Y4Q A;  3PAT A;  1FI6 A;  3CR4 X;  2KNE A;  2KGB C;  2A4J A;  2HET A;  2KI4 C;  1AP4 A;  3TDI A;  1GQM A;  4MZL A;  1GJY A;  3SG3 A;  1OMR A;  1TNP A;  3KHE A;  1S5G Y;  2L50 A;  1F55 A;  3I5G C;  1J7Q A;  3PN7 C;  3GOF A;  1U5I A;  1L2O B;  2BCX A;  1WDC C;  2BBM A;  2HPS A;  5HLV A;  1PK0 D;  5AXI A;  1B8R A;  1PSR A;  2I18 A;  1OMV A;  3VGO A;  1EXR A;  3OX5 A;  4GGF A;  2K0J A;  1NSH A;  2ZKM X;  2E30 A;  1BOD A;  2JU0 A;  2CTN A;  2LUX A;  1CB1 A;  2BKI B;  2LM5 A;  4I5N B;  1M46 A;  1C07 A;  1K9P A;  1SR6 C;  5GQQ C;  4BY4 A;  4ZCU A;  1DMO A;  2GGM A;  1SKT A;  4GFT A;  1LIN A;  3KPX A;  3OB2 B;  4DIR A;  1CDN A;  2KSP A;  2WC8 A;  2BKH B;  2MLE C;  4MRY A;  1MWN A;  4MZJ A;  3C1V A;  2NXQ A;  1XFY O;  3GK1 A;  2D8N A;  1IWQ A;  1WLZ A;  3KO0 A;  1NX1 A;  1OZS A;  2LLS A;  4M2P A;  4TNC A;  3CZT X;  1YX8 A;  1MXL C;  2GGZ A;  1NWD A;  1SW8 A;  2LVI A;  2VRG A;  1WRK A;  1B47 A;  1MR8 A;  2M0R A;  4XYN A;  3SIB A;  1CM4 A;  2F2P A;  1U5I B;  2LC5 A;  4YGE B;  5FYX A;  2HF5 A;  2ZRS A;  4DCK A;  1DF0 A;  4D1E A;  1E8A A;  3VRP A;  3FIA A;  1A4P A;  3DF0 A;  2H2K A;  4MRX A;  2KFH A;  1IJ5 A;  1X02 A;  1A75 A;  2OPO A;  3AKB A;  4P5O E;  3TDU A;  2KI4 B;  2LHL A;  4PHK A;  3I5H C;  4PE7 A;  5KTY A;  3EKH A;  1K95 A;  3LK1 A;  1PUL A;  2I2R E;  4I5K A;  4PHJ A;  2CCM A;  5HLO A;  1RRO A;  3SG2 A;  4A4C A;  3I5G B;  3O6B A;  1YUS A;  4NDB A;  1SK6 D;  2JQ6 A;  1PVA A;  1WDC B;  2M3W A;  3F45 A;  1M45 A;  4L9M A;  3TS5 B;  2F8P A;  1S1E A;  1SPY A;  1JF0 A;  1NX3 A;  5JJG A;  2TN4 A;  2LCP A;  1GGZ A;  1F8H A;  4M2O A;  2KBM A;  3EVV A;  1AUI B;  1CLB A;  2PAL A;  5G08 A;  3FWC A;  1YVL A;  1SR6 B;  3BOW A;  3TDZ A;  2K2A A;  1OQP A;  1DF0 B;  2PSR A;  2ISD A;  1K2H A;  1YRU B;  1QTX A;  3I5I B;  4MLW A;  1XFZ O;  3DF0 B;  2SCP A;  2E6W A;  3BUO B;  2JT8 A;  1A75 B;  3DVE A;  4F0Z B;  2ZNE A;  1LA3 A;  1ZUZ A;  5I2L A;  5D69 A;  1JFK A;  2LE9 B;  1OSA A;  4OKH A;  1R6P A;  3IQQ A;  4GBA A;  2WCE A;  1WLM A;  1QS7 A;  2OS8 B;  5DKR A;  4ETO A;  5KSZ A;  1Y1X A;  1XO5 A;  1KFX S;  1S6I A;  2OTG B;  3I5F B;  3ZWH A;  1XVJ A;  2WCF A;  1JUO A;  1YVH A;  1J1E A;  1TNQ A;  4ZCV A;  1SCM C;  1BR1 B;  1MF8 B;  1UUR A;  2ZN9 A;  2G9B A;  4YGC B;  3BOW B;  5HYD A;  3CS1 A;  1PRW A;  2JZI A;  4HRE E;  1B7T Y;  1DJW A;  1SCV A;  4N1F A;  2MRD A;  2AAO A;  4HRH A;  4YRU A;  1MXE A;  2KAX A;  1CDP A;  1K9K A;  1XFW O;  4GAO A;  1OZO A;  5I8N A;  4YGB B;  2KFF A;  2K7C A;  1QAT A;  3SG5 A;  1XFU O;  4ICB A;  4PCW A;  5BPJ A;  1SY9 A;  3PLF B;  1PSB A;  4UPG A;  4USL A;  3IF7 A;  1CDM