3FE9A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand soaked at ph 7.0
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 44
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe9A00
2WC5A 3D76A 2WC6A 3FE8A 3B87A 2WCHA 3CDNA 3V2LA 3BJHA 2QEHA 1OOGA 3NHIA 2P71A 1C3YA 3VB1A 3S0FA 4INXA 3DXLA 5EL2A 2ERBA 3BFAA 3DZTA 2H8VA 4INWA 4FQTA 3D77A 2WCJA 2KPHA 1XFRA 1T14A 4JD9A 3FE6A 1ORGA 2L2CA 1TWOA 3S0GA 3RZSA 3D75A 3NHTA 3CZ0A 3CABA 3QMEA 2QEOA 2QEVA 3R1PA 1LS8A 3B7AA 1P28A 3B88A 4PT1A 1C3ZA 2WCLA 1OW4A 3OGNA 2PQLA 2FJYA 3D78A 3B86A 1OOIX 2JPOA 5DICA 2QDIA 3R72A 1DQEA 3CYZA 3R1VA 3L4LA 3D74A 1TUJA 3BFBA 3DYEA 2WCMA 1QWVA 3S0BA 2QEBA 2WCKA 2GTEA 4F7FA 3R1OA 3L47A 3L4AA 3CZ1A 3Q8IA 3D73A 1GM0A 3B6XA 1OOFA 3S0EA 3S0AA 2P70A 3K1EA 3N7HA 3NGVA 1OOHA 3BFHA 3CZ2A 3FE9A 3DY9A 3S0DA 4OZDA 3PJIA
chains in the Genus database with same CATH superfamily
3NSOA 5D69A 1JC2A 4GUKA 1QV0A 2BBMA 2LLSA 2WCHA 1ZACA 2ZFDA 4NQGA 5FI2A 4ZCVA 1CTRA 3AKBA 5HLOA 3EK8A 1A2XA 5F6TA 2A4JA 2G9BA 3WHUB 1BLQA 2MHHA 3BUOB 3O4YA 2WCFA 4OCIA 1BT6A 1M63B 2COLB 2OPOA 2ZN8A 1BR4B 4U8DA 3IF7A 1M45A 1DJGA 2F8PA 1OOGA 1B47A 1UHIA 2KHNA 2QACA 3NHIA 1WDCB 2H61C 1YUUA 1XK4A 3IQQA 3VRNA 1C3YA 2KYFA 3VB1A 2MLFC 1Y6WA 4INXA 1NUBA 1OOJA 1A4PA 1NPQA 1KSOA 2LP2A 4I5LB 1G33A 4YI9A 4I5KA 2MAZA 3KF9A 2ERBA 1QIWA 2LP3A 1MQ1A 1F4OA 1K9UA 1KWOB 1SL9A 1QTXA 2KI4C 2AMIA 2KPHA 1J1DA 1Y1AA 1Y1UA 1ORGA 1WY9A 2VRGA 1MF8B 2HQWA 2L2CA 1TRFA 3CR5X 1KK7Y 1TCOB 4C0LA 1NX3A 4JKTA 3CZ0A 3CTNA 3CABA 2KI6D 3KEVA 4N1FA 2QEOA 3RLZA 4Q04A 4OVNF 1LS8A 3B7AA 1RWYA 1PULA 1Z4HA 2PALA 5CSFA 3B88A 1YURA 1C7WA 1JF2A 1A29A 2BNXA 1CDLA 4GPLB 3HX4A 1TIZA 2Y1NA 1LXFC 2WCLA 1OW4A 2KI6C 1L2OC 2JZIA 2LM5A 3BXKA 4DCKA 5HKYA 1IGVA 5JOLA 2I94A 3SG3A 4DIRA 1SK6D 1S3PA 1UURA 2KAXA 2Y4QA 2V53A 4MZJA 5TNCA 3CR4X 2AAOA 2HETA 3FS7A 3R1VA 3BYAA 3VRRA 3TUYB 2JTZA 5I2QA 1IIOA 1PALA 1A75B 3I5HC 2CCMA 2BECA 3OX6A 4YBHB 2Q91A 3JVTC 4NDBA 1DELA 2WCMA 2WCEA 2JXLA 2EC6C 1F71A 3NXAA 4OKHA 2QPTA 4ORCB 1MHOA 1UUSA 2F33A 1XFUO 3TDUA 3ZNIA 3DVEA 4F0ZB 4CLNA 1TUZA 1FBVA 3L47A 1ODBA 1ZUZA 3R1OA 3KHEA 3PLFB 2BCXA 3L4AA 1M31A 2G2BA 1QXPA 4MZLA 3CZTX 3D73A 1QJTA 2OS8C 1OOFA 3DVJA 2NXQA 2K7OA 1G4YR 2P70A 5AFPA 5I2LA 1XFWO 1K2HA 4I5NB 3EK4A 3DY9A 1YRTB 1TN4A 2JT0A 1QVIY 1AHRA 4BY5A 1CM4A 4YGDB 3RM1A 1S6JA 2BAPA 4QJ5B 2ZNEA 3SS3A 3DVMA 1OZOA 2GGZA 3O2PA 4GGNA 1OSAA 