3BYAA

Structure of a calmodulin complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
137
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMASEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Calmodulin Complex
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Calmodulin
total genus 48
structure length 137
sequence length 144
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3byaA00
1KQMC 2RGIA 2KYCA 2AMIA 3AAKA 3SG7A 2I2RE 2JOJA 1PSBA 3M0WA 3SIAA 1DTLA 4QJ3B 1SR6B 1NP8A 3EKJA 3GK1A 1DT7B 2FCEA 3MSEB 1IKUA 5AERA 1XK4A 2JXCA 1XK4C 2M7NA 1OZSA 2NZ0A 2R2IA 1J7RA 1XFVO 2M1KB 3BUWB 1BT6A 1QS7A 3CS1A 4PE0A 1CM4A 2ZKMX 1GJYA 2M3WA 1S26D 1FF1A 3K21A 1AP4A 1TOPA 5HKYA 3DVKA 2O60A 2WCBA 3KEVA 1BR4B 2QPTA 1KFXL 1UP5A 3LK0A 3TDZA 2KYFA 1M31A 2HPSA 2K7OA 2PMYA 3BOWA 2I94A 4MRYA 2OS8C 2DOQA 2JTZA 2OTGB 3I5GB 3O4YA 5DKRA 1J1DA 1HT9A 2KFGA 1NUBA 3EVUA 2NXQA 1SBJA 1WRZA 4PDZA 3F45A 1Y1UA 1TIZA 1YX7A 2ZN8A 2LP3A 1ZUZA 1MQ1A 1YVLA 2ZN9A 1OQPA 1SPYA 1K9UA 1DJIA 2Q91A 4GAOA 4DUQA 1BU3A 2OPOA 4ORBB 3CZTX 2BCAA 2FOTA 2LNKA 2LMVA 1NIWA 1XVJA 2E6WA 3FIAA 5AXIA 3WHUB 5KU1A 4NDDA 1DJWA 2JNXA 2WC8A 1KFXS 1QATA 1BJFA 1CNPA 3GOFA 1W7JB 2JWWA 1MXLC 1SRAA 2EC6B 1KK7Y 1OZOA 1G4YR 4AQJA 1Y6WA 1F8HA 4PHMA 2SASA 2M97A 1AHRA 2JULA 4PE7A 2L98A 2ZRSA 2PALA 1OMRA 2WNDA 1OE9B 3KHEA 4P5OE 4WQ3A 1J1EA 3CR5X 1DJYA 1CDPA 2LP2A 2NCOA 2M7LA 1J7QA 2KHNA 2JU0A 4I5LB 5J3XA 4FQOA 1F4OA 1ZMZA 4UPGA 2L50A 1KCYA 1PULA 2L2EA 1DF0A 3JVTC 1IQ3A 5HYDA 1PVBA 3BOWB 3OX5A 4IL1A 1CFPA 1N2DA 4GNKB 4YGAA 1ALVA 1XO5A 4MBEA 5F6TA 3KO0A 3GK4X 1C7WA 1U5IB 3DVMA 1KK7Z 4GFTA 3BUMB 1CLLA 1TCFA 3HCMA 3SIBA 1DF0B 1QV1A 1DJHA 4U8DA 1V1GA 2WCFA 4PALA 4GGFA 2KSPA 3FS7A 3SJSA 4CFRA 2KBIA 2LV7A 3ICBA 2JC2A 4P2YB 1F55A 1PK0D 1M46A 2I18A 2BL0B 1B7TZ 3D10A 3RM1A 1F54A 1UHHA 5CSFA 4XYNA 2KOTA 3KF9A 2H2KA 4AQIA 1TNQA 4GPLB 2CTNA 3SG6A 1TNWA 1QTXA 1SL7A 3SG3A 3DD4A 3O2PA 3I5IC 1K2HA 4CIDA 2KFFA 2BL0C 1A75A 5GQQC 5CSJA 3QRXA 4WRIA 2BBNA 2L4IA 4A4CA 4GUKA 4MZLA 2F3ZA 2JPTA 4ZCUA 3WHTB 2LUCA 2G2BA 1TTXA 2M29A 3I5GC 1FI5A 1TCOB 