3BYAA

Structure of a calmodulin complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
137
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMASEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structure of a Calmodulin Complex
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 48
structure length 137
sequence length 144
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3byaA00
2K7OA 1Y1AA 1NX1A 2K7BA 2MLFC 1K96A 1QVIZ 2L50A 4ZCVA 1NCYA 2K61A 1M31A 1OMVA 3I5IC 1FF1A 5I2OA 3WNXB 2L4HA 4DUQA 2KQYA 3BOWA 3IQQA 4GGFC 4PALA 1YR5A 2I7AA 1C07A 1GGZA 1C7VA 4JWQA 2CNPA 1XFZO 1A4PA 2WORA 2Y1NA 1NCXA 1NWDA 1B8LA 4I5JA 1ALWA 1RK9A 3TS5C 2F3YA 1A29A 2KDHA 3GK2A 1BLQA 2COLB 1NX3A 1ZFSA 1UHKA 2G9BA 5IBWA 4ORBB 1CFFA 5I2QA 5HYDA 3EK4A 4DRWA 3TUYC 4FQOA 1YUTA 1S6JA 5CSFA 2KAYA 1CDMA 5KU1A 3TDZA 3DF0B 2O5GA 1KFUS 2M8UA 5B8IB 1CM1A 2TN4A 4WRIA 1WDCC 2ZKMX 1IRJA 1SMGA 3EKHA 3CWGA 1CLBA 2KBMA 4XJKA 2EGDA 4OV2A 4CLNA 2FCEA 1UHHA 3BUOB 1YUUA 3F45A 1SL8A 1GJYA 2LMTA 1DJWA 2KI4B 2LNKA 3VRNA 3NXAA 1J1EA 1MR8A 1QTXA 3SG6A 1X02A 2M49B 2B1UA 2HF5A 4UPGA 1A75B 1IG5A 2CXJA 3BYAA 1F71A 3EVVA 3FWBA 2JTTA 1TNPA 2HPSA 2LUCA 1L7ZA 1B4CA 2PSRA 4OVNF 1QV0A 1KCYA 1A2XA 5KTYA 1DJYA 2M0RA 4MZJA 4YGBB 1SR6B 1SCMB 3NSOA 1SYMA 1IGVA 2L4IA 1SK6D 3PN7C 4C0KA 2BL0C 4GGFA 1LINA 1K9KA 1S1EA 3BXKA 5HLOA 1XFWO 1S36A 1S6IA 2PALA 1IWQA 1Y6WA 3ICBA 1J7OA 1RTP1 3NSKA 4E68A 3PM8A 2M1KB 1PSBA 3AAKA 1CTRA 1SY9A 2CBLA 1B47A 2AUCA 2PASA 2BKIB 3MSEB 4N1GA 4AQJA 2FJUB 4F0ZB 2LHLA 3A4UB 3I5HB 4ZCUA 2QACA 4DCKA 1XK4C 1PSRA 2HQ8A 3I5FC 4GPLB 1UP5A 3WHUB 2BECA 2WC8A 3PFVA 4N5XA 1L2OB 1OZOA 1J7RA 1DVIA 3AKAA 4PHNA 1CMGA 1KK7Y 3VRQA 3SJSA 3KHEA 1N65A 1BJFA 1TOPA 3TS5B 3SIAA 1PALA 1MF8B 1F70A 2M9GA 4PE7A 1XFXO 5DKQA 3DVMA 1MXLC 4QJ5B 2KI6D 2RGIA 1JF0A 3CLNA 4NDBA 1LVCD 1UHNA 1CNPA 1XO5A 4GUKA 1CDNA 3IF7A 2KSPA 2ZFDA 1J7PA 3CGAA 3PLFB 3O4YA 1XFVO 4PHJA 1CDLA 1NX0A 2BBMA 2ZRTA 5CPVA 4DIRA 1RJVA 1LKJA 2LVIA 2LVKA 2K2AA 1CDPA 2NXQA 1OMDA 3HX4A 4AOMA 1DGUA 2G2BA 1RROA 2I94A 4NQGA 3CTNA 3GK4X 3GOFA 1NCZA 2LV7A 1U5IA 2Y1MA 1GQMA 3LCPC 1AJ4A 1BG1A 1NPQA 1XYDA 2L5XB 3FIAA 1B7TZ 1RWYA 1SPYA 2MRDA 2R2IA 4TNCA 2LE9B 1JFJA 1YURA 5I8NA 5PALA 1PULA 1CLLA 1JUOA 2NLNA 1QLSA 1OSAA 1K94A 1TIZA 2JZIA 4USLA 3PATA 4PDZA 1QVIY 3SG2A 4MZLA 4MN0A 2KOTA 4C0LA 1XK4A 1DJIA 1N2DA 2BKHB 1YTZC 1U5IB 2JXLA 3OX6A 3PN7B 2BL0B 1B8RA 2CT9A 2V53A 2JXCA 3IQOA 2JU0A 1N0YA 2LP3A 2F2OA 3QRXA 2L51A 1H4BA 4ORCB 2MBXA 1NIWA 3NSLA 4PCWA 1LA0A 2NCOA 2P6BB 2Q91A 5D69A 2GGZA 4D1EA 1SRAA 4YGDB 3BOWB 1AP4A 1Y1UA 1QJTA 3KF9A 2WNDA 4GAOA 4OCIA 1JWDA 2LLUA 1F4OA 3D0YA 3E3RA 1M45A 2LLSA 1UURA 2KAVA 2OS8C 2WCFA 3RM1A 1XA5A 2CCMA 3OB1B 3ZWHA 4GBAA 1MUXA 1BR4B 5ER5A 4CPVA 4IL1A 1MXEA 1M63B 3JTDC 1FI6A 3O6BA 3LK0A 1QX5B 5CSIA 3C1VA 2EC6C 2ISDA 3CR5X 3CS1A 2KBIA 2VRGA 1EJ3A 4JPZB 4Q04A 2LMUA 1AUIB 3WHTB 1ZACA 2F33A 1TN4A 2OTGB 1IQ3A 1VRKA 2JT8A 2KQ6A 3BUWB 1EXRA 1S5GZ 4GNKB 4WQ3A 4XJKB 1KQMC 1SL7A 1WLZA 3D0YB 2BCBA 2KYFA 2WCBA 4YI9A 4YGAA 4MRYA 3KEVA 4M2QA 5HKWA 2KNEA 1W7IB 2KFHA 2A4JA 4PHMA 5KSZA 1JC2A 5AXIA 1KWOB 5AFPA 2LVVA 2AAOA 3AAJA 3OP0A 1E8AA 1AVSA 1CFPA 1AJ5A 1F55A 4CIDA 2JC2A 4A4BA 1A03A 1AHRA 1QXPA 1XFUO 3I5IB 2M1UA 2K7CA 1UWOA 2L0PA 2PVBA 2K7DA 2KGRA 1JFKA 3LK1A 1RECA 1QATA 1DGVA 2JOJA 2SASA 4FTGA 1SKTA 1NYAA 3BUNB 2QPTA 3EKJA 2DOQA 4N1FA 2LM5A 3TUYB 1UHIA 4PE1A 2HQWA 2GGMA 5AANA 4L9MA 4YBHB 1KFXS 1R6PA 1TNXA 5F6TA 1CFDA 4M2PA 1AK8A 1F4QA 1WRKA 2PRUA 5D7FA 3CR4X 1DTLA 1Q80A 1WDCB 2I18A 2KYCA 5CSNA 1SCVA 1QLKA 2BBNA 1JSAA 1OQPA 4PHKA 3SG5A 5J3XA 3FWCA 2JQ6A 4JQ0D 2KGBC 4MEWA 4U8DA 5AEQA 3WXAA 3H4SE 1S26D 3EK8A 2KAXA 3CR2A 1KSMA 2OS8B 3JVTC 3FS7A 5JOLA 3VRRA 1QV1A 2BCXA 3BQ3A 1J1DA 1IJ5A 5I2LA 4ICBA 1J7QA 2ZN9A 1C7WA 3DD4A 4MSPA 1B7TY 1TNWA 2LLTA 1WRLA 2D8NA 2EC6B 1YRUB 4HRHA 5FYXA 3BUMB 1B1GA 3HCMA 2M29A 1SR6C 1V1FA 3LLEA 5CSJA 2CTNA 2JNXA 1XVJA 1KQMB 2HETA 1V1GA 3PSRA 2JTZA 3GK1A 1OE9B 2Q4UA 3SG3A 1PVAA 5ER4X 1BODA 2H2KA 2K8MB 4AQIA 1LXFC 1NP8A 1NX2A 1OZSA 4MZKA 1TNQA 1DT7B 1K2HA 3O78A 1XFYO 2FCDA 2K2FA 2KFGA 3O2PA 2M97A 3SIBA 1OMRA 1BU3A 1B9AA 2E30A 1EL4A 1YX8A 3I5HC 1KFUL 3K21A 1TCOB 1CM4A 4HRGA 1TRFA 3DF0A 2ZRSA 2L2EA 1K9PA 1QX7A 5DKNA 4M2OA 1QX2A 2MLEC 1L2OC 1KK8C 3I5FB 1WLMA 2K0JA 4XYNA 4YGCB 4QJ3B 1CMFA 1ZMZA 2GV5A 2PMYA 1WY9A 1PK0D 3OB2B 3CZTX 1G33A 1S3PA 1DJHA 3VGOA 4MRXA 1DJGA 4MLWA 1LA3A 3VRPA 1FPWA 2NCPA 1YUSA 1ZOTB 1H8BA 3D10A 3DVJA 1KSOA 1G8IA 2F2PA 3DVKA 2WOSA 3I5GC 4A4CA 1DF0A 1EH2A 1K9UA 4GFTA 1A75A 3EK7A 1K95A 2LMVA 2MJWB 4I5LB 1PRWA 1IKUA 1SNLA 4BY5A 3TDUA 1S5GY 4BY4A 2JT3A 1ZUZA 1G4YR 3ZNIA 4P2YB 2NZ0A 1SL9A 4CFQA 1D1OA 2H61C 2F8PA 1HT9A 3JVTB 1KQVA 2LVJA 1S6CA 4QJ4B 3OHMB 1DF0B 4OR9B 1UHJA 2MHHA 1OOJA 4NDCA 1UUSA 2ZNEA 2JRFA 5BPJA 1HQVA 2M3WA 1R2UA 1YRTB 3M0WA 3AKBA 4ETOA 1NSHA 5K89A 4HSZA 2BE4A 3SG7A 1FI5A 4P5OE 4R1EA 4CFRA 2IS9A 3DVEA 2LCPA 3EVUA 2AMIA 5HLVA 2L98A 1J55A 1TTXA 2JULA 2F3ZA 1BMOA 2WCEA 1IQ5A 4YGEB 5JJGA 2LHIA 4OKHA 1EG4A 2I2RE 1WRZA 2ZN8A 1SW8A 2KHNA 1PVBA 3EVRA 2M7LA 1CB1A 1EG3A 1W7JB 4PE4A 1K93D 1DMOA 4I5KA 1NUBA 2OPOA 3VROA 2MAZA 5G08A 1KFXL 1YVLA 1IJ6A 2LUXA 4MBEA 4WQ2A 4GGNA 4NDDA 1Y0VH 1QS7A 1ODBA 1IH0A 5TNCA 3OX5A 3KO0A 1GGWA 4MVFA 1CKKA 1KK7Z 3SG4A 2O60A 1KK8B 1JBAA 3LL8B 1QASA 2FOTA 5DKRA 2JT0A 4I5NB 2KI4C 1MQ1A 2Y5IA 1F54A 2BE6A 5HKYA 1Y1XA 1JF2A 2M7NA 2MA2A 3NSIA 2H61A 1ALVA 1MWNA 2EHBA 2ZNDA 3JTDB 2LAPA 2KI6C 1FBVA 2OTGC 3I5GB 4ORAB 4HREE 2LP2A 1TCFA 1YX7A 1QIWA 2JPTA 1BT6A 4DS7A 2E6WA 2LANA 2Y4QA 3KPXA 1QIVA 3TDIA 4C0JA 1SCMC 1DJXA 3PALA 1YVHA 1CFCA 2KFFA 1BF5A 3A8RA 1K8UA 1BOCA 4YI8A 1BR1B 2LC5A 1K90D 2BCAA 5HKZA 2JNFA 5GQQC 1M46A 1SBJA 4YRUA 1KWOC 1MHOA 5AERA 4PE0A 3RLZA 1M39A 1DJZA 1CLMA 1B8CA 3TZ1A 1F8HA 1FW4A 3BUXB 2JWWA 2SCPA 1RFJA
