3FE9A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand soaked at ph 7.0
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
total genus 44
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe9A00
2QDIA 2H8VA 3FE9A 2KPHA 2P70A 3VB1A 3R72A 2WCJA 3B88A 3NGVA 3FE6A 2WCKA 1OOIX 1XFRA 1OOGA 3DZTA 1OW4A 3B87A 3RZSA 3QMEA 3CABA 1P28A 3CDNA 3S0DA 3S0FA 1QWVA 3S0EA 3R1VA 3B86A 3B6XA 3D76A 2WCMA 2WC5A 3Q8IA 2JPOA 2GTEA 4JD9A 3NHIA 3S0GA 2FJYA 3K1EA 2WCHA 3BJHA 3L47A 3CZ0A 3NHTA 3L4LA 3N7HA 3CZ1A 5DICA 3BFBA 3OGNA 1TWOA 3D74A 1OOHA 3D75A 2PQLA 4FQTA 3B7AA 3BFAA 3DYEA 4F7FA 2QEVA 4INXA 2QEBA 3DY9A 5EL2A 1T14A 3S0AA 2P71A 3R1OA 1LS8A 2L2CA 3CZ2A 2WCLA 3R1PA 3D77A 3V2LA 2QEHA 3CYZA 3S0BA 2WC6A 3D73A 1TUJA 1C3YA 2ERBA 1OOFA 1DQEA 3PJIA 3D78A 4OZDA 3L4AA 3FE8A 1ORGA 3DXLA 4INWA 3BFHA 1GM0A 1C3ZA 4PT1A 2QEOA
chains in the Genus database with same CATH superfamily
2AMIA 4KYNA 5HYDA 1LKJA 1DELA 3TDIA 5CSJA 1B4CA 2EGDA 1CTRA 2P70A 1B47A 3SG7A 4WQ3A 3TDUA 1CLMA 2K2FA 2Y1NA 4NDDA 2KGRA 3PSRA 1TNQA 3QRXA 5I2LA 1D1OA 1CMFA 3JTDC 4MEWA 4ORAB 2A4JA 3DZTA 1OW4A 3NSOA 4P5OE 5D69A 2LNKA 1PSBA 1W7IB 1TRFA 2KLDA 1F71A 1SL9A 3KHEA 5ER4X 3KO0A 1UHJA 4OR9B 1QLSA 3OP0A 1OMRA 2ISDA 2M3WA 1P28A 3WXAA 3CDNA 3IQOA 4HRGA 2M8UA 4ORBB 3AKBA 3NSKA 1HT9A 3E3RA 1DJWA 3R1VA 1SR6C 2M1UA 3B86A 3B6XA 1ZUZA 3D76A 2O60A 5FI2A 1S5GZ 1UHNA 2COLB 4GAOA 1V1GA 1XK4A 2TN4A 3PFVA 5I94A 2BECA 1BODA 2GTEA 3SJSA 1WLMA 5HL1A 1NX1A 2BNXA 1TCFA 1YURA 2BL0B 2KBIA 3BOWB 3S0GA 1ALVA 2FJYA 1S6CA 2KSPA 1A4PA 2KDHA 2HF5A 1CMGA 3SG3A 1B8CA 2YGUA 2LANA 3EVUA 2K60A 1M46A 1V1FA 2NCOA 3TS5B 1XK4C 1AVSA 1QIVA 1IG5A 1S1EA 2L4IA 1DEKA 4PHMA 1B8RA 5AEQA 3CZ1A 4IJ7A 2FOTA 3BUNB 1G4YR 1RTP1 1A75B 4QJ4B 2PQLA 5CSFA 1DMOA 1FW4A 1YVLA 1W9ZA 3I5HB 3BUMB 3AKAA 4USLA 4F7FA 3F45A 3LL8B 1XO5A 2PSRA 2QEVA 3PN7B 2SCPA 3EK7A 4ICBA 1N2DA 4R1EA 3O2PA 1HQVA 3OHMB 1ALWA 2JC2A 2WORA 3HX4A 1F55A 1DF0B 1F8HA 1KK7Y 1S5GY 5G08A 4IL1A 4A4CA 5DKQA 3VRQA 2Q91A 2KBMA 1FF1A 2QACA 1OMDA 1RROA 2LVJA 3HCMA 5HLOA 3SS5A 2CXJA 1LVCD 1NIWA 1WDCB 2F2PA 2KYFA 3O4YA 4YGBB 1BOCA 1J1DA 3S0BA 1J7PA 4MZLA 1SR6B 2L50A 1CDLA 4UPGA 1EG4A 1CNPA 1EXRA 1OMVA 3BUOB 3ZWHA 2OPOA 1WLZA 1BR1B 2HQ8A 2R2IA 2LAPA 3DD4A 3L4AA 4D1EA 3DXLA 2M7LA 4PCWA 1N0YA 1QXPA 2K7OA 4WRIA 1NWDA 5ER5A 1ZFSA 1WY9A 1RFJA 1C3ZA 2K7CA 2H2KA 2LM5A 1SBJA 2M7NA 1NP8A 2QEOA 2LMVA 2M1KB 1NCXA 4WQ2A 