3FE9A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand soaked at ph 7.0
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
117
structure length
117
Chain Sequence
b'DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 44
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe9A00
1DQEA 3BFBA 1TUJA 4FQTA 4PT1A 3NHTA 2WCKA 3K1EA 1C3ZA 3BFHA 3D77A 3R72A 3DZTA 2KPHA 3S0AA 2WCMA 3CZ0A 3NGVA 2P71A 3D75A 3S0BA 1T14A 3BFAA 1LS8A 2QDIA 3D73A 4INWA 1OOGA 2QEBA 3OGNA 3BJHA 3D78A 3R1VA 3V2LA 3L4LA 3N7HA 3VB1A 3B86A 1C3YA 3CZ2A 3PJIA 1OOHA 3CABA 3FE9A 1OW4A 2PQLA 1QWVA 4OZDA 1ORGA 3D76A 3DYEA 3B87A 3B6XA 3DY9A 4JD9A 2L2CA 4F7FA 2WC6A 2FJYA 2GTEA 3B88A 3R1OA 2P70A 1P28A 1XFRA 3FE6A 3NHIA 1OOFA 2ERBA 3QMEA 1OOIX 3B7AA 3RZSA 2WC5A 5DICA 3FE8A 2WCLA 3Q8IA 3CYZA 2QEHA 3L47A 3L4AA 2WCJA 3DXLA 4INXA 3D74A 3S0GA 3S0EA 1TWOA 3S0DA 3CDNA 2JPOA 3S0FA 1GM0A 2QEOA 2QEVA 5EL2A 2H8VA 3R1PA 3CZ1A 2WCHA
chains in the Genus database with same CATH superfamily
3CR4X 2GGMA 2OS8B 3BFBA 3SIAA 1SPYA 4I5LB 1TUJA 1DMOA 2K8MB 3SS5A 1MXLC 3BUMB 1Z2CB 3K1EA 1NCXA 1N0YA 2JQ6A 1OOJA 2JOJA 2LANA 3D77A 3R72A 2TN4A 5GQQC 3TZ1A 3UO9A 1DJYA 1KK7Z 2KPHA 3CR5X 2WCMA 4IL1A 1B1GA 1KK7Y 3NXAA 1F4QA 1SY9A 2LUCA 3BUOB 2K7BA 1S5GZ 5J3XA 1C07A 4DIRA 1NUBA 3PLFB 2BCAA 2RGIA 1SCMC 2PMYA 4AQIA 1G33A 1M63B 2KBIA 3OP0A 1OMDA 2NZ0A 3D75A 1SL7A 1TIZA 2JU0A 2M49B 3OHMB 2WC8A 4FTGA 2L51A 4GNKB 4NDDA 5I2OA 2LVJA 1BF5A 2M7LA 1IH0A 1UHHA 3PN7B 1H8BA 5FI6A 1W7IB 2ISDA 2M1KB 3EG5B 4MN0A 1QS7A 1CDPA 1AJ5A 2QEBA 3H4SE 4MLWA 3OGNA 1SK6D 1JC2A 5ER4X 3R1VA 1CDLA 1S3PA 1VRKA 4PE7A 1KWOB 1XYDA 3RM1A 2E30A 2M0RA 3JVTC 4CFRA 3VB1A 5HYDA 1C3YA 1YX7A 3CTNA 4TNCA 2JPTA 4MZJA 1B8CA 1JSAA 5CSNA 1QASA 3OB1B 1GGZA 2OS8C 1A4PA 3PM8A 1FI6A 1DJGA 2KQ6A 1DF0B 3FE9A 3WHUB 2M3WA 1KFUS 2OTGC 2P6BB 1Y6WA 1K93D 1ORGA 1K95A 1OZOA 2BL0C 1NCZA 2Y1MA 1IGVA 1TN4A 4ETOA 2HF5A 4OR9B 2GV5A 1SR6B 1BJFA 1LA3A 4MRXA 4A4CA 4ZCVA 2KOTA 3EK4A 1CFPA 4QJ5B 2KGBC 3BYAA 2CBLA 3OB2B 2F2OA 3WXAA 1GQMA 2KYFA 3DY9A 1G4YR 4JD9A 4NDBA 3MSEB 2COLB 2KI6C 2L2CA 1YVLA 1JF0A 1NX2A 2BNXA 2JC2A 1XK4A 3VRQA 5AEQA 2YGUA 5B8IB 5CSJA 3FE6A 2L5XB 3CZTX 3NHIA 3I5GC 1HQVA 1Y0VH 4WQ3A 4HSZA 3GOFA 1K2HA 1G8IA 3EKHA 2LLUA 3GK2A 3B7AA 1QTXA 4P2YB 1IQ3A 2KLEA 5I94A 1TNXA 1V1GA 5TNCA 4L9MA 1A75A 2WCLA 2ZN9A 3GK1A 2LAPA 1YR5A 1DJWA 4NDCA 1C7VA 1SRAA 4NQGA 2QEHA 1KK8B 2KNEA 1NCYA 1ODBA 3TS5C 