3FE9A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand soaked at ph 7.0
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 44
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe9A00
3NHTA 2L2CA 1OOIX 2WC6A 3L4AA 2QDIA 1TUJA 5EL2A 3S0GA 3V2LA 1LS8A 3NHIA 3OGNA 3D74A 3S0DA 2WCKA 1OOHA 1C3ZA 2P70A 3FE8A 3Q8IA 1GM0A 3FE9A 3CDNA 2H8VA 3B86A 2QEOA 3B7AA 1P28A 3R1VA 3D78A 1DQEA 3D73A 3R1OA 1C3YA 4F7FA 3S0AA 3BFHA 2QEBA 1TWOA 3DZTA 3D77A 2WC5A 1OOGA 3DXLA 2ERBA 2WCJA 3N7HA 3CYZA 1XFRA 2JPOA 4INXA 2PQLA 2FJYA 3CZ0A 3R72A 1T14A 3NGVA 3K1EA 3RZSA 4PT1A 2WCHA 3D76A 4FQTA 3S0BA 4OZDA 3L4LA 2WCLA 3B88A 3CABA 3S0EA 1QWVA 3FE6A 3D75A 1OW4A 3BFBA 2QEVA 3B6XA 3DY9A 5DICA 2KPHA 3DYEA 4JD9A 1OOFA 2WCMA 3S0FA 3PJIA 3BJHA 2P71A 3B87A 3QMEA 2GTEA 3L47A 4INWA 3R1PA 3CZ2A 3VB1A 2QEHA 3BFAA 3CZ1A 1ORGA
chains in the Genus database with same CATH superfamily
4YI8A 1JC2A 4YRUA 3BXKA 1SW8A 2L2CA 3NHTA 1GGZA 3CS1A 3LK0A 1B47A 2KAYA 4MRYA 4MVFA 3SG7A 4CLNA 3LLEA 1N65A 2EC6C 1SNLA 1TUJA 3KEVA 4PHKA 2LE9B 3NHIA 4PDZA 4DRWA 1BR1B 1FPWA 5J3XA 1LA0A 1SK6D 1KK7Z 1YURA 5AERA 1KFUS 4QJ3B 2L4IA 2M0RA 4JPZB 1SBJA 5HLVA 4UPGA 3TUYB 3D74A 1ODBA 1ZUZA 2P6BB 1NUBA 3DD4A 1DJZA 2CTNA 1CLLA 2JXLA 1QS7A 2NCOA 1C7VA 1QATA 1UHJA 4YGDB 1Y0VH 3Q8IA 3I5FB 2BL0B 2OS8C 2ISDA 1ALWA 3EG5B 1J7RA 2H8VA 3KO0A 3CGAA 2CBLA 5D3OA 1OOJA 2KSPA 1AK8A 4I5JA 4PHJA 2BNXA 2M7NA 2I2RE 2KBIA 3B7AA 1J1EA 1JF2A 3B86A 3NSKA 4ORCB 2KFFA 2LV7A 2K61A 3E3RA 1PK0D 3D10A 4GUKA 3RLZA 4A4CA 1DQEA 1KK7Y 1DT7B 3EVRA 2CCMA 1C3YA 1LA3A 3DVMA 4FTGA 1CDPA 1YRUB 1XYDA 3AAJA 1QJTA 4CPVA 1BMOA 4MLWA 1H8BA 2HF5A 3D77A 1OOGA 2G2BA 3FIAA 2M8UA 2BCAA 2M97A 3JVTB 3DVJA 1LKJA 3O4XA 3UNWA 4C0KA 2COLB 1MXLC 1XFRA 4D1EA 1WY9A 2K60A 4PHMA 5HLOA 1M45A 1JF0A 1NCXA 1WLZA 3R72A 5HKWA 3TDZA 1T14A 2LLUA 1Y6WA 2Y5IA 3K1EA 4WQ2A 2OTGC 3RZSA 1YRTB 4YGEB 4NDCA 3D76A 4FQTA 1GGWA 1U5IB 2SCPA 4C0LA 5CSNA 4ETOA 3OX5A 5I2QA 1YVLA 2KLEA 5CSJA 2JZIA 2O5GA 2KYFA 2JWWA 2WCLA 3CR4X 3LCPC 1KWOC 3CTNA 3B88A 4DCKA 1CFPA 5K89A 3FE6A 4OV2A 2BBMA 3DF0B 2M29A 3D75A 3NSIA 2EC6B 2K7CA 3HX4A 1NX3A 5DICA 5DKRA 5I94A 3I5IC 2BE6A 1TTXA 4BY5A 2BECA 2B1UA 2WCMA 4M2PA 2RGIA 3H4SE 3S0FA 4U8DA 1SR6B 1M31A 3O2PA 2P71A 2O60A 4P5OE 4USLA 1K96A 2D8NA 1DJYA 3QMEA 4TNCA 3EK8A 3L47A 2E30A 2E6WA 2JOJA 4GFTA 2GGZA 1SY9A 4INWA 1V1GA 3O78A 4XYNA 5KSZA 4MZLA 5B8IB 1RWYA 1S6JA 3PALA 1PRWA 