chains in the Genus database with same CATH superfamily
2K7OA 1Y1AA 1NX1A 2K7BA 2MLFC 1K96A 2WC6A 1QVIZ 2L50A 4ZCVA 1NCYA 2K61A 1M31A 1OMVA 3I5IC 1FF1A 5I2OA 3WNXB 2L4HA 4DUQA 2KQYA 3BOWA 3IQQA 4GGFC 4PALA 1YR5A 2I7AA 1C07A 1GGZA 1C7VA 4JWQA 2CNPA 1XFZO 3D75A 1A4PA 2WORA 2Y1NA 1NCXA 1NWDA 1B8LA 4I5JA 1ALWA 1RK9A 3TS5C 2F3YA 1A29A 2KDHA 3GK2A 1BLQA 2COLB 1T14A 1NX3A 1ZFSA 1UHKA 2G9BA 5IBWA 4ORBB 5FI2A 5I2QA 5HYDA 1CFFA 3EK4A 4DRWA 3TUYC 4FQOA 1YUTA 1S6JA 5CSFA 2KAYA 1CDMA 5KU1A 3TDZA 3DF0B 2O5GA 1KFUS 2M8UA 5B8IB 1CM1A 2TN4A 4WRIA 1WDCC 2ZKMX 1IRJA 1SMGA 3EKHA 3CWGA 1CLBA 2KBMA 4XJKA 2EGDA 4OV2A 4CLNA 3DYEA 2FCEA 1UHHA 3BUOB 1YUUA 3F45A 1SL8A 1GJYA 2LMTA 1DJWA 2KI4B 2LNKA 3VRNA 3NXAA 1J1EA 1MR8A 1QTXA 3SG6A 1X02A 2M49B 2B1UA 2HF5A 3D76A 4UPGA 1A75B 3N7HA 1IG5A 2CXJA 3BYAA 1F71A 3EVVA 3FWBA 2JTTA 1TNPA 2HPSA 2LUCA 1L7ZA 1XFRA 2WCJA 3SS3A 1B4CA 2PSRA 4OVNF 1QV0A 1KCYA 1A2XA 5KTYA 1DJYA 2M0RA 4MZJA 4YGBB 1SR6B 1SCMB 3NSOA 1SYMA 2QDIA 1IGVA 2L4IA 1SK6D 3PN7C 4C0KA 2BL0C 4GGFA 1LINA 1K9KA 1S1EA 3BXKA 3L47A 3S0DA 5HLOA 1XFWO 1S36A 1S6IA 2PALA 1IWQA 1Y6WA 3BFAA 3ICBA 3IVTA 1J7OA 1RTP1 3NSKA 4E68A 3PM8A 2M1KB 3S0FA 1PSBA 3AAKA 1CTRA 1SY9A 2CBLA 1B47A 2AUCA 2PASA 2BKIB 3MSEB 4N1GA 4AQJA 2FJUB 1DELA 2LHLA 2WC5A 4F0ZB 1IIOA 3A4UB 3QMEA 3I5HB 4ZCUA 2QACA 4DCKA 1XK4C 1PSRA 2HQ8A 3V2LA 3UO9A 3I5FC 4GPLB 1UP5A 3WHUB 2BECA 2WC8A 3PFVA 3EG5B 4N5XA 1L2OB 1OZOA 1J7RA 1DVIA 3AKAA 4PHNA 1CMGA 1KK7Y 3VRQA 3SJSA 3KHEA 1N65A 1BJFA 1TOPA 3TS5B 3SIAA 2ERBA 1PALA 1MF8B 1F70A 2M9GA 4PE7A 1XFXO 5DKQA 3DVMA 1MXLC 4QJ5B 2KI6D 2RGIA 1JF0A 3CLNA 4NDBA 1LVCD 1UHNA 3R1VA 1CNPA 1XO5A 4GUKA 1CDNA 3IF7A 2KSPA 2ZFDA 1J7PA 3BFHA 3CGAA 3PLFB 3O4YA 1XFVO 4PHJA 1CDLA 1NX0A 2BBMA 2ZRTA 5CPVA 4DIRA 1RJVA 5HL1A 1LKJA 2LVIA 2LVKA 2PYQA 2K2AA 1CDPA 2NXQA 1OMDA 2P70A 3HX4A 2KLEA 3R72A 1DGUA 4AOMA 5I94A 2G2BA 1RROA 2I94A 3CZ2A 3PM2A 4NQGA 3CTNA 3S0BA 3GK4X 4INWA 3GOFA 1NCZA 2LV7A 1U5IA 2Y1MA 1GQMA 3LCPC 1AJ4A 1BG1A 1NPQA 1XYDA 2L5XB 3FIAA 1B7TZ 1RWYA 1SPYA 2MRDA 2R2IA 3CZ1A 2WCKA 3FE8A 4TNCA 2LE9B 1JFJA 1YURA 5I8NA 5PALA 1PULA 1CLLA 1JUOA 2NLNA 1QLSA 1OSAA 1K94A 1TIZA 2JZIA 4USLA 3PATA 4PDZA 1QVIY 1LS8A 2L2CA 3SG2A 4MZLA 4MN0A 2KOTA 4C0LA 1XK4A 1DJIA 1N2DA 2BKHB 1YTZC 1U5IB 2JXLA 3OX6A 3PN7B 2BL0B 1B8RA 2CT9A 2V53A 3B88A 2JXCA 3IQOA 2JU0A 1N0YA 2LP3A 2F2OA 5DICA 3QRXA 2L51A 1H4BA 4ORCB 2MBXA 1NIWA 3PJIA 3NSLA 4PCWA 1LA0A 2NCOA 2P6BB 1OOHA 2Q91A 5D69A 2GGZA 4D1EA 1SRAA 4YGDB 3NGVA 3BOWB 1AP4A 1SSEB 1Y1UA 1QJTA 3KF9A 2QEVA 2WNDA 4GAOA 4OCIA 1JWDA 2LLUA 1F4OA 3D0YA 3E3RA 1DC1A 1M45A 2LLSA 1UURA 2KAVA 2OS8C 2WCFA 3RM1A 1XA5A 2CCMA 3O4XA 2QEHA 3OB1B 4GBAA 3ZWHA 1MUXA 3S0AA 1BR4B 4PT1A 5ER5A 4CPVA 3K1EA 4IL1A 1MXEA 1M63B 3JTDC 1FI6A 3D78A 3O6BA 3LK0A 1QX5B 5CSIA 3C1VA 2EC6C 2ISDA 3CR5X 3CS1A 2KBIA 2VRGA 1EJ3A 4JPZB 4Q04A 2LMUA 1AUIB 3WHTB 1ZACA 2F33A 1OOIX 1TN4A 2OTGB 1VRKA 2JT8A 2KQ6A 2QEBA 1IQ3A 1C3YA 3BUWB 1EXRA 1S5GZ 4GNKB 4WQ3A 4XJKB 1KQMC 1SL7A 1WLZA 3D0YB 2BAPA 2BCBA 2KYFA 2WCBA 4YI9A 4YGAA 4MRYA 3KEVA 4M2QA 3D73A 2KNEA 5HKWA 1W7IB 2KFHA 2A4JA 4PHMA 5KSZA 1DQEA 1JC2A 5AXIA 1KWOB 5AFPA 2LVVA 2AAOA 3AAJA 3OP0A 1E8AA 1OOGA 1AVSA 3OGNA 1CFPA 1AJ5A 1F55A 4CIDA 2JC2A 4A4BA 1A03A 1AHRA 4INXA 1QXPA 1XFUO 3I5IB 1TWOA 2M1UA 2K7CA 1UWOA 2L0PA 2PVBA 4JD9A 2K7DA 2KGRA 1JFKA 2BNXA 3LK1A 1RECA 1QATA 1DGVA 2JOJA 2SASA 4FTGA 1SKTA 1NYAA 1C3ZA 3BUNB 2H8VA 2QPTA 3EKJA 2DOQA 4N1FA 2LM5A 3TUYB 1UHIA 4PE1A 2HQWA 1ORGA 2GGMA 5AANA 2FJYA 4L9MA 4YBHB 1KFXS 1R6PA 1TNXA 5F6TA 1CFDA 4M2PA 1AK8A 1F4QA 1WRKA 2PRUA 5D7FA 3CR4X 1DTLA 1Q80A 1WDCB 2I18A 2KYCA 5CSNA 1SCVA 1QLKA 2BBNA 1JSAA 1OQPA 4PHKA 3SG5A 3CYZA 3FWCA 2JQ6A 5J3XA 4JQ0D 2KGBC 4MEWA 4U8DA 5AEQA 3WXAA 3H4SE 1S26D 3EK8A 2KAXA 3CR2A 3R1PA 1KSMA 2OS8B 3JVTC 3FS7A 5JOLA 3VRRA 1QV1A 5EL2A 2BCXA 3B6XA 3BQ3A 1J1DA 1IJ5A 5I2LA 4ICBA 3D74A 3VB1A 1J7QA 2ZN9A 1C7WA 2K60A 3B86A 3DD4A 4MSPA 1B7TY 1TNWA 2LLTA 1WRLA 2D8NA 2EC6B 1YRUB 4HRHA 5FYXA 3BUMB 1B1GA 3Q8IA 3HCMA 2M29A 1SR6C 1V1FA 3LLEA 5CSJA 2CTNA 2JNXA 1XVJA 1TUJA 1KQMB 2HETA 2KLDA 1V1GA 3PSRA 2JTZA 3GK1A 1OE9B 2Q4UA 3SG3A 1PVAA 5ER4X 1BODA 2H2KA 2K8MB 4AQIA 1LXFC 1NP8A 1NX2A 1OZSA 4MZKA 1TNQA 3S0EA 1DT7B 1TUZA 3O78A 1K2HA 1XFYO 2FCDA 2K2FA 2KFGA 3O2PA 2M97A 3SIBA 1OMRA 3RZSA 1BU3A 1B9AA 3BFBA 2E30A 1EL4A 4F7FA 1YX8A 3I5HC 1KFUL 3K21A 1TCOB 1CM4A 4OZDA 4HRGA 1TRFA 3DF0A 2ZRSA 1OOFA 2L2EA 1K9PA 1QX7A 5DKNA 4M2OA 1QX2A 2P71A 3B87A 2MLEC 1L2OC 1KK8C 3I5FB 3SS4A 1WLMA 2K0JA 4XYNA 4YGCB 4QJ3B 1CMFA 1ZMZA 2GV5A 2PMYA 1WY9A 1PK0D 3OB2B 3CZTX 1G33A 1S3PA 1DJHA 3VGOA 4MRXA 1DJGA 4MLWA 1LA3A 3VRPA 1FPWA 2NCPA 1YUSA 1ZOTB 3UNWA 3D10A 1H8BA 3DVJA 1KSOA 1G8IA 2F2PA 3DVKA 2WOSA 3I5GC 4A4CA 1DF0A 1EH2A 1K9UA 4GFTA 1A75A 3EK7A 1K95A 2LMVA 2MJWB 4I5LB 4JKTA 1PRWA 1IKUA 1SNLA 1GM0A 4BY5A 3TDUA 1S5GY 4BY4A 5FI7A 2JT3A 1ZUZA 1G4YR 3ZNIA 4P2YB 2NZ0A 1SL9A 4CFQA 1D1OA 2H61C 2F8PA 1HT9A 2L5YA 3JVTB 1KQVA 2LVJA 1S6CA 4QJ4B 3OHMB 1DF0B 4OR9B 3L4LA 1UHJA 2MHHA 