A;  5IBW A;  1TTX A;  1HQV A;  1NCZ A;  2COL B;  1BMO A;  2Y1M A;  3O2P A;  1UP5 A;  1CFD A;  4U8D A;  2MJW B;  5CSF A;  1ODB A;  1Y1A A;  1UHN A;  1IJ6 A;  1BU3 A;  3M0W A;  3PAL A;  1YRT B;  2JTT A;  3CGA A;  1QIV A;  4GNK B;  1J7P A;  1YR5 A;  1KSM A;  5ER4 X;  1DJH A;  3D0Y A;  1ALV A;  1TIZ A;  4M2Q A;  1MUX A;  2K8M B;  1FI5 A;  1FPW A;  1F4Q A;  2L4I A;  3BQ3 A;  4PDZ A;  4I5L B;  2JC2 A;  2M7N A;  2Y5I A;  1QX7 A;  3LCP C;  1K9U A;  1TN4 A;  1IH0 A;  2PVB A;  2JXC A;  2Q4U A;  1J1D A;  5HKZ A;  2KHN A;  4YGD B;  3AAK A;  3NSK A;  5B8I B;  2Y1N A;  3SG4 A;  2F33 A;  2KQ6 A;  2MBX A;  5AFP A;  1S26 D;  5CSJ A;  3LK0 A;  4CFQ A;  1F71 A;  1CLL A;  3BUM B;  1SCM B;  2LP3 A;  1M63 B;  1A03 A;  2M49 B;  1DJG A;  2EC6 B;  4DRW A;  3OB1 B;  3D10 A;  2R2I A;  1NYA A;  3SG6 A;  2LAP A;  1QLS A;  1DVI A;  1QJT A;  2O60 A;  2DOQ A;  5PAL A;  1RTP 1;  1KWO C;  5CSI A;  1PAL A;  2CNP A;  3O4Y A;  1WRZ A;  3DVM A; 
#chains in the Genus database with same CATH topology
 4INW A;  4I5J A;  1CMF A;  1AJ5 A;  4FQO A;  1QVI Y;  4NQG A;  1REC A;  3Q8I A;  4JD9 A;  3BXK A;  3VRN A;  2BL0 C;  3CZ1 A;  2QAC A;  1IG5 A;  5FI6 A;  1KK7 Y;  2WCB A;  4DUQ A;  2ZN8 A;  1TOP A;  1JFJ A;  2M7L A;  3WHU B;  4AQJ A;  3PN7 B;  2WOS A;  1FBV A;  1XYD A;  2M29 A;  3QRX A;  1RJV A;  4C0K A;  5CPV A;  1SL8 A;  3VRO A;  2FJU B;  1MQ1 A;  4PAL A;  1AK8 A;  2AMI A;  4FQT A;  1CKK A;  4MVF A;  1OOH A;  3JVT C;  4FTG A;  1J7R A;  3K1E A;  4OR9 B;  2NLN A;  3MSE B;  2LVJ A;  2KOT A;  2WC5 A;  3HCM A;  1BOC A;  2KGR A;  3WXA A;  3LL8 B;  1TNX A;  1LKJ A;  2H61 C;  1FW4 A;  2L5X B;  1OOG A;  2Q91 A;  1TCO B;  1NX2 A;  2MA2 A;  4OZD A;  1L7Z A;  3DVK A;  1M39 A;  4PE0 A;  4DS7 A;  3DYE A;  2RGI A;  2V53 A;  2KAV A;  1OMD A;  1BLQ A;  2LV7 A;  2P70 A;  4INX A;  4AQI A;  1SL7 A;  2JPT A;  1K90 D;  1QLK A;  3NXA A;  2JOJ A;  1S3P A;  3D77 A;  4ORB B;  1KFU S;  1DTL A;  1NUB A;  2M97 A;  3O78 A;  3WNX B;  3DY9 A;  1HT9 A;  5CSN A;  3JTD C;  5I2O A;  3SG7 A;  2I7A A;  2LLT A;  1QX5 B;  2LP2 A;  1Q80 A;  1CDL A;  1XFR A;  3HX4 A;  5HKY A;  3UNW A;  1UWO A;  1KWO B;  2HQ8 A;  1XK4 C;  1KFX L;  1UHI A;  2K7O A;  3AKA A;  3FWB A;  1XFX O;  3NSL A;  3PSR A;  2O5G A;  2IS9 A;  4MZK A;  1IRJ A;  3VRQ A;  1UUS A;  1BJF A;  1S6C A;  5DKQ A;  1TRF A;  1OOJ A;  1ZFS A;  1AJ4 A;  2G2B A;  1CM1 A;  1KK8 C;  2JXL A;  2KAY A;  2KI6 D;  3CR5 X;  3I5H B;  4QJ4 B;  3RZS A;  3TUY C;  1R2U A;  1J7O A;  1IQ3 A;  1RK9 A;  3NSO A;  4JKT A;  1TNW A;  2M1U A;  1C3Z A;  4JQ0 D;  4YBH B;  1C3Y A;  1UHH A;  1W7I B;  2KDH A;  1LVC D;  2LMT