1EJ3A 1PK0D 3D76A 2WC6A 3TDIA 1DMOA 1PRWA 1DJZA 2ZN9A 4PE7A 2CT9A 1JFKA 3NSIA 1S6IA 1XO5A 1HT9A 2JNXA 3V2LA 1AJ5A 1FI6A 1V1FA 5HYDA 2JTTA 1F8HA 2KQYA 3BJHA 1J7OA 1QS7A 3A8RA 1EXRA 2Y1MA 3BQ3A 4HREE 3DD4A 4YGEB 3VGOA 1CLBA 2JULA 1SKTA 1KK8B 1IG5A 1EL4A 1Y0VH 1GGZA 1B8RA 4PALA 3D10A 2JU0A 3JTDC 3OP0A 1WRKA 2O5GA 1K95A 2Q4UA 4GGFC 4PHKA 1OMVA 2JRFA 4CIDA 1CFCA 5FI7A 3SS5A 3O4XA 4N1GA 1ALVA 1KQMC 3PSRA 1SR6C 1X02A 4MN0A 4AQIA 1AK8A 3BUNB 1CB1A 2BL0B 2M1KB 3D77A 2E30A 2CNPA 5BPJA 1CFDA 1JUOA 1T14A 4M2PA 1DJIA 1A03A 3H4SE 1M46A 2KFFA 2D8NA 1QV1A 4R1EA 3S0GA 3D75A 3I5IC 2LAPA 2SCPA 1K90D 3KPXA 1YRUB 1XA5A 3EVUA 1C07A 1CDNA 3VRPA 1MXLC 4OV2A 1BMOA 3AKAA 1KFUL 1SCMB 2JPTA 3LLEA 4KYNA 4TNCA 5ER5A 1LKJA 3VRQA 2CBLA 5IBWA 1IJ5A 1XFVO 1YUTA 2KAVA 5G08A 1CFPA 2L4HA 3BOWA 1YR5A 2KDHA 1PVAA 1S26D 3EVRA 1JSAA 1C3ZA 2JQ6A 2LMVA 2F2PA 2OTGB 2PQLA 2KGRA 4UPGA 1F55A 2FJYA 1NP8A 3E3RA 1OOIX 2JPOA 2HQ8A 1LINA 2MA2A 3PFVA 3HCMA 3R72A 1VRKA 1Y1XA 1YX7A 1DF0B 4HRHA 4WQ2A 1LA0A 3CYZA 5J3XA 1RROA 2KBIA 1B1GA 3UO9A 3D74A 4HSZA 1NSHA 2EGDA 1TNQA 1B7TY 4JPZB 4OR9B 1TUJA 5AXIA 5HKZA 1UHKA 5FYXA 1YVHA 3DYEA 2I18A 3EK7A 2F3ZA 3PN7C 1K8UA 2M8UA 3I5GC 2BE6A 4PE1A 1IKUA 2LC5A 1F4QA 1TTXA 2QEBA 2M7LA 2PSRA 2GTEA 3QRXA 3DVKA 1RK9A 2WORA 3TS5C 1K9KA 1J1EA 2M9GA 3CZ1A 1OZSA 2LLTA 3Q8IA 4DRWA 2K8MB 2ZRTA 2LCPA 3B6XA 1J7RA 1IH0A 1KK7Z 2R2IA 2LVKA 3IQOA 2LNKA 3N7HA 2K2AA 3TZ1A 1OMRA 3FE9A 1C7VA 1B7TZ 5DKRA 3S0DA 1YX8A 4GGFA 2KI4B 3MSEB 1ALWA 3OX5A 2RGIA 1DF0A 1KQVA 2EHBA 3CGAA 3SG6A 4HRGA 3PJIA 3K21A 1DJXA 3OB2B 3GOFA 3EKHA 5I8NA 1B8CA 4E68A 3B87A 1BJFA 1XYDA 1J7QA 4IL1A 1EG4A 1IQ3A 5CSJA 1KFUS 1K96A 2O60A 3CDNA 1N0YA 2JXCA 4CFRA 3WHTB 1UWOA 4YGBB 5AERA 2H61A 4MLWA 4MBEA 4PHNA 2LMTA 4GFTA 3NSKA 2NCPA 3SG7A 3IVTA 3I5FC 4MRYA 5HL1A 2BCAA 2L5YA 2LUXA 1L2OB 3VROA 4MRXA 2FCDA 3UNWA 2M49B 3SIBA 2ZRSA 3OBVA 1NIWA 3PM8A 4MSPA 2WOSA 2E6WA 3DF0B 4MEWA 3S0FA 2L98A 2JC2A 3DXLA 1Q80A 2KGBC 1TCFA 2CXJA 2PYQA 1XK4C 3BFAA 2H8VA 1OMDA 4NDCA 4FQTA 3I5HB 2K0JA 2K7BA 4XJKA 1CFFA 4QJ3B 5AEQA 3JVTB 1R2UA 2KYCA 3SG2A 5GQQC 4P2YB 3SS4A 1BF5A 3SIAA 1MR8A 2YGUA 1CDPA 3AAJA 4ETOA 5PALA 4ZCUA 3RZSA 3FIAA 1QVIZ 4MVFA 1SYMA 1W7IB 2HF5A 3QMEA 3EVVA 4IJ7A 4I5JA 1DJHA 1IJ6A 3GK2A 2MLEC 1K93D 3BOWB 5DKQA 2QEVA 1QIVA 3CS1A 2JT3A 2KOTA 2LHIA 2FJUB 3OB1B 1GGWA 4FTGA 1CNPA 1GQMA 1FPWA 1JF0A 3C1VA 4YRUA 4PT1A 2LVJA 4DS7A 3DF0A 2M0RA 