1OOJA 4KYNA 1UUSA 2ZNEA 2JRFA 4NDCA 5BPJA 1HQVA 2M3WA 1R2UA 1YRTB 3M0WA 3AKBA 4ETOA 1NSHA 5K89A 4HSZA 2BE4A 3FE9A 5D3OA 3SG7A 1FI5A 2PQLA 4P5OE 4R1EA 4CFRA 3L4AA 2IS9A 1Z4HA 3DVEA 3SS5A 2LCPA 3EVUA 1QWVA 2AMIA 4FQTA 2QEOA 5HLVA 2L98A 3NHIA 3CZ0A 1J55A 1TTXA 2JULA 3S0GA 2F3ZA 1BMOA 3FE6A 2WCEA 1IQ5A 4YGEB 5JJGA 2LHIA 2JPOA 5FI6A 1P28A 4OKHA 3DXLA 1EG4A 2GTEA 1WRZA 2I2RE 1W9ZA 1SW8A 2KHNA 1PVBA 2ZN8A 3EVRA 2M7LA 1CB1A 1EG3A 1W7JB 4PE4A 3D77A 1K93D 1DMOA 4I5KA 1NUBA 3DY9A 2OPOA 2WCMA 3VROA 2MAZA 5G08A 1KFXL 1YVLA 1IJ6A 2LUXA 4MBEA 4WQ2A 4GGNA 4NDDA 1Y0VH 1QS7A 1ODBA 1IH0A 5TNCA 3OX5A 3KO0A 1GGWA 4MVFA 1CKKA 1KK7Z 3SG4A 2O60A 1KK8B 1JBAA 3B7AA 3LL8B 1QASA 2FOTA 5DKRA 2JT0A 4I5NB 2KI4C 1MQ1A 2Y5IA 3CABA 3DZTA 1F54A 4IJ7A 2BE6A 5HKYA 1Y1XA 1JF2A 2M7NA 2KPHA 2MA2A 3NSIA 2H61A 1ALVA 1MWNA 2EHBA 1DEKA 2ZNDA 3JTDB 2LAPA 2KI6C 1FBVA 2OTGC 2WCLA 3I5GB 3OBVA 4HREE 4ORAB 2LP2A 1TCFA 1YX7A 1QIWA 3R1OA 2JPTA 3NHTA 1BT6A 4DS7A 1OW4A 2E6WA 2LANA 2Y4QA 3KPXA 1QIVA 3TDIA 4C0JA 1SCMC 1DJXA 3PALA 1YVHA 1CFCA 2KFFA 1BF5A 3A8RA 1K8UA 3CDNA 4YI8A 1BOCA 1BR1B 2LC5A 1K90D 2BCAA 5HKZA 2JNFA 5GQQC 1M46A 2WCHA 1SBJA 4YRUA 1KWOC 1MHOA 5AERA 4PE0A 1Z2CB 1M39A 3RLZA 1DJZA 1CLMA 1B8CA 3BJHA 3TZ1A 1F8HA 1FW4A 3BUXB 2YGUA 2JWWA 2SCPA 1RFJA
chains in the Genus database with same CATH topology
2K7OA 1Y1AA 1NX1A 2K7BA 2MLFC 1K96A 1QVIZ 2L50A 4ZCVA 1NCYA 2K61A 1M31A 1OMVA 3I5IC 1FF1A 5I2OA 3WNXB 2L4HA 4DUQA 2KQYA 3BOWA 3IQQA 4GGFC 4PALA 1YR5A 2I7AA 1C07A 1GGZA 1C7VA 4JWQA 2CNPA 1XFZO 1A4PA 2WORA 2Y1NA 1NCXA 1NWDA 1B8LA 4I5JA 1ALWA 1RK9A 3TS5C 2F3YA 1A29A 2KDHA 3GK2A 1BLQA 2COLB 1NX3A 1ZFSA 1UHKA 2G9BA 5IBWA 4ORBB 1CFFA 5I2QA 5HYDA 3EK4A 4DRWA 3TUYC 4FQOA 1YUTA 1S6JA 5CSFA 2KAYA 1CDMA 5KU1A 3TDZA 3DF0B 2O5GA 1KFUS 2M8UA 5B8IB 1CM1A 2TN4A 4WRIA 1WDCC 2ZKMX 1IRJA 1SMGA 3EKHA 3CWGA 1CLBA 2KBMA 4XJKA 2EGDA 4OV2A 4CLNA 2FCEA 1UHHA 3BUOB 1YUUA 3F45A 1SL8A 1GJYA 2LMTA 1DJWA 2KI4B 2LNKA 3VRNA 3NXAA 1J1EA 1MR8A 1QTXA 3SG6A 1X02A 2M49B 2B1UA 2HF5A 4UPGA 1A75B 1IG5A 2CXJA 3BYAA 1F71A 3EVVA 3FWBA 2JTTA 1TNPA 2HPSA 2LUCA 1L7ZA 1B4CA 2PSRA 4OVNF 1QV0A 1KCYA 1A2XA 5KTYA 1DJYA 2M0RA 4MZJA 4YGBB 1SR6B 1SCMB 3NSOA 1SYMA 1IGVA 2L4IA 1SK6D 3PN7C 4C0KA 2BL0C 4GGFA 1LINA 1K9KA 1S1EA 3BXKA 5HLOA 1XFWO 1S36A 1S6IA 2PALA 1IWQA 1Y6WA 3ICBA 1J7OA 1RTP1 3NSKA 4E68A 3PM8A 2M1KB 1PSBA 3AAKA 1CTRA 1SY9A 2CBLA 1B47A 2AUCA 2PASA 2BKIB 3MSEB 4N1GA 4AQJA 2FJUB 4F0ZB 2LHLA 3A4UB 3I5HB 4ZCUA 2QACA 4DCKA 1XK4C 1PSRA 2HQ8A 3I5FC 4GPLB 1UP5A 3WHUB 2BECA 2WC8A 3PFVA 4N5XA 1L2OB 1OZOA 1J7RA 1DVIA 3AKAA 4PHNA 1CMGA 1KK7Y 3VRQA 3SJSA 3KHEA 1N65A 1BJFA 1TOPA 3TS5B 3SIAA 1PALA 1MF8B 1F70A 2M9GA 4PE7A 1XFXO 5DKQA 3DVMA 1MXLC 4QJ5B 2KI6D 2RGIA 1JF0A 3CLNA 4NDBA 1LVCD 1UHNA 1CNPA 1XO5A 4GUKA 1CDNA 3IF7A 2KSPA 2ZFDA 1J7PA 3CGAA 3PLFB 3O4YA 1XFVO 4PHJA 1CDLA 1NX0A 2BBMA 2ZRTA 5CPVA 4DIRA 1RJVA 1LKJA 2LVIA 2LVKA 2K2AA 1CDPA 2NXQA 1OMDA 3HX4A 4AOMA 1DGUA 2G2BA 1RROA 2I94A 4NQGA 3CTNA 3GK4X 3GOFA 1NCZA 2LV7A 1U5IA 2Y1MA 1GQMA 3LCPC 1AJ4A 1BG1A 1NPQA 1XYDA 2L5XB 3FIAA 1B7TZ 1RWYA 1SPYA 2MRDA 2R2IA 4TNCA 2LE9B 1JFJA 1YURA 5I8NA 5PALA 1PULA 1CLLA 1JUOA 2NLNA 1QLSA 1OSAA 1K94A 1TIZA 2JZIA 4USLA 3PATA 4PDZA 1QVIY 3SG2A 4MZLA 4MN0A 2KOTA 4C0LA 1XK4A 1DJIA 1N2DA 2BKHB 1YTZC 1U5IB 2JXLA 3OX6A 3PN7B 2BL0B 1B8RA 2CT9A 2V53A 2JXCA 3IQOA 2JU0A 1N0YA 2LP3A 2F2OA 3QRXA 2L51A 1H4BA 4ORCB 2MBXA 1NIWA 3NSLA 4PCWA 1LA0A 2NCOA 2P6BB 2Q91A 5D69A 2GGZA 4D1EA 1SRAA 4YGDB 3BOWB 1AP4A 1Y1UA 1QJTA 3KF9A 2WNDA 4GAOA 4OCIA 1JWDA 2LLUA 1F4OA 3D0YA 3E3RA 1M45A 2LLSA 1UURA 2KAVA 2OS8C 2WCFA 3RM1A 1XA5A 2CCMA 3OB1B 3ZWHA 4GBAA 1MUXA 1BR4B 5ER5A 4CPVA 4IL1A 1MXEA 1M63B 3JTDC 1FI6A 3O6BA 3LK0A 1QX5B 5CSIA 3C1VA 2EC6C 2ISDA 3CR5X 3CS1A 2KBIA 2VRGA 1EJ3A 4JPZB 4Q04A 2LMUA 1AUIB 3WHTB 1ZACA 2F33A 1TN4A 2OTGB 1IQ3A 1VRKA 2JT8A 2KQ6A 3BUWB 1EXRA 1S5GZ 4GNKB 4WQ3A 4XJKB 1KQMC 1SL7A 1WLZA 3D0YB 2BCBA 2KYFA 2WCBA 4YI9A 4YGAA 4MRYA 3KEVA 4M2QA 5HKWA 2KNEA 1W7IB 2KFHA 2A4JA 4PHMA 5KSZA 1JC2A 5AXIA 1KWOB 5AFPA 2LVVA 2AAOA 3AAJA 3OP0A 1E8AA 1AVSA 1CFPA 1AJ5A 1F55A 4CIDA 2JC2A 4A4BA 1A03A 1AHRA 1QXPA 1XFUO 3I5IB 2M1UA 2K7CA 1UWOA 2L0PA 2PVBA 2K7DA 2KGRA 1JFKA 3LK1A 1RECA 1QATA 1DGVA 2JOJA 2SASA 4FTGA 1SKTA 1NYAA 3BUNB 2QPTA 3EKJA 2DOQA 4N1FA 2LM5A 3TUYB 1UHIA 4PE1A 2HQWA 2GGMA 5AANA 4L9MA 4YBHB 1KFXS 1R6PA 1TNXA 5F6TA 1CFDA 4M2PA 1AK8A 1F4QA 1WRKA 2PRUA 5D7FA 3CR4X 1DTLA 1Q80A 1WDCB 2I18A 2KYCA 5CSNA 1SCVA 1QLKA 2BBNA 1JSAA 1OQPA 4PHKA 3SG5A 5J3XA 3FWCA 2JQ6A 4JQ0D 2KGBC 4MEWA 4U8DA 5AEQA 3WXAA 3H4SE 1S26D 3EK8A 2KAXA 3CR2A 1KSMA 2OS8B 3JVTC 3FS7A 5JOLA 3VRRA 1QV1A 2BCXA 3BQ3A 1J1DA 1IJ5A 5I2LA 4ICBA 1J7QA 2ZN9A 1C7WA 3DD4A 4MSPA 1B7TY 1TNWA 2LLTA 1WRLA 2D8NA 2EC6B 1YRUB 4HRHA 5FYXA 3BUMB 1B1GA 3HCMA 2M29A 1SR6C 1V1FA 3LLEA 5CSJA 2CTNA 2JNXA 1XVJA 1KQMB 2HETA 1V1GA 3PSRA 2JTZA 3GK1A 1OE9B 2Q4UA 3SG3A 1PVAA 5ER4X 1BODA 2H2KA 2K8MB 4AQIA 1LXFC 1NP8A 1NX2A 1OZSA 4MZKA 1TNQA 1DT7B 1K2HA 3O78A 1XFYO 2FCDA 2K2FA 2KFGA 3O2PA 2M97A 3SIBA 1OMRA 1BU3A 1B9AA 2E30A 1EL4A 1YX8A 3I5HC 1KFUL 3K21A 1TCOB 1CM4A 4HRGA 1TRFA 3DF0A 2ZRSA 2L2EA 1K9PA 1QX7A 5DKNA 4M2OA 1QX2A 2MLEC 1L2OC 1KK8C 3I5FB 1WLMA 2K0JA 4XYNA 4YGCB 4QJ3B 1CMFA 1ZMZA 2GV5A 2PMYA 1WY9A 1PK0D 3OB2B 3CZTX 1G33A 1S3PA 1DJHA 3VGOA 4MRXA 1DJGA 4MLWA 1LA3A 3VRPA 1FPWA 2NCPA 1YUSA 1ZOTB 1H8BA 3D10A 3DVJA 1KSOA 1G8IA 2F2PA 