4GBAA 3EVRA 3VGOA 3ZNIA 3C1VA 1IWQA 2ZNEA 2H61A 1BT6A 1TWOA 3S0DA 2FOTA 2JPOA 3CDNA 4XYNA 5HKWA 4PCWA 3IQOA 2EC6B 2K7DA 2WCFA 3QRXA 3SS3A 4GGNA 1QVIY 1SYMA 1S6IA 3CZ1A 2PASA 2V53A 1L7ZA 1XFUO 4PT1A 5G08A 1WRKA 1QV0A 1DT7B 4OVNF 5D69A 4USLA 2BKIB 1SKTA 1LKJA 3DZTA 4P5OE 1CKKA 1J1DA 4JPZB 4QJ3B 2CTNA 1CMFA 1J1EA 3PSRA 1NSHA 2KQYA 2E6WA 1UP5A 4UPGA 1XFZO 1TCOB 1DVIA 2EGDA 1AVSA 1LXFC 2KAYA 3NGVA 4M2PA 4PE1A 1ZMZA 1S6JA 3CLNA 1J7QA 1GGWA 1T14A 2Y5IA 1CM4A 1MUXA 4YGCB 5HLVA 3LK1A 2ZN8A 1TNQA 1L2OB 4JWQA 2AUCA 4GAOA 4CFQA 1OOGA 2BCBA 4MVFA 3NSOA 5AFPA 4ORBB 2K61A 2LCPA 2LMUA 4HRGA 5CSFA 3F45A 3KEVA 2WORA 4PE4A 5CSIA 2BBNA 4PE0A 4AQJA 4C0KA 4ORAB 2JXCA 2KGRA 1WDCC 2MHHA 3DVKA 4FQOA 2L50A 5FYXA 1DJXA 1M31A 1RJVA 3CZ2A 4GUKA 1A29A 1YUTA 2KI6D 1F54A 1K90D 3PJIA 1OOHA 3UNWA 2MLEC 3VRPA 1Z4HA 3CABA 1BMOA 2FCDA 2KFHA 1A75B 4XJKA 2PSRA 2SASA 2JRFA 1FW4A 2VRGA 3I5FB 1JFJA 3IVTA 1F4OA 1B4CA 1F70A 2WOSA 4C0LA 5HL1A 4GGFA 3VRRA 3B87A 3IQQA 4M2QA 1QX7A 2KI4B 2I7AA 1CMGA 2EHBA 1XFWO 1FI5A 1PSBA 1M39A 1UUSA 1YRUB 4F7FA 2O60A 2QPTA 2BE4A 1EG4A 1BR4B 1CFDA 3TUYC 3SG6A 2K7OA 1CNPA 5AERA 1MWNA 3R1OA 3JTDC 1W7JB 1AP4A 2P70A 4MZKA 2FCEA 4I5KA 4A4BA 2PVBA 1R2UA 2ERBA 1PSRA 3D0YA 4HRHA 1N2DA 2LC5A 4M2OA 5HKYA 1PVBA 3SS4A 1IKUA 1PULA 1CFFA 1CLBA 1Y1AA 2BCXA 5DKNA 3DF0A 3EVUA 1FBVA 2LHIA 4I5NB 1KCYA 1DTLA 1AUIB 2M29A 5JOLA 5I2QA 1K9KA 1WLZA 2LLSA 5ER5A 1KFUL 1YUUA 2K7CA 4HREE 4WQ2A 2WCJA 1UHJA 1S26D 2LVKA 2I18A 3BUWB 1UHIA 3TDIA 3PN7C 3S0FA 2K0JA 1U5IA 3CR2A 1QATA 5EL2A 4QJ4B 3R1PA 1X02A 1LA0A 1YX8A 5FI7A 1XFYO 1DQEA 2JT3A 1QLKA 1KWOC 3I5IB 2F3ZA 2HQ8A 1S36A 3O2PA 2ZRSA 2WNDA 5I8NA 2CT9A 4BY4A 4D1EA 1K94A 3FIAA 3D10A 4ICBA 1BU3A 3NHTA 2G2BA 1KQMB 2LP2A 1ZOTB 1MF8B 1K9UA 2Q4UA 4MRYA 4OKHA 4MBEA 2GGZA 4WRIA 1V1FA 1QLSA 1NPQA 1YVHA 1S1EA 1TCFA 3ICBA 5D7FA 3PATA 3NSIA 4YGDB 2SCPA 2KDHA 1B9AA 1SNLA 1SR6C 2LM5A 4C0JA 1TOPA 3E3RA 1E8AA 1MQ1A 4ORCB 1A03A 1F71A 1AHRA 1OQPA 2AMIA 2KBMA 3FWCA 1XFXO 3PFVA 4PHNA 1NIWA 2MLFC 1QVIZ 1A2XA 1CM1A 3S0BA 4Q04A 1IIOA 2NXQA 4CLNA 3SG7A 3I5HB 1LS8A 3DD4A 1LVCD 4INWA 1GJYA 3CWGA 5KTYA 4PDZA 1SSEB 2M1UA 3BJHA 1TNWA 1EJ3A 1M46A 2HPSA 2F33A 2ZFDA 1B8RA 2BAPA 3D0YB 3FS7A 3L4LA 3B86A 3O4YA 4JKTA 1DEKA 1KQVA 3HX4A 4YI8A 1B8LA 3IF7A 2K2AA 1UHKA 5HLOA 5AXIA 1IJ6A 1OW4A 1K96A 1QWVA 1RECA 3EKJA 2L4HA 3SJSA 1YTZC 1TNPA 3BQ3A 3O78A 4PALA 4YGBB 5KSZA 3OBVA 1UURA 2D8NA 2L5YA 1DF0A 