2PVBA 1HQVA 3OGNA 3LK1A 3D78A 1WDCC 1LVCD 3B86A 2LV7A 3PALA 4PE4A 5CSNA 1EH2A 2BKHB 5DICA 1JWDA 1EG3A 3OHMB 1SCVA 1N2DA 2IS9A 2L50A 2QDIA 3NSLA 5JJGA 4PHMA 1WLZA 3GK1A 1DQEA 1F54A 3LCPC 2MJWB 2PASA 4L9MA 3M0WA 2JT8A 4DUQA 4BY4A 1MXEA 1J55A 1OQPA 3PATA 2KQ6A 5AANA 1JFJA 1FI5A 2KLEA 1KWOC 3F45A 1QX7A 2KFGA 4FQOA 1SMGA 2I2RE 3FWCA 4ORAB 5B8IB 3S0BA 1WLMA 1AP4A 1H8BA 1KFXL 2WCKA 1NX0A 1DGVA 1U5IA 2WNDA 4AQJA 2L5XB 1DJWA 1MUXA 2LE9B 3EG5B 1E8AA 2B1UA 3JTDB 4D1EA 1MWNA 1UHNA 2L0PA 3BUWB 1B9AA 1GM0A 1PSRA 1WRZA 3BUXB 5HLVA 3S0AA 1PSBA 1BR1B 1Z2CB 2DOQA 1BU3A 1SSEB 1KQMB 3K1EA 3KO0A 3NGVA 1SR6B 3TDZA 1OOHA 2P6BB 1PVBA 3CZ2A 5CSIA 1CKKA 3PM2A 2LVIA 1K9PA 2CTNA 4OZDA 1W7JB 1CM1A 1RTP1 2GV5A 1B8LA 2WC5A 1IWQA 2ZNDA 2K2FA 3I5IB 2AUCA 3D0YA 3FE8A 4AOMA 1H4BA 1DTLA 2ISDA 4JQ0D 1BOCA 1KSMA 1JBAA 2JNFA 1AVSA 4C0JA 4XYNA 1GJYA 1NCYA 1OE9B 1RECA 3TUYC 3ZWHA 2M1UA 1DT7B 2MBXA 2M7NA 1CMFA 1D1OA 4N5XA 1DGUA 1CLMA 1QLSA 1DJYA 2K7CA 2WC8A 1SW8A 1CMGA 4A4CA 1FW4A 2QEHA 1ZFSA 4NDDA 5ER4X 2KAYA 2KNEA 2SASA 4CPVA 1UHHA 3CR2A 5I2OA 1N65A 5HKWA 2P71A 5KU1A 4A4BA 1DC1A 2KSPA 1RFJA 4XJKB 1YUSA 2ZKMX 3A4UB 5DKNA 3SG4A 1BG1A 1NYAA 2I7AA 1QASA 2JWWA 5EL2A 4INWA 4USLA 3DZTA 4YGAA 4C0KA 5I94A 5KSZA 2KLDA 2L2EA 4PHJA 3BUMB 1SRAA 1V1GA 4WQ3A 1SPYA 4GBAA 1AJ4A 2WCJA 3PN7B 5D7FA 1XFRA 1XVJA 3I5GB 2NLNA 3FE6A 3LK0A 4JD9A 1R6PA 1KFXS 2HPSA 2MRDA 2NZ0A 1QX5B 1TWOA 2PMYA 2BE4A 1YVLA 1NWDA 1DVIA 1SNLA 3NHTA 3TS5B 1QATA 2LUCA 2JOJA 2LLUA 4PCWA 2GGMA 3AAKA 1IRJA 3R1PA 1P28A 4JWQA 4QJ4B 1KCYA 3CWGA 3FWBA 5K89A 5FI6A 3O78A 1SBJA 3O6BA 2LVVA 1WRLA 4YGCB 5KTYA 4PE0A 1NX1A 1QX2A 1S5GY 1S1EA 4CFQA 3CLNA 1KK8C 4PDZA 1IQ5A 2H2KA 1DEKA 1XFXO 1ZOTB 2L51A 2EC6B 2M29A 1BODA 1NCXA 1W9ZA 2L4IA 1SY9A 2BKIB 4M2QA 2F2OA 1XFZO 3L4LA 1CLLA 3ICBA 4M2OA 1ZMZA 2FCEA 2Y5IA 1FF1A 3WXAA 1QLKA 2LANA 3BFBA 1S6CA 2TN4A 2BL0C 1K94A 1TOPA 2FOTA 2OS8B 1NX2A 1U5IB 2K61A 1B4CA 1F70A 1NCZA 2KFHA 2M97A 4YI8A 1QWVA 2M3WA 4P5OE 2NCOA 3I5FB 1TNPA 1A75A 2WCBA 1M39A 1S5GZ 1TNXA 3GK4X 4GNKB 4WRIA 5CPVA 4GAOA 4F7FA 5D3OA 1S36A 3LL8B 1YTZC 1CDMA 1G8IA 1SL7A 4MZKA 2K7DA 1AUIB 1TNWA 1L7ZA 3S0EA 3SJSA 2K60A 1SCMC 2BCBA 3BFHA 4ORBB 1UHJA 1XFYO 2F3YA 3WNXB 2KBMA 4ICBA 1LA3A 1RJVA 3EKJA 3SG5A 3D0YB 2LMUA 1SL8A 1UP5A 2LHLA 2BBNA 2OTGC 2PRUA 1J7PA
chains in the Genus database with same CATH topology