5ER4X 4HRGA 3ZWHA 2KQYA 2OS8B 1PVBA 2TN4A 4MZKA 1A75A 3M0WA 2AAOA 5CSIA 1TNXA 1YUSA 3PATA 1QLSA 1NX0A 5FI6A 2KI6D 1ZOTB 1C7WA 4GBAA 1FI6A 2KGRA 2YGUA 2K2AA 2OPOA 4MZJA 1K95A 1F71A 1AJ5A 1GJYA 3AKAA 3PN7B 2QACA 3EVVA 5EL2A 1AJ4A 4IL1A 3I5HC 1JSAA 2BKIB 3SS4A 2JU0A 3SG2A 4YBHB 2LANA 5AFPA 2PVBA 2JULA 1XFUO 2ZNEA 2LVIA 1QX5B 5BPJA 1S5GZ 2KNEA 2KAVA 4QJ4B 1J1DA 1BJFA 2LUCA 1SPYA 2MJWB 1B4CA 1TRFA 2LC5A 1NX2A 1OSAA 3OB1B 1J7OA 1S3PA 1B8LA 1WDCC 3EK4A 2OTGB 1TNQA 2AUCA 4IJ7A 3CDNA 1M63B 1S6CA 1TIZA 2KFGA 1TCFA 2L5YA 4MBEA 4BY4A 5HL1A 1SYMA 1E8AA 1DJIA 2NCPA 1NP8A 3DVKA 4ORAB 5DKNA 1YUUA 3DF0A 4N1FA 1DVIA 1EL4A 1P28A 1PSRA 3GK4X 4ZCUA 1IQ3A 3OB2B 1KWOB 1B8CA 2H2KA 5JJGA 2I18A 1UURA 4I5NB 4F7FA 3SJSA 1S5GY 1DJHA 3OX6A 2QEBA 2ZKMX 1CMFA 1TWOA 3I5IB 2F33A 2ZRSA 2WCJA 3EKHA 2L98A 2HQ8A 3SG6A 2CXJA 1LVCD 1RTP1 1K8UA 3OHMB 4NDBA 4AQJA 4MN0A 2JPOA 1Z4HA 2FCEA 4E68A 1YX7A 3BQ3A 3CR5X 4MEWA 4QJ5B 1KQMB 1CFCA 2PQLA 4PHNA 1DEKA 2DOQA 2KQ6A 1ALVA 1B7TZ 1GQMA 3CZ0A 3NGVA 1A75B 2M7LA 4PT1A 3JTDC 2KI4C 4N5XA 4ZCVA 1EH2A 4ICBA 1DF0A 2PSRA 1X02A 2FCDA 1BT6A 1XFVO 1PALA 1XFZO 3HCMA 4PCWA 5PALA 1BODA 2Q91A 3CABA 3SS5A 1QWVA 1OMVA 2PALA 1A4PA 4MSPA 5KTYA 1OZSA 4PALA 1FBVA 2NLNA 1OW4A 1CLMA 3PLFB 1HQVA 1K9UA 3DY9A 1BOCA 2I94A 3DVEA 3I5HB 2BCXA 1CTRA 4KYNA 3DYEA 4I5KA 4OR9B 4CIDA 1OOFA 2KDHA 1SKTA 2KBMA 4DUQA 1B7TY 3BJHA 5HKZA 1CNPA 2KOTA 1S1EA 4JWQA 2JQ6A 4HSZA 4JQ0D 1FW4A 1Y1AA 2KHNA 1SMGA 2LP3A 2Y1MA 3AKBA 5D69A 1H4BA 4PE0A 1DMOA 2KYCA 3I5GB 3R1PA 3CZ2A 1ZFSA 1IWQA 2LAPA 1UWOA 2K0JA 2LMVA 3VB1A 2K8MB 4GGFC 1WDCB 3CZ1A 2WCBA 4GGFA 2K7OA 3IF7A 2BCBA 3VRPA 1TNWA 1RK9A 2ZRTA 2K7DA 1J7PA 2M9GA 1OOIX 2WC6A 1XO5A 1XFXO 2QDIA 1WRKA 1QV1A 3VROA 1SCVA 3SG4A 4YI9A 1C07A 3S0GA 1F54A 1LS8A 2JTZA 2LLTA 3RM1A 1OMRA 2JNXA 3TDIA 1J55A 1KCYA 1F4QA 2LMTA 3OGNA 1F55A 5FI2A 1L2OC 4GNKB 1QTXA 1OOHA 1XFWO 5CPVA 1A29A 1C3ZA 3C1VA 3F45A 4JKTA 1AP4A 3TS5C 5KU1A 3BUOB 3BYAA 5JOLA 1BR4B 1FI5A 1GM0A 3FE9A 1R6PA 1L7ZA 1OMDA 2F2PA 1DF0B 3JTDB 1V1FA 1CFDA 2HETA 1G4YR 1CB1A 3I5FC 1DJGA 1NIWA 2ZN9A 3D0YA 1N0YA 5F6TA 1XK4C 1SSEB 3QRXA 3D78A 2L0PA 2LUXA 2F3YA 3D73A 2NZ0A 1NCZA 1AVSA 1MXEA 3SIBA 1FF1A 1R2UA 2JTTA 3BFHA 4MRXA 1SRAA 2H61C 2BBNA 2PRUA 1KQVA 2EGDA 2PMYA 1WLMA 2R2IA 4HREE 1YUTA 1IQ5A 2CT9A 2H61A 1QIVA 2LHLA 1PSBA 3DZTA 4GPLB 2ERBA 1K94A 2FOTA 3CWGA 1J7QA 2VRGA 1S26D 2BE4A 3BOWA 3N7HA 3VGOA 2PASA 5IBWA 