A;  3NHT A;  2WND A;  1B9A A;  2F3Y A;  2P71 A;  1C7W A;  1DQE A;  1DJY A;  1DJX A;  1KCY A;  1K8U A;  2QPT A;  4WRI A;  1UHJ A;  1IKU A;  4YI8 A;  1XK4 A;  1NIW A;  4ORA B;  1DJZ A;  3JVT B;  4MEW A;  4P2Y B;  4JPZ B;  4Q04 A;  2P6B B;  4WQ2 A;  3GK2 A;  1F70 A;  3IQO A;  2JT3 A;  4C0L A;  1NCX A;  1BT6 A;  1Y6W A;  3CTN A;  1GGW A;  2QEV A;  3PFV A;  1M31 A;  3V2L A;  2JNF A;  3CLN A;  4CPV A;  1CTR A;  1NP8 A;  1YTZ C;  4ORC B;  5J3X A;  5F6T A;  2KFG A;  3S0D A;  2I94 A;  3B88 A;  1ZMZ A;  2AUC A;  5FI2 A;  1DJI A;  2LVK A;  3OGN A;  1W7J B;  2PAS A;  1B8L A;  1QV0 A;  2BCA A;  3K21 A;  4N5X A;  1LA0 A;  2L51 A;  4XJK A;  3SJS A;  2L2E A;  1WY9 A;  1PVB A;  2CBL A;  4YGA A;  1W9Z A;  2LNK A;  2WOR A;  3LLE A;  2EHB A;  3JTD B;  3EK8 A;  2LMV A;  3FS7 A;  4HRG A;  1KQM C;  2JNX A;  2ZRT A;  4WQ3 A;  3KEV A;  4BY5 A;  5AER A;  3TS5 C;  2K61 A;  4N1G A;  5D7F A;  1C7V A;  1N2D A;  5K89 A;  1CNP A;  2L4H A;  4PHN A;  1KK8 B;  3ZNI A;  2KYC A;  3TUY B;  1FF1 A;  3FE6 A;  1B1G A;  1EH2 A;  4IL1 A;  1D1O A;  4OCI A;  1JBA A;  2JT0 A;  1B7T Z;  5AEQ A;  1N65 A;  1H8B A;  2M9G A;  3I5I C;  3VB1 A;  2K7D A;  1NX0 A;  4CID A;  2JPO A;  4R1E A;  3BJH A;  2M1K B;  2PMY A;  4XJK B;  4HSZ A;  2KQY A;  3D0Y B;  3NSI A;  1CMG A;  2QEH A;  2M8U A;  1DGV A;  2CT9 A;  3RLZ A;  1G8I A;  2KYF A;  1Y0V H;  1Y1U A;  1B8C A;  1K93 D;  4C0J A;  1B4C A;  1AVS A;  3B87 A;  2BBN A;  1K96 A;  1QAS A;  2LVV A;  2OS8 C;  3L4L A;  2NZ0 A;  4YI9 A;  1S5G Z;  2PYQ A;  3E3R A;  4GPL B;  1SL9 A;  1A2X A;  2OTG C;  2JUL A;  1LXF C;  2LAN A;  1QIW A;  4PHM A;  2LHI A;  2GV5 A;  1JSA A;  3I5F C;  1QXP A;  2JWW A;  2F3Z A;  4CLN A;  1K94 A;  5TNC A;  1JWD A;  1YUT A;  5DIC A;  1EL4 A;  3S0A A;  1EG4 A;  3BFB A;  1OE9 B;  3GK4 X;  4PE4 A;  2BCB A;  2LUC A;  1KQV A;  3WHT B;  1SYM A;  1V1F A;  2MHH A;  4MN0 A;  4OV2 A;  1A29 A;  2B1U A;  3EK7 A;  2FCD A;  2SAS A;  1SMG A;  3O4X A;  2MAZ A;  2MLF C;  3R1P A;  2L98 A;  2JRF A;  3VRR A;  3BUW B;  3ICB A;  1KQM B;  2BEC A;  1WRL A;  2NCP A;  3N7H A;  3A8R A;  3SS5 A;  1ZOT B;  2ZND A;  2LLU A;  4NDD A;  5ER5 A;  2EGD A;  4E68 A;  4OVN F;  1TCF A;  1SBJ A;  1KSO A;  1QV1 A;  2NCO A;  3BYA A;  4IJ7 A;  1T14 A;  2BE4 A;  3CYZ A;  3SS4 A;  2LMU A;  1TUZ A;  1G33 A;  1SRA A;  2CXJ A;  1SNL A;  4QJ5 B;  1BG1 A;  3OP0 A;  1QWV A;  1KFU L;  3OX6 A;  1YUR A;  1L2O C;  3CWG A;  5AAN A;  3S0F A;  5HKW A;  1MHO A;  2H61 A;  2HQW A;  1N0Y A;  1BF5 A;  1YUU A;  2JTZ A;  4NDC A;  3DD4 A;  3EKJ A;  3AAJ A;  1ALW A;  1XFV O;  2FOT A;  1EG3 A;  3SIA A;  1F4O A;  1CFC A;  3EVU A;  