4M2QA 3TS5B 2G9BA 2AAOA 2SCPA 1LA0A 1SNLA 4PHNA 5KSZA 2MRDA 2E30A 4YI9A 2LHIA 4C0KA 2FCDA 3DF0A 1EH2A 2K7BA 5ER4X 1LKJA 5D7FA 1CFCA 4D1EA 2BCBA 1WRKA 4L9MA 4OVNF 5G08A 3EK4A 1YUUA 2LE9B 1A29A 1XFUO 1MR8A 5I2LA 1UURA 1Y1AA 4MEWA 4MLWA 1UHNA 2ZFDA 1BG1A 1IWQA 4N5XA 1UHIA 2ZRTA 1CM1A 1J7PA 3TUYC 1K95A 1CDMA 1Q80A 1QVIZ 1UHKA 1XFYO 1YURA 1QLKA 2OTGC 4XJKB 1E8AA 2BKHB 4YBHB 1DJXA 2GV5A 1ZACA 1QJTA 4I5JA 5CSNA 1UWOA 5IBWA 4ZCVA 1TNPA 1R2UA 1QX7A 5DKQA 1L7ZA 1ZOTB 2WCEA 1IJ5A 2LUXA 2ZNEA 3CLNA 3OB2B 4BY4A 2F33A 1S6IA 3KPXA 5AEQA 2BE4A 1WLZA 4A4BA 4TNCA 1SL9A 1IRJA 3OHMB 1CTRA 1K9PA 2WOSA 3JVTB 1DJZA 4OR9B 1NX0A 2I7AA 4PHKA 3PFVA 1AK8A 1LVCD 1CMFA 4ORCB 1DGUA 3A4UB 1OMDA 1K93D 1YTZC 3O78A 4MZKA 5D69A 2KNEA 4JQ0D 2KAXA 2MAZA 1EG3A 2LVKA 1CLBA 1RFJA 2JT3A 1B8LA 2LVVA 1QXPA 4HSZA 1RK9A 5CPVA 1J55A 5I2OA 1D1OA 3BUXB 2LLTA 1BODA 5BPJA 3CTNA 4JWQA 1KWOC 1U5IA 2Y1NA 1K90D 1SY9A 1A4PA 4GGFC 1M39A 2O5GA 2MA2A 1QASA 4JPZB 2JT8A 1UUSA 1F4QA 2LHLA 3OP0A 4NQGA 2PASA 4YGEB 4QJ4B 1KFUL 2LMUA 1QV0A 1YR5A 4ORAB 1RTP1 5AFPA 1LXFC 1KWOB 2V53A 2L4HA 1CDNA 1J7OA 3CGAA 3AAJA 4PE4A 2M8UA 3FWCA 4WQ2A 2P6BB 5JOLA 1WLMA 2HF5A 1QX5B 2LC5A 1H8BA 1B9AA 1MF8B 2HQWA 3D0YB 4CFQA 2BKIB 3BUNB 1LINA 1MHOA 1EXRA 1SK6D 3BQ3A 3DF0B 3JTDC 1CMGA 1B47A 4YRUA 1KK8B 4OCIA 2LVJA 4ETOA 1JUOA 1SCMB 1NX2A 2PRUA 3IQQA 5FYXA 1WDCC 1S6CA 1KQMB 5I8NA 2KI6D 5ER5A 1YVHA 4C0JA 1ODBA 2BBMA 1LA3A 4I5NB 2HQ8A 5JJGA 1MUXA 1NWDA 1WRLA 4GBAA 3BXKA 2KI6C 3IQOA 1TNXA 4USLA 2CCMA 2KGBC 2ZNDA 4GGNA 3EK7A 1IH0A 1K96A 4XJKA 4C0LA 1CKKA 2LLSA 1Y0VH 4N1GA 1RJVA 4YGCB 5I2QA 1PVAA 1YUSA 1JFJA 1B7TY 4M2OA 1QX2A 2KAYA 1YX8A 1IQ5A 4MN0A 3EVRA 2EHBA 1B8CA 1M45A 2A4JA 2L51A 2L5XB 5DKNA 1KSMA 1SMGA 1FW4A 3D0YA 1TRFA 2F3YA 2OS8B 1OSAA 2F8PA 4R1EA 3I5HC 3NSKA 1CFFA 5HLOA 2MLFC 3PN7C 4NDBA 1Y1XA 2KI4C 2GGMA 3BYAA 2K8MB 3IF7A 4PHJA 3TDUA 1S6JA 1SKTA 2CNPA 1B8RA 1S3PA 1WY9A 1ZFSA 5HKZA 1NCXA 2MBXA 1SL8A 1NX1A 2B1UA 1C7VA 1KQVA 3PN7B 1CDLA 1DJGA 1XA5A 4BY5A 3VROA 1JWDA 1B1GA 1K94A 1VRKA 1KFUS 1N0YA 2JZIA 2MJWB 4YGDB 3OX6A 1BR1B 3PM8A 3VRPA 2KAVA 3TDIA 