1IH0A 3CYZA 1QVIZ 1WRLA 3SG5A 1W9ZA 4INXA 4C0JA 2MAZA 3NXAA 2FJYA 3BUXB 5GQQC 1ZACA 1Y1XA 2FJUB 3CZTX 3PSRA 3EK7A 3VRRA 1B8RA 1TUZA 1UHIA 1HT9A 2EHBA 1S36A 3NSOA 2WCHA 1CM4A 1VRKA 2F8PA 1MWNA 3IQQA 5HKYA 4YGBB 1B1GA 2LM5A 2JXCA 2KAXA 2JT0A 2PYQA 3EKJA 2MLEC 2MRDA 3L4LA 1Z2CB 2M3WA 1KFXS 3S0EA 1NWDA 3PM2A 1W7JB 4YGAA 1EG4A 2SASA 2LP2A 4YGCB 2V53A 3SG3A 1CDLA 2WC8A 1G8IA 2A4JA 4I5LB 1QVIY 2LMUA 2ZN8A 4CFQA 3PJIA 4ORBB 1M39A 1XA5A 1F8HA 2MBXA 5I2LA 2F2OA 1Q80A 2Y4QA 1L2OB 2JT3A 1CM1A 1NYAA 3B87A 3GOFA 1DTLA 1MF8B 2ZFDA 1F70A 2GTEA 4OCIA 1MQ1A 2WCFA 4OVNF 2MHHA 1YTZC 1PVAA 1SR6C 2F3ZA 1IKUA 1BLQA 1CMGA 1UHHA 3TS5B 5I2OA 3O6BA 3TDUA 1JFKA 3BFAA 5I8NA 1A03A 2JC2A 4P2YB 2HPSA 1ORGA 3D0YB 4M2OA 2Y1NA 2KLDA 3FS7A 3TZ1A 3VRQA 1BG1A 3GK2A 2JT8A 4L9MA 1DC1A 1CLBA 1TNPA 1RROA 1KK8C 1CDMA 3K21A 1SL9A 2BKHB 2LCPA 3L4AA 2GGMA 3KHEA 1DJXA 2LLSA 3VRNA 4AQIA 1QIWA 1UP5A 3V2LA 4NQGA 3IVTA 1QXPA 3EVUA 2LVKA 4Q04A 1LXFC 1MR8A 3PN7C 4HRHA 5AXIA 3UO9A 1IRJA 2L2EA 1KSMA 2LVJA 4CFRA 3AAKA 3BOWB 5D7FA 2L4HA 4WRIA 3CLNA 1G33A 3S0DA 2WCKA 1SCMC 3OP0A 1UHKA 1CFFA 1QX2A 4A4BA 1AHRA 1W7IB 3WNXB 1F4OA 1MHOA 2KGBC 2M49B 2Q4UA 5AEQA 3SS3A 1LINA 1KSOA 2P70A 5ER5A 1DELA 3FE8A 1TOPA 3GK1A 1DJWA 3PM8A 1XFYO 5FI7A 3IQOA 1BF5A 2WORA 1XVJA 4NDDA 3ZNIA 4XJKB 1YVHA 3BUMB 1SL7A 2BAPA 2QEOA 3FWBA 2LNKA 1NX1A 1K2HA 2JPTA 1RFJA 3R1VA 2ZNDA 1NPQA 3O4YA 1B9AA 3R1OA 1ZMZA 1IIOA 3S0AA 3ICBA 1M46A 2JRFA 1CKKA 1K93D 1QLKA 2AMIA 1OE9B 2WOSA 1SL8A 2L50A 1QASA 3FWCA 1JUOA 1K9KA 2WC5A 3DXLA 1N2DA 1Y1UA 1NCYA 4R1EA 3TUYC 1DGUA 2MLFC 1RECA 1IJ6A 5AANA 1K90D 2NXQA 2GV5A 1AUIB 2WNDA 2L5XB 3KPXA 5G08A 5TNCA 1JFJA 2KI4B 4N1GA 1EXRA 1UUSA 3PFVA 2BL0C 1RJVA 4PE1A 3WHUB 4F0ZB 1PULA 1OZOA 1D1OA 1KQMC 1IGVA 4PE4A 1XK4A 2K2FA 4DIRA 2LHIA 3MSEB 3NSLA 3S0BA 1IG5A 1EJ3A 1S6IA 1WRZA 3A4UB 4OZDA 1UHNA 2JNFA 1KK8B 5DKQA 1EG3A 4OKHA 2M1UA 3LL8B 2KFHA 4DS7A 1TN4A 3BFBA 4FQOA 2QEVA 3B6XA 1MUXA 2IS9A 2KPHA 3A8RA 2K7BA 2MA2A 1CDNA 4JD9A 1KFXL 1NSHA 1YR5A 3JVTC 5HYDA 2WCEA 5CSFA 1BU3A 3BUNB 4WQ3A 5FYXA 1A2XA 3LK1A 1SCMB 4GAOA 2M1KB 4AOMA 1IJ5A 4GGNA 3SIAA 1QX7A 3CR2A 2KI6C 1TCOB 4XJKA 3WXAA 4M2QA 3BUWB 1K9PA 4PE7A 1JWDA 2HQWA 2QPTA 1DGVA 1YX8A 2I7AA 1KFUL 2L51A 2LVVA 2QEHA 3OBVA 3WHTB 1QV0A 3I5GC 2CNPA 3KF9A 2G9BA 1OQPA 1JBAA 1U5IA
chains in the Genus database with same CATH topology