1G4Y R;  1QVI Z;  2BL0 B;  3CR2 A;  3S0G A;  4GGN A;  3RM1 A;  1CLM A;  1RFJ A;  2K2F A;  2WCM A;  3PM2 A;  1V1G A;  1OOI X;  4CFR A;  3B86 A;  1KK7 Z;  2PRU A;  1ORG A;  5DKN A;  1RWY A;  1Z2C B;  1VRK A;  2YGU A;  3EK4 A;  1CFP A;  1F54 A;  1XA5 A;  1UHK A;  4PE1 A;  3R1O A;  2F2O A;  1S6J A;  1S36 A;  4MBE A;  3OHM B;  5KU1 A;  1BR4 B;  2L0P A;  1QX2 A;  3DVJ A;  1DT7 B;  1P28 A;  4MSP A;  2WCJ A;  3KF9 A;  2EC6 C;  5I2Q A;  1IQ5 A;  5JOL A;  3A4U B;  2KI6 C;  1NCY A;  1JF2 A;  2FCE A;  3EG5 B;  4QJ3 B;  1CFF A;  3BUX B;  1ZAC A;  1J55 A;  1JC2 A;  1NPQ A;  1IGV A;  1AHR A;  1EJ3 A;  2ZFD A;  3BFA A;  2BE6 A;  2K7B A;  3EVR A;  3CAB A;  1DGU A;  4JWQ A;  3TZ1 A;  4A4B A;  1H4B A;  3PM8 A;  2WC6 A;  4GGF C;  4GUK A;  3BUN B;  3H4S E;  4AOM A;  1YX7 A;  2WCH A;  2KBI A;  2Y4Q A;  3PAT A;  1FI6 A;  3CR4 X;  2KNE A;  3CDN A;  2KGB C;  2A4J A;  2HET A;  2KI4 C;  1AP4 A;  3TDI A;  1GQM A;  4MZL A;  1GJY A;  3SG3 A;  1OMR A;  1TNP A;  3KHE A;  1S5G Y;  2L50 A;  1F55 A;  3I5G C;  1J7Q A;  3PN7 C;  3GOF A;  1U5I A;  1L2O B;  2BCX A;  1WDC C;  2BBM A;  2HPS A;  5HLV A;  1DEK A;  1PK0 D;  5AXI A;  1B8R A;  1PSR A;  2I18 A;  1OMV A;  3VGO A;  1EXR A;  3OX5 A;  4GGF A;  2K0J A;  1NSH A;  2ZKM X;  2E30 A;  1BOD A;  2JU0 A;  3PJI A;  2CTN A;  2LUX A;  1CB1 A;  2BKI B;  2LM5 A;  4I5N B;  1M46 A;  1C07 A;  1K9P A;  1SR6 C;  3DZT A;  5GQQ C;  4BY4 A;  4ZCU A;  1DMO A;  2GGM A;  1SKT A;  2WCK A;  4GFT A;  3NGV A;  1LIN A;  3KPX A;  3OB2 B;  4DIR A;  1CDN A;  2KSP A;  2WC8 A;  2BKH B;  2MLE C;  4MRY A;  1MWN A;  4MZJ A;  3C1V A;  2NXQ A;  1XFY O;  3GK1 A;  1DEL A;  2D8N A;  1IWQ A;  1WLZ A;  3KO0 A;  4PT1 A;  1NX1 A;  1OZS A;  2LLS A;  4M2P A;  4TNC A;  3CZT X;  2K60 A;  1YX8 A;  1MXL C;  3BFH A;  2GGZ A;  1NWD A;  1SW8 A;  2LVI A;  2VRG A;  1WRK A;  1B47 A;  2WCL A;  1MR8 A;  2FJY A;  2GTE A;  2M0R A;  4XYN A;  2ERB A;  3SIB A;  1CM4 A;  2F2P A;  1U5I B;  2QEB A;  2LC5 A;  4YGE B;  5FYX A;  2HF5 A;  3SS3 A;  2ZRS A;  4DCK A;  1DF0 A;  3UO9 A;  1E8A A;  4D1E A;  3CZ2 A;  3VRP A;  3FIA A;  1A4P A;  3DF0 A;  2H2K A;  3QME A;  4MRX A;  2KFH A;  1IJ5 A;  1X02 A;  1A75 A;  2OPO A;  3AKB A;  4P5O E;  3TDU A;  1Z4H A;  2KI4 B;  2LHL A;  4PHK A;  3I5H C;  4PE7 A;  5KTY A;  3B7A A;  1K95 A;  3EKH A;  3LK1 A;  1PUL A;  2QEO A;  2I2R E;  4I5K A;  4PHJ A;  2CCM A;  5HLO A;  1RRO A;  3SG2 A;  4A4C A;  3I5G B;  3O6B A;  1YUS A;  4NDB A;  5EL2 A;  1SK6 D;  2JQ6 A;  1PVA A;  1OW4 A;  1WDC B;  2M3W A;  3F45 A;  1M45 A;  4L9M A;  3TS5 B;  2F8P A;  1S1E A;  1SPY A;  1JF0 A;  1NX3 A;  5D3O A;  5JJG A;  2KPH