1DVIA 1A2XA 2K61A 2VRGA 5HKWA 4HREE 3GK2A 3H4SE 2Q4UA 1QLSA 3WNXB 4NDCA 3CR4X 5PALA 1QVIY 4HRGA 3BUOB 4OV2A 3A8RA 4AOMA 2L0PA 2LAPA 2LLUA 1AJ5A 4Q04A 1K8UA 1G8IA 1KSOA 1IJ6A 2HETA 2LANA 2Y1MA 4HRHA 1JC2A 4CPVA 2PVBA 1JF2A 1EL4A 1SR6C 1XFZO 1FI6A 2JQ6A 4YI8A 4M2PA 1CLMA 2COLB 1EG4A 3CR2A 1AUIB 1SW8A 2MLEC 2BECA 3VRNA 1BLQA 1CB1A 2CXJA 1OMVA 1WDCB 2K2FA 2K7DA 3SG2A 3I5FC 1X02A 1DMOA 2H61C 1M63B 1W7IB 3LL8B 3ZWHA 1GQMA 4ICBA 3SG5A 3OB1B 3EKHA 2KGRA 3EVVA 4PE1A 3O6BA 1YUTA 2JTTA 3I5FB 1RWYA 2M0RA 3PLFB 1MXEA 1PRWA 2JXLA 4DRWA 2AUCA 2H61A 1AJ4A 1XFXO 2M1UA 3I5IB 1S1EA 2KQ6A 2QACA 1AVSA 1ALWA 2F2OA 2CBLA 1C07A 1XYDA 2CT9A 1NYAA 3LCPC 5AANA 3RLZA 2FJUB 3LK1A 1TN4A 1PSRA 3NXAA 1BOCA 1NX3A 3NSOA 3TS5C 2JT0A 1XFWO 2WORA 1F70A 1SCVA 2KI4B 3E3RA 1IGVA 2F2PA 2KFHA 2TN4A 3LLEA 1FBVA 1JSAA 1L2OC 4I5KA 1S5GY 4PCWA 1YRTB 2NLNA 3VRRA 1IG5A 1NCZA 2K2AA 1BMOA 2KDHA 1NSHA 1GGWA 2K7CA 3NSIA 1S36A 1MWNA 4YGBB 3SG4A 3VGOA 3FWBA 1R6PA 3TUYB 1L2OB 2LMTA 2KQYA 2Y4QA 2BE6A 1GGZA 3CWGA 2JRFA 2Y5IA 3I5HB 2M9GA 1NPQA 2PSRA 4MRXA 4MZJA 4DCKA 4DIRA 1A75B 2IS9A 2NCPA 1HQVA 5KTYA 4MSPA 1RECA 3VRQA 1RROA 2K0JA 3NSLA 5B8IB 5HLVA 5K89A 1B4CA 1K9KA 1JF0A 5TNCA 1A03A 2D8NA 2LVIA 2EC6C 3PATA 2M49B 1S5GZ 3EK8A 3HX4A 1BF5A 2JNFA 1OOJA 2BCXA 2EGDA 2LCPA 1CFDA 1QIWA 4CLNA 3AKAA 1JBAA 2GGZA 4FTGA 4E68A 1QIVA 3WXAA 3AKBA 1V1FA 1YRUB 4OKHA 3ZNIA 4MVFA 4QJ5B 4DS7A 1FPWA 4F0ZB 1NCYA 1N65A 2LM5A 2MHHA 1SYMA 3DVEA 1EJ3A 1H4BA 3PSRA 1F71A 4N1FA 3C1VA 3DVJA 1JFKA 3JTDB 1DGVA 1PALA 1KK8C 1UHJA 3TZ1A 1SCMC 2KBMA 5CSIA 2ISDA 3PALA 1G33A
chains in the Genus database with same CATH superfamily
1KQMC 2RGIA 2KYCA 2AMIA 3AAKA 3SG7A 2I2RE 2JOJA 1PSBA 3M0WA 3SIAA 1DTLA 4QJ3B 1SR6B 1NP8A 3EKJA 3GK1A 1DT7B 2FCEA 3MSEB 1IKUA 1XFRA 5AERA 1XK4A 2QEVA 2JXCA 1XK4C 2M7NA 1OZSA 2NZ0A 2R2IA 3BFAA 1J7RA 1XFVO 2M1KB 3BUWB 1BT6A 1QS7A 3CS1A 4PE0A 1CM4A 3DZTA 2ZKMX 1GJYA 2M3WA 3R1OA 1S26D 1FF1A 3K21A 1AP4A 1TOPA 3B6XA 5HKYA 3DVKA 2O60A 2WCBA 3KEVA 1BR4B 2QPTA 1KFXL 1UP5A 3LK0A 3NGVA 3S0GA 3TDZA 3V2LA 2KYFA 1M31A 2HPSA 2K7OA 2PMYA 3BOWA 