3BOWA 3WHTB 2M0RA 1RWYA 3TZ1A 4YRUA 2QDIA 2PRUA 2LVVA 5D7FA 1IQ5A 1UHKA 4PHNA 1E8AA 1PK0D 3R72A 4MRXA 2FCEA 1S36A 2JT3A 4PE4A 2H61A 2LC5A 2MRDA 2WCKA 1UUSA 3LK1A 2QPTA 3M0WA 2PVBA 2BL0C 1G33A 1KFXS 1BG1A 1Y1UA 1A75A 2PMYA 3IQQA 1YRTB 1YUSA 1XFYO 1F70A 3RZSA 1IRJA 4CPVA 1NX3A 3DVMA 3CABA 3QMEA 2KHNA 1K2HA 1NUBA 2H61C 3UNWA 3I5FC 1XA5A 2HPSA 4XJKA 2PASA 4I5NB 3S0FA 3CS1A 1QWVA 2GV5A 5CPVA 2JT8A 3RLZA 1DF0A 5K89A 1DT7B 3BUWB 1CKKA 1TUZA 2MHHA 3KPXA 3SS4A 1Z4HA 2JULA 2PYQA 4YI8A 3PM8A 3I5HC 3Q8IA 2JPOA 1XFVO 2K8MB 3JVTB 1CLBA 4JD9A 3PN7C 1RECA 1ODBA 2L5XB 2JZIA 3K1EA 2WCHA 3BQ3A 3FIAA 1MUXA 1K93D 2NCPA 1SL7A 1SKTA 1K95A 4AOMA 2LHIA 1YX8A 2LUCA 1Y1AA 3SIAA 5KU1A 2SASA 3WHUB 1AK8A 2JXCA 3H4SE 5DICA 4I5LB 4N1GA 1MF8B 3FWCA 1VRKA 1TWOA 1WDCC 1K8UA 2NZ0A 1EH2A 4GFTA 1YVHA 2KNEA 2PALA 2VRGA 2D8NA 3B7AA 1OZSA 2WNDA 1OQPA 3BFAA 3CTNA 4DUQA 2Y1MA 5GQQC 3EK8A 3OX5A 1NCZA 3EVVA 1WRKA 2Q4UA 1CM1A 1LA3A 3PALA 4NDCA 1GGZA 5EL2A 2EC6C 3EKHA 5I2QA 2GGMA 2G2BA 4YGDB 3S0AA 1QLKA 2L98A 2P71A 2CT9A 2JWWA 2BBNA 5FYXA 1EG3A 1X02A 1ZACA 2NLNA 5FI7A 4PHKA 4MSPA 2L2CA 1S3PA 1CDNA 5J3XA 1QIWA 1KFUL 1WRZA 3A8RA 1F4OA 3I5FB 1UHHA 2QEHA 2K7BA 1AJ4A 3VRNA 1TUJA 1YX7A 1C07A 1OZOA 4YGAA 3DF0B 3EKJA 1R6PA 3D78A 1NPQA 3OB1B 1BT6A 1XFWO 4CLNA 1ORGA 1F4QA 1YUUA 3GK4X 5HKZA 5AERA 2F2OA 1NX0A 1J7QA 1S26D 2I94A 4XJKB 1GM0A 4DS7A 1DJYA 4BY4A 4DRWA 2K2AA 1SCMC 1YRUB 4M2OA 4PE0A 3K21A 1J7RA 1Q80A 2LHLA 4PALA 1BR4B 2WC8A 5KTYA 3EK4A 5HKYA 2KI6D 1KK8B 1DJZA 1DJXA 4NQGA 4PE1A 4FQOA 3SG5A 2JPTA 2E30A 1C7WA 2B1UA 5AXIA 2LVIA 1AJ5A 1MXEA 2JOJA 2M9GA 1B9AA 3FE9A 3SIBA 4GGNA 1SY9A 3WNXB 1PVBA 3VB1A 4P2YB 2F33A 2WCJA 3NGVA 1JUOA 3JVTC 1GGWA 1XFRA 4MVFA 4OV2A 1CB1A 4PE7A 1NYAA 1DGVA 2BAPA 1OOGA 3TDZA 1LA0A 1NX2A 2EC6B 3KEVA 2I18A 4CIDA 4JQ0D 3B87A 3VRPA 3VGOA 2F3ZA 3ZNIA 2CCMA 1FI5A 2KAXA 1SPYA 1L2OC 1A2XA 2CNPA 1XFXO 1LINA 3S0EA 2ZNEA 1QATA 1IKUA 3CR2A 2WCMA 2WCBA 1GQMA 3CR5X 2LVKA 2Y4QA 4A4BA 2WC5A 4C0JA 1BF5A 2JQ6A 1SSEB 4Q04A 5F6TA 2L2EA 2K7DA 4BY5A 1L7ZA 2LLUA 4YGCB 4ORCB 2LE9B 2LP3A 1JWDA 3DF0A 3L47A 3CZ0A 4NDBA 2L51A 1DC1A 2WCEA 2ZKMX 2BKIB 1SCMB 2OTGB 3N7HA 1DJGA 1OOJA 4AQIA 1TCOB 1JFJA 2MA2A 1JFKA 3OGNA 1DTLA 3AAKA 1B7TZ 4OCIA 1Y6WA 2FJUB 1QX2A 3D75A 1YUTA 3I5GB 4F0ZB 4FQTA 2KFHA 2L0PA 3BXKA 2KAYA 2F3YA 1QJTA 4U8DA 5TNCA 1QASA 5CSNA 1RK9A 4DIRA 1UHIA 3GK2A 1M45A 1EJ3A 2LCPA 2QEBA 1IQ3A 3DY9A 1KQMC 