1KK8C 1KSOA 3GK4X 1SCMB 1TTXA 2F8PA 4DUQA 1MR8A 1KFXS 1MHOA 2JNXA 3BOWA 1XA5A 2JTZA 2BECA 4PHKA 3ZWHA 1S6CA 5IBWA 2WC6A 2K2FA 4YBHB 1EH2A 1U5IB 2EC6C 4GFTA 3TDZA 2FJYA 1SBJA 3B88A 4YGEB 4GPLB 2PALA 2LMVA 5I2LA 1OE9B 3KPXA 1SW8A 1B7TZ 2JTTA 1ZACA 2MRDA 1OOFA 1B7TY 3JVTB 3K21A 5FI2A 4YGAA 2H2KA 2M9GA 3EK8A 1PRWA 1JUOA 3RZSA 5DICA 2OTGB 1TRFA 2L2EA 3LL8B 1DJIA 1RWYA 1RK9A 2BL0B 1IJ5A 1DGVA 1W9ZA 4PHJA 3CYZA 2KAXA 4MSPA 3AAKA 5D3OA 3V2LA 2F2PA 1EG3A 4JQ0D 3LK0A 3VRNA 3L4AA 2LNKA 1BLQA 1CFCA 2JNFA 3TDUA 2KLDA 4N1FA 3S0GA 3A4UB 1RTP1 1N65A 2ZNDA 1S5GY 1L2OC 2M97A 1BG1A 1XK4C 1J7PA 1NWDA 2KFGA 2PRUA 1DC1A 2H8VA 1DJZA 2M7NA 2Y4QA 2WCHA 1GM0A 2NCPA 4N5XA 2I2RE 1DJHA 1K8UA 1TUZA 3I5GB 2KYCA 1JWDA 1RFJA 1SL8A 4FQTA 1NP8A 2L98A 1YUSA 1NX3A 1BR1B 2WCKA 1EXRA 1C3ZA 1M45A 1B47A 1CLMA 2JT8A 1WLMA 3BFHA 4PHMA 3M0WA 1CB1A 1UHNA 2ZKMX 3DVJA 3SG3A 1IRJA 3S0AA 1HT9A 4R1EA 1Y1XA 1CDMA 3I5FC 3NSLA 1SMGA 3CZ0A 3NSKA 2MA2A 4I5JA 2A4JA 2KAVA 5HKZA 5BPJA 2JXLA 5K89A 1ZUZA 1QIVA 1ALVA 1XVJA 3WNXB 2LLTA 2P71A 1LINA 2KI4C 3TS5B 1RROA 2IS9A 1YRTB 2H61C 3BOWB 4CIDA 2LVIA 4DS7A 3BFAA 3O6BA 1NYAA 3AKAA 3BUXB 2QDIA 2JT0A 3D73A 4OV2A 1UWOA 4DRWA 1PK0D 5CPVA 1SCVA 2LVVA 2JULA 1OMVA 3D78A 2R2IA 3BUNB 1XFVO 1R6PA 3PM2A 2DOQA 2MJWB 2OPOA 1QV1A 3BXKA 3FWBA 3KHEA 3N7HA 3RLZA 2LV7A 1F8HA 2NLNA 2WCEA 4XJKB 1C7WA 1NX1A 4ZCUA 5AANA 1Q80A 3EVVA 4MZLA 1YURA 2WCBA 1Y1UA 4N1GA 2CCMA 2BE6A 1IG5A 1QIWA 2L4IA 2PQLA 3AAJA 1ALWA 3D76A 4OZDA 3SG2A 3SG5A 1QJTA 2HETA 2M8UA 2FJUB 3OX5A 3PALA 4OCIA 5DKRA 5DKQA 3DYEA 5PALA 5KU1A 3VROA 2NCOA 1QXPA 1WRZA 1DELA 1J7OA 3LCPC 1CLLA 1BOCA 2MAZA 1MXEA 2G9BA 2KSPA 2Y1NA 1D1OA 3B6XA 1OMRA 4CPVA 1FF1A 3EK7A 2Q91A 4U8DA 1KSMA 1AK8A 2L0PA 2LMTA 2QACA 1OZSA 1PALA 2I94A 3CGAA 1JFKA 2GTEA 3OX6A 4YI9A 2JWWA 1WY9A 3CS1A 2K60A 3I5IC 1P28A 1J55A 1XFRA 2BKHB 1CDNA 1IQ5A 1DGUA 3A8RA 3DF0B 1QX5B 1WDCB 2F3YA 2LHLA 2KFFA 1KQMC 2CNPA 4MEWA 4DCKA 2KHNA 2MBXA 4BY5A 1OOIX 3QMEA 1SL9A 2LUXA 1CTRA 2PYQA 2CXJA 2WC5A 1JBAA 1H4BA 3SG4A 3KF9A 3FE8A 1QX2A 3DVMA 1WRLA 4KYNA 3Q8IA 5JJGA 1JF2A 2LP3A 3HCMA 4GGFC 1ZFSA 2JZIA 4AOMA 1EL4A 3KO0A 3L47A 2LE9B 1F55A 1PVAA 2HQWA 3WHTB 3DXLA 2BBMA 4INXA 4F0ZB 3D74A 4YRUA 2O5GA 3LLEA 3S0EA 4E68A 1BODA 1K9PA 1NX0A 3AKBA 3I5HC 3SIBA 1FPWA 1AJ4A 3O4XA 2QEOA 2B1UA 4IJ7A 3TUYB 2ZRTA 2QEVA 1XO5A 1KFXL 3DVEA 5F6TA 3JTDB 1J7RA 1OSAA 2AAOA
chains in the Genus database with same CATH topology