2I94A 4MRYA 2OS8C 2DOQA 2JTZA 2OTGB 3I5GB 3O4YA 5DKRA 3SS4A 1J1DA 1HT9A 2KFGA 1NUBA 3EVUA 2NXQA 1SBJA 1WRZA 4PDZA 2KLDA 2ERBA 3F45A 3B86A 1Y1UA 1TIZA 1IIOA 1YX7A 2ZN8A 3CYZA 2LP3A 1ZUZA 1MQ1A 1YVLA 2ZN9A 1OQPA 1SPYA 1K9UA 1DJIA 2Q91A 4GAOA 4DUQA 1BU3A 2OPOA 4ORBB 3CZTX 1OW4A 2BCAA 2FOTA 2LNKA 2LMVA 3SS3A 1NIWA 1XVJA 2E6WA 3FIAA 5AXIA 3WHUB 5KU1A 4NDDA 1DJWA 2H8VA 2JNXA 1KFXS 1QATA 1BJFA 2WC8A 3GOFA 1T14A 1CNPA 1W7JB 2JWWA 1MXLC 1SRAA 1OOGA 2EC6B 1KK7Y 1OZOA 3S0EA 1G4YR 4AQJA 1Y6WA 1F8HA 1OOHA 4PHMA 2SASA 2M97A 1AHRA 2JULA 4PE7A 2L98A 3BFHA 2ZRSA 2PALA 1OMRA 2WNDA 1OE9B 3D74A 3KHEA 4P5OE 4WQ3A 1J1EA 3CR5X 1DJYA 1CDPA 2LP2A 2KPHA 2NCOA 2M7LA 1J7QA 2KHNA 2JU0A 4I5LB 5J3XA 4FQOA 1F4OA 1ZMZA 4UPGA 2L50A 1KCYA 1DEKA 1PULA 2L2EA 1DF0A 3JVTC 1IQ3A 5HYDA 1PVBA 3BOWB 3OX5A 1C3ZA 4IL1A 1CFPA 1N2DA 4GNKB 1QWVA 4YGAA 1ALVA 1XO5A 2JPOA 4MBEA 3KO0A 3GK4X 1C7WA 5F6TA 1U5IB 3DVMA 1KK7Z 4GFTA 3BUMB 1CLLA 1TCFA 3HCMA 3SIBA 3S0AA 1DF0B 1QV1A 1DJHA 4U8DA 1V1GA 2WCFA 4PALA 2WC5A 2KSPA 3FS7A 4GGFA 3SJSA 2KBIA 4CFRA 2LV7A 3ICBA 2JC2A 4P2YB 3BJHA 1F55A 1PK0D 1M46A 2I18A 2BL0B 1B7TZ 3D10A 3PJIA 3RM1A 1F54A 1DELA 1UHHA 5CSFA 4XYNA 2KOTA 3KF9A 2H2KA 5FI2A 1TNQA 3R1VA 4AQIA 4GPLB 2CTNA 3SG6A 1TNWA 1QTXA 1SL7A 3SG3A 3DD4A 3O2PA 3I5IC 1C3YA 1K2HA 4CIDA 2KFFA 2BL0C 1A75A 5GQQC 5CSJA 3QRXA 4WRIA 2BBNA 2L4IA 3DY9A 4A4CA 4GUKA 4MZLA 1W9ZA 2F3ZA 2JPTA 4ZCUA 3WHTB 3Q8IA 2LUCA 2G2BA 1TTXA 2M29A 3I5GC 2PYQA 1FI5A 1TCOB 4M2QA 3TS5B 2G9BA 2AAOA 2SCPA 1LA0A 2QDIA 1SNLA 4PHNA 5KSZA 2MRDA 2E30A 2QEBA 4YI9A 2LHIA 4C0KA 2FCDA 3DF0A 1EH2A 2K7BA 5ER4X 1LKJA 2GTEA 3R1PA 5D7FA 4D1EA 1CFCA 2BCBA 1WRKA 3S0BA 4L9MA 4OVNF 5G08A 3EK4A 1YUUA 2LE9B 3S0FA 1A29A 1XFUO 1MR8A 5I2LA 1UURA 1Y1AA 4MEWA 4F7FA 4MLWA 1UHNA 2ZFDA 1BG1A 1IWQA 4N5XA 1UHIA 3EG5B 2ZRTA 1CM1A 1J7PA 3TUYC 1K95A 1CDMA 1Q80A 1QVIZ 1UHKA 1XFYO 1YURA 1QLKA 2OTGC 4XJKB 3B87A 1E8AA 2BKHB 4YBHB 1DJXA 2GV5A 1ZACA 1QJTA 4I5JA 5CSNA 1UWOA 5IBWA 4ZCVA 1TNPA 1R2UA 1QX7A 5DKQA 1L7ZA 2FJYA 1ZOTB 2WCEA 1IJ5A 1OOFA 2LUXA 2ZNEA 3CLNA 3OB2B 4BY4A 2F33A 3N7HA 3D73A 