2L4HA 3CGAA 4MLWA 1GJYA 4GUKA 1J55A 2KLEA 1KFUS 1Y0VH 1QX7A 4XYNA 1OSAA 3R1OA 2LV7A 1N65A 1IGVA 2KI4C 2WCLA 2HQWA 3GOFA 1L2OB 2MLFC 3CR4X 3D77A 4I5JA 4L9MA 3LK0A 4MBEA 3CYZA 3V2LA 1KK8C 1QX5B 1XFUO 3BUXB 4I5KA 1OE9B 2WC6A 3D73A 5IBWA 1C3YA 1FBVA 1SMGA 1OOFA 2KOTA 1IJ6A 1QS7A 2BCAA 2KYCA 1RJVA 3PJIA 1K9PA 2LLSA 1QVIZ 1BU3A 2K0JA 1MWNA 3PLFB 4JPZB 3D0YA 1AP4A 4OVNF 1KCYA 2O5GA 1H8BA 3BYAA 1JSAA 1SCVA 1B7TY 1XVJA 2KFGA 2KI6C 1FPWA 3DVKA 1U5IB 4YI9A 1F54A 1KFXL 2JU0A 3OX6A 1ZOTB 1EL4A 1BJFA 1TTXA 1YR5A 3I5IC 3LLEA 4MN0A 1KWOC 3SG2A 3SG4A 4GGFA 1R2UA 1IIOA 2CBLA 1K9KA 2H8VA 1KK7Z 1PVAA 2P6BB 2KPHA 4E68A 1KSOA 1XYDA 1LXFC 1PRWA 1DJIA 2L5YA 3TUYB 1IJ5A 2BCBA 3B88A 3FE6A 3VRRA 3CWGA 3PATA 2BE6A 1UP5A 1OOIX 1PULA 3EVRA 4QJ3B 3C1VA 2G9BA 4C0KA 1XFZO 4GGFC 1JC2A 1KQMB 2NXQA 5PALA 2KQ6A 3FS7A 1TNPA 1UURA 4HSZA 4MRYA 3AAJA 1B8LA 2DOQA 2IS9A 2JT0A 3UO9A 3O78A 2LLTA 2OTGC 1DVIA 1CDPA 4ZCUA 1QVIY 2OS8C 4MZJA 3VROA 2KI4B 5HKWA 2EHBA 2FCDA 4OKHA 1C7VA 3S0DA 3NXAA 2WCFA 2LP2A 1S6JA 2KFFA 2ZFDA 5AANA 1G8IA 2JTTA 3DVJA 3I5GC 3MSEB 2AUCA 5KSZA 5D3OA 4M2QA 5HLVA 1K9UA 1MXLC 4HREE 2ZRTA 2LMTA 2MJWB 3JTDB 1JF2A 3OB2B 2JNXA 1AUIB 1YTZC 3NHIA 1QV0A 4ETOA 1SNLA 1NSHA 1QV1A 1K90D 2RGIA 4JWQA 2KGBC 2LMUA 3O6BA 5B8IB 1TN4A 2I7AA 2ZN9A 3BJHA 1M31A 2JXLA 1AHRA 5AFPA 3LCPC 1TNXA 3NHTA 1BLQA 3CZTX 3L4LA 1DJHA 4MZKA 1IWQA 1Y1XA 2MBXA 1CFPA 1M63B 1TIZA 3D0YB 3BFBA 3I5IB 5DKRA 1KWOB 1CM4A 5FI6A 3D74A 2CTNA 1OOHA 1CFDA 1U5IA 2LUXA 4HRHA 1SYMA 3EG5B 4M2PA 4GBAA 1FI6A 1M39A 5I2OA 3DYEA 4JKTA 1NCYA 3GK1A 4FTGA 2KQYA 3FWBA 4GPLB 2AAOA 1PSRA 4INXA 1SL8A 1DGUA 3D10A 2JRFA 1SK6D 4N5XA 1TNWA 1IH0A 2F8PA 3ICBA 1A03A 1JBAA 1BMOA 4GNKB 1T14A 2M29A 3IF7A 5BPJA 2BE4A 1H4BA 2JTZA 4PDZA 1A29A 1J1EA 2WOSA 4YGEB 3NSIA 4ZCVA 3DVEA 5CSIA 2HETA 1LS8A 2ZNDA 2BBMA 5I8NA 5DKNA 1J7OA 3SG6A 1KQVA 3CZ2A 2OS8B 3R1PA 5JJGA 4CFRA 2BKHB 1K94A 3O4XA 1JF0A 1MHOA 4YBHB 1W7JB 2K61A 2MAZA 2ERBA 3A4UB 1CFFA 1SW8A 1SRAA 1DQEA 4AQJA 3IVTA 1TOPA 2E6WA 1MQ1A 1CLLA 2KAVA 3TUYC 1K96A 1CFCA 4OZDA 2M49B 1QTXA 1MR8A 3CLNA 3FE8A 5JOLA 4CFQA 1UWOA 1Z2CB 1PALA 2M97A 2JNFA 3PM2A 3RM1A 3SS3A 4INWA 4QJ5B 1KSMA 1CDMA 1WRLA 2GGZA 3BFHA 4TNCA 1B1GA 4C0LA 4N1FA 2V53A 2I2RE 3OBVA 4PT1A 3TS5C 2BCXA 3KF9A 4DCKA 1S6IA 3NSLA 4PHJA 2MLEC 1ZMZA 2ZRSA 2Y5IA 2ZN8A
chains in the Genus database with same CATH topology