3NHTA 2L2CA 1OOIX 2WC6A 3L4AA 2QDIA 1TUJA 5EL2A 3S0GA 3V2LA 1LS8A 3NHIA 3OGNA 3D74A 3S0DA 2WCKA 1OOHA 1C3ZA 2P70A 3FE8A 3Q8IA 1GM0A 3FE9A 3CDNA 2H8VA 3B86A 2QEOA 3B7AA 1P28A 3R1VA 3D78A 1DQEA 3D73A 3R1OA 1C3YA 4F7FA 3S0AA 3BFHA 2QEBA 1TWOA 3DZTA 3D77A 2WC5A 1OOGA 3DXLA 2ERBA 2WCJA 3N7HA 3CYZA 1XFRA 2JPOA 4INXA 2PQLA 2FJYA 3CZ0A 3R72A 1T14A 3NGVA 3K1EA 3RZSA 4PT1A 2WCHA 3D76A 4FQTA 3S0BA 4OZDA 3L4LA 2WCLA 3B88A 3CABA 3S0EA 1QWVA 3FE6A 3D75A 1OW4A 3BFBA 2QEVA 3B6XA 3DY9A 5DICA 2KPHA 3DYEA 4JD9A 1OOFA 2WCMA 3S0FA 3PJIA 3BJHA 2P71A 3B87A 3QMEA 2GTEA 3L47A 4INWA 3R1PA 3CZ2A 3VB1A 2QEHA 3BFAA 3CZ1A 1ORGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHT A;  2L2C A;  1OOI X;  2WC6 A;  3L4A A;  2QDI A;  1TUJ A;  5EL2 A;  3S0G A;  3V2L A;  1LS8 A;  3NHI A;  3OGN A;  3D74 A;  3S0D A;  2WCK A;  1OOH A;  1C3Z A;  2P70 A;  3FE8 A;  3Q8I A;  1GM0 A;  3FE9 A;  3CDN A;  2H8V A;  3B86 A;  2QEO A;  3B7A A;  1P28 A;  3R1V A;  3D78 A;  1DQE A;  3D73 A;  3R1O A;  1C3Y A;  4F7F A;  3S0A A;  3BFH A;  2QEB A;  1TWO A;  3DZT A;  3D77 A;  2WC5 A;  1OOG A;  3DXL A;  2ERB A;  2WCJ A;  3N7H A;  3CYZ A;  1XFR A;  2JPO A;  4INX A;  2PQL A;  2FJY A;  3CZ0 A;  3R72 A;  1T14 A;  3NGV A;  3K1E A;  3RZS A;  4PT1 A;  2WCH A;  3D76 A;  4FQT A;  3S0B A;  4OZD A;  3L4L A;  2WCL A;  3B88 A;  3CAB A;  3S0E A;  1QWV A;  3FE6 A;  3D75 A;  1OW4 A;  3BFB A;  2QEV A;  3B6X A;  3DY9 A;  5DIC A;  2KPH A;  3DYE A;  4JD9 A;  1OOF A;  2WCM A;  3S0F A;  3PJI A;  3BJH A;  2P71 A;  3B87 A;  3QME A;  2GTE A;  3L47 A;  4INW A;  3R1P A;  3CZ2 A;  3VB1 A;  2QEH A;  3BFA A;  3CZ1 A;  1ORG A; 
#chains in the Genus database with same CATH topology
 4YI8 A;  1JC2 A;  4YRU A;  3BXK A;  1SW8 A;  2L2C A;  3NHT A;  1GGZ A;  3CS1 A;  3LK0 A;  1B47 A;  2KAY A;  4MRY A;  4MVF A;  3SG7 A;  4CLN A;  3LLE A;  1N65 A;  2EC6 C;  1SNL A;  1TUJ A;  3KEV A;  4PHK A;  2LE9 B;  3NHI A;  4PDZ A;  4DRW A;  1BR1 B;  1FPW A;  5J3X A;  1LA0 A;  1SK6 D;  1KK7 Z;  1YUR A;  5AER A;  1KFU S;  4QJ3 B;  2L4I A;  2M0R A;  4JPZ B;  1SBJ A;  5HLV A;  4UPG A;  3TUY B;  3D74 A;  1ODB A;  1ZUZ A;  2P6B B;  1NUB A;  3DD4 A;  1DJZ A;  2CTN A;  1CLL A;  2JXL A;  1QS7 A;  2NCO A;  1C7V A;  1QAT A;  1UHJ A;  4YGD B;  1Y0V H;  3Q8I A;  3I5F B;  2BL0 B;  2OS8 C;  2ISD A;  1ALW A;  3EG5 B;  1J7R A;  2H8V A;  3KO0 A;  3CGA A;  2CBL A;  5D3O A;  1OOJ A;  2KSP A;  1AK8 A;  4I5J A;  4PHJ A;  2BNX A;  