1S6IA 3IVTA 3KPXA 5AEQA 4OZDA 2BE4A 1WLZA 4A4BA 2BAPA 4TNCA 1SL9A 1IRJA 3OHMB 1CTRA 1K9PA 2WOSA 3JVTB 1DJZA 4OR9B 2L2CA 1NX0A 2I7AA 4PHKA 3PFVA 1AK8A 1LVCD 1CMFA 4ORCB 1DGUA 2P71A 3A4UB 1OMDA 1K93D 3R72A 1YTZC 3O78A 4MZKA 5D69A 2KNEA 4JQ0D 2KAXA 2MAZA 3D77A 1EG3A 2LVKA 1CLBA 1RFJA 2JT3A 1B8LA 2LVVA 1P28A 1QXPA 1RK9A 4HSZA 1J55A 4INXA 5CPVA 5I2OA 1D1OA 3BUXB 2LLTA 1BODA 5BPJA 2WCKA 3CTNA 4JWQA 1KWOC 1U5IA 2Y1NA 1K90D 1SY9A 3D75A 1A4PA 4GGFC 1M39A 2O5GA 4JKTA 4FQTA 3UO9A 2MA2A 3L4AA 1QASA 3FE8A 4JPZB 2JT8A 1UUSA 1F4QA 2LHLA 3OP0A 4NQGA 3SS5A 2PASA 4YGEB 4QJ4B 3K1EA 1KFUL 2LMUA 1QV0A 1YR5A 4ORAB 1RTP1 5AFPA 1LXFC 1KWOB 2V53A 2L4HA 2KLEA 1CDNA 1J7OA 3CGAA 3AAJA 4PE4A 2M8UA 3FWCA 4WQ2A 2P6BB 3OGNA 5JOLA 1WLMA 2HF5A 1QX5B 2LC5A 1H8BA 1B9AA 1MF8B 2HQWA 3BFBA 2WCHA 2BKIB 3D0YB 4CFQA 3BUNB 1LINA 1MHOA 1EXRA 1SK6D 2WCJA 3BQ3A 3DF0B 3JTDC 1B47A 3FE6A 4YRUA 1KK8B 4OCIA 2LVJA 4ETOA 1JUOA 1SCMB 1NX2A 2PRUA 3IQQA 5FYXA 1WDCC 1S6CA 1KQMB 5I8NA 2KI6D 5ER5A 1YVHA 4C0JA 1ODBA 2BBMA 1LA3A 4I5NB 2HQ8A 5JJGA 1MUXA 1NWDA 1WRLA 4GBAA 3BXKA 2KI6C 3IQOA 1TNXA 4USLA 2CCMA 2KGBC 3CZ2A 2ZNDA 4GGNA 3EK7A 1IH0A 1K96A 4XJKA 4C0LA 1CKKA 2LLSA 1Y0VH 4N1GA 1RJVA 4YGCB 5I2QA 1PVAA 1YUSA 5D3OA 1JFJA 1B7TY 4M2OA 5DICA 1QX2A 3NHIA 2KAYA 1YX8A 1IQ5A 4MN0A 4JD9A 3EVRA 2EHBA 1B8CA 1M45A 2A4JA 2L51A 2L5XB 5DKNA 1KSMA 1SMGA 3QMEA 1FW4A 3D0YA 2BNXA 1Z4HA 1TRFA 2F3YA 2OS8B 1OSAA 2F8PA 4R1EA 3I5HC 3NSKA 1CFFA 5HLOA 2MLFC 3PN7C 4NDBA 1Y1XA 2KI4C 2GGMA 3BYAA 2K8MB 3IF7A 1GM0A 4PHJA 3TDUA 1S6JA 1SKTA 2CNPA 1B8RA 1S3PA 1WY9A 1LS8A 1ZFSA 5HKZA 1NCXA 2MBXA 1SL8A 1NX1A 2B1UA 1C7VA 3DYEA 1KQVA 3PN7B 1CDLA 1DJGA 1XA5A 4BY5A 3VROA 3UNWA 1JWDA 1B1GA 1K94A 1VRKA 1DC1A 1KFUS 1N0YA 2JZIA 2MJWB 3CABA 4YGDB 3OX6A 5FI7A 1DQEA 1BR1B 3PM8A 3VRPA 2KAVA 3TDIA 1DVIA 1A2XA 3S0DA 2WCLA 2K61A 2VRGA 5HKWA 4HREE 3GK2A 3O4XA 2YGUA 3H4SE 2Q4UA 3OBVA 1QLSA 3WNXB 4NDCA 3CR4X 5PALA 1QVIY 4HRGA 3BUOB 4OV2A 3A8RA 4AOMA 2L0PA 2LAPA 2LLUA 3B7AA 1AJ5A 4KYNA 4Q04A 1K8UA 1G8IA 1KSOA 1IJ6A 4PT1A 2L5YA 2HETA 2K60A 2LANA 2Y1MA 4HRHA 1JC2A 4CPVA 2PVBA 