1DQEA 3BFBA 1TUJA 4FQTA 4PT1A 3NHTA 2WCKA 3K1EA 1C3ZA 3BFHA 3D77A 3R72A 3DZTA 2KPHA 3S0AA 2WCMA 3CZ0A 3NGVA 2P71A 3D75A 3S0BA 1T14A 3BFAA 1LS8A 2QDIA 3D73A 4INWA 1OOGA 2QEBA 3OGNA 3BJHA 3D78A 3R1VA 3V2LA 3L4LA 3N7HA 3VB1A 3B86A 1C3YA 3CZ2A 3PJIA 1OOHA 3CABA 3FE9A 1OW4A 2PQLA 1QWVA 4OZDA 1ORGA 3D76A 3DYEA 3B87A 3B6XA 3DY9A 4JD9A 2L2CA 4F7FA 2WC6A 2FJYA 2GTEA 3B88A 3R1OA 2P70A 1P28A 1XFRA 3FE6A 3NHIA 1OOFA 2ERBA 3QMEA 1OOIX 3B7AA 3RZSA 2WC5A 5DICA 3FE8A 2WCLA 3Q8IA 3CYZA 2QEHA 3L47A 3L4AA 2WCJA 3DXLA 4INXA 3D74A 3S0GA 3S0EA 1TWOA 3S0DA 3CDNA 2JPOA 3S0FA 1GM0A 2QEOA 2QEVA 5EL2A 2H8VA 3R1PA 3CZ1A 2WCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQE A;  3BFB A;  1TUJ A;  4FQT A;  4PT1 A;  3NHT A;  2WCK A;  3K1E A;  1C3Z A;  3BFH A;  3D77 A;  3R72 A;  3DZT A;  2KPH A;  3S0A A;  2WCM A;  3CZ0 A;  3NGV A;  2P71 A;  3D75 A;  3S0B A;  1T14 A;  3BFA A;  1LS8 A;  2QDI A;  3D73 A;  4INW A;  1OOG A;  2QEB A;  3OGN A;  3BJH A;  3D78 A;  3R1V A;  3V2L A;  3L4L A;  3N7H A;  3VB1 A;  3B86 A;  1C3Y A;  3CZ2 A;  3PJI A;  1OOH A;  3CAB A;  3FE9 A;  1OW4 A;  2PQL A;  1QWV A;  4OZD A;  1ORG A;  3D76 A;  3DYE A;  3B87 A;  3B6X A;  3DY9 A;  4JD9 A;  2L2C A;  4F7F A;  2WC6 A;  2FJY A;  2GTE A;  3B88 A;  3R1O A;  2P70 A;  1P28 A;  1XFR A;  3FE6 A;  3NHI A;  1OOF A;  2ERB A;  3QME A;  1OOI X;  3B7A A;  3RZS A;  2WC5 A;  5DIC A;  3FE8 A;  2WCL A;  3Q8I A;  3CYZ A;  2QEH A;  3L47 A;  3L4A A;  2WCJ A;  3DXL A;  4INX A;  3D74 A;  3S0G A;  3S0E A;  1TWO A;  3S0D A;  3CDN A;  2JPO A;  3S0F A;  1GM0 A;  2QEO A;  2QEV A;  5EL2 A;  2H8V A;  3R1P A;  3CZ1 A;  2WCH A; 
#chains in the Genus database with same CATH topology
 3CR4 X;  2GGM A;  2OS8 B;  3BFB A;  3SIA A;  1SPY A;  4I5L B;  1TUJ A;  1DMO A;  2K8M B;  3SS5 A;  1MXL C;  3BUM B;  1Z2C B;  3K1E A;  1NCX A;  1N0Y A;  2JQ6 A;  1OOJ A;  2JOJ A;  2LAN A;  3D77 A;  3R72 A;  2TN4 A;  5GQQ C;  3TZ1 A;  3UO9 A;  1DJY A;  1KK7 Z;  2KPH A;  3CR5 X;  2WCM A;  4IL1 A;  1B1G A;  1KK7 Y;  3NXA A;  1F4Q A;  1SY9 A;  2LUC A;  3BUO B;  2K7B A;  1S5G Z;  5J3X A;  1C07 A;  4DIR A;  1NUB A;  3PLF B;  2BCA A;  2RGI A;  1SCM C;  2PMY A;  4AQI A;  1G33 A;  1M63 B;  2KBI A;  3OP0 A;  1OMD A;  2NZ0 A;  3D75 A;  1SL7 A;  1TIZ A;  2JU0 A;  2M49 B;  3OHM B;  2WC8 A;  4FTG A;  2L51 A;  4GNK B;  4NDD A;  5I2O A;  2LVJ A;  1BF5 A;  2M7L A;  1IH0 A;  1UHH A;  