2QDIA 2H8VA 3FE9A 2KPHA 2P70A 3VB1A 3R72A 2WCJA 3B88A 3NGVA 3FE6A 2WCKA 1OOIX 1XFRA 1OOGA 3DZTA 1OW4A 3B87A 3RZSA 3QMEA 3CABA 1P28A 3CDNA 3S0DA 3S0FA 1QWVA 3S0EA 3R1VA 3B86A 3B6XA 3D76A 2WCMA 2WC5A 3Q8IA 2JPOA 2GTEA 4JD9A 3NHIA 3S0GA 2FJYA 3K1EA 2WCHA 3BJHA 3L47A 3CZ0A 3NHTA 3L4LA 3N7HA 3CZ1A 5DICA 3BFBA 3OGNA 1TWOA 3D74A 1OOHA 3D75A 2PQLA 4FQTA 3B7AA 3BFAA 3DYEA 4F7FA 2QEVA 4INXA 2QEBA 3DY9A 5EL2A 1T14A 3S0AA 2P71A 3R1OA 1LS8A 2L2CA 3CZ2A 2WCLA 3R1PA 3D77A 3V2LA 2QEHA 3CYZA 3S0BA 2WC6A 3D73A 1TUJA 1C3YA 2ERBA 1OOFA 1DQEA 3PJIA 3D78A 4OZDA 3L4AA 3FE8A 1ORGA 3DXLA 4INWA 3BFHA 1GM0A 1C3ZA 4PT1A 2QEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDI A;  2H8V A;  3FE9 A;  2KPH A;  2P70 A;  3VB1 A;  3R72 A;  2WCJ A;  3B88 A;  3NGV A;  3FE6 A;  2WCK A;  1OOI X;  1XFR A;  1OOG A;  3DZT A;  1OW4 A;  3B87 A;  3RZS A;  3QME A;  3CAB A;  1P28 A;  3CDN A;  3S0D A;  3S0F A;  1QWV A;  3S0E A;  3R1V A;  3B86 A;  3B6X A;  3D76 A;  2WCM A;  2WC5 A;  3Q8I A;  2JPO A;  2GTE A;  4JD9 A;  3NHI A;  3S0G A;  2FJY A;  3K1E A;  2WCH A;  3BJH A;  3L47 A;  3CZ0 A;  3NHT A;  3L4L A;  3N7H A;  3CZ1 A;  5DIC A;  3BFB A;  3OGN A;  1TWO A;  3D74 A;  1OOH A;  3D75 A;  2PQL A;  4FQT A;  3B7A A;  3BFA A;  3DYE A;  4F7F A;  2QEV A;  4INX A;  2QEB A;  3DY9 A;  5EL2 A;  1T14 A;  3S0A A;  2P71 A;  3R1O A;  1LS8 A;  2L2C A;  3CZ2 A;  2WCL A;  3R1P A;  3D77 A;  3V2L A;  2QEH A;  3CYZ A;  3S0B A;  2WC6 A;  3D73 A;  1TUJ A;  1C3Y A;  2ERB A;  1OOF A;  1DQE A;  3PJI A;  3D78 A;  4OZD A;  3L4A A;  3FE8 A;  1ORG A;  3DXL A;  4INW A;  3BFH A;  1GM0 A;  1C3Z A;  4PT1 A;  2QEO A; 
#chains in the Genus database with same CATH topology
 2AMI A;  4KYN A;  5HYD A;  1LKJ A;  1DEL A;  3TDI A;  5CSJ A;  1B4C A;  2EGD A;  1CTR A;  2P70 A;  1B47 A;  3SG7 A;  4WQ3 A;  3TDU A;  1CLM A;  2K2F A;  2Y1N A;  4NDD A;  2KGR A;  3PSR A;  1TNQ A;  3QRX A;  5I2L A;  1D1O A;  1CMF A;  3JTD C;  4MEW A;  4ORA B;  2A4J A;  3DZT A;  1OW4 A;  3NSO A;  4P5O E;  5D69 A;  2LNK A;  1PSB A;  1W7I B;  1TRF A;  2KLD A;  1F71 A;  1SL9 A;  3KHE A;  5ER4 X;  3KO0 A;  1UHJ A;  4OR9 B;  1QLS A;  3OP0 A;  1OMR A;  2ISD A;  2M3W A;  1P28 A;  3WXA A;  3CDN A;  3IQO A;  4HRG A;  2M8U A;  4ORB B;  3AKB A;  3NSK A;  1HT9 A;  3E3R A;  1DJW A;  3R1V A;  1SR6 C;  2M1U A;  3B86 A;  3B6X A;  1ZUZ A;  3D76 A;  2O60 A;  5FI2 A;  1S5G Z;  1UHN A;  2COL B;  4GAO A;  1V1G A;  1XK4 A;  2TN4 