A;  2TN4 A;  1OOF A;  2LCP A;  4F7F A;  1GGZ A;  1F8H A;  4M2O A;  2KBM A;  3EVV A;  1AUI B;  1CLB A;  2PAL A;  5G08 A;  3FWC A;  1YVL A;  1SR6 B;  3BOW A;  3TDZ A;  2K2A A;  1OQP A;  3NHI A;  1DF0 B;  2L5Y A;  2PSR A;  2ISD A;  1K2H A;  1YRU B;  1QTX A;  3I5I B;  3FE9 A;  1XFZ O;  3DF0 B;  2BAP A;  4MLW A;  1GM0 A;  2SCP A;  2E6W A;  3BUO B;  2JT8 A;  1A75 B;  3DVE A;  3B6X A;  4F0Z B;  2ZNE A;  3R1V A;  2BNX A;  2L2C A;  1LA3 A;  5HL1 A;  1ZUZ A;  5I2L A;  5D69 A;  1JFK A;  3D78 A;  2LE9 B;  1OSA A;  4OKH A;  3D74 A;  1R6P A;  3IQQ A;  4GBA A;  3CZ0 A;  1TUJ A;  1TWO A;  1WLM A;  2WCE A;  1QS7 A;  2OS8 B;  5DKR A;  4ETO A;  5KSZ A;  1Y1X A;  1XO5 A;  1KFX S;  1S6I A;  2OTG B;  3I5F B;  3ZWH A;  1XVJ A;  2WCF A;  2KLE A;  1JUO A;  1YVH A;  1J1E A;  1TNQ A;  1LS8 A;  1SCM C;  4ZCV A;  1BR1 B;  1MF8 B;  1UUR A;  2ZN9 A;  2G9B A;  4YGC B;  3BOW B;  5HYD A;  3CS1 A;  1IIO A;  1PRW A;  2JZI A;  4HRE E;  1B7T Y;  1DJW A;  1SCV A;  4N1F A;  2MRD A;  2AAO A;  2KLD A;  4HRH A;  4YRU A;  1MXE A;  2KAX A;  1CDP A;  1K9K A;  1XFW O;  4GAO A;  1OZO A;  5I8N A;  4YGB B;  2KFF A;  2K7C A;  1QAT A;  3SG5 A;  1XFU O;  4ICB A;  4PCW A;  5I94 A;  3DXL A;  1SY9 A;  3PLF B;  1PSB A;  4UPG A;  5BPJ A;  4USL A;  3IF7 A;  3R72 A;  1CDM A;  5IBW A;  1TTX A;  1HQV A;  1NCZ A;  2COL B;  1BMO A;  2Y1M A;  3O2P A;  1UP5 A;  2PQL A;  1CFD A;  3L4A A;  4U8D A;  2MJW B;  5CSF A;  1ODB A;  1Y1A A;  1UHN A;  1IJ6 A;  1BU3 A;  3M0W A;  3PAL A;  1YRT B;  1SSE B;  2JTT A;  3CGA A;  1QIV A;  4GNK B;  1J7P A;  1YR5 A;  4KYN A;  3D76 A;  1KSM A;  3IVT A;  1DJH A;  5ER4 X;  3D0Y A;  3S0B A;  1ALV A;  1TIZ A;  4M2Q A;  1MUX A;  2K8M B;  1FI5 A;  1FPW A;  1F4Q A;  2L4I A;  3BQ3 A;  4PDZ A;  4I5L B;  2JC2 A;  2M7N A;  2Y5I A;  1QX7 A;  3LCP C;  1K9U A;  1TN4 A;  1IH0 A;  2PVB A;  2JXC A;  2Q4U A;  1J1D A;  5HKZ A;  2KHN A;  4YGD B;  3AAK A;  3NSK A;  5B8I B;  2Y1N A;  3OBV A;  3SG4 A;  2F33 A;  2KQ6 A;  2MBX A;  5AFP A;  1DC1 A;  2QDI A;  1S26 D;  5CSJ A;  3LK0 A;  4CFQ A;  1F71 A;  1CLL A;  3BUM B;  1SCM B;  2LP3 A;  1M63 B;  1A03 A;  2M49 B;  1DJG A;  3L47 A;  2EC6 B;  3S0E A;  4DRW A;  3OB1 B;  3D10 A;  2R2I A;  1NYA A;  3SG6 A;  2LAP A;  1QLS A;  1DVI A;  1QJT A;  5FI7 A;  2O60 A;  2DOQ A;  5PAL A;  1RTP 1;  3D73 A;  3D75 A;  1KWO C;  5CSI A;  1PAL A;  2CNP A;  2H8V A;  3O4Y A;  1WRZ A;  3DVM A;  3FE8 A; 
#chains in the Genus database with same CATH homology