3PN7 B;  1H8B A;  5FI6 A;  1W7I B;  2ISD A;  2M1K B;  3EG5 B;  4MN0 A;  1QS7 A;  1CDP A;  1AJ5 A;  2QEB A;  3H4S E;  4MLW A;  3OGN A;  1SK6 D;  1JC2 A;  5ER4 X;  3R1V A;  1CDL A;  1S3P A;  1VRK A;  4PE7 A;  1KWO B;  1XYD A;  3RM1 A;  2E30 A;  2M0R A;  3JVT C;  4CFR A;  3VB1 A;  5HYD A;  1C3Y A;  1YX7 A;  3CTN A;  4TNC A;  2JPT A;  4MZJ A;  1B8C A;  1JSA A;  5CSN A;  1QAS A;  3OB1 B;  1GGZ A;  2OS8 C;  1A4P A;  3PM8 A;  1FI6 A;  1DJG A;  2KQ6 A;  1DF0 B;  3FE9 A;  3WHU B;  2M3W A;  1KFU S;  2OTG C;  2P6B B;  1Y6W A;  1K93 D;  1ORG A;  1K95 A;  1OZO A;  2BL0 C;  1NCZ A;  2Y1M A;  1IGV A;  1TN4 A;  4ETO A;  2HF5 A;  4OR9 B;  2GV5 A;  1SR6 B;  1BJF A;  1LA3 A;  4MRX A;  4A4C A;  4ZCV A;  2KOT A;  3EK4 A;  1CFP A;  4QJ5 B;  2KGB C;  3BYA A;  2CBL A;  3OB2 B;  2F2O A;  3WXA A;  1GQM A;  2KYF A;  3DY9 A;  1G4Y R;  4JD9 A;  4NDB A;  3MSE B;  2COL B;  2KI6 C;  2L2C A;  1YVL A;  1JF0 A;  1NX2 A;  2BNX A;  2JC2 A;  1XK4 A;  3VRQ A;  5AEQ A;  2YGU A;  5B8I B;  5CSJ A;  3FE6 A;  2L5X B;  3CZT X;  3NHI A;  3I5G C;  1HQV A;  1Y0V H;  4WQ3 A;  4HSZ A;  3GOF A;  1K2H A;  1G8I A;  3EKH A;  2LLU A;  3GK2 A;  3B7A A;  1QTX A;  4P2Y B;  1IQ3 A;  2KLE A;  5I94 A;  1TNX A;  1V1G A;  5TNC A;  4L9M A;  1A75 A;  2WCL A;  2ZN9 A;  3GK1 A;  2LAP A;  1YR5 A;  1DJW A;  4NDC A;  1C7V A;  1SRA A;  4NQG A;  2QEH A;  1KK8 B;  2KNE A;  1NCY A;  1ODB A;  3TS5 C;  4GBA A;  3EVR A;  3VGO A;  3ZNI A;  3C1V A;  1IWQ A;  2ZNE A;  2H61 A;  1BT6 A;  1TWO A;  3S0D A;  2FOT A;  2JPO A;  3CDN A;  4XYN A;  5HKW A;  4PCW A;  3IQO A;  2EC6 B;  2K7D A;  2WCF A;  3QRX A;  3SS3 A;  4GGN A;  1QVI Y;  1SYM A;  1S6I A;  3CZ1 A;  2PAS A;  2V53 A;  1L7Z A;  1XFU O;  4PT1 A;  5G08 A;  1WRK A;  1QV0 A;  1DT7 B;  4OVN F;  5D69 A;  4USL A;  2BKI B;  1SKT A;  1LKJ A;  3DZT A;  4P5O E;  1CKK A;  1J1D A;  4JPZ B;  4QJ3 B;  2CTN A;  1CMF A;  1J1E A;  3PSR A;  1NSH A;  2KQY A;  2E6W A;  1UP5 A;  4UPG A;  1XFZ O;  1TCO B;  1DVI A;  2EGD A;  1AVS A;  1LXF C;  2KAY A;  3NGV A;  4M2P A;  4PE1 A;  1ZMZ A;  1S6J A;  3CLN A;  1J7Q A;  1GGW A;  1T14 A;  2Y5I A;  1CM4 A;  1MUX A;  4YGC B;  5HLV A;  3LK1 A;  2ZN8 A;  1TNQ A;  1L2O B;  4JWQ A;  2AUC A;  4GAO A;  4CFQ A;  1OOG A;  2BCB A;  4MVF A;  3NSO A;  5AFP A;  4ORB B;  2K61 A;  2LCP A;  2LMU A;  4HRG A;  5CSF A;  3F45 A;  3KEV A;  2WOR A;  4PE4 A;  5CSI A;  2BBN A;  4PE0 A;  4AQJ A;  