A;  3PFV A;  5I94 A;  2BEC A;  1BOD A;  2GTE A;  3SJS A;  1WLM A;  5HL1 A;  1NX1 A;  2BNX A;  1TCF A;  1YUR A;  2BL0 B;  2KBI A;  3BOW B;  3S0G A;  1ALV A;  2FJY A;  1S6C A;  2KSP A;  1A4P A;  2KDH A;  2HF5 A;  1CMG A;  3SG3 A;  1B8C A;  2YGU A;  2LAN A;  3EVU A;  2K60 A;  1M46 A;  1V1F A;  2NCO A;  3TS5 B;  1XK4 C;  1AVS A;  1QIV A;  1IG5 A;  1S1E A;  2L4I A;  1DEK A;  4PHM A;  1B8R A;  5AEQ A;  3CZ1 A;  4IJ7 A;  2FOT A;  3BUN B;  1G4Y R;  1RTP 1;  1A75 B;  4QJ4 B;  2PQL A;  5CSF A;  1DMO A;  1FW4 A;  1YVL A;  1W9Z A;  3I5H B;  3BUM B;  3AKA A;  4USL A;  4F7F A;  3F45 A;  3LL8 B;  1XO5 A;  2PSR A;  2QEV A;  3PN7 B;  2SCP A;  3EK7 A;  4ICB A;  1N2D A;  4R1E A;  3O2P A;  1HQV A;  3OHM B;  1ALW A;  2JC2 A;  2WOR A;  3HX4 A;  1F55 A;  1DF0 B;  1F8H A;  1KK7 Y;  1S5G Y;  5G08 A;  4IL1 A;  4A4C A;  5DKQ A;  3VRQ A;  2Q91 A;  2KBM A;  1FF1 A;  2QAC A;  1OMD A;  1RRO A;  2LVJ A;  3HCM A;  5HLO A;  3SS5 A;  2CXJ A;  1LVC D;  1NIW A;  1WDC B;  2F2P A;  2KYF A;  3O4Y A;  4YGB B;  1BOC A;  1J1D A;  3S0B A;  1J7P A;  4MZL A;  1SR6 B;  2L50 A;  1CDL A;  4UPG A;  1EG4 A;  1CNP A;  1EXR A;  1OMV A;  3BUO B;  3ZWH A;  2OPO A;  1WLZ A;  1BR1 B;  2HQ8 A;  2R2I A;  2LAP A;  3DD4 A;  3L4A A;  4D1E A;  3DXL A;  2M7L A;  4PCW A;  1N0Y A;  1QXP A;  2K7O A;  4WRI A;  1NWD A;  5ER5 A;  1ZFS A;  1WY9 A;  1RFJ A;  1C3Z A;  2K7C A;  2H2K A;  2LM5 A;  1SBJ A;  2M7N A;  1NP8 A;  2QEO A;  2LMV A;  2M1K B;  1NCX A;  4WQ2 A;  3BOW A;  3WHT B;  2M0R A;  1RWY A;  3TZ1 A;  4YRU A;  2QDI A;  2PRU A;  2LVV A;  5D7F A;  1IQ5 A;  1UHK A;  4PHN A;  1E8A A;  1PK0 D;  3R72 A;  4MRX A;  2FCE A;  1S36 A;  2JT3 A;  4PE4 A;  2H61 A;  2LC5 A;  2MRD A;  2WCK A;  1UUS A;  3LK1 A;  2QPT A;  3M0W A;  2PVB A;  2BL0 C;  1G33 A;  1KFX S;  1BG1 A;  1Y1U A;  1A75 A;  2PMY A;  3IQQ A;  1YRT B;  1YUS A;  1XFY O;  1F70 A;  3RZS A;  1IRJ A;  4CPV A;  1NX3 A;  3DVM A;  3CAB A;  3QME A;  2KHN A;  1K2H A;  1NUB A;  2H61 C;  3UNW A;  3I5F C;  1XA5 A;  2HPS A;  4XJK A;  2PAS A;  4I5N B;  3S0F A;  3CS1 A;  1QWV A;  2GV5 A;  5CPV A;  2JT8 A;  3RLZ A;  1DF0 A;  5K89 A;  1DT7 B;  3BUW B;  1CKK A;  1TUZ A;  2MHH A;  3KPX A;  3SS4 A;  1Z4H A;  2JUL A;  2PYQ A;  4YI8 A;  3PM8 A;  3I5H C;  3Q8I A;  2JPO A;  1XFV O;  2K8M B;  3JVT B;  1CLB A;  4JD9 A;  3PN7 C;  1REC A;  1ODB A;  2L5X B;  2JZI A;  3K1E A;  2WCH A;  3BQ3 A;  3FIA