2M7N A;  2I2R E;  2KBI A;  3B7A A;  1J1E A;  1JF2 A;  3B86 A;  3NSK A;  4ORC B;  2KFF A;  2LV7 A;  2K61 A;  3E3R A;  1PK0 D;  3D10 A;  4GUK A;  3RLZ A;  4A4C A;  1DQE A;  1KK7 Y;  1DT7 B;  3EVR A;  2CCM A;  1C3Y A;  1LA3 A;  3DVM A;  4FTG A;  1CDP A;  1YRU B;  1XYD A;  3AAJ A;  1QJT A;  4CPV A;  1BMO A;  4MLW A;  1H8B A;  2HF5 A;  3D77 A;  1OOG A;  2G2B A;  3FIA A;  2M8U A;  2BCA A;  2M97 A;  3JVT B;  3DVJ A;  1LKJ A;  3O4X A;  3UNW A;  4C0K A;  2COL B;  1MXL C;  1XFR A;  4D1E A;  1WY9 A;  2K60 A;  4PHM A;  5HLO A;  1M45 A;  1JF0 A;  1NCX A;  1WLZ A;  3R72 A;  5HKW A;  3TDZ A;  1T14 A;  2LLU A;  1Y6W A;  2Y5I A;  3K1E A;  4WQ2 A;  2OTG C;  3RZS A;  1YRT B;  4YGE B;  4NDC A;  3D76 A;  4FQT A;  1GGW A;  1U5I B;  2SCP A;  4C0L A;  5CSN A;  4ETO A;  3OX5 A;  5I2Q A;  1YVL A;  2KLE A;  5CSJ A;  2JZI A;  2O5G A;  2KYF A;  2JWW A;  2WCL A;  3CR4 X;  3LCP C;  1KWO C;  3CTN A;  3B88 A;  4DCK A;  1CFP A;  5K89 A;  3FE6 A;  4OV2 A;  2BBM A;  3DF0 B;  2M29 A;  3D75 A;  3NSI A;  2EC6 B;  2K7C A;  3HX4 A;  1NX3 A;  5DIC A;  5DKR A;  5I94 A;  3I5I C;  2BE6 A;  1TTX A;  4BY5 A;  2BEC A;  2B1U A;  2WCM A;  4M2P A;  2RGI A;  3H4S E;  3S0F A;  4U8D A;  1SR6 B;  1M31 A;  3O2P A;  2P71 A;  2O60 A;  4P5O E;  4USL A;  1K96 A;  2D8N A;  1DJY A;  3QME A;  4TNC A;  3EK8 A;  3L47 A;  2E30 A;  2E6W A;  2JOJ A;  4GFT A;  2GGZ A;  1SY9 A;  4INW A;  1V1G A;  3O78 A;  4XYN A;  5KSZ A;  4MZL A;  5B8I B;  1RWY A;  1S6J A;  3PAL A;  1PRW A;  5ER4 X;  4HRG A;  3ZWH A;  2KQY A;  2OS8 B;  1PVB A;  2TN4 A;  4MZK A;  1A75 A;  3M0W A;  2AAO A;  5CSI A;  1TNX A;  1YUS A;  3PAT A;  1QLS A;  1NX0 A;  5FI6 A;  2KI6 D;  1ZOT B;  1C7W A;  4GBA A;  1FI6 A;  2KGR A;  2YGU A;  2K2A A;  2OPO A;  4MZJ A;  1K95 A;  1F71 A;  1AJ5 A;  1GJY A;  3AKA A;  3PN7 B;  2QAC A;  3EVV A;  5EL2 A;  1AJ4 A;  4IL1 A;  3I5H C;  1JSA A;  2BKI B;  3SS4 A;  2JU0 A;  3SG2 A;  4YBH B;  2LAN A;  5AFP A;  2PVB A;  2JUL A;  1XFU O;  2ZNE A;  2LVI A;  1QX5 B;  5BPJ A;  1S5G Z;  2KNE A;  2KAV A;  4QJ4 B;  1J1D A;  1BJF A;  2LUC A;  1SPY A;  2MJW B;  1B4C A;  1TRF A;  2LC5 A;  1NX2 A;  1OSA A;  3OB1 B;  1J7O A;  1S3P A;  1B8L A;  1WDC C;  3EK4 A;  2OTG B;  1TNQ A;  2AUC A;  4IJ7 A;  3CDN A;  1M63 B;  1S6C A;  1TIZ A;  2KFG A;  1TCF A;  2L5Y A;  4MBE A;  4BY4 A;  5HL1 A;  1SYM A;  1E8A A;  1DJI A;  2NCP A;  1NP8 A;  3DVK A;  4ORA B;  