2WC5A 3D76A 2WC6A 3FE8A 3B87A 2WCHA 3CDNA 3V2LA 3BJHA 2QEHA 1OOGA 3NHIA 2P71A 1C3YA 3VB1A 3S0FA 4INXA 3DXLA 5EL2A 2ERBA 3BFAA 3DZTA 2H8VA 4INWA 4FQTA 3D77A 2WCJA 2KPHA 1XFRA 1T14A 4JD9A 3FE6A 1ORGA 2L2CA 1TWOA 3S0GA 3RZSA 3D75A 3NHTA 3CZ0A 3CABA 3QMEA 2QEOA 2QEVA 3R1PA 1LS8A 3B7AA 1P28A 3B88A 4PT1A 1C3ZA 2WCLA 1OW4A 3OGNA 2PQLA 2FJYA 3D78A 3B86A 1OOIX 2JPOA 5DICA 2QDIA 3R72A 1DQEA 3CYZA 3R1VA 3L4LA 3D74A 1TUJA 3BFBA 3DYEA 2WCMA 1QWVA 3S0BA 2QEBA 2WCKA 2GTEA 4F7FA 3R1OA 3L47A 3L4AA 3CZ1A 3Q8IA 3D73A 1GM0A 3B6XA 1OOFA 3S0EA 3S0AA 2P70A 3K1EA 3N7HA 3NGVA 1OOHA 3BFHA 3CZ2A 3FE9A 3DY9A 3S0DA 4OZDA 3PJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC5 A;  3D76 A;  2WC6 A;  3FE8 A;  3B87 A;  2WCH A;  3CDN A;  3V2L A;  3BJH A;  2QEH A;  1OOG A;  3NHI A;  2P71 A;  1C3Y A;  3VB1 A;  3S0F A;  4INX A;  3DXL A;  5EL2 A;  2ERB A;  3BFA A;  3DZT A;  2H8V A;  4INW A;  4FQT A;  3D77 A;  2WCJ A;  2KPH A;  1XFR A;  1T14 A;  4JD9 A;  3FE6 A;  1ORG A;  2L2C A;  1TWO A;  3S0G A;  3RZS A;  3D75 A;  3NHT A;  3CZ0 A;  3CAB A;  3QME A;  2QEO A;  2QEV A;  3R1P A;  1LS8 A;  3B7A A;  1P28 A;  3B88 A;  4PT1 A;  1C3Z A;  2WCL A;  1OW4 A;  3OGN A;  2PQL A;  2FJY A;  3D78 A;  3B86 A;  1OOI X;  2JPO A;  5DIC A;  2QDI A;  3R72 A;  1DQE A;  3CYZ A;  3R1V A;  3L4L A;  3D74 A;  1TUJ A;  3BFB A;  3DYE A;  2WCM A;  1QWV A;  3S0B A;  2QEB A;  2WCK A;  2GTE A;  4F7F A;  3R1O A;  3L47 A;  3L4A A;  3CZ1 A;  3Q8I A;  3D73 A;  1GM0 A;  3B6X A;  1OOF A;  3S0E A;  3S0A A;  2P70 A;  3K1E A;  3N7H A;  3NGV A;  1OOH A;  3BFH A;  3CZ2 A;  3FE9 A;  3DY9 A;  3S0D A;  4OZD A;  3PJI A; 
#chains in the Genus database with same CATH topology
 3NSO A;  5D69 A;  1JC2 A;  4GUK A;  1QV0 A;  2BBM A;  2LLS A;  2WCH A;  1ZAC A;  2ZFD A;  4NQG A;  5FI2 A;  4ZCV A;  1CTR A;  3AKB A;  5HLO A;  3EK8 A;  1A2X A;  5F6T A;  2A4J A;  2G9B A;  3WHU B;  1BLQ A;  2MHH A;  3BUO B;  3O4Y A;  2WCF A;  4OCI A;  1BT6 A;  1M63 B;  2COL B;  2OPO A;  2ZN8 A;  1BR4 B;  4U8D A;  3IF7 A;  1M45 A;  1DJG A;  2F8P A;  1OOG A;  1B47 A;  1UHI A;  2KHN A;  2QAC A;  3NHI A;  1WDC B;  2H61 C;  1YUU A;  1XK4 A;  3IQQ A;  3VRN A;  1C3Y A;  2KYF A;  3VB1 A;  2MLF C;  1Y6W A;  4INX A;  1NUB A;  1OOJ A;  1A4P A;  1NPQ A;  1KSO A;  2LP2 A;  4I5L B;  1G33 A;  4YI9 A;  4I5K A;  2MAZ A;  3KF9 A;  2ERB A;  1QIW A;  2LP3 A;  1MQ1 A;  1F4O A;  1K9U A;  1KWO B;  1SL9 A;  1QTX A;  2KI4 C;  2AMI A;  