4C0K A;  4ORA B;  2JXC A;  2KGR A;  1WDC C;  2MHH A;  3DVK A;  4FQO A;  2L50 A;  5FYX A;  1DJX A;  1M31 A;  1RJV A;  3CZ2 A;  4GUK A;  1A29 A;  1YUT A;  2KI6 D;  1F54 A;  1K90 D;  3PJI A;  1OOH A;  3UNW A;  2MLE C;  3VRP A;  1Z4H A;  3CAB A;  1BMO A;  2FCD A;  2KFH A;  1A75 B;  4XJK A;  2PSR A;  2SAS A;  2JRF A;  1FW4 A;  2VRG A;  3I5F B;  1JFJ A;  3IVT A;  1F4O A;  1B4C A;  1F70 A;  2WOS A;  4C0L A;  5HL1 A;  4GGF A;  3VRR A;  3B87 A;  3IQQ A;  4M2Q A;  1QX7 A;  2KI4 B;  2I7A A;  1CMG A;  2EHB A;  1XFW O;  1FI5 A;  1PSB A;  1M39 A;  1UUS A;  1YRU B;  4F7F A;  2O60 A;  2QPT A;  2BE4 A;  1EG4 A;  1BR4 B;  1CFD A;  3TUY C;  3SG6 A;  2K7O A;  1CNP A;  5AER A;  1MWN A;  3R1O A;  3JTD C;  1W7J B;  1AP4 A;  2P70 A;  4MZK A;  2FCE A;  4I5K A;  4A4B A;  2PVB A;  1R2U A;  2ERB A;  1PSR A;  3D0Y A;  4HRH A;  1N2D A;  2LC5 A;  4M2O A;  5HKY A;  1PVB A;  3SS4 A;  1IKU A;  1PUL A;  1CFF A;  1CLB A;  1Y1A A;  2BCX A;  5DKN A;  3DF0 A;  3EVU A;  1FBV A;  2LHI A;  4I5N B;  1KCY A;  1DTL A;  1AUI B;  2M29 A;  5JOL A;  5I2Q A;  1K9K A;  1WLZ A;  2LLS A;  5ER5 A;  1KFU L;  1YUU A;  2K7C A;  4HRE E;  4WQ2 A;  2WCJ A;  1UHJ A;  1S26 D;  2LVK A;  2I18 A;  3BUW B;  1UHI A;  3TDI A;  3PN7 C;  3S0F A;  2K0J A;  1U5I A;  3CR2 A;  1QAT A;  5EL2 A;  4QJ4 B;  3R1P A;  1X02 A;  1LA0 A;  1YX8 A;  5FI7 A;  1XFY O;  1DQE A;  2JT3 A;  1QLK A;  1KWO C;  3I5I B;  2F3Z A;  2HQ8 A;  1S36 A;  3O2P A;  2ZRS A;  2WND A;  5I8N A;  2CT9 A;  4BY4 A;  4D1E A;  1K94 A;  3FIA A;  3D10 A;  4ICB A;  1BU3 A;  3NHT A;  2G2B A;  1KQM B;  2LP2 A;  1ZOT B;  1MF8 B;  1K9U A;  2Q4U A;  4MRY A;  4OKH A;  4MBE A;  2GGZ A;  4WRI A;  1V1F A;  1QLS A;  1NPQ A;  1YVH A;  1S1E A;  1TCF A;  3ICB A;  5D7F A;  3PAT A;  3NSI A;  4YGD B;  2SCP A;  2KDH A;  1B9A A;  1SNL A;  1SR6 C;  2LM5 A;  4C0J A;  1TOP A;  3E3R A;  1E8A A;  1MQ1 A;  4ORC B;  1A03 A;  1F71 A;  1AHR A;  1OQP A;  2AMI A;  2KBM A;  3FWC A;  1XFX O;  3PFV A;  4PHN A;  1NIW A;  2MLF C;  1QVI Z;  1A2X A;  1CM1 A;  3S0B A;  4Q04 A;  1IIO A;  2NXQ A;  4CLN A;  3SG7 A;  3I5H B;  1LS8 A;  3DD4 A;  1LVC D;  4INW A;  1GJY A;  3CWG A;  5KTY A;  4PDZ A;  1SSE B;  2M1U A;  3BJH A;  1TNW A;  1EJ3 A;  1M46 A;  2HPS A;  2F33 A;  2ZFD A;  1B8R A;  2BAP A;  3D0Y B;  3FS7 A;  3L4L A;  3B86 A;  3O4Y A;  4JKT A;  1DEK A;  1KQV A;  3HX4 A;  4YI8 A;  1B8L A;  3IF7 A;  2K2A A;  1UHK