5DKN A;  1YUU A;  3DF0 A;  4N1F A;  1DVI A;  1EL4 A;  1P28 A;  1PSR A;  3GK4 X;  4ZCU A;  1IQ3 A;  3OB2 B;  1KWO B;  1B8C A;  2H2K A;  5JJG A;  2I18 A;  1UUR A;  4I5N B;  4F7F A;  3SJS A;  1S5G Y;  1DJH A;  3OX6 A;  2QEB A;  2ZKM X;  1CMF A;  1TWO A;  3I5I B;  2F33 A;  2ZRS A;  2WCJ A;  3EKH A;  2L98 A;  2HQ8 A;  3SG6 A;  2CXJ A;  1LVC D;  1RTP 1;  1K8U A;  3OHM B;  4NDB A;  4AQJ A;  4MN0 A;  2JPO A;  1Z4H A;  2FCE A;  4E68 A;  1YX7 A;  3BQ3 A;  3CR5 X;  4MEW A;  4QJ5 B;  1KQM B;  1CFC A;  2PQL A;  4PHN A;  1DEK A;  2DOQ A;  2KQ6 A;  1ALV A;  1B7T Z;  1GQM A;  3CZ0 A;  3NGV A;  1A75 B;  2M7L A;  4PT1 A;  3JTD C;  2KI4 C;  4N5X A;  4ZCV A;  1EH2 A;  4ICB A;  1DF0 A;  2PSR A;  1X02 A;  2FCD A;  1BT6 A;  1XFV O;  1PAL A;  1XFZ O;  3HCM A;  4PCW A;  5PAL A;  1BOD A;  2Q91 A;  3CAB A;  3SS5 A;  1QWV A;  1OMV A;  2PAL A;  1A4P A;  4MSP A;  5KTY A;  1OZS A;  4PAL A;  1FBV A;  2NLN A;  1OW4 A;  1CLM A;  3PLF B;  1HQV A;  1K9U A;  3DY9 A;  1BOC A;  2I94 A;  3DVE A;  3I5H B;  2BCX A;  1CTR A;  4KYN A;  3DYE A;  4I5K A;  4OR9 B;  4CID A;  1OOF A;  2KDH A;  1SKT A;  2KBM A;  4DUQ A;  1B7T Y;  3BJH A;  5HKZ A;  1CNP A;  2KOT A;  1S1E A;  4JWQ A;  2JQ6 A;  4HSZ A;  4JQ0 D;  1FW4 A;  1Y1A A;  2KHN A;  1SMG A;  2LP3 A;  2Y1M A;  3AKB A;  5D69 A;  1H4B A;  4PE0 A;  1DMO A;  2KYC A;  3I5G B;  3R1P A;  3CZ2 A;  1ZFS A;  1IWQ A;  2LAP A;  1UWO A;  2K0J A;  2LMV A;  3VB1 A;  2K8M B;  4GGF C;  1WDC B;  3CZ1 A;  2WCB A;  4GGF A;  2K7O A;  3IF7 A;  2BCB A;  3VRP A;  1TNW A;  1RK9 A;  2ZRT A;  2K7D A;  1J7P A;  2M9G A;  1OOI X;  2WC6 A;  1XO5 A;  1XFX O;  2QDI A;  1WRK A;  1QV1 A;  3VRO A;  1SCV A;  3SG4 A;  4YI9 A;  1C07 A;  3S0G A;  1F54 A;  1LS8 A;  2JTZ A;  2LLT A;  3RM1 A;  1OMR A;  2JNX A;  3TDI A;  1J55 A;  1KCY A;  1F4Q A;  2LMT A;  3OGN A;  1F55 A;  5FI2 A;  1L2O C;  4GNK B;  1QTX A;  1OOH A;  1XFW O;  5CPV A;  1A29 A;  1C3Z A;  3C1V A;  3F45 A;  4JKT A;  1AP4 A;  3TS5 C;  5KU1 A;  3BUO B;  3BYA A;  5JOL A;  1BR4 B;  1FI5 A;  1GM0 A;  3FE9 A;  1R6P A;  1L7Z A;  1OMD A;  2F2P A;  1DF0 B;  3JTD B;  1V1F A;  1CFD A;  2HET A;  1G4Y R;  1CB1 A;  3I5F C;  1DJG A;  1NIW A;  2ZN9 A;  3D0Y A;  1N0Y A;  5F6T A;  1XK4 C;  1SSE B;  3QRX A;  3D78 A;  2L0P A;  2LUX A;  2F3Y A;  3D73 A;  2NZ0 A;  1NCZ A;  1AVS A;  1MXE A;  3SIB A;  1FF1 A;  1R2U A;  2JTT A;  3BFH A;  4MRX A;  1SRA