2KPH A;  1J1D A;  1Y1A A;  1Y1U A;  1ORG A;  1WY9 A;  2VRG A;  1MF8 B;  2HQW A;  2L2C A;  1TRF A;  3CR5 X;  1KK7 Y;  1TCO B;  4C0L A;  1NX3 A;  4JKT A;  3CZ0 A;  3CTN A;  3CAB A;  2KI6 D;  3KEV A;  4N1F A;  2QEO A;  3RLZ A;  4Q04 A;  4OVN F;  1LS8 A;  3B7A A;  1RWY A;  1PUL A;  1Z4H A;  2PAL A;  5CSF A;  3B88 A;  1YUR A;  1C7W A;  1JF2 A;  1A29 A;  2BNX A;  1CDL A;  4GPL B;  3HX4 A;  1TIZ A;  2Y1N A;  1LXF C;  2WCL A;  1OW4 A;  2KI6 C;  1L2O C;  2JZI A;  2LM5 A;  3BXK A;  4DCK A;  5HKY A;  1IGV A;  5JOL A;  2I94 A;  3SG3 A;  4DIR A;  1SK6 D;  1S3P A;  1UUR A;  2KAX A;  2Y4Q A;  2V53 A;  4MZJ A;  5TNC A;  3CR4 X;  2AAO A;  2HET A;  3FS7 A;  3R1V A;  3BYA A;  3VRR A;  3TUY B;  2JTZ A;  5I2Q A;  1IIO A;  1PAL A;  1A75 B;  3I5H C;  2CCM A;  2BEC A;  3OX6 A;  4YBH B;  2Q91 A;  3JVT C;  4NDB A;  1DEL A;  2WCM A;  2WCE A;  2JXL A;  2EC6 C;  1F71 A;  3NXA A;  4OKH A;  2QPT A;  4ORC B;  1MHO A;  1UUS A;  2F33 A;  1XFU O;  3TDU A;  3ZNI A;  3DVE A;  4F0Z B;  4CLN A;  1TUZ A;  1FBV A;  3L47 A;  1ODB A;  1ZUZ A;  3R1O A;  3KHE A;  3PLF B;  2BCX A;  3L4A A;  1M31 A;  2G2B A;  1QXP A;  4MZL A;  3CZT X;  3D73 A;  1QJT A;  2OS8 C;  1OOF A;  3DVJ A;  2NXQ A;  2K7O A;  1G4Y R;  2P70 A;  5AFP A;  5I2L A;  1XFW O;  1K2H A;  4I5N B;  3EK4 A;  3DY9 A;  1YRT B;  1TN4 A;  2JT0 A;  1QVI Y;  1AHR A;  4BY5 A;  1CM4 A;  4YGD B;  3RM1 A;  1S6J A;  2BAP A;  4QJ5 B;  2ZNE A;  3SS3 A;  3DVM A;  1OZO A;  2GGZ A;  3O2P A;  4GGN A;  1OSA A;  1EJ3 A;  1PK0 D;  3D76 A;  2WC6 A;  3TDI A;  1DMO A;  1PRW A;  1DJZ A;  2ZN9 A;  4PE7 A;  2CT9 A;  1JFK A;  3NSI A;  1S6I A;  1XO5 A;  1HT9 A;  2JNX A;  3V2L A;  1AJ5 A;  1FI6 A;  1V1F A;  5HYD A;  2JTT A;  1F8H A;  2KQY A;  3BJH A;  1J7O A;  1QS7 A;  3A8R A;  1EXR A;  2Y1M A;  3BQ3 A;  4HRE E;  3DD4 A;  4YGE B;  3VGO A;  1CLB A;  2JUL A;  1SKT A;  1KK8 B;  1IG5 A;  1EL4 A;  1Y0V H;  1GGZ A;  1B8R A;  4PAL A;  3D10 A;  2JU0 A;  3JTD C;  3OP0 A;  1WRK A;  2O5G A;  1K95 A;  2Q4U A;  4GGF C;  4PHK A;  1OMV A;  2JRF A;  4CID A;  1CFC A;  5FI7 A;  3SS5 A;  3O4X A;  4N1G A;  1ALV A;  1KQM C;  3PSR A;  1SR6 C;  1X02 A;  4MN0 A;  4AQI A;  1AK8 A;  3BUN B;  1CB1 A;  2BL0 B;  2M1K B;  3D77 A;  2E30 A;  2CNP A;  5BPJ A;  1CFD A;  1JUO A;  1T14 A;  4M2P A;  1DJI A;  1A03 A;  3H4S E;  1M46 A;  2KFF A;  2D8N A;  1QV1 A;  4R1E A;  3S0G A;  3D75 A;  3I5I C;  2LAP A;  