 4I5J A;  1CMF A;  1AJ5 A;  4FQO A;  1QVI Y;  4NQG A;  1REC A;  3BXK A;  3VRN A;  2BL0 C;  2QAC A;  1IG5 A;  1KK7 Y;  2WCB A;  4DUQ A;  2ZN8 A;  1TOP A;  1JFJ A;  2M7L A;  3WHU B;  4AQJ A;  3PN7 B;  2WOS A;  1FBV A;  1XYD A;  2M29 A;  3QRX A;  1RJV A;  4C0K A;  5CPV A;  1SL8 A;  3VRO A;  2FJU B;  1MQ1 A;  4PAL A;  1AK8 A;  2AMI A;  1CKK A;  4MVF A;  3JVT C;  4FTG A;  1J7R A;  4OR9 B;  2NLN A;  3MSE B;  2LVJ A;  2KOT A;  3HCM A;  1BOC A;  2KGR A;  3WXA A;  3LL8 B;  1TNX A;  1LKJ A;  2H61 C;  1FW4 A;  2L5X B;  2Q91 A;  1TCO B;  1NX2 A;  2MA2 A;  1L7Z A;  3DVK A;  1M39 A;  4PE0 A;  4DS7 A;  2RGI A;  2V53 A;  2KAV A;  1OMD A;  1BLQ A;  2LV7 A;  4AQI A;  1SL7 A;  2JPT A;  1K90 D;  1QLK A;  3NXA A;  2JOJ A;  1S3P A;  4ORB B;  1KFU S;  1DTL A;  1NUB A;  2M97 A;  3O78 A;  3WNX B;  1HT9 A;  5CSN A;  3JTD C;  5I2O A;  3SG7 A;  2I7A A;  2LLT A;  1QX5 B;  2LP2 A;  1Q80 A;  1CDL A;  3HX4 A;  5HKY A;  1UWO A;  1KWO B;  2HQ8 A;  1XK4 C;  1KFX L;  1UHI A;  2K7O A;  3AKA A;  3FWB A;  1XFX O;  3NSL A;  3PSR A;  2O5G A;  2IS9 A;  4MZK A;  1IRJ A;  3VRQ A;  1UUS A;  1BJF A;  1S6C A;  5DKQ A;  1TRF A;  1OOJ A;  1AJ4 A;  1ZFS A;  2G2B A;  1CM1 A;  1KK8 C;  2JXL A;  2KAY A;  2KI6 D;  3CR5 X;  3I5H B;  4QJ4 B;  3TUY C;  1R2U A;  1J7O A;  1IQ3 A;  1RK9 A;  3NSO A;  4JQ0 D;  1TNW A;  2M1U A;  4YBH B;  1UHH A;  1W7I B;  2KDH A;  1LVC D;  2LMT A;  2WND A;  1B9A A;  2F3Y A;  1C7W A;  1KCY A;  1DJY A;  1DJX A;  1K8U A;  2QPT A;  4WRI A;  1UHJ A;  1IKU A;  4YI8 A;  1XK4 A;  1NIW A;  4ORA B;  1DJZ A;  3JVT B;  4MEW A;  4P2Y B;  4JPZ B;  4Q04 A;  2P6B B;  4WQ2 A;  3GK2 A;  1F70 A;  3IQO A;  2JT3 A;  4C0L A;  1NCX A;  1BT6 A;  1Y6W A;  3CTN A;  1GGW A;  3PFV A;  1M31 A;  4CPV A;  2JNF A;  3CLN A;  1CTR A;  1NP8 A;  1YTZ C;  4ORC B;  5J3X A;  5F6T A;  2KFG A;  2I94 A;  1ZMZ A;  2AUC A;  1DJI A;  2LVK A;  1W7J B;  2PAS A;  1B8L A;  1QV0 A;  2BCA A;  3K21 A;  4N5X A;  1LA0 A;  2L51 A;  4XJK A;  3SJS A;  2L2E A;  1WY9 A;  1PVB A;  2CBL A;  4YGA A;  2LNK A;  2WOR A;  3LLE A;  2EHB A;  3JTD B;  3EK8 A;  2LMV A;  3FS7 A;  4HRG A;  1KQM C;  2JNX A;  2ZRT A;  4WQ3 A;  3KEV A;  4BY5 A;  5AER A;  3TS5 C;  2K61 A;  4N1G A;  5D7F A;  1C7V A;  1N2D A;  5K89 A;  1CNP A;  2L4H A;  4PHN A;  1KK8 B;  3ZNI A;  2KYC A;  3TUY B;  1FF1 A;  1B1G A;  1EH2 A;  4IL1 A;  1D1O A;  4OCI A;  1JBA A;  2JT0 A;  1B7T Z;  5AEQ A;  1N65 A;  1H8B A;  2M9G A;  3I5I C;  2K7D A;  1NX0 A;  4CID A;  4R1E A;  2M1K B;  2PMY A;  4XJK B;  4HSZ A;  2KQY A;  3D0Y B;  3NSI A;  1CMG A;  2M8U A;  1DGV A;  2CT9 A;  3RLZ A;  1G8I A;  2KYF A;  1Y0V H;  1Y1U A;  1B8C A;  1K93 D;  4C0J A;  1B4C A;  1AVS A;  2BBN A;  1K96 A;  1QAS A;  2LVV A;  2OS8 C;  4YI9 A;  2NZ0 A;  1S5G Z;  3E3R A;  4GPL B;  1SL9 A;  