A;  1MUX A;  1K93 D;  2NCP A;  1SL7 A;  1SKT A;  1K95 A;  4AOM A;  2LHI A;  1YX8 A;  2LUC A;  1Y1A A;  3SIA A;  5KU1 A;  2SAS A;  3WHU B;  1AK8 A;  2JXC A;  3H4S E;  5DIC A;  4I5L B;  4N1G A;  1MF8 B;  3FWC A;  1VRK A;  1TWO A;  1WDC C;  1K8U A;  2NZ0 A;  1EH2 A;  4GFT A;  1YVH A;  2KNE A;  2PAL A;  2VRG A;  2D8N A;  3B7A A;  1OZS A;  2WND A;  1OQP A;  3BFA A;  3CTN A;  4DUQ A;  2Y1M A;  5GQQ C;  3EK8 A;  3OX5 A;  1NCZ A;  3EVV A;  1WRK A;  2Q4U A;  1CM1 A;  1LA3 A;  3PAL A;  4NDC A;  1GGZ A;  5EL2 A;  2EC6 C;  3EKH A;  5I2Q A;  2GGM A;  2G2B A;  4YGD B;  3S0A A;  1QLK A;  2L98 A;  2P71 A;  2CT9 A;  2JWW A;  2BBN A;  5FYX A;  1EG3 A;  1X02 A;  1ZAC A;  2NLN A;  5FI7 A;  4PHK A;  4MSP A;  2L2C A;  1S3P A;  1CDN A;  5J3X A;  1QIW A;  1KFU L;  1WRZ A;  3A8R A;  1F4O A;  3I5F B;  1UHH A;  2QEH A;  2K7B A;  1AJ4 A;  3VRN A;  1TUJ A;  1YX7 A;  1C07 A;  1OZO A;  4YGA A;  3DF0 B;  3EKJ A;  1R6P A;  3D78 A;  1NPQ A;  3OB1 B;  1BT6 A;  1XFW O;  4CLN A;  1ORG A;  1F4Q A;  1YUU A;  3GK4 X;  5HKZ A;  5AER A;  2F2O A;  1NX0 A;  1J7Q A;  1S26 D;  2I94 A;  4XJK B;  1GM0 A;  4DS7 A;  1DJY A;  4BY4 A;  4DRW A;  2K2A A;  1SCM C;  1YRU B;  4M2O A;  4PE0 A;  3K21 A;  1J7R A;  1Q80 A;  2LHL A;  4PAL A;  1BR4 B;  2WC8 A;  5KTY A;  3EK4 A;  5HKY A;  2KI6 D;  1KK8 B;  1DJZ A;  1DJX A;  4NQG A;  4PE1 A;  4FQO A;  3SG5 A;  2JPT A;  2E30 A;  1C7W A;  2B1U A;  5AXI A;  2LVI A;  1AJ5 A;  1MXE A;  2JOJ A;  2M9G A;  1B9A A;  3FE9 A;  3SIB A;  4GGN A;  1SY9 A;  3WNX B;  1PVB A;  3VB1 A;  4P2Y B;  2F33 A;  2WCJ A;  3NGV A;  1JUO A;  3JVT C;  1GGW A;  1XFR A;  4MVF A;  4OV2 A;  1CB1 A;  4PE7 A;  1NYA A;  1DGV A;  2BAP A;  1OOG A;  3TDZ A;  1LA0 A;  1NX2 A;  2EC6 B;  3KEV A;  2I18 A;  4CID A;  4JQ0 D;  3B87 A;  3VRP A;  3VGO A;  2F3Z A;  3ZNI A;  2CCM A;  1FI5 A;  2KAX A;  1SPY A;  1L2O C;  1A2X A;  2CNP A;  1XFX O;  1LIN A;  3S0E A;  2ZNE A;  1QAT A;  1IKU A;  3CR2 A;  2WCM A;  2WCB A;  1GQM A;  3CR5 X;  2LVK A;  2Y4Q A;  4A4B A;  2WC5 A;  4C0J A;  1BF5 A;  2JQ6 A;  1SSE B;  4Q04 A;  5F6T A;  2L2E A;  2K7D A;  4BY5 A;  1L7Z A;  2LLU A;  4YGC B;  4ORC B;  2LE9 B;  2LP3 A;  1JWD A;  3DF0 A;  3L47 A;  3CZ0 A;  4NDB A;  2L51 A;  1DC1 A;  2WCE A;  2ZKM X;  2BKI B;  1SCM B;  2OTG B;  3N7H A;  1DJG A;  1OOJ A;  4AQI A;  1TCO B;  1JFJ A;  2MA2 A;  1JFK A;  3OGN A;  1DTL A;  3AAK A;  1B7T Z;  