A;  2H61 C;  2BBN A;  2PRU A;  1KQV A;  2EGD A;  2PMY A;  1WLM A;  2R2I A;  4HRE E;  1YUT A;  1IQ5 A;  2CT9 A;  2H61 A;  1QIV A;  2LHL A;  1PSB A;  3DZT A;  4GPL B;  2ERB A;  1K94 A;  2FOT A;  3CWG A;  1J7Q A;  2VRG A;  1S26 D;  2BE4 A;  3BOW A;  3N7H A;  3VGO A;  2PAS A;  5IBW A;  1IH0 A;  3CYZ A;  1QVI Z;  1WRL A;  3SG5 A;  1W9Z A;  4INX A;  4C0J A;  2MAZ A;  3NXA A;  2FJY A;  3BUX B;  5GQQ C;  1ZAC A;  1Y1X A;  2FJU B;  3CZT X;  3PSR A;  3EK7 A;  3VRR A;  1B8R A;  1TUZ A;  1UHI A;  1HT9 A;  2EHB A;  1S36 A;  3NSO A;  2WCH A;  1CM4 A;  1VRK A;  2F8P A;  1MWN A;  3IQQ A;  5HKY A;  4YGB B;  1B1G A;  2LM5 A;  2JXC A;  2KAX A;  2JT0 A;  2PYQ A;  3EKJ A;  2MLE C;  2MRD A;  3L4L A;  1Z2C B;  2M3W A;  1KFX S;  3S0E A;  1NWD A;  3PM2 A;  1W7J B;  4YGA A;  1EG4 A;  2SAS A;  2LP2 A;  4YGC B;  2V53 A;  3SG3 A;  1CDL A;  2WC8 A;  1G8I A;  2A4J A;  4I5L B;  1QVI Y;  2LMU A;  2ZN8 A;  4CFQ A;  3PJI A;  4ORB B;  1M39 A;  1XA5 A;  1F8H A;  2MBX A;  5I2L A;  2F2O A;  1Q80 A;  2Y4Q A;  1L2O B;  2JT3 A;  1CM1 A;  1NYA A;  3B87 A;  3GOF A;  1DTL A;  1MF8 B;  2ZFD A;  1F70 A;  2GTE A;  4OCI A;  1MQ1 A;  2WCF A;  4OVN F;  2MHH A;  1YTZ C;  1PVA A;  1SR6 C;  2F3Z A;  1IKU A;  1BLQ A;  1CMG A;  1UHH A;  3TS5 B;  5I2O A;  3O6B A;  3TDU A;  1JFK A;  3BFA A;  5I8N A;  1A03 A;  2JC2 A;  4P2Y B;  2HPS A;  1ORG A;  3D0Y B;  4M2O A;  2Y1N A;  2KLD A;  3FS7 A;  3TZ1 A;  3VRQ A;  1BG1 A;  3GK2 A;  2JT8 A;  4L9M A;  1DC1 A;  1CLB A;  1TNP A;  1RRO A;  1KK8 C;  1CDM A;  3K21 A;  1SL9 A;  2BKH B;  2LCP A;  3L4A A;  2GGM A;  3KHE A;  1DJX A;  2LLS A;  3VRN A;  4AQI A;  1QIW A;  1UP5 A;  3V2L A;  4NQG A;  3IVT A;  1QXP A;  3EVU A;  2LVK A;  4Q04 A;  1LXF C;  1MR8 A;  3PN7 C;  4HRH A;  5AXI A;  3UO9 A;  1IRJ A;  2L2E A;  1KSM A;  2LVJ A;  4CFR A;  3AAK A;  3BOW B;  5D7F A;  2L4H A;  4WRI A;  3CLN A;  1G33 A;  3S0D A;  2WCK A;  1SCM C;  3OP0 A;  1UHK A;  1CFF A;  1QX2 A;  4A4B A;  1AHR A;  1W7I B;  3WNX B;  1F4O A;  1MHO A;  2KGB C;  2M49 B;  2Q4U A;  5AEQ A;  3SS3 A;  1LIN A;  1KSO A;  2P70 A;  5ER5 A;  1DEL A;  3FE8 A;  1TOP A;  3GK1 A;  1DJW A;  3PM8 A;  1XFY O;  5FI7 A;  3IQO A;  1BF5 A;  2WOR A;  1XVJ A;  4NDD A;  3ZNI A;  4XJK B;  1YVH A;  3BUM B;  1SL7 A;  2BAP A;  2QEO A;  3FWB A;  2LNK A;  1NX1 A;  1K2H A;  2JPT A;  1RFJ A;  3R1V A;  2ZND A;  1NPQ A;  3O4Y A;  1B9A A;  3R1O A;  