3DVKA 2WOSA 3I5GC 4A4CA 1DF0A 1EH2A 1K9UA 4GFTA 1A75A 3EK7A 1K95A 2LMVA 2MJWB 4I5LB 1PRWA 1IKUA 1SNLA 4BY5A 3TDUA 1S5GY 4BY4A 2JT3A 1ZUZA 1G4YR 3ZNIA 4P2YB 2NZ0A 1SL9A 4CFQA 1D1OA 2H61C 2F8PA 1HT9A 3JVTB 1KQVA 2LVJA 1S6CA 4QJ4B 3OHMB 1DF0B 4OR9B 1UHJA 2MHHA 1OOJA 4NDCA 1UUSA 2ZNEA 2JRFA 5BPJA 1HQVA 2M3WA 1R2UA 1YRTB 3M0WA 3AKBA 4ETOA 1NSHA 5K89A 4HSZA 2BE4A 3SG7A 1FI5A 4P5OE 4R1EA 4CFRA 2IS9A 3DVEA 2LCPA 3EVUA 2AMIA 5HLVA 2L98A 1J55A 1TTXA 2JULA 2F3ZA 1BMOA 2WCEA 1IQ5A 4YGEB 5JJGA 2LHIA 4OKHA 1EG4A 2I2RE 1WRZA 2ZN8A 1SW8A 2KHNA 1PVBA 3EVRA 2M7LA 1CB1A 1EG3A 1W7JB 4PE4A 1K93D 1DMOA 4I5KA 1NUBA 2OPOA 3VROA 2MAZA 5G08A 1KFXL 1YVLA 1IJ6A 2LUXA 4MBEA 4WQ2A 4GGNA 4NDDA 1Y0VH 1QS7A 1ODBA 1IH0A 5TNCA 3OX5A 3KO0A 1GGWA 4MVFA 1CKKA 1KK7Z 3SG4A 2O60A 1KK8B 1JBAA 3LL8B 1QASA 2FOTA 5DKRA 2JT0A 4I5NB 2KI4C 1MQ1A 2Y5IA 1F54A 2BE6A 5HKYA 1Y1XA 1JF2A 2M7NA 2MA2A 3NSIA 2H61A 1ALVA 1MWNA 2EHBA 2ZNDA 3JTDB 2LAPA 2KI6C 1FBVA 2OTGC 3I5GB 4ORAB 4HREE 2LP2A 1TCFA 1YX7A 1QIWA 2JPTA 1BT6A 4DS7A 2E6WA 2LANA 2Y4QA 3KPXA 1QIVA 3TDIA 4C0JA 1SCMC 1DJXA 3PALA 1YVHA 1CFCA 2KFFA 1BF5A 3A8RA 1K8UA 1BOCA 4YI8A 1BR1B 2LC5A 1K90D 2BCAA 5HKZA 2JNFA 5GQQC 1M46A 1SBJA 4YRUA 1KWOC 1MHOA 5AERA 4PE0A 3RLZA 1M39A 1DJZA 1CLMA 1B8CA 3TZ1A 1F8HA 1FW4A 3BUXB 2JWWA 2SCPA 1RFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7O A;  1Y1A A;  1NX1 A;  2K7B A;  2MLF C;  1K96 A;  1QVI Z;  2L50 A;  4ZCV A;  1NCY A;  2K61 A;  1M31 A;  1OMV A;  3I5I C;  1FF1 A;  5I2O A;  3WNX B;  2L4H A;  4DUQ A;  2KQY A;  3BOW A;  3IQQ A;  4GGF C;  4PAL A;  1YR5 A;  2I7A A;  1C07 A;  1GGZ A;  1C7V A;  4JWQ A;  2CNP A;  1XFZ O;  1A4P A;  2WOR A;  2Y1N A;  1NCX A;  1NWD A;  1B8L A;  4I5J A;  1ALW A;  1RK9 A;  3TS5 C;  2F3Y A;  1A29 A;  2KDH A;  3GK2 A;  1BLQ A;  2COL B;  1NX3 A;  1ZFS A;  1UHK A;  2G9B A;  5IBW A;  4ORB B;  1CFF A;  5I2Q A;  5HYD A;  3EK4 A;  4DRW A;  3TUY C;  4FQO A;  1YUT A;  1S6J A;  5CSF A;  2KAY A;  1CDM A;  5KU1 A;  3TDZ A;  3DF0 B;  2O5G A;  1KFU S;  2M8U A;  5B8I B;  1CM1 A;  2TN4 A;  4WRI A;  1WDC C;  2ZKM X;  1IRJ A;  1SMG A;  3EKH A;  3CWG A;  1CLB A;  2KBM A;  4XJK A;  2EGD A;  4OV2 A;  4CLN A;  2FCE A;  1UHH A;  3BUO B;  1YUU A;  3F45 A;  1SL8 A;  1GJY A;  2LMT A;  1DJW A;  2KI4 B;  2LNK A;  3VRN A;  3NXA A;  1J1E A;  1MR8 A;  1QTX A;  3SG6 A;  1X02 A;  2M49 B;  2B1U A;  2HF5 A;  4UPG A;  1A75 B;  1IG5 A;  2CXJ A;  3BYA A;  1F71 A;  3EVV A;  3FWB A;  2JTT A;  1TNP A;  2HPS A;  2LUC A;  1L7Z A;  1B4C A;  2PSR A;  4OVN F;  1QV0 A;  1KCY A;  1A2X A;  5KTY A;  1DJY A;  2M0R A;  4MZJ A;  4YGB B;  1SR6 B;  1SCM B;  3NSO A;  1SYM A;  1IGV A;  2L4I A;  1SK6 D;  3PN7 C;  4C0K A;  2BL0 C;  4GGF A;  1LIN A;  1K9K A;  1S1E A;  3BXK A;  5HLO A;  1XFW O;  1S36 A;  1S6I A;  2PAL A;  1IWQ A;  1Y6W A;  3ICB A;  1J7O A;  1RTP 1;  3NSK A;  4E68 A;  3PM8 A;  2M1K B;  1PSB A;  3AAK A;  1CTR A;  1SY9 A;  2CBL A;  1B47 A;  2AUC A;  2PAS A;  2BKI B;  3MSE B;  4N1G A;  4AQJ A;  2FJU B;  4F0Z B;  2LHL A;  3A4U B;  3I5H B;  4ZCU A;  2QAC A;  4DCK A;  1XK4 C;  1PSR A;  2HQ8 A;  3I5F C;  4GPL B;  1UP5 A;  3WHU B;  2BEC A;  2WC8 A;  3PFV A;  4N5X A;  1L2O B;  1OZO A;  1J7R A;  1DVI A;  3AKA A;  4PHN A;  1CMG A;  1KK7 Y;  3VRQ A;  3SJS A;  3KHE A;  1N65 A;  1BJF A;  1TOP A;  3TS5 B;  3SIA A;  1PAL A;  1MF8 B;  1F70 A;  2M9G A;  4PE7 A;  1XFX O;  5DKQ A;  3DVM A;  1MXL C;  4QJ5 B;  2KI6 D;  2RGI A;  1JF0 A;  3CLN A;  4NDB A;  1LVC D;  1UHN A;  1CNP A;  1XO5 A;  4GUK A;  1CDN A;  3IF7 A;  2KSP A;  2ZFD A;  1J7P A;  3CGA A;  3PLF B;  3O4Y A;  1XFV O;  4PHJ A;  1CDL A;  1NX0 A;  2BBM A;  2ZRT A;  5CPV A;  4DIR A;  1RJV A;  1LKJ A;  2LVI A;  2LVK A;  2K2A A;  1CDP A;  2NXQ A;  1OMD A;  3HX4 A;  4AOM A;  1DGU A;  2G2B A;  1RRO A;  2I94 A;  4NQG A;  3CTN A;  3GK4 X;  3GOF A;  1NCZ A;  2LV7 A;  1U5I A;  2Y1M A;  1GQM A;  3LCP C;  1AJ4 A;  1BG1 A;  1NPQ A;  1XYD A;  2L5X B;  3FIA A;  1B7T Z;  1RWY A;  1SPY A;  2MRD A;  2R2I A;  4TNC A;  2LE9 B;  1JFJ A;  1YUR A;  5I8N A;  5PAL A;  1PUL A;  1CLL A;  1JUO A;  2NLN A;  1QLS A;  1OSA A;  1K94 A;  1TIZ A;  2JZI A;  4USL A;  3PAT A;  4PDZ A;  1QVI Y;  3SG2 A;  4MZL A;  4MN0 A;  2KOT A;  4C0L A;  1XK4 A;  1DJI A;  1N2D A;  2BKH B;  1YTZ C;  1U5I B;  2JXL A;  3OX6 A;  3PN7 B;  2BL0 B;  1B8R A;  2CT9 A;  2V53 A;  2JXC A;  3IQO A;  2JU0 A;  1N0Y A;  2LP3 A;  2F2O A;  3QRX A;  2L51 A;  1H4B A;  4ORC B;  2MBX A;  1NIW A;  3NSL A;  4PCW A;  1LA0 A;  2NCO A;  2P6B B;  2Q91 A;  5D69 A;  2GGZ A;  4D1E A;  1SRA A;  4YGD B;  3BOW B;  1AP4 A;  1Y1U A;  1QJT A;  3KF9 A;  2WND A;  4GAO A;  4OCI A;  1JWD A;  2LLU A;  1F4O A;  3D0Y A;  3E3R A;  1M45 A;  2LLS A;  1UUR A;  2KAV A;  2OS8 C;  2WCF A;  3RM1 A;  1XA5 A;  2CCM A;  3OB1 B;  3ZWH A;  4GBA A;  1MUX A;  1BR4 B;  5ER5 A;  4CPV A;  4IL1 A;  1MXE A;  1M63 B;  3JTD C;  1FI6 A;  3O6B A;  3LK0 A;  1QX5 B;  5CSI A;  3C1V A;  2EC6 C;  2ISD A;  3CR5 X;  3CS1 A;  2KBI A;  2VRG A;  1EJ3 A;  4JPZ B;  4Q04 A;  2LMU A;  1AUI B;  3WHT B;  1ZAC A;  2F33 A;  1TN4 A;  2OTG B;  1IQ3 A;  1VRK A;  2JT8 A;  2KQ6 A;  3BUW B;  1EXR A;  1S5G Z;  4GNK B;  4WQ3 A;  4XJK B;  1KQM C;  1SL7 A;  1WLZ A;  3D0Y B;  2BCB A;  2KYF A;  2WCB A;  4YI9 A;  4YGA A;  4MRY A;  3KEV A;  4M2Q A;  5HKW A;  2KNE A;  1W7I B;  2KFH A;  2A4J A;  4PHM A;  5KSZ A;  1JC2 A;  5AXI