1A2X A;  2OTG C;  2JUL A;  1LXF C;  2LAN A;  1QIW A;  4PHM A;  2LHI A;  2GV5 A;  1JSA A;  3I5F C;  1QXP A;  2JWW A;  2F3Z A;  4CLN A;  1K94 A;  5TNC A;  1JWD A;  1YUT A;  1EL4 A;  1EG4 A;  1OE9 B;  3GK4 X;  4PE4 A;  2BCB A;  2LUC A;  1KQV A;  3WHT B;  1SYM A;  1V1F A;  2MHH A;  4MN0 A;  4OV2 A;  1A29 A;  2B1U A;  3EK7 A;  2FCD A;  2SAS A;  1SMG A;  2MAZ A;  2MLF C;  2L98 A;  2JRF A;  3VRR A;  3BUW B;  3ICB A;  1KQM B;  2BEC A;  1WRL A;  2NCP A;  3A8R A;  1ZOT B;  2ZND A;  2LLU A;  4NDD A;  5ER5 A;  2EGD A;  4E68 A;  4OVN F;  1TCF A;  1SBJ A;  1KSO A;  1QV1 A;  2NCO A;  3BYA A;  2BE4 A;  2LMU A;  1G33 A;  1SRA A;  2CXJ A;  1SNL A;  4QJ5 B;  1BG1 A;  3OP0 A;  1KFU L;  3OX6 A;  1YUR A;  1L2O C;  3CWG A;  5AAN A;  5HKW A;  1MHO A;  2H61 A;  2HQW A;  1N0Y A;  1BF5 A;  1YUU A;  2JTZ A;  4NDC A;  3DD4 A;  3EKJ A;  3AAJ A;  1ALW A;  1XFV O;  2FOT A;  1EG3 A;  3SIA A;  1F4O A;  1CFC A;  3EVU A;  1G4Y R;  1QVI Z;  2BL0 B;  3CR2 A;  4GGN A;  3RM1 A;  1CLM A;  1RFJ A;  2K2F A;  1V1G A;  4CFR A;  1KK7 Z;  2PRU A;  1F54 A;  5DKN A;  1RWY A;  3EK4 A;  1VRK A;  1CFP A;  1XA5 A;  1UHK A;  4PE1 A;  5KU1 A;  2F2O A;  1S6J A;  1S36 A;  4MBE A;  3OHM B;  1BR4 B;  2L0P A;  1QX2 A;  3DVJ A;  1DT7 B;  4MSP A;  3KF9 A;  2EC6 C;  5I2Q A;  1IQ5 A;  5JOL A;  3A4U B;  2KI6 C;  1NCY A;  1JF2 A;  2FCE A;  4QJ3 B;  1CFF A;  3BUX B;  1ZAC A;  1J55 A;  1JC2 A;  1NPQ A;  1IGV A;  1AHR A;  1EJ3 A;  2ZFD A;  3EVR A;  2BE6 A;  2K7B A;  4JWQ A;  3TZ1 A;  1DGU A;  4A4B A;  1H4B A;  3PM8 A;  4GGF C;  4GUK A;  3BUN B;  3H4S E;  4AOM A;  1YX7 A;  2KBI A;  2Y4Q A;  3PAT A;  1FI6 A;  3CR4 X;  2KNE A;  2KGB C;  2A4J A;  2HET A;  2KI4 C;  1AP4 A;  3TDI A;  1GQM A;  4MZL A;  1GJY A;  3SG3 A;  1OMR A;  1TNP A;  3KHE A;  1S5G Y;  2L50 A;  1F55 A;  3I5G C;  1J7Q A;  3PN7 C;  3GOF A;  1U5I A;  1L2O B;  2BCX A;  1WDC C;  2BBM A;  2HPS A;  5HLV A;  1PK0 D;  5AXI A;  1B8R A;  1PSR A;  2I18 A;  1OMV A;  3VGO A;  1EXR A;  3OX5 A;  4GGF A;  2K0J A;  1NSH A;  2ZKM X;  2E30 A;  1BOD A;  2JU0 A;  2CTN A;  2LUX A;  1CB1 A;  2BKI B;  2LM5 A;  4I5N B;  1M46 A;  1C07 A;  1K9P A;  1SR6 C;  5GQQ C;  4BY4 A;  4ZCU A;  1DMO A;  2GGM A;  1SKT A;  4GFT A;  1LIN A;  3KPX A;  3OB2 B;  4DIR A;  1CDN A;  2KSP A;  2WC8 A;  2BKH B;  2MLE C;  4MRY A;  1MWN A;  4MZJ A;  3C1V A;  2NXQ A;  1XFY O;  3GK1 A;  2D8N A;  1IWQ A;  1WLZ A;  3KO0 A;  1NX1 A;  1OZS A;  2LLS A;  4M2P A;  4TNC A;  3CZT X;  1YX8 A;  1MXL C;  2GGZ A;  1NWD A;  1SW8 A;  2LVI A;  2VRG A;  1WRK A;  1B47 A;  1MR8 A;  2M0R A;  4XYN A;  3SIB A;  1CM4 A;  2F2P A;  1U5I B;  2LC5 A;  