A;  5HLO A;  5AXI A;  1IJ6 A;  1OW4 A;  1K96 A;  1QWV A;  1REC A;  3EKJ A;  2L4H A;  3SJS A;  1YTZ C;  1TNP A;  3BQ3 A;  3O78 A;  4PAL A;  4YGB B;  5KSZ A;  3OBV A;  1UUR A;  2D8N A;  2L5Y A;  1DF0 A;  1KK8 C;  1KSO A;  3GK4 X;  1SCM B;  1TTX A;  2F8P A;  4DUQ A;  1MR8 A;  1KFX S;  1MHO A;  2JNX A;  3BOW A;  1XA5 A;  2JTZ A;  2BEC A;  4PHK A;  3ZWH A;  1S6C A;  5IBW A;  2WC6 A;  2K2F A;  4YBH B;  1EH2 A;  1U5I B;  2EC6 C;  4GFT A;  3TDZ A;  2FJY A;  1SBJ A;  3B88 A;  4YGE B;  4GPL B;  2PAL A;  2LMV A;  5I2L A;  1OE9 B;  3KPX A;  1SW8 A;  1B7T Z;  2JTT A;  1ZAC A;  2MRD A;  1OOF A;  1B7T Y;  3JVT B;  3K21 A;  5FI2 A;  4YGA A;  2H2K A;  2M9G A;  3EK8 A;  1PRW A;  1JUO A;  3RZS A;  5DIC A;  2OTG B;  1TRF A;  2L2E A;  3LL8 B;  1DJI A;  1RWY A;  1RK9 A;  2BL0 B;  1IJ5 A;  1DGV A;  1W9Z A;  4PHJ A;  3CYZ A;  2KAX A;  4MSP A;  3AAK A;  5D3O A;  3V2L A;  2F2P A;  1EG3 A;  4JQ0 D;  3LK0 A;  3VRN A;  3L4A A;  2LNK A;  1BLQ A;  1CFC A;  2JNF A;  3TDU A;  2KLD A;  4N1F A;  3S0G A;  3A4U B;  1RTP 1;  1N65 A;  2ZND A;  1S5G Y;  1L2O C;  2M97 A;  1BG1 A;  1XK4 C;  1J7P A;  1NWD A;  2KFG A;  2PRU A;  1DC1 A;  2H8V A;  1DJZ A;  2M7N A;  2Y4Q A;  2WCH A;  1GM0 A;  2NCP A;  4N5X A;  2I2R E;  1DJH A;  1K8U A;  1TUZ A;  3I5G B;  2KYC A;  1JWD A;  1RFJ A;  1SL8 A;  4FQT A;  1NP8 A;  2L98 A;  1YUS A;  1NX3 A;  1BR1 B;  2WCK A;  1EXR A;  1C3Z A;  1M45 A;  1B47 A;  1CLM A;  2JT8 A;  1WLM A;  3BFH A;  4PHM A;  3M0W A;  1CB1 A;  1UHN A;  2ZKM X;  3DVJ A;  3SG3 A;  1IRJ A;  3S0A A;  1HT9 A;  4R1E A;  1Y1X A;  1CDM A;  3I5F C;  3NSL A;  1SMG A;  3CZ0 A;  3NSK A;  2MA2 A;  4I5J A;  2A4J A;  2KAV A;  5HKZ A;  5BPJ A;  2JXL A;  5K89 A;  1ZUZ A;  1QIV A;  1ALV A;  1XVJ A;  3WNX B;  2LLT A;  2P71 A;  1LIN A;  2KI4 C;  3TS5 B;  1RRO A;  2IS9 A;  1YRT B;  2H61 C;  3BOW B;  4CID A;  2LVI A;  4DS7 A;  3BFA A;  3O6B A;  1NYA A;  3AKA A;  3BUX B;  2QDI A;  2JT0 A;  3D73 A;  4OV2 A;  1UWO A;  4DRW A;  1PK0 D;  5CPV A;  1SCV A;  2LVV A;  2JUL A;  1OMV A;  3D78 A;  2R2I A;  3BUN B;  1XFV O;  1R6P A;  3PM2 A;  2DOQ A;  2MJW B;  2OPO A;  1QV1 A;  3BXK A;  3FWB A;  3KHE A;  3N7H A;  3RLZ A;  2LV7 A;  1F8H A;  2NLN A;  2WCE A;  4XJK B;  1C7W A;  1NX1 A;  4ZCU A;  5AAN A;  1Q80 A;  3EVV A;  4MZL A;  1YUR A;  2WCB A;  1Y1U A;  4N1G A;  2CCM A;  2BE6 A;  1IG5 A;  1QIW A;  2L4I A;  2PQL A;  3AAJ A;  1ALW A;  3D76 