A;  1KWO B;  5AFP A;  2LVV A;  2AAO A;  3AAJ A;  3OP0 A;  1E8A A;  1AVS A;  1CFP A;  1AJ5 A;  1F55 A;  4CID A;  2JC2 A;  4A4B A;  1A03 A;  1AHR A;  1QXP A;  1XFU O;  3I5I B;  2M1U A;  2K7C A;  1UWO A;  2L0P A;  2PVB A;  2K7D A;  2KGR A;  1JFK A;  3LK1 A;  1REC A;  1QAT A;  1DGV A;  2JOJ A;  2SAS A;  4FTG A;  1SKT A;  1NYA A;  3BUN B;  2QPT A;  3EKJ A;  2DOQ A;  4N1F A;  2LM5 A;  3TUY B;  1UHI A;  4PE1 A;  2HQW A;  2GGM A;  5AAN A;  4L9M A;  4YBH B;  1KFX S;  1R6P A;  1TNX A;  5F6T A;  1CFD A;  4M2P A;  1AK8 A;  1F4Q A;  1WRK A;  2PRU A;  5D7F A;  3CR4 X;  1DTL A;  1Q80 A;  1WDC B;  2I18 A;  2KYC A;  5CSN A;  1SCV A;  1QLK A;  2BBN A;  1JSA A;  1OQP A;  4PHK A;  3SG5 A;  5J3X A;  3FWC A;  2JQ6 A;  4JQ0 D;  2KGB C;  4MEW A;  4U8D A;  5AEQ A;  3WXA A;  3H4S E;  1S26 D;  3EK8 A;  2KAX A;  3CR2 A;  1KSM A;  2OS8 B;  3JVT C;  3FS7 A;  5JOL A;  3VRR A;  1QV1 A;  2BCX A;  3BQ3 A;  1J1D A;  1IJ5 A;  5I2L A;  4ICB A;  1J7Q A;  2ZN9 A;  1C7W A;  3DD4 A;  4MSP A;  1B7T Y;  1TNW A;  2LLT A;  1WRL A;  2D8N A;  2EC6 B;  1YRU B;  4HRH A;  5FYX A;  3BUM B;  1B1G A;  3HCM A;  2M29 A;  1SR6 C;  1V1F A;  3LLE A;  5CSJ A;  2CTN A;  2JNX A;  1XVJ A;  1KQM B;  2HET A;  1V1G A;  3PSR A;  2JTZ A;  3GK1 A;  1OE9 B;  2Q4U A;  3SG3 A;  1PVA A;  5ER4 X;  1BOD A;  2H2K A;  2K8M B;  4AQI A;  1LXF C;  1NP8 A;  1NX2 A;  1OZS A;  4MZK A;  1TNQ A;  1DT7 B;  1K2H A;  3O78 A;  1XFY O;  2FCD A;  2K2F A;  2KFG A;  3O2P A;  2M97 A;  3SIB A;  1OMR A;  1BU3 A;  1B9A A;  2E30 A;  1EL4 A;  1YX8 A;  3I5H C;  1KFU L;  3K21 A;  1TCO B;  1CM4 A;  4HRG A;  1TRF A;  3DF0 A;  2ZRS A;  2L2E A;  1K9P A;  1QX7 A;  5DKN A;  4M2O A;  1QX2 A;  2MLE C;  1L2O C;  1KK8 C;  3I5F B;  1WLM A;  2K0J A;  4XYN A;  4YGC B;  4QJ3 B;  1CMF A;  1ZMZ A;  2GV5 A;  2PMY A;  1WY9 A;  1PK0 D;  3OB2 B;  3CZT X;  1G33 A;  1S3P A;  1DJH A;  3VGO A;  4MRX A;  1DJG A;  4MLW A;  1LA3 A;  3VRP A;  1FPW A;  2NCP A;  1YUS A;  1ZOT B;  1H8B A;  3D10 A;  3DVJ A;  1KSO A;  1G8I A;  2F2P A;  3DVK A;  2WOS A;  3I5G C;  4A4C A;  1DF0 A;  1EH2 A;  1K9U A;  4GFT A;  1A75 A;  3EK7 A;  1K95 A;  2LMV A;  2MJW B;  4I5L B;  1PRW A;  1IKU A;  1SNL A;  4BY5 A;  3TDU A;  1S5G Y;  4BY4 A;  2JT3 A;  1ZUZ A;  1G4Y R;  3ZNI A;  4P2Y B;  2NZ0 A;  1SL9 A;  4CFQ A;  1D1O A;  2H61 C;  2F8P A;  1HT9 A;  3JVT B;  1KQV A;  2LVJ A;  1S6C A;  4QJ4 B;  3OHM B;  1DF0 B;  4OR9 B;  1UHJ A;  2MHH A;  1OOJ A;  4NDC A;  1UUS A;  2ZNE A;  2JRF A;  5BPJ A;  1HQV A;  2M3W A;  1R2U A;  1YRT B;  3M0W A;  3AKB A;  4ETO A;  1NSH A;  5K89 A;  4HSZ A;  2BE4 A;  3SG7 A;  1FI5 A;  4P5O E;  4R1E A;  4CFR A;  2IS9 A;  3DVE A;  2LCP A;  3EVU A;  2AMI A;  5HLV A;  2L98 A;  1J55 A;  1TTX A;  2JUL A;  2F3Z A;  1BMO A;  2WCE A;  1IQ5 A;  4YGE B;  5JJG A;  2LHI A;  4OKH A;  1EG4 A;  2I2R E;  1WRZ A;  2ZN8 A;  1SW8 A;  2KHN A;  1PVB A;  3EVR A;  2M7L A;  1CB1 A;  1EG3 A;  1W7J B;  4PE4 A;  1K93 D;  1DMO A;  4I5K A;  1NUB A;  2OPO A;  3VRO A;  2MAZ A;  5G08 A;  1KFX L;  1YVL A;  1IJ6 A;  2LUX A;  4MBE A;  4WQ2 A;  4GGN A;  4NDD A;  1Y0V H;  1QS7 A;  1ODB A;  1IH0 A;  5TNC A;  3OX5 A;  3KO0 A;  1GGW A;  4MVF A;  1CKK A;  1KK7 Z;  3SG4 A;  2O60 A;  1KK8 B;  1JBA A;  3LL8 B;  1QAS A;  2FOT A;  5DKR A;  2JT0 A;  4I5N B;  2KI4 C;  1MQ1 A;  2Y5I A;  1F54 A;  2BE6 A;  5HKY A;  1Y1X A;  1JF2 A;  2M7N A;  2MA2 A;  3NSI A;  2H61 A;  1ALV A;  1MWN A;  2EHB A;  2ZND A;  3JTD B;  2LAP A;  2KI6 C;  1FBV A;  2OTG C;  3I5G B;  4ORA B;  4HRE E;  2LP2 A;  1TCF A;  1YX7 A;  1QIW A;  2JPT A;  1BT6 A;  4DS7 A;  2E6W A;  2LAN A;  2Y4Q A;  3KPX A;  1QIV A;  3TDI A;  4C0J A;  1SCM C;  1DJX A;  3PAL A;  1YVH A;  1CFC A;  2KFF A;  1BF5 A;  3A8R A;  1K8U A;  1BOC A;  4YI8 A;  1BR1 B;  2LC5 A;  1K90 D;  2BCA A;  5HKZ A;  2JNF A;  5GQQ C;  1M46 A;  1SBJ A;  4YRU A;  1KWO C;  1MHO A;  5AER A;  4PE0 A;  3RLZ A;  1M39 A;  1DJZ A;  1CLM A;  1B8C A;  3TZ1 A;  1F8H A;  1FW4 A;  3BUX B;  2JWW A;  2SCP A;  1RFJ A; 
#chains in the Genus database with same CATH topology
 2K7O A;  1Y1A A;  1NX1 A;  2K7B A;  2MLF C;  1K96 A;  2WC6 A;  1QVI Z;  2L50 A;  4ZCV A;  1NCY A;  2K61 A;  1M31 A;  1OMV A;  3I5I C;  1FF1 A;  5I2O A;  3WNX B;  2L4H A;  4DUQ A;  2KQY A;  3BOW A;  3IQQ A;  4GGF C;  4PAL A;  1YR5 A;  2I7A A;  1C07 A;  1GGZ A;  1C7V A;  4JWQ A;  2CNP A;  1XFZ O;  3D75 A;  1A4P A;  2WOR A;  2Y1N A;  1NCX A;  1NWD A;  1B8L A;  4I5J A;  1ALW A;  1RK9 A;  3TS5 C;  2F3Y A;  1A29 A;  2KDH A;  3GK2 A;  1BLQ A;  2COL B;  1T14 A;  1NX3 A;  1ZFS A;  1UHK A;  2G9B A;  5IBW A;  4ORB B;  5FI2 A;  5I2Q A;  5HYD A;  1CFF A;  3EK4 A;  4DRW A;  3TUY C;  4FQO A;  1YUT A;  1S6J A;  5CSF A;  2KAY A;  1CDM A;  5KU1 A;  3TDZ A;  3DF0 B;  2O5G A;  1KFU S;  2M8U A;  5B8I B;  1CM1 A;  2TN4 A;  4WRI A;  1WDC C;  2ZKM X;  1IRJ A;  1SMG A;  3EKH A;  3CWG A;  1CLB A;  2KBM A;  4XJK A;  2EGD A;  4OV2 A;  4CLN A;  3DYE A;  2FCE A;  1UHH A;  3BUO B;  1YUU A;  3F45 A;  1SL8 A;  1GJY A;  2LMT A;  1DJW A;  2KI4 B;  2LNK A;  3VRN A;  3NXA A;  1J1E A;  1MR8 A;  1QTX A;  3SG6 A;  1X02 A;  2M49 B;  2B1U A;  2HF5 A;  3D76 A;  4UPG A;  1A75 B;  3N7H A;  1IG5 A;  2CXJ A;  3BYA A;  1F71 A;  3EVV A;  3FWB A;  2JTT A;  1TNP A;  2HPS A;  2LUC A;  1L7Z A;  1XFR A;  2WCJ A;  3SS3 A;  1B4C A;  2PSR A;  4OVN F;  1QV0 A;  1KCY A;  1A2X A;  5KTY A;  1DJY