4YGE B;  5FYX A;  2HF5 A;  2ZRS A;  4DCK A;  1DF0 A;  4D1E A;  1E8A A;  3VRP A;  3FIA A;  1A4P A;  3DF0 A;  2H2K A;  4MRX A;  2KFH A;  1IJ5 A;  1X02 A;  1A75 A;  2OPO A;  3AKB A;  4P5O E;  3TDU A;  2KI4 B;  2LHL A;  4PHK A;  3I5H C;  4PE7 A;  5KTY A;  3EKH A;  1K95 A;  3LK1 A;  1PUL A;  2I2R E;  4I5K A;  4PHJ A;  2CCM A;  5HLO A;  1RRO A;  3SG2 A;  4A4C A;  3I5G B;  3O6B A;  1YUS A;  4NDB A;  1SK6 D;  2JQ6 A;  1PVA A;  1WDC B;  2M3W A;  3F45 A;  1M45 A;  4L9M A;  3TS5 B;  2F8P A;  1S1E A;  1SPY A;  1JF0 A;  1NX3 A;  5JJG A;  2TN4 A;  2LCP A;  1GGZ A;  1F8H A;  4M2O A;  2KBM A;  3EVV A;  1AUI B;  1CLB A;  2PAL A;  5G08 A;  3FWC A;  1YVL A;  1SR6 B;  3BOW A;  3TDZ A;  2K2A A;  1OQP A;  1DF0 B;  2PSR A;  2ISD A;  1K2H A;  1YRU B;  1QTX A;  3I5I B;  4MLW A;  1XFZ O;  3DF0 B;  2SCP A;  2E6W A;  3BUO B;  2JT8 A;  1A75 B;  3DVE A;  4F0Z B;  2ZNE A;  1LA3 A;  1ZUZ A;  5I2L A;  5D69 A;  1JFK A;  2LE9 B;  1OSA A;  4OKH A;  1R6P A;  3IQQ A;  4GBA A;  2WCE A;  1WLM A;  1QS7 A;  2OS8 B;  5DKR A;  4ETO A;  5KSZ A;  1Y1X A;  1XO5 A;  1KFX S;  1S6I A;  2OTG B;  3I5F B;  3ZWH A;  1XVJ A;  2WCF A;  1JUO A;  1YVH A;  1J1E A;  1TNQ A;  4ZCV A;  1SCM C;  1BR1 B;  1MF8 B;  1UUR A;  2ZN9 A;  2G9B A;  4YGC B;  3BOW B;  5HYD A;  3CS1 A;  1PRW A;  2JZI A;  4HRE E;  1B7T Y;  1DJW A;  1SCV A;  4N1F A;  2MRD A;  2AAO A;  4HRH A;  4YRU A;  1MXE A;  2KAX A;  1CDP A;  1K9K A;  1XFW O;  4GAO A;  1OZO A;  5I8N A;  4YGB B;  2KFF A;  2K7C A;  1QAT A;  3SG5 A;  1XFU O;  4ICB A;  4PCW A;  5BPJ A;  1SY9 A;  3PLF B;  1PSB A;  4UPG A;  4USL A;  3IF7 A;  1CDM A;  5IBW A;  1TTX A;  1HQV A;  1NCZ A;  2COL B;  1BMO A;  2Y1M A;  3O2P A;  1UP5 A;  1CFD A;  4U8D A;  2MJW B;  5CSF A;  1ODB A;  1Y1A A;  1UHN A;  1IJ6 A;  1BU3 A;  3M0W A;  3PAL A;  1YRT B;  2JTT A;  3CGA A;  1QIV A;  4GNK B;  1J7P A;  1YR5 A;  1KSM A;  5ER4 X;  1DJH A;  3D0Y A;  1ALV A;  1TIZ A;  4M2Q A;  1MUX A;  2K8M B;  1FI5 A;  1FPW A;  1F4Q A;  2L4I A;  3BQ3 A;  4PDZ A;  4I5L B;  2JC2 A;  2M7N A;  2Y5I A;  1QX7 A;  3LCP C;  1K9U A;  1TN4 A;  1IH0 A;  2PVB A;  2JXC A;  2Q4U A;  1J1D A;  5HKZ A;  2KHN A;  4YGD B;  3AAK A;  3NSK A;  5B8I B;  2Y1N A;  3SG4 A;  2F33 A;  2KQ6 A;  2MBX A;  5AFP A;  1S26 D;  5CSJ A;  3LK0 A;  4CFQ A;  1F71 A;  1CLL A;  3BUM B;  1SCM B;  2LP3 A;  1M63 B;  1A03 A;  2M49 B;  1DJG A;  2EC6 B;  4DRW A;  3OB1 B;  3D10 A;  2R2I A;  1NYA A;  3SG6 A;  2LAP A;  1QLS A;  1DVI A;  1QJT A;  2O60 A;  2DOQ A;  5PAL A;  1RTP 1;  1KWO C;  5CSI A;  1PAL A;  2CNP A;  3O4Y A;  1WRZ A;  3DVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...