1JF2A 1EL4A 1SR6C 1XFZO 1FI6A 2JQ6A 4YI8A 4M2PA 1CLMA 2COLB 1EG4A 3CR2A 5HL1A 1AUIB 1SW8A 2MLEC 2BECA 3VRNA 1BLQA 1CB1A 2CXJA 1OMVA 1WDCB 2K2FA 2K7DA 3SG2A 3I5FC 1X02A 3B88A 2H61C 1DMOA 1M63B 1W7IB 3LL8B 3ZWHA 1GQMA 4ICBA 3SG5A 3OB1B 3EKHA 2KGRA 3EVVA 5EL2A 3D78A 4PE1A 3O6BA 1YUTA 2JTTA 3I5FB 1RWYA 2M0RA 3PLFB 1MXEA 3L47A 2WCMA 1PRWA 5FI6A 1OOIX 2JXLA 4DRWA 2AUCA 2H61A 1AJ4A 1XFXO 4IJ7A 2M1UA 3I5IB 1S1EA 2KQ6A 2QACA 1AVSA 1ALWA 2F2OA 3PM2A 2CBLA 1C07A 1XYDA 2CT9A 2QEHA 1NYAA 3LCPC 5AANA 3RLZA 2FJUB 3LK1A 1TN4A 1PSRA 3NXAA 1BOCA 1NX3A 2QEOA 3NSOA 1TWOA 1ORGA 2JT0A 3CDNA 3TS5C 3VB1A 1XFWO 2WORA 1F70A 1SCVA 2KI4B 3E3RA 1IGVA 2F2PA 2KFHA 2TN4A 3LLEA 3NHTA 1FBVA 1JSAA 1L2OC 4I5KA 1S5GY 4PCWA 1YRTB 2NLNA 3L4LA 3VRRA 1IG5A 1NCZA 2K2AA 1BMOA 2KDHA 1NSHA 1GGWA 2K7CA 3NSIA 1S36A 1MWNA 4YGBB 3SG4A 3VGOA 3FWBA 1R6PA 1TUJA 3D76A 3TUYB 1L2OB 3CZ0A 2LMTA 2KQYA 2Y4QA 2BE6A 1GGZA 3CWGA 2JRFA 1Z2CB 1TUZA 2Y5IA 3I5HB 2M9GA 1NPQA 2PSRA 4MRXA 4MZJA 4DCKA 3RZSA 4DIRA 1A75B 3FE9A 2IS9A 2NCPA 1HQVA 5KTYA 4MSPA 1RECA 3VRQA 1RROA 2K0JA 3NSLA 5B8IB 5HLVA 5K89A 1B4CA 1K9KA 1JF0A 5TNCA 1A03A 2D8NA 2LVIA 1CMGA 2EC6C 2WC6A 3PATA 2M49B 1S5GZ 3EK8A 3HX4A 4INWA 1BF5A 2JNFA 3CZ1A 1OOJA 2BCXA 2EGDA 1SSEB 2LCPA 1CFDA 1QIWA 4CLNA 2PQLA 3AKAA 1JBAA 2GGZA 4FTGA 4E68A 1QIVA 3WXAA 3AKBA 1V1FA 1YRUB 4OKHA 3ZNIA 4MVFA 4QJ5B 4DS7A 1FPWA 4F0ZB 1NCYA 1N65A 2LM5A 2MHHA 1SYMA 2P70A 1EJ3A 3DVEA 1H4BA 3PSRA 1F71A 4N1FA 3C1VA 3DVJA 1JFKA 3JTDB 1DGVA 3DXLA 1PALA 1KK8C 1UHJA 3TZ1A 1SCMC 5I94A 2KBMA 5CSIA 2ISDA 3PALA 1G33A
chains in the Genus database with same CATH topology
1KQMC 2RGIA 2KYCA 2AMIA 3AAKA 3SG7A 2I2RE 2JOJA 1PSBA 3M0WA 3SIAA 1DTLA 4QJ3B 1SR6B 1NP8A 3EKJA 3GK1A 1DT7B 2FCEA 3MSEB 1IKUA 5AERA 1XK4A 2JXCA 1XK4C 2M7NA 1OZSA 2NZ0A 2R2IA 1J7RA 1XFVO 2M1KB 3BUWB 1BT6A 1QS7A 3CS1A 4PE0A 1CM4A 2ZKMX 1GJYA 2M3WA 1S26D 1FF1A 3K21A 1AP4A 1TOPA 5HKYA 3DVKA 2O60A 2WCBA 3KEVA 1BR4B 2QPTA 1KFXL 1UP5A 3LK0A 3TDZA 2KYFA 1M31A 2HPSA 2K7OA 2PMYA 3BOWA 2I94A 4MRYA 2OS8C 2DOQA 2JTZA 2OTGB 3I5GB 3O4YA 5DKRA 1J1DA 1HT9A 2KFGA 