2SCP A;  1K90 D;  3KPX A;  1YRU B;  1XA5 A;  3EVU A;  1C07 A;  1CDN A;  3VRP A;  1MXL C;  4OV2 A;  1BMO A;  3AKA A;  1KFU L;  1SCM B;  2JPT A;  3LLE A;  4KYN A;  4TNC A;  5ER5 A;  1LKJ A;  3VRQ A;  2CBL A;  5IBW A;  1IJ5 A;  1XFV O;  1YUT A;  2KAV A;  5G08 A;  1CFP A;  2L4H A;  3BOW A;  1YR5 A;  2KDH A;  1PVA A;  1S26 D;  3EVR A;  1JSA A;  1C3Z A;  2JQ6 A;  2LMV A;  2F2P A;  2OTG B;  2PQL A;  2KGR A;  4UPG A;  1F55 A;  2FJY A;  1NP8 A;  3E3R A;  1OOI X;  2JPO A;  2HQ8 A;  1LIN A;  2MA2 A;  3PFV A;  3HCM A;  3R72 A;  1VRK A;  1Y1X A;  1YX7 A;  1DF0 B;  4HRH A;  4WQ2 A;  1LA0 A;  3CYZ A;  5J3X A;  1RRO A;  2KBI A;  1B1G A;  3UO9 A;  3D74 A;  4HSZ A;  1NSH A;  2EGD A;  1TNQ A;  1B7T Y;  4JPZ B;  4OR9 B;  1TUJ A;  5AXI A;  5HKZ A;  1UHK A;  5FYX A;  1YVH A;  3DYE A;  2I18 A;  3EK7 A;  2F3Z A;  3PN7 C;  1K8U A;  2M8U A;  3I5G C;  2BE6 A;  4PE1 A;  1IKU A;  2LC5 A;  1F4Q A;  1TTX A;  2QEB A;  2M7L A;  2PSR A;  2GTE A;  3QRX A;  3DVK A;  1RK9 A;  2WOR A;  3TS5 C;  1K9K A;  1J1E A;  2M9G A;  3CZ1 A;  1OZS A;  2LLT A;  3Q8I A;  4DRW A;  2K8M B;  2ZRT A;  2LCP A;  3B6X A;  1J7R A;  1IH0 A;  1KK7 Z;  2R2I A;  2LVK A;  3IQO A;  2LNK A;  3N7H A;  2K2A A;  3TZ1 A;  1OMR A;  3FE9 A;  1C7V A;  1B7T Z;  5DKR A;  3S0D A;  1YX8 A;  4GGF A;  2KI4 B;  3MSE B;  1ALW A;  3OX5 A;  2RGI A;  1DF0 A;  1KQV A;  2EHB A;  3CGA A;  3SG6 A;  4HRG A;  3PJI A;  3K21 A;  1DJX A;  3OB2 B;  3GOF A;  3EKH A;  5I8N A;  1B8C A;  4E68 A;  3B87 A;  1BJF A;  1XYD A;  1J7Q A;  4IL1 A;  1EG4 A;  1IQ3 A;  5CSJ A;  1KFU S;  1K96 A;  2O60 A;  3CDN A;  1N0Y A;  2JXC A;  4CFR A;  3WHT B;  1UWO A;  4YGB B;  5AER A;  2H61 A;  4MLW A;  4MBE A;  4PHN A;  2LMT A;  4GFT A;  3NSK A;  2NCP A;  3SG7 A;  3IVT A;  3I5F C;  4MRY A;  5HL1 A;  2BCA A;  2L5Y A;  2LUX A;  1L2O B;  3VRO A;  4MRX A;  2FCD A;  3UNW A;  2M49 B;  3SIB A;  2ZRS A;  3OBV A;  1NIW A;  3PM8 A;  4MSP A;  2WOS A;  2E6W A;  3DF0 B;  4MEW A;  3S0F A;  2L98 A;  2JC2 A;  3DXL A;  1Q80 A;  2KGB C;  1TCF A;  2CXJ A;  2PYQ A;  1XK4 C;  3BFA A;  2H8V A;  1OMD A;  4NDC A;  4FQT A;  3I5H B;  2K0J A;  2K7B A;  4XJK A;  1CFF A;  4QJ3 B;  5AEQ A;  3JVT B;  1R2U A;  2KYC A;  3SG2 A;  5GQQ C;  4P2Y B;  3SS4 A;  1BF5 A;  3SIA A;  1MR8 A;  2YGU A;  1CDP A;  3AAJ A;  4ETO A;  5PAL A;  4ZCU A;  3RZS A;  3FIA A;  1QVI Z;  4MVF A;  1SYM A;  1W7I B;  2HF5 A;  3QME