A;  4OZD A;  3SG2 A;  3SG5 A;  1QJT A;  2HET A;  2M8U A;  2FJU B;  3OX5 A;  3PAL A;  4OCI A;  5DKR A;  5DKQ A;  3DYE A;  5PAL A;  5KU1 A;  3VRO A;  2NCO A;  1QXP A;  1WRZ A;  1DEL A;  1J7O A;  3LCP C;  1CLL A;  1BOC A;  2MAZ A;  1MXE A;  2G9B A;  2KSP A;  2Y1N A;  1D1O A;  3B6X A;  1OMR A;  4CPV A;  1FF1 A;  3EK7 A;  2Q91 A;  4U8D A;  1KSM A;  1AK8 A;  2L0P A;  2LMT A;  2QAC A;  1OZS A;  1PAL A;  2I94 A;  3CGA A;  1JFK A;  2GTE A;  3OX6 A;  4YI9 A;  2JWW A;  1WY9 A;  3CS1 A;  2K60 A;  3I5I C;  1P28 A;  1J55 A;  1XFR A;  2BKH B;  1CDN A;  1IQ5 A;  1DGU A;  3A8R A;  3DF0 B;  1QX5 B;  1WDC B;  2F3Y A;  2LHL A;  2KFF A;  1KQM C;  2CNP A;  4MEW A;  4DCK A;  2KHN A;  2MBX A;  4BY5 A;  1OOI X;  3QME A;  1SL9 A;  2LUX A;  1CTR A;  2PYQ A;  2CXJ A;  2WC5 A;  1JBA A;  1H4B A;  3SG4 A;  3KF9 A;  3FE8 A;  1QX2 A;  3DVM A;  1WRL A;  4KYN A;  3Q8I A;  5JJG A;  1JF2 A;  2LP3 A;  3HCM A;  4GGF C;  1ZFS A;  2JZI A;  4AOM A;  1EL4 A;  3KO0 A;  3L47 A;  2LE9 B;  1F55 A;  1PVA A;  2HQW A;  3WHT B;  3DXL A;  2BBM A;  4INX A;  4F0Z B;  3D74 A;  4YRU A;  2O5G A;  3LLE A;  3S0E A;  4E68 A;  1BOD A;  1K9P A;  1NX0 A;  3AKB A;  3I5H C;  3SIB A;  1FPW A;  1AJ4 A;  3O4X A;  2QEO A;  2B1U A;  4IJ7 A;  3TUY B;  2ZRT A;  2QEV A;  1XO5 A;  1KFX L;  3DVE A;  5F6T A;  3JTD B;  1J7R A;  1OSA A;  2AAO A; 
#chains in the Genus database with same CATH homology
 1DQE A;  3BFB A;  1TUJ A;  4FQT A;  4PT1 A;  3NHT A;  2WCK A;  3K1E A;  1C3Z A;  3BFH A;  3D77 A;  3R72 A;  3DZT A;  2KPH A;  3S0A A;  2WCM A;  3CZ0 A;  3NGV A;  2P71 A;  3D75 A;  3S0B A;  1T14 A;  3BFA A;  1LS8 A;  2QDI A;  3D73 A;  4INW A;  1OOG A;  2QEB A;  3OGN A;  3BJH A;  3D78 A;  3R1V A;  3V2L A;  3L4L A;  3N7H A;  3VB1 A;  3B86 A;  1C3Y A;  3CZ2 A;  3PJI A;  1OOH A;  3CAB A;  3FE9 A;  1OW4 A;  2PQL A;  1QWV A;  4OZD A;  1ORG A;  3D76 A;  3DYE A;  3B87 A;  3B6X A;  3DY9 A;  4JD9 A;  2L2C A;  4F7F A;  2WC6 A;  2FJY A;  2GTE A;  3B88 A;  3R1O A;  2P70 A;  1P28 A;  1XFR A;  3FE6 A;  3NHI A;  1OOF A;  2ERB A;  3QME A;  1OOI X;  3B7A A;  3RZS A;  2WC5 A;  5DIC A;  3FE8 A;  2WCL A;  3Q8I A;  3CYZ A;  2QEH A;  3L47 A;  3L4A A;  2WCJ A;  3DXL A;  4INX A;  3D74 A;  3S0G A;  3S0E A;  1TWO A;  3S0D A;  3CDN A;  2JPO A;  3S0F A;  1GM0 A;  2QEO A;  2QEV A;  5EL2 A;  2H8V A;  3R1P A;  3CZ1 A;  2WCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...