1NUBA 3EVUA 2NXQA 1SBJA 1WRZA 4PDZA 3F45A 1Y1UA 1TIZA 1YX7A 2ZN8A 2LP3A 1ZUZA 1MQ1A 1YVLA 2ZN9A 1OQPA 1SPYA 1K9UA 1DJIA 2Q91A 4GAOA 4DUQA 1BU3A 2OPOA 4ORBB 3CZTX 2BCAA 2FOTA 2LNKA 2LMVA 1NIWA 1XVJA 2E6WA 3FIAA 5AXIA 3WHUB 5KU1A 4NDDA 1DJWA 2JNXA 2WC8A 1KFXS 1QATA 1BJFA 1CNPA 3GOFA 1W7JB 2JWWA 1MXLC 1SRAA 2EC6B 1KK7Y 1OZOA 1G4YR 4AQJA 1Y6WA 1F8HA 4PHMA 2SASA 2M97A 1AHRA 2JULA 4PE7A 2L98A 2ZRSA 2PALA 1OMRA 2WNDA 1OE9B 3KHEA 4P5OE 4WQ3A 1J1EA 3CR5X 1DJYA 1CDPA 2LP2A 2NCOA 2M7LA 1J7QA 2KHNA 2JU0A 4I5LB 5J3XA 4FQOA 1F4OA 1ZMZA 4UPGA 2L50A 1KCYA 1PULA 2L2EA 1DF0A 3JVTC 1IQ3A 5HYDA 1PVBA 3BOWB 3OX5A 4IL1A 1CFPA 1N2DA 4GNKB 4YGAA 1ALVA 1XO5A 4MBEA 5F6TA 3KO0A 3GK4X 1C7WA 1U5IB 3DVMA 1KK7Z 4GFTA 3BUMB 1CLLA 1TCFA 3HCMA 3SIBA 1DF0B 1QV1A 1DJHA 4U8DA 1V1GA 2WCFA 4PALA 4GGFA 2KSPA 3FS7A 3SJSA 4CFRA 2KBIA 2LV7A 3ICBA 2JC2A 4P2YB 1F55A 1PK0D 1M46A 2I18A 2BL0B 1B7TZ 3D10A 3RM1A 1F54A 1UHHA 5CSFA 4XYNA 2KOTA 3KF9A 2H2KA 4AQIA 1TNQA 4GPLB 2CTNA 3SG6A 1TNWA 1QTXA 1SL7A 3SG3A 3DD4A 3O2PA 3I5IC 1K2HA 4CIDA 2KFFA 2BL0C 1A75A 5GQQC 5CSJA 3QRXA 4WRIA 2BBNA 2L4IA 4A4CA 4GUKA 4MZLA 2F3ZA 2JPTA 4ZCUA 3WHTB 2LUCA 2G2BA 1TTXA 2M29A 3I5GC 1FI5A 1TCOB 4M2QA 3TS5B 2G9BA 2AAOA 2SCPA 1LA0A 1SNLA 4PHNA 5KSZA 2MRDA 2E30A 4YI9A 2LHIA 4C0KA 2FCDA 3DF0A 1EH2A 2K7BA 5ER4X 1LKJA 5D7FA 1CFCA 4D1EA 2BCBA 1WRKA 4L9MA 4OVNF 5G08A 3EK4A 1YUUA 2LE9B 1A29A 1XFUO 1MR8A 5I2LA 1UURA 1Y1AA 4MEWA 4MLWA 1UHNA 2ZFDA 1BG1A 1IWQA 4N5XA 1UHIA 2ZRTA 1CM1A 1J7PA 3TUYC 1K95A 1CDMA 1Q80A 1QVIZ 1UHKA 1XFYO 1YURA 1QLKA 2OTGC 4XJKB 1E8AA 2BKHB 4YBHB 1DJXA 2GV5A 1ZACA 1QJTA 4I5JA 5CSNA 1UWOA 5IBWA 4ZCVA 1TNPA 1R2UA 1QX7A 5DKQA 1L7ZA 1ZOTB 2WCEA 1IJ5A 2LUXA 2ZNEA 3CLNA 3OB2B 4BY4A 2F33A 1S6IA 3KPXA 5AEQA 2BE4A 1WLZA 4A4BA 4TNCA 1SL9A 1IRJA 3OHMB 1CTRA 1K9PA 2WOSA 3JVTB 1DJZA 4OR9B 1NX0A 2I7AA 4PHKA 3PFVA 1AK8A 1LVCD 1CMFA 4ORCB 1DGUA 3A4UB 1OMDA 1K93D 1YTZC 3O78A 4MZKA 5D69A 2KNEA 4JQ0D 2KAXA 2MAZA 1EG3A 2LVKA 1CLBA 1RFJA 2JT3A 1B8LA 2LVVA 1QXPA 4HSZA 1RK9A 5CPVA 1J55A 5I2OA 1D1OA 3BUXB 2LLTA 1BODA 5BPJA 3CTNA 4JWQA 1KWOC 1U5IA 