A;  3EVV A;  4IJ7 A;  4I5J A;  1DJH A;  1IJ6 A;  3GK2 A;  2MLE C;  1K93 D;  3BOW B;  5DKQ A;  2QEV A;  1QIV A;  3CS1 A;  2JT3 A;  2KOT A;  2LHI A;  2FJU B;  3OB1 B;  1GGW A;  4FTG A;  1CNP A;  1GQM A;  1FPW A;  1JF0 A;  3C1V A;  4YRU A;  4PT1 A;  2LVJ A;  4DS7 A;  3DF0 A;  2M0R A;  2PVB A;  1HQV A;  3OGN A;  3LK1 A;  3D78 A;  1WDC C;  1LVC D;  3B86 A;  2LV7 A;  3PAL A;  4PE4 A;  5CSN A;  1EH2 A;  2BKH B;  5DIC A;  1JWD A;  1EG3 A;  3OHM B;  1SCV A;  1N2D A;  2IS9 A;  2L50 A;  2QDI A;  3NSL A;  5JJG A;  4PHM A;  1WLZ A;  3GK1 A;  1DQE A;  1F54 A;  3LCP C;  2MJW B;  2PAS A;  4L9M A;  3M0W A;  2JT8 A;  4DUQ A;  4BY4 A;  1MXE A;  1J55 A;  1OQP A;  3PAT A;  2KQ6 A;  5AAN A;  1JFJ A;  1FI5 A;  2KLE A;  1KWO C;  3F45 A;  1QX7 A;  2KFG A;  4FQO A;  1SMG A;  2I2R E;  3FWC A;  4ORA B;  5B8I B;  3S0B A;  1WLM A;  1AP4 A;  1H8B A;  1KFX L;  2WCK A;  1NX0 A;  1DGV A;  1U5I A;  2WND A;  4AQJ A;  2L5X B;  1DJW A;  1MUX A;  2LE9 B;  3EG5 B;  1E8A A;  2B1U A;  3JTD B;  4D1E A;  1MWN A;  1UHN A;  2L0P A;  3BUW B;  1B9A A;  1GM0 A;  1PSR A;  1WRZ A;  3BUX B;  5HLV A;  3S0A A;  1PSB A;  1BR1 B;  1Z2C B;  2DOQ A;  1BU3 A;  1SSE B;  1KQM B;  3K1E A;  3KO0 A;  3NGV A;  1SR6 B;  3TDZ A;  1OOH A;  2P6B B;  1PVB A;  3CZ2 A;  5CSI A;  1CKK A;  3PM2 A;  2LVI A;  1K9P A;  2CTN A;  4OZD A;  1W7J B;  1CM1 A;  1RTP 1;  2GV5 A;  1B8L A;  2WC5 A;  1IWQ A;  2ZND A;  2K2F A;  3I5I B;  2AUC A;  3D0Y A;  3FE8 A;  4AOM A;  1H4B A;  1DTL A;  2ISD A;  4JQ0 D;  1BOC A;  1KSM A;  1JBA A;  2JNF A;  1AVS A;  4C0J A;  4XYN A;  1GJY A;  1NCY A;  1OE9 B;  1REC A;  3TUY C;  3ZWH A;  2M1U A;  1DT7 B;  2MBX A;  2M7N A;  1CMF A;  1D1O A;  4N5X A;  1DGU A;  1CLM A;  1QLS A;  1DJY A;  2K7C A;  2WC8 A;  1SW8 A;  1CMG A;  4A4C A;  1FW4 A;  2QEH A;  1ZFS A;  4NDD A;  5ER4 X;  2KAY A;  2KNE A;  2SAS A;  4CPV A;  1UHH A;  3CR2 A;  5I2O A;  1N65 A;  5HKW A;  2P71 A;  5KU1 A;  4A4B A;  1DC1 A;  2KSP A;  1RFJ A;  4XJK B;  1YUS A;  2ZKM X;  3A4U B;  5DKN A;  3SG4 A;  1BG1 A;  1NYA A;  2I7A A;  1QAS A;  2JWW A;  5EL2 A;  4INW A;  4USL A;  3DZT A;  4YGA A;  4C0K A;  5I94 A;  5KSZ A;  2KLD A;  2L2E A;  4PHJ A;  3BUM B;  1SRA A;  1V1G A;  4WQ3 A;  1SPY A;  4GBA A;  1AJ4 A;  2WCJ A;  3PN7 B;  5D7F A;  1XFR A;  1XVJ A;  3I5G B;  2NLN A;  3FE6 A;  3LK0 A;  4JD9 A;  1R6P A;  1KFX S;  2HPS A;  2MRD A;  2NZ0 A;  1QX5 B;  