A;  2M0R A;  4MZJ A;  4YGB B;  1SR6 B;  1SCM B;  3NSO A;  1SYM A;  2QDI A;  1IGV A;  2L4I A;  1SK6 D;  3PN7 C;  4C0K A;  2BL0 C;  4GGF A;  1LIN A;  1K9K A;  1S1E A;  3BXK A;  3L47 A;  3S0D A;  5HLO A;  1XFW O;  1S36 A;  1S6I A;  2PAL A;  1IWQ A;  1Y6W A;  3BFA A;  3ICB A;  3IVT A;  1J7O A;  1RTP 1;  3NSK A;  4E68 A;  3PM8 A;  2M1K B;  3S0F A;  1PSB A;  3AAK A;  1CTR A;  1SY9 A;  2CBL A;  1B47 A;  2AUC A;  2PAS A;  2BKI B;  3MSE B;  4N1G A;  4AQJ A;  2FJU B;  1DEL A;  2LHL A;  2WC5 A;  4F0Z B;  1IIO A;  3A4U B;  3QME A;  3I5H B;  4ZCU A;  2QAC A;  4DCK A;  1XK4 C;  1PSR A;  2HQ8 A;  3V2L A;  3UO9 A;  3I5F C;  4GPL B;  1UP5 A;  3WHU B;  2BEC A;  2WC8 A;  3PFV A;  3EG5 B;  4N5X A;  1L2O B;  1OZO A;  1J7R A;  1DVI A;  3AKA A;  4PHN A;  1CMG A;  1KK7 Y;  3VRQ A;  3SJS A;  3KHE A;  1N65 A;  1BJF A;  1TOP A;  3TS5 B;  3SIA A;  2ERB A;  1PAL A;  1MF8 B;  1F70 A;  2M9G A;  4PE7 A;  1XFX O;  5DKQ A;  3DVM A;  1MXL C;  4QJ5 B;  2KI6 D;  2RGI A;  1JF0 A;  3CLN A;  4NDB A;  1LVC D;  1UHN A;  3R1V A;  1CNP A;  1XO5 A;  4GUK A;  1CDN A;  3IF7 A;  2KSP A;  2ZFD A;  1J7P A;  3BFH A;  3CGA A;  3PLF B;  3O4Y A;  1XFV O;  4PHJ A;  1CDL A;  1NX0 A;  2BBM A;  2ZRT A;  5CPV A;  4DIR A;  1RJV A;  5HL1 A;  1LKJ A;  2LVI A;  2LVK A;  2PYQ A;  2K2A A;  1CDP A;  2NXQ A;  1OMD A;  2P70 A;  3HX4 A;  2KLE A;  3R72 A;  1DGU A;  4AOM A;  5I94 A;  2G2B A;  1RRO A;  2I94 A;  3CZ2 A;  3PM2 A;  4NQG A;  3CTN A;  3S0B A;  3GK4 X;  4INW A;  3GOF A;  1NCZ A;  2LV7 A;  1U5I A;  2Y1M A;  1GQM A;  3LCP C;  1AJ4 A;  1BG1 A;  1NPQ A;  1XYD A;  2L5X B;  3FIA A;  1B7T Z;  1RWY A;  1SPY A;  2MRD A;  2R2I A;  3CZ1 A;  2WCK A;  3FE8 A;  4TNC A;  2LE9 B;  1JFJ A;  1YUR A;  5I8N A;  5PAL A;  1PUL A;  1CLL A;  1JUO A;  2NLN A;  1QLS A;  1OSA A;  1K94 A;  1TIZ A;  2JZI A;  4USL A;  3PAT A;  4PDZ A;  1QVI Y;  1LS8 A;  2L2C A;  3SG2 A;  4MZL A;  4MN0 A;  2KOT A;  4C0L A;  1XK4 A;  1DJI A;  1N2D A;  2BKH B;  1YTZ C;  1U5I B;  2JXL A;  3OX6 A;  3PN7 B;  2BL0 B;  1B8R A;  2CT9 A;  2V53 A;  3B88 A;  2JXC A;  3IQO A;  2JU0 A;  1N0Y A;  2LP3 A;  2F2O A;  5DIC A;  3QRX A;  2L51 A;  1H4B A;  4ORC B;  2MBX A;  1NIW A;  3PJI A;  3NSL A;  4PCW A;  1LA0 A;  2NCO A;  2P6B B;  1OOH A;  2Q91 A;  5D69 A;  2GGZ A;  4D1E A;  1SRA A;  4YGD B;  3NGV A;  3BOW B;  1AP4 A;  1SSE B;  1Y1U A;  1QJT A;  3KF9 A;  2QEV A;  2WND A;  4GAO A;  4OCI A;  1JWD A;  2LLU A;  1F4O A;  3D0Y A;  3E3R A;  1DC1 A;  1M45 A;  2LLS A;  1UUR A;  2KAV A;  2OS8 C;  2WCF A;  3RM1 A;  1XA5 A;  2CCM A;  3O4X A;  2QEH A;  3OB1 B;  4GBA A;  3ZWH A;  1MUX A;  3S0A A;  1BR4 B;  4PT1 A;  5ER5 A;  4CPV A;  3K1E A;  4IL1 A;  1MXE A;  1M63 B;  3JTD C;  1FI6 A;  3D78 A;  3O6B A;  3LK0 A;  1QX5 B;  5CSI A;  3C1V A;  2EC6 C;  2ISD A;  3CR5 X;  3CS1 A;  2KBI A;  2VRG A;  1EJ3 A;  4JPZ B;  4Q04 A;  2LMU A;  1AUI B;  3WHT B;  1ZAC A;  2F33 A;  1OOI X;  1TN4 A;  2OTG B;  1VRK A;  2JT8 A;  2KQ6 A;  2QEB A;  1IQ3 A;  1C3Y A;  3BUW B;  1EXR A;  1S5G Z;  4GNK B;  4WQ3 A;  4XJK B;  1KQM C;  1SL7 A;  1WLZ A;  3D0Y B;  2BAP A;  2BCB A;  2KYF A;  2WCB A;  4YI9 A;  4YGA A;  4MRY A;  3KEV A;  4M2Q A;  3D73 A;  2KNE A;  5HKW A;  1W7I B;  2KFH A;  2A4J A;  4PHM A;  5KSZ A;  1DQE A;  1JC2 A;  5AXI A;  1KWO B;  5AFP A;  2LVV A;  2AAO A;  3AAJ A;  3OP0 A;  1E8A A;  1OOG A;  1AVS A;  3OGN A;  1CFP A;  1AJ5 A;  1F55 A;  4CID A;  2JC2 A;  4A4B A;  1A03 A;  1AHR A;  4INX A;  1QXP A;  1XFU O;  3I5I B;  1TWO A;  2M1U A;  2K7C A;  1UWO A;  2L0P A;  2PVB A;  4JD9 A;  2K7D A;  2KGR A;  1JFK A;  2BNX A;  3LK1 A;  1REC A;  1QAT A;  1DGV A;  2JOJ A;  2SAS A;  4FTG A;  1SKT A;  1NYA A;  1C3Z A;  3BUN B;  2H8V A;  2QPT A;  3EKJ A;  2DOQ A;  4N1F A;  2LM5 A;  3TUY B;  1UHI A;  4PE1 A;  2HQW A;  1ORG A;  2GGM A;  5AAN A;  2FJY A;  4L9M A;  4YBH B;  1KFX S;  1R6P A;  1TNX A;  5F6T A;  1CFD A;  4M2P A;  1AK8 A;  1F4Q A;  1WRK A;  2PRU A;  5D7F A;  3CR4 X;  1DTL A;  1Q80 A;  1WDC B;  2I18 A;  2KYC A;  5CSN A;  1SCV A;  1QLK A;  2BBN A;  1JSA A;  1OQP A;  4PHK A;  3SG5 A;  3CYZ A;  3FWC A;  2JQ6 A;  5J3X A;  4JQ0 D;  2KGB C;  4MEW A;  4U8D A;  5AEQ A;  3WXA A;  3H4S E;  1S26 D;  3EK8 A;  2KAX A;  3CR2 A;  3R1P A;  1KSM A;  2OS8 B;  3JVT C;  3FS7 A;  5JOL A;  3VRR A;  1QV1 A;  5EL2 A;  2BCX A;  3B6X A;  3BQ3 A;  1J1D A;  1IJ5 A;  5I2L A;  4ICB A;  3D74 A;  3VB1 A;  1J7Q A;  2ZN9 A;  1C7W A;  2K60 A;  3B86 A;  3DD4 A;  4MSP A;  1B7T Y;  1TNW A;  2LLT A;  1WRL A;  2D8N A;  2EC6 B;  1YRU B;  4HRH A;  5FYX A;  3BUM B;  1B1G A;  3Q8I A;  3HCM A;  2M29 A;  1SR6 C;  1V1F A;  3LLE A;  5CSJ A;  2CTN A;  2JNX A;  1XVJ A;  1TUJ A;  1KQM B;  2HET A;  2KLD A;  1V1G A;  3PSR A;  2JTZ A;  3GK1 A;  1OE9 B;  2Q4U A;  3SG3 A;  1PVA A;  5ER4 X;  1BOD A;  2H2K A;  2K8M B;  4AQI A;  1LXF C;  1NP8 A;  1NX2 A;  1OZS A;  4MZK A;  1TNQ A;  3S0E A;  1DT7 B;  1TUZ A;  3O78 A;  1K2H A;  1XFY O;  2FCD A;  2K2F A;  2KFG A;  3O2P A;  2M97 A;  3SIB A;  1OMR A;  3RZS A;  1BU3 A;  1B9A A;  3BFB A;  2E30 A;  1EL4 A;  4F7F A;  1YX8 A;  3I5H C;  1KFU L;  3K21 A;  1TCO B;  1CM4 A;  4OZD A;  4HRG A;  1TRF A;  3DF0 A;  2ZRS A;  1OOF A;  2L2E A;  1K9P A;  1QX7 A;  5DKN A;  4M2O A;  1QX2 A;  2P71 A;  3B87 A;  2MLE C;  1L2O C;  1KK8 C;  3I5F B;  3SS4 A;  1WLM A;  2K0J A;  4XYN A;  4YGC B;  4QJ3 B;  1CMF A;  1ZMZ A;  2GV5 