1ZMZ A;  1IIO A;  3S0A A;  3ICB A;  1M46 A;  2JRF A;  1CKK A;  1K93 D;  1QLK A;  2AMI A;  1OE9 B;  2WOS A;  1SL8 A;  2L50 A;  1QAS A;  3FWC A;  1JUO A;  1K9K A;  2WC5 A;  3DXL A;  1N2D A;  1Y1U A;  1NCY A;  4R1E A;  3TUY C;  1DGU A;  2MLF C;  1REC A;  1IJ6 A;  5AAN A;  1K90 D;  2NXQ A;  2GV5 A;  1AUI B;  2WND A;  2L5X B;  3KPX A;  5G08 A;  5TNC A;  1JFJ A;  2KI4 B;  4N1G A;  1EXR A;  1UUS A;  3PFV A;  2BL0 C;  1RJV A;  4PE1 A;  3WHU B;  4F0Z B;  1PUL A;  1OZO A;  1D1O A;  1KQM C;  1IGV A;  4PE4 A;  1XK4 A;  2K2F A;  4DIR A;  2LHI A;  3MSE B;  3NSL A;  3S0B A;  1IG5 A;  1EJ3 A;  1S6I A;  1WRZ A;  3A4U B;  4OZD A;  1UHN A;  2JNF A;  1KK8 B;  5DKQ A;  1EG3 A;  4OKH A;  2M1U A;  3LL8 B;  2KFH A;  4DS7 A;  1TN4 A;  3BFB A;  4FQO A;  2QEV A;  3B6X A;  1MUX A;  2IS9 A;  2KPH A;  3A8R A;  2K7B A;  2MA2 A;  1CDN A;  4JD9 A;  1KFX L;  1NSH A;  1YR5 A;  3JVT C;  5HYD A;  2WCE A;  5CSF A;  1BU3 A;  3BUN B;  4WQ3 A;  5FYX A;  1A2X A;  3LK1 A;  1SCM B;  4GAO A;  2M1K B;  4AOM A;  1IJ5 A;  4GGN A;  3SIA A;  1QX7 A;  3CR2 A;  2KI6 C;  1TCO B;  4XJK A;  3WXA A;  4M2Q A;  3BUW B;  1K9P A;  4PE7 A;  1JWD A;  2HQW A;  2QPT A;  1DGV A;  1YX8 A;  2I7A A;  1KFU L;  2L51 A;  2LVV A;  2QEH A;  3OBV A;  3WHT B;  1QV0 A;  3I5G C;  2CNP A;  3KF9 A;  2G9B A;  1OQP A;  1JBA A;  1U5I A; 
#chains in the Genus database with same CATH homology
 3NHT A;  2L2C A;  1OOI X;  2WC6 A;  3L4A A;  2QDI A;  1TUJ A;  5EL2 A;  3S0G A;  3V2L A;  1LS8 A;  3NHI A;  3OGN A;  3D74 A;  3S0D A;  2WCK A;  1OOH A;  1C3Z A;  2P70 A;  3FE8 A;  3Q8I A;  1GM0 A;  3FE9 A;  3CDN A;  2H8V A;  3B86 A;  2QEO A;  3B7A A;  1P28 A;  3R1V A;  3D78 A;  1DQE A;  3D73 A;  3R1O A;  1C3Y A;  4F7F A;  3S0A A;  3BFH A;  2QEB A;  1TWO A;  3DZT A;  3D77 A;  2WC5 A;  1OOG A;  3DXL A;  2ERB A;  2WCJ A;  3N7H A;  3CYZ A;  1XFR A;  2JPO A;  4INX A;  2PQL A;  2FJY A;  3CZ0 A;  3R72 A;  1T14 A;  3NGV A;  3K1E A;  3RZS A;  4PT1 A;  2WCH A;  3D76 A;  4FQT A;  3S0B A;  4OZD A;  3L4L A;  2WCL A;  3B88 A;  3CAB A;  3S0E A;  1QWV A;  3FE6 A;  3D75 A;  1OW4 A;  3BFB A;  2QEV A;  3B6X A;  3DY9 A;  5DIC A;  2KPH A;  3DYE A;  4JD9 A;  1OOF A;  2WCM A;  3S0F A;  3PJI A;  3BJH A;  2P71 A;  3B87 A;  3QME A;  2GTE A;  3L47 A;  4INW A;  3R1P A;  3CZ2 A;  3VB1 A;  2QEH A;  3BFA A;  3CZ1 A;  1ORG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...