4OCI A;  1Y6W A;  2FJU B;  1QX2 A;  3D75 A;  1YUT A;  3I5G B;  4F0Z B;  4FQT A;  2KFH A;  2L0P A;  3BXK A;  2KAY A;  2F3Y A;  1QJT A;  4U8D A;  5TNC A;  1QAS A;  5CSN A;  1RK9 A;  4DIR A;  1UHI A;  3GK2 A;  1M45 A;  1EJ3 A;  2LCP A;  2QEB A;  1IQ3 A;  3DY9 A;  1KQM C;  2L4H A;  3CGA A;  4MLW A;  1GJY A;  4GUK A;  1J55 A;  2KLE A;  1KFU S;  1Y0V H;  1QX7 A;  4XYN A;  1OSA A;  3R1O A;  2LV7 A;  1N65 A;  1IGV A;  2KI4 C;  2WCL A;  2HQW A;  3GOF A;  1L2O B;  2MLF C;  3CR4 X;  3D77 A;  4I5J A;  4L9M A;  3LK0 A;  4MBE A;  3CYZ A;  3V2L A;  1KK8 C;  1QX5 B;  1XFU O;  3BUX B;  4I5K A;  1OE9 B;  2WC6 A;  3D73 A;  5IBW A;  1C3Y A;  1FBV A;  1SMG A;  1OOF A;  2KOT A;  1IJ6 A;  1QS7 A;  2BCA A;  2KYC A;  1RJV A;  3PJI A;  1K9P A;  2LLS A;  1QVI Z;  1BU3 A;  2K0J A;  1MWN A;  3PLF B;  4JPZ B;  3D0Y A;  1AP4 A;  4OVN F;  1KCY A;  2O5G A;  1H8B A;  3BYA A;  1JSA A;  1SCV A;  1B7T Y;  1XVJ A;  2KFG A;  2KI6 C;  1FPW A;  3DVK A;  1U5I B;  4YI9 A;  1F54 A;  1KFX L;  2JU0 A;  3OX6 A;  1ZOT B;  1EL4 A;  1BJF A;  1TTX A;  1YR5 A;  3I5I C;  3LLE A;  4MN0 A;  1KWO C;  3SG2 A;  3SG4 A;  4GGF A;  1R2U A;  1IIO A;  2CBL A;  1K9K A;  2H8V A;  1KK7 Z;  1PVA A;  2P6B B;  2KPH A;  4E68 A;  1KSO A;  1XYD A;  1LXF C;  1PRW A;  1DJI A;  2L5Y A;  3TUY B;  1IJ5 A;  2BCB A;  3B88 A;  3FE6 A;  3VRR A;  3CWG A;  3PAT A;  2BE6 A;  1UP5 A;  1OOI X;  1PUL A;  3EVR A;  4QJ3 B;  3C1V A;  2G9B A;  4C0K A;  1XFZ O;  4GGF C;  1JC2 A;  1KQM B;  2NXQ A;  5PAL A;  2KQ6 A;  3FS7 A;  1TNP A;  1UUR A;  4HSZ A;  4MRY A;  3AAJ A;  1B8L A;  2DOQ A;  2IS9 A;  2JT0 A;  3UO9 A;  3O78 A;  2LLT A;  2OTG C;  1DVI A;  1CDP A;  4ZCU A;  1QVI Y;  2OS8 C;  4MZJ A;  3VRO A;  2KI4 B;  5HKW A;  2EHB A;  2FCD A;  4OKH A;  1C7V A;  3S0D A;  3NXA A;  2WCF A;  2LP2 A;  1S6J A;  2KFF A;  2ZFD A;  5AAN A;  1G8I A;  2JTT A;  3DVJ A;  3I5G C;  3MSE B;  2AUC A;  5KSZ A;  5D3O A;  4M2Q A;  5HLV A;  1K9U A;  1MXL C;  4HRE E;  2ZRT A;  2LMT A;  2MJW B;  3JTD B;  1JF2 A;  3OB2 B;  2JNX A;  1AUI B;  1YTZ C;  3NHI A;  1QV0 A;  4ETO A;  1SNL A;  1NSH A;  1QV1 A;  1K90 D;  2RGI A;  4JWQ A;  2KGB C;  2LMU A;  3O6B A;  5B8I B;  1TN4 A;  2I7A A;  2ZN9 A;  3BJH A;  1M31 A;  2JXL A;  1AHR A;  5AFP A;  3LCP C;  1TNX A;  3NHT A;  1BLQ A;  3CZT X;  3L4L A;  1DJH A;  4MZK A;  1IWQ A;  1Y1X A;  2MBX A;  1CFP A;  1M63 B;  1TIZ A;  3D0Y B;  3BFB A;  