A;  2PMY A;  1WY9 A;  1PK0 D;  3OB2 B;  3CZT X;  1G33 A;  1S3P A;  1DJH A;  3VGO A;  4MRX A;  1DJG A;  4MLW A;  1LA3 A;  3VRP A;  1FPW A;  2NCP A;  1YUS A;  1ZOT B;  3UNW A;  3D10 A;  1H8B A;  3DVJ A;  1KSO A;  1G8I A;  2F2P A;  3DVK A;  2WOS A;  3I5G C;  4A4C A;  1DF0 A;  1EH2 A;  1K9U A;  4GFT A;  1A75 A;  3EK7 A;  1K95 A;  2LMV A;  2MJW B;  4I5L B;  4JKT A;  1PRW A;  1IKU A;  1SNL A;  1GM0 A;  4BY5 A;  3TDU A;  1S5G Y;  4BY4 A;  5FI7 A;  2JT3 A;  1ZUZ A;  1G4Y R;  3ZNI A;  4P2Y B;  2NZ0 A;  1SL9 A;  4CFQ A;  1D1O A;  2H61 C;  2F8P A;  1HT9 A;  2L5Y A;  3JVT B;  1KQV A;  2LVJ A;  1S6C A;  4QJ4 B;  3OHM B;  1DF0 B;  4OR9 B;  3L4L A;  1UHJ A;  2MHH A;  1OOJ A;  4KYN A;  1UUS A;  2ZNE A;  2JRF A;  4NDC A;  5BPJ A;  1HQV A;  2M3W A;  1R2U A;  1YRT B;  3M0W A;  3AKB A;  4ETO A;  1NSH A;  5K89 A;  4HSZ A;  2BE4 A;  3FE9 A;  5D3O A;  3SG7 A;  1FI5 A;  2PQL A;  4P5O E;  4R1E A;  4CFR A;  3L4A A;  2IS9 A;  1Z4H A;  3DVE A;  3SS5 A;  2LCP A;  3EVU A;  1QWV A;  2AMI A;  4FQT A;  2QEO A;  5HLV A;  2L98 A;  3NHI A;  3CZ0 A;  1J55 A;  1TTX A;  2JUL A;  3S0G A;  2F3Z A;  1BMO A;  3FE6 A;  2WCE A;  1IQ5 A;  4YGE B;  5JJG A;  2LHI A;  2JPO A;  5FI6 A;  1P28 A;  4OKH A;  3DXL A;  1EG4 A;  2GTE A;  1WRZ A;  2I2R E;  1W9Z A;  1SW8 A;  2KHN A;  1PVB A;  2ZN8 A;  3EVR A;  2M7L A;  1CB1 A;  1EG3 A;  1W7J B;  4PE4 A;  3D77 A;  1K93 D;  1DMO A;  4I5K A;  1NUB A;  3DY9 A;  2OPO A;  2WCM A;  3VRO A;  2MAZ A;  5G08 A;  1KFX L;  1YVL A;  1IJ6 A;  2LUX A;  4MBE A;  4WQ2 A;  4GGN A;  4NDD A;  1Y0V H;  1QS7 A;  1ODB A;  1IH0 A;  5TNC A;  3OX5 A;  3KO0 A;  1GGW A;  4MVF A;  1CKK A;  1KK7 Z;  3SG4 A;  2O60 A;  1KK8 B;  1JBA A;  3B7A A;  3LL8 B;  1QAS A;  2FOT A;  5DKR A;  2JT0 A;  4I5N B;  2KI4 C;  1MQ1 A;  2Y5I A;  3CAB A;  3DZT A;  1F54 A;  4IJ7 A;  2BE6 A;  5HKY A;  1Y1X A;  1JF2 A;  2M7N A;  2KPH A;  2MA2 A;  3NSI A;  2H61 A;  1ALV A;  1MWN A;  2EHB A;  1DEK A;  2ZND A;  3JTD B;  2LAP A;  2KI6 C;  1FBV A;  2OTG C;  2WCL A;  3I5G B;  3OBV A;  4HRE E;  4ORA B;  2LP2 A;  1TCF A;  1YX7 A;  1QIW A;  3R1O A;  2JPT A;  3NHT A;  1BT6 A;  4DS7 A;  1OW4 A;  2E6W A;  2LAN A;  2Y4Q A;  3KPX A;  1QIV A;  3TDI A;  4C0J A;  1SCM C;  1DJX A;  3PAL A;  1YVH A;  1CFC A;  2KFF A;  1BF5 A;  3A8R A;  1K8U A;  3CDN A;  4YI8 A;  1BOC A;  1BR1 B;  2LC5 A;  1K90 D;  2BCA A;  5HKZ A;  2JNF A;  5GQQ C;  1M46 A;  2WCH A;  1SBJ A;  4YRU A;  1KWO C;  1MHO A;  5AER A;  4PE0 A;  1Z2C B;  1M39 A;  3RLZ A;  1DJZ A;  1CLM A;  1B8C A;  3BJH A;  3TZ1 A;  1F8H A;  1FW4 A;  3BUX B;  2YGU A;  2JWW A;  2SCP A;  1RFJ A; 
#chains in the Genus database with same CATH homology
 2K7O A;  1Y1A A;  1NX1 A;  2K7B A;  2MLF C;  1K96 A;  1QVI Z;  2L50 A;  4ZCV A;  1NCY A;  2K61 A;  1M31 A;  1OMV A;  3I5I C;  1FF1 A;  5I2O A;  3WNX B;  2L4H A;  4DUQ A;  2KQY A;  3BOW A;  3IQQ A;  4GGF C;  4PAL A;  1YR5 A;  2I7A A;  1C07 A;  1GGZ A;  1C7V A;  4JWQ A;  2CNP A;  1XFZ O;  1A4P A;  2WOR A;  2Y1N A;  1NCX A;  1NWD A;  1B8L A;  4I5J A;  1ALW A;  1RK9 A;  3TS5 C;  2F3Y A;  1A29 A;  2KDH A;  3GK2 A;  1BLQ A;  2COL B;  1NX3 A;  1ZFS A;  1UHK A;  2G9B A;  5IBW A;  4ORB B;  1CFF A;  5I2Q A;  5HYD A;  3EK4 A;  4DRW A;  3TUY C;  4FQO A;  1YUT A;  1S6J A;  5CSF A;  2KAY A;  1CDM A;  5KU1 A;  3TDZ A;  3DF0 B;  2O5G A;  1KFU S;  2M8U A;  5B8I B;  1CM1 A;  2TN4 A;  4WRI A;  1WDC C;  2ZKM X;  1IRJ A;  1SMG A;  3EKH A;  3CWG A;  1CLB A;  2KBM A;  4XJK A;  2EGD A;  4OV2 A;  4CLN A;  2FCE A;  1UHH A;  3BUO B;  1YUU A;  3F45 A;  1SL8 A;  1GJY A;  2LMT A;  1DJW A;  2KI4 B;  2LNK A;  3VRN A;  3NXA A;  1J1E A;  1MR8 A;  1QTX A;  3SG6 A;  1X02 A;  2M49 B;  2B1U A;  2HF5 A;  4UPG A;  1A75 B;  1IG5 A;  2CXJ A;  3BYA A;  1F71 A;  3EVV A;  3FWB A;  2JTT A;  1TNP A;  2HPS A;  2LUC A;  1L7Z A;  1B4C A;  2PSR A;  4OVN F;  1QV0 A;  1KCY A;  1A2X A;  5KTY A;  1DJY A;  2M0R A;  4MZJ A;  4YGB B;  1SR6 B;  1SCM B;  3NSO A;  1SYM A;  1IGV A;  2L4I A;  1SK6 D;  3PN7 C;  4C0K A;  2BL0 C;  4GGF A;  1LIN A;  1K9K A;  1S1E A;  3BXK A;  5HLO A;  1XFW O;  1S36 A;  1S6I A;  2PAL A;  1IWQ A;  1Y6W A;  3ICB A;  1J7O A;  1RTP 1;  3NSK A;  4E68 A;  3PM8 A;  2M1K B;  1PSB A;  3AAK A;  1CTR A;  1SY9 A;  2CBL A;  1B47 A;  2AUC A;  2PAS A;  2BKI B;  3MSE B;  4N1G A;  4AQJ A;  2FJU B;  4F0Z B;  2LHL A;  3A4U B;  3I5H B;  4ZCU A;  2QAC A;  4DCK A;  1XK4 C;  1PSR A;  2HQ8 A;  3I5F C;  4GPL B;  1UP5 A;  3WHU B;  2BEC A;  2WC8 A;  3PFV A;  4N5X A;  1L2O B;  1OZO A;  1J7R A;  1DVI A;  3AKA A;  4PHN A;  1CMG A;  1KK7 Y;  3VRQ A;  3SJS A;  3KHE A;  1N65 A;  1BJF A;  1TOP A;  3TS5 B;  3SIA A;  1PAL A;  1MF8 B;  1F70 A;  2M9G A;  4PE7 A;  1XFX O;  5DKQ A;  3DVM A;  1MXL C;  4QJ5 B;  2KI6 D;  2RGI A;  1JF0 A;  3CLN A;  4NDB A;  1LVC D;  1UHN A;  1CNP A;  1XO5 A;  4GUK A;  1CDN A;  3IF7 A;  2KSP A;  2ZFD A;  1J7P A;  3CGA A;  3PLF B;  3O4Y A;  1XFV O;  4PHJ A;  1CDL A;  1NX0 A;  2BBM A;  2ZRT A;  5CPV A;  4DIR A;  1RJV A;  1LKJ A;  2LVI A;  2LVK A;  2K2A A;  1CDP A;  2NXQ A;  1OMD A;  3HX4 A;  4AOM A;  1DGU A;  2G2B A;  1RRO A;  2I94 A;  4NQG A;  3CTN A;  3GK4 X;  3GOF A;  1NCZ A;  2LV7 A;  1U5I A;  2Y1M A;  1GQM A;  3LCP C;  1AJ4 A;  1BG1 A;  1NPQ A;  1XYD A;  2L5X B;  3FIA A;  1B7T Z;  1RWY A;  1SPY A;  2MRD A;  2R2I A;  4TNC A;  2LE9 B;  1JFJ A;  1YUR A;  5I8N A;  5PAL