1TWO A;  2PMY A;  2BE4 A;  1YVL A;  1NWD A;  1DVI A;  1SNL A;  3NHT A;  3TS5 B;  1QAT A;  2LUC A;  2JOJ A;  2LLU A;  4PCW A;  2GGM A;  3AAK A;  1IRJ A;  3R1P A;  1P28 A;  4JWQ A;  4QJ4 B;  1KCY A;  3CWG A;  3FWB A;  5K89 A;  5FI6 A;  3O78 A;  1SBJ A;  3O6B A;  2LVV A;  1WRL A;  4YGC B;  5KTY A;  4PE0 A;  1NX1 A;  1QX2 A;  1S5G Y;  1S1E A;  4CFQ A;  3CLN A;  1KK8 C;  4PDZ A;  1IQ5 A;  2H2K A;  1DEK A;  1XFX O;  1ZOT B;  2L51 A;  2EC6 B;  2M29 A;  1BOD A;  1NCX A;  1W9Z A;  2L4I A;  1SY9 A;  2BKI B;  4M2Q A;  2F2O A;  1XFZ O;  3L4L A;  1CLL A;  3ICB A;  4M2O A;  1ZMZ A;  2FCE A;  2Y5I A;  1FF1 A;  3WXA A;  1QLK A;  2LAN A;  3BFB A;  1S6C A;  2TN4 A;  2BL0 C;  1K94 A;  1TOP A;  2FOT A;  2OS8 B;  1NX2 A;  1U5I B;  2K61 A;  1B4C A;  1F70 A;  1NCZ A;  2KFH A;  2M97 A;  4YI8 A;  1QWV A;  2M3W A;  4P5O E;  2NCO A;  3I5F B;  1TNP A;  1A75 A;  2WCB A;  1M39 A;  1S5G Z;  1TNX A;  3GK4 X;  4GNK B;  4WRI A;  5CPV A;  4GAO A;  4F7F A;  5D3O A;  1S36 A;  3LL8 B;  1YTZ C;  1CDM A;  1G8I A;  1SL7 A;  4MZK A;  2K7D A;  1AUI B;  1TNW A;  1L7Z A;  3S0E A;  3SJS A;  2K60 A;  1SCM C;  2BCB A;  3BFH A;  4ORB B;  1UHJ A;  1XFY O;  2F3Y A;  3WNX B;  2KBM A;  4ICB A;  1LA3 A;  1RJV A;  3EKJ A;  3SG5 A;  3D0Y B;  2LMU A;  1SL8 A;  1UP5 A;  2LHL A;  2BBN A;  2OTG C;  2PRU A;  1J7P A; 
#chains in the Genus database with same CATH homology
 2WC5 A;  3D76 A;  2WC6 A;  3FE8 A;  3B87 A;  2WCH A;  3CDN A;  3V2L A;  3BJH A;  2QEH A;  1OOG A;  3NHI A;  2P71 A;  1C3Y A;  3VB1 A;  3S0F A;  4INX A;  3DXL A;  5EL2 A;  2ERB A;  3BFA A;  3DZT A;  2H8V A;  4INW A;  4FQT A;  3D77 A;  2WCJ A;  2KPH A;  1XFR A;  1T14 A;  4JD9 A;  3FE6 A;  1ORG A;  2L2C A;  1TWO A;  3S0G A;  3RZS A;  3D75 A;  3NHT A;  3CZ0 A;  3CAB A;  3QME A;  2QEO A;  2QEV A;  3R1P A;  1LS8 A;  3B7A A;  1P28 A;  3B88 A;  4PT1 A;  1C3Z A;  2WCL A;  1OW4 A;  3OGN A;  2PQL A;  2FJY A;  3D78 A;  3B86 A;  1OOI X;  2JPO A;  5DIC A;  2QDI A;  3R72 A;  1DQE A;  3CYZ A;  3R1V A;  3L4L A;  3D74 A;  1TUJ A;  3BFB A;  3DYE A;  2WCM A;  1QWV A;  3S0B A;  2QEB A;  2WCK A;  2GTE A;  4F7F A;  3R1O A;  3L47 A;  3L4A A;  3CZ1 A;  3Q8I A;  3D73 A;  1GM0 A;  3B6X A;  1OOF A;  3S0E A;  3S0A A;  2P70 A;  3K1E A;  3N7H A;  3NGV A;  1OOH A;  3BFH A;  3CZ2 A;  3FE9 A;  3DY9 A;  3S0D A;  4OZD A;  3PJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...