3I5I B;  5DKR A;  1KWO B;  1CM4 A;  5FI6 A;  3D74 A;  2CTN A;  1OOH A;  1CFD A;  1U5I A;  2LUX A;  4HRH A;  1SYM A;  3EG5 B;  4M2P A;  4GBA A;  1FI6 A;  1M39 A;  5I2O A;  3DYE A;  4JKT A;  1NCY A;  3GK1 A;  4FTG A;  2KQY A;  3FWB A;  4GPL B;  2AAO A;  1PSR A;  4INX A;  1SL8 A;  1DGU A;  3D10 A;  2JRF A;  1SK6 D;  4N5X A;  1TNW A;  1IH0 A;  2F8P A;  3ICB A;  1A03 A;  1JBA A;  1BMO A;  4GNK B;  1T14 A;  2M29 A;  3IF7 A;  5BPJ A;  2BE4 A;  1H4B A;  2JTZ A;  4PDZ A;  1A29 A;  1J1E A;  2WOS A;  4YGE B;  3NSI A;  4ZCV A;  3DVE A;  5CSI A;  2HET A;  1LS8 A;  2ZND A;  2BBM A;  5I8N A;  5DKN A;  1J7O A;  3SG6 A;  1KQV A;  3CZ2 A;  2OS8 B;  3R1P A;  5JJG A;  4CFR A;  2BKH B;  1K94 A;  3O4X A;  1JF0 A;  1MHO A;  4YBH B;  1W7J B;  2K61 A;  2MAZ A;  2ERB A;  3A4U B;  1CFF A;  1SW8 A;  1SRA A;  1DQE A;  4AQJ A;  3IVT A;  1TOP A;  2E6W A;  1MQ1 A;  1CLL A;  2KAV A;  3TUY C;  1K96 A;  1CFC A;  4OZD A;  2M49 B;  1QTX A;  1MR8 A;  3CLN A;  3FE8 A;  5JOL A;  4CFQ A;  1UWO A;  1Z2C B;  1PAL A;  2M97 A;  2JNF A;  3PM2 A;  3RM1 A;  3SS3 A;  4INW A;  4QJ5 B;  1KSM A;  1CDM A;  1WRL A;  2GGZ A;  3BFH A;  4TNC A;  1B1G A;  4C0L A;  4N1F A;  2V53 A;  2I2R E;  3OBV A;  4PT1 A;  3TS5 C;  2BCX A;  3KF9 A;  4DCK A;  1S6I A;  3NSL A;  4PHJ A;  2MLE C;  1ZMZ A;  2ZRS A;  2Y5I A;  2ZN8 A; 
#chains in the Genus database with same CATH homology
 2QDI A;  2H8V A;  3FE9 A;  2KPH A;  2P70 A;  3VB1 A;  3R72 A;  2WCJ A;  3B88 A;  3NGV A;  3FE6 A;  2WCK A;  1OOI X;  1XFR A;  1OOG A;  3DZT A;  1OW4 A;  3B87 A;  3RZS A;  3QME A;  3CAB A;  1P28 A;  3CDN A;  3S0D A;  3S0F A;  1QWV A;  3S0E A;  3R1V A;  3B86 A;  3B6X A;  3D76 A;  2WCM A;  2WC5 A;  3Q8I A;  2JPO A;  2GTE A;  4JD9 A;  3NHI A;  3S0G A;  2FJY A;  3K1E A;  2WCH A;  3BJH A;  3L47 A;  3CZ0 A;  3NHT A;  3L4L A;  3N7H A;  3CZ1 A;  5DIC A;  3BFB A;  3OGN A;  1TWO A;  3D74 A;  1OOH A;  3D75 A;  2PQL A;  4FQT A;  3B7A A;  3BFA A;  3DYE A;  4F7F A;  2QEV A;  4INX A;  2QEB A;  3DY9 A;  5EL2 A;  1T14 A;  3S0A A;  2P71 A;  3R1O A;  1LS8 A;  2L2C A;  3CZ2 A;  2WCL A;  3R1P A;  3D77 A;  3V2L A;  2QEH A;  3CYZ A;  3S0B A;  2WC6 A;  3D73 A;  1TUJ A;  1C3Y A;  2ERB A;  1OOF A;  1DQE A;  3PJI A;  3D78 A;  4OZD A;  3L4A A;  3FE8 A;  1ORG A;  3DXL A;  4INW A;  3BFH A;  1GM0 A;  1C3Z A;  4PT1 A;  2QEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...