A;  1PUL A;  1CLL A;  1JUO A;  2NLN A;  1QLS A;  1OSA A;  1K94 A;  1TIZ A;  2JZI A;  4USL A;  3PAT A;  4PDZ A;  1QVI Y;  3SG2 A;  4MZL A;  4MN0 A;  2KOT A;  4C0L A;  1XK4 A;  1DJI A;  1N2D A;  2BKH B;  1YTZ C;  1U5I B;  2JXL A;  3OX6 A;  3PN7 B;  2BL0 B;  1B8R A;  2CT9 A;  2V53 A;  2JXC A;  3IQO A;  2JU0 A;  1N0Y A;  2LP3 A;  2F2O A;  3QRX A;  2L51 A;  1H4B A;  4ORC B;  2MBX A;  1NIW A;  3NSL A;  4PCW A;  1LA0 A;  2NCO A;  2P6B B;  2Q91 A;  5D69 A;  2GGZ A;  4D1E A;  1SRA A;  4YGD B;  3BOW B;  1AP4 A;  1Y1U A;  1QJT A;  3KF9 A;  2WND A;  4GAO A;  4OCI A;  1JWD A;  2LLU A;  1F4O A;  3D0Y A;  3E3R A;  1M45 A;  2LLS A;  1UUR A;  2KAV A;  2OS8 C;  2WCF A;  3RM1 A;  1XA5 A;  2CCM A;  3OB1 B;  3ZWH A;  4GBA A;  1MUX A;  1BR4 B;  5ER5 A;  4CPV A;  4IL1 A;  1MXE A;  1M63 B;  3JTD C;  1FI6 A;  3O6B A;  3LK0 A;  1QX5 B;  5CSI A;  3C1V A;  2EC6 C;  2ISD A;  3CR5 X;  3CS1 A;  2KBI A;  2VRG A;  1EJ3 A;  4JPZ B;  4Q04 A;  2LMU A;  1AUI B;  3WHT B;  1ZAC A;  2F33 A;  1TN4 A;  2OTG B;  1IQ3 A;  1VRK A;  2JT8 A;  2KQ6 A;  3BUW B;  1EXR A;  1S5G Z;  4GNK B;  4WQ3 A;  4XJK B;  1KQM C;  1SL7 A;  1WLZ A;  3D0Y B;  2BCB A;  2KYF A;  2WCB A;  4YI9 A;  4YGA A;  4MRY A;  3KEV A;  4M2Q A;  5HKW A;  2KNE A;  1W7I B;  2KFH A;  2A4J A;  4PHM A;  5KSZ A;  1JC2 A;  5AXI A;  1KWO B;  5AFP A;  2LVV A;  2AAO A;  3AAJ A;  3OP0 A;  1E8A A;  1AVS A;  1CFP A;  1AJ5 A;  1F55 A;  4CID A;  2JC2 A;  4A4B A;  1A03 A;  1AHR A;  1QXP A;  1XFU O;  3I5I B;  2M1U A;  2K7C A;  1UWO A;  2L0P A;  2PVB A;  2K7D A;  2KGR A;  1JFK A;  3LK1 A;  1REC A;  1QAT A;  1DGV A;  2JOJ A;  2SAS A;  4FTG A;  1SKT A;  1NYA A;  3BUN B;  2QPT A;  3EKJ A;  2DOQ A;  4N1F A;  2LM5 A;  3TUY B;  1UHI A;  4PE1 A;  2HQW A;  2GGM A;  5AAN A;  4L9M A;  4YBH B;  1KFX S;  1R6P A;  1TNX A;  5F6T A;  1CFD A;  4M2P A;  1AK8 A;  1F4Q A;  1WRK A;  2PRU A;  5D7F A;  3CR4 X;  1DTL A;  1Q80 A;  1WDC B;  2I18 A;  2KYC A;  5CSN A;  1SCV A;  1QLK A;  2BBN A;  1JSA A;  1OQP A;  4PHK A;  3SG5 A;  5J3X A;  3FWC A;  2JQ6 A;  4JQ0 D;  2KGB C;  4MEW A;  4U8D A;  5AEQ A;  3WXA A;  3H4S E;  1S26 D;  3EK8 A;  2KAX A;  3CR2 A;  1KSM A;  2OS8 B;  3JVT C;  3FS7 A;  5JOL A;  3VRR A;  1QV1 A;  2BCX A;  3BQ3 A;  1J1D A;  1IJ5 A;  5I2L A;  4ICB A;  1J7Q A;  2ZN9 A;  1C7W A;  3DD4 A;  4MSP A;  1B7T Y;  1TNW A;  2LLT A;  1WRL A;  2D8N A;  2EC6 B;  1YRU B;  4HRH A;  5FYX A;  3BUM B;  1B1G A;  3HCM A;  2M29 A;  1SR6 C;  1V1F A;  3LLE A;  5CSJ A;  2CTN A;  2JNX A;  1XVJ A;  1KQM B;  2HET A;  1V1G A;  3PSR A;  2JTZ A;  3GK1 A;  1OE9 B;  2Q4U A;  3SG3 A;  1PVA A;  5ER4 X;  1BOD A;  2H2K A;  2K8M B;  4AQI A;  1LXF C;  1NP8 A;  1NX2 A;  1OZS A;  4MZK A;  1TNQ A;  1DT7 B;  1K2H A;  3O78 A;  1XFY O;  2FCD A;  2K2F A;  2KFG A;  3O2P A;  2M97 A;  3SIB A;  1OMR A;  1BU3 A;  1B9A A;  2E30 A;  1EL4 A;  1YX8 A;  3I5H C;  1KFU L;  3K21 A;  1TCO B;  1CM4 A;  4HRG A;  1TRF A;  3DF0 A;  2ZRS A;  2L2E A;  1K9P A;  1QX7 A;  5DKN A;  4M2O A;  1QX2 A;  2MLE C;  1L2O C;  1KK8 C;  3I5F B;  1WLM A;  2K0J A;  4XYN A;  4YGC B;  4QJ3 B;  1CMF A;  1ZMZ A;  2GV5 A;  2PMY A;  1WY9 A;  1PK0 D;  3OB2 B;  3CZT X;  1G33 A;  1S3P A;  1DJH A;  3VGO A;  4MRX A;  1DJG A;  4MLW A;  1LA3 A;  3VRP A;  1FPW A;  2NCP A;  1YUS A;  1ZOT B;  1H8B A;  3D10 A;  3DVJ A;  1KSO A;  1G8I A;  2F2P A;  3DVK A;  2WOS A;  3I5G C;  4A4C A;  1DF0 A;  1EH2 A;  1K9U A;  4GFT A;  1A75 A;  3EK7 A;  1K95 A;  2LMV A;  2MJW B;  4I5L B;  1PRW A;  1IKU A;  1SNL A;  4BY5 A;  3TDU A;  1S5G Y;  4BY4 A;  2JT3 A;  1ZUZ A;  1G4Y R;  3ZNI A;  4P2Y B;  2NZ0 A;  1SL9 A;  4CFQ A;  1D1O A;  2H61 C;  2F8P A;  1HT9 A;  3JVT B;  1KQV A;  2LVJ A;  1S6C A;  4QJ4 B;  3OHM B;  1DF0 B;  4OR9 B;  1UHJ A;  2MHH A;  1OOJ A;  4NDC A;  1UUS A;  2ZNE A;  2JRF A;  5BPJ A;  1HQV A;  2M3W A;  1R2U A;  1YRT B;  3M0W A;  3AKB A;  4ETO A;  1NSH A;  5K89 A;  4HSZ A;  2BE4 A;  3SG7 A;  1FI5 A;  4P5O E;  4R1E A;  4CFR A;  2IS9 A;  3DVE A;  2LCP A;  3EVU A;  2AMI A;  5HLV A;  2L98 A;  1J55 A;  1TTX A;  2JUL A;  2F3Z A;  1BMO A;  2WCE A;  1IQ5 A;  4YGE B;  5JJG A;  2LHI A;  4OKH A;  1EG4 A;  2I2R E;  1WRZ A;  2ZN8 A;  1SW8 A;  2KHN A;  1PVB A;  3EVR A;  2M7L A;  1CB1 A;  1EG3 A;  1W7J B;  4PE4 A;  1K93 D;  1DMO A;  4I5K A;  1NUB A;  2OPO A;  3VRO A;  2MAZ A;  5G08 A;  1KFX L;  1YVL A;  1IJ6 A;  2LUX A;  4MBE A;  4WQ2 A;  4GGN A;  4NDD A;  1Y0V H;  1QS7 A;  1ODB A;  1IH0 A;  5TNC A;  3OX5 A;  3KO0 A;  1GGW A;  4MVF A;  1CKK A;  1KK7 Z;  3SG4 A;  2O60 A;  1KK8 B;  1JBA A;  3LL8 B;  1QAS A;  2FOT A;  5DKR A;  2JT0 A;  4I5N B;  2KI4 C;  1MQ1 A;  2Y5I A;  1F54 A;  2BE6 A;  5HKY A;  1Y1X A;  1JF2 A;  2M7N A;  2MA2 A;  3NSI A;  2H61 A;  1ALV A;  1MWN A;  2EHB A;  2ZND A;  3JTD B;  2LAP A;  2KI6 C;  1FBV A;  2OTG C;  3I5G B;  4ORA B;  4HRE E;  2LP2 A;  1TCF A;  1YX7 A;  1QIW A;  2JPT A;  1BT6 A;  4DS7 A;  2E6W A;  2LAN A;  2Y4Q A;  3KPX A;  1QIV A;  3TDI A;  4C0J A;  1SCM C;  1DJX A;  3PAL A;  1YVH A;  1CFC A;  2KFF A;  1BF5 A;  3A8R A;  1K8U A;  1BOC A;  4YI8 A;  1BR1 B;  2LC5 A;  1K90 D;  2BCA A;  5HKZ A;  2JNF A;  5GQQ C;  1M46 A;  1SBJ A;  4YRU A;  1KWO C;  1MHO A;  5AER A;  4PE0 A;  3RLZ A;  1M39 A;  1DJZ A;  1CLM A;  1B8C A;  3TZ1 A;  1F8H A;  1FW4 A;  3BUX B;  2JWW A;  2SCP A;  1RFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...