2Y1NA 1K90D 1SY9A 1A4PA 4GGFC 1M39A 2O5GA 2MA2A 1QASA 4JPZB 2JT8A 1UUSA 1F4QA 2LHLA 3OP0A 4NQGA 2PASA 4YGEB 4QJ4B 1KFUL 2LMUA 1QV0A 1YR5A 4ORAB 1RTP1 5AFPA 1LXFC 1KWOB 2V53A 2L4HA 1CDNA 1J7OA 3CGAA 3AAJA 4PE4A 2M8UA 3FWCA 4WQ2A 2P6BB 5JOLA 1WLMA 2HF5A 1QX5B 2LC5A 1H8BA 1B9AA 1MF8B 2HQWA 3D0YB 4CFQA 2BKIB 3BUNB 1LINA 1MHOA 1EXRA 1SK6D 3BQ3A 3DF0B 3JTDC 1CMGA 1B47A 4YRUA 1KK8B 4OCIA 2LVJA 4ETOA 1JUOA 1SCMB 1NX2A 2PRUA 3IQQA 5FYXA 1WDCC 1S6CA 1KQMB 5I8NA 2KI6D 5ER5A 1YVHA 4C0JA 1ODBA 2BBMA 1LA3A 4I5NB 2HQ8A 5JJGA 1MUXA 1NWDA 1WRLA 4GBAA 3BXKA 2KI6C 3IQOA 1TNXA 4USLA 2CCMA 2KGBC 2ZNDA 4GGNA 3EK7A 1IH0A 1K96A 4XJKA 4C0LA 1CKKA 2LLSA 1Y0VH 4N1GA 1RJVA 4YGCB 5I2QA 1PVAA 1YUSA 1JFJA 1B7TY 4M2OA 1QX2A 2KAYA 1YX8A 1IQ5A 4MN0A 3EVRA 2EHBA 1B8CA 1M45A 2A4JA 2L51A 2L5XB 5DKNA 1KSMA 1SMGA 1FW4A 3D0YA 1TRFA 2F3YA 2OS8B 1OSAA 2F8PA 4R1EA 3I5HC 3NSKA 1CFFA 5HLOA 2MLFC 3PN7C 4NDBA 1Y1XA 2KI4C 2GGMA 3BYAA 2K8MB 3IF7A 4PHJA 3TDUA 1S6JA 1SKTA 2CNPA 1B8RA 1S3PA 1WY9A 1ZFSA 5HKZA 1NCXA 2MBXA 1SL8A 1NX1A 2B1UA 1C7VA 1KQVA 3PN7B 1CDLA 1DJGA 1XA5A 4BY5A 3VROA 1JWDA 1B1GA 1K94A 1VRKA 1KFUS 1N0YA 2JZIA 2MJWB 4YGDB 3OX6A 1BR1B 3PM8A 3VRPA 2KAVA 3TDIA 1DVIA 1A2XA 2K61A 2VRGA 5HKWA 4HREE 3GK2A 3H4SE 2Q4UA 1QLSA 3WNXB 4NDCA 3CR4X 5PALA 1QVIY 4HRGA 3BUOB 4OV2A 3A8RA 4AOMA 2L0PA 2LAPA 2LLUA 1AJ5A 4Q04A 1K8UA 1G8IA 1KSOA 1IJ6A 2HETA 2LANA 2Y1MA 4HRHA 1JC2A 4CPVA 2PVBA 1JF2A 1EL4A 1SR6C 1XFZO 1FI6A 2JQ6A 4YI8A 4M2PA 1CLMA 2COLB 1EG4A 3CR2A 1AUIB 1SW8A 2MLEC 2BECA 3VRNA 1BLQA 1CB1A 2CXJA 1OMVA 1WDCB 2K2FA 2K7DA 3SG2A 3I5FC 1X02A 1DMOA 2H61C 1M63B 1W7IB 3LL8B 3ZWHA 1GQMA 4ICBA 3SG5A 3OB1B 3EKHA 2KGRA 3EVVA 4PE1A 3O6BA 1YUTA 2JTTA 3I5FB 1RWYA 2M0RA 3PLFB 1MXEA 1PRWA 2JXLA 4DRWA 2AUCA 2H61A 1AJ4A 1XFXO 2M1UA 3I5IB 1S1EA 2KQ6A 2QACA 1AVSA 1ALWA 2F2OA 2CBLA 1C07A 1XYDA 2CT9A 1NYAA 3LCPC 5AANA 3RLZA 2FJUB 3LK1A 1TN4A 1PSRA 3NXAA 1BOCA 1NX3A 3NSOA 3TS5C 2JT0A 1XFWO 2WORA 1F70A 1SCVA 2KI4B 3E3RA 1IGVA 2F2PA 2KFHA 2TN4A 3LLEA 1FBVA 1JSAA 1L2OC 4I5KA 1S5GY 4PCWA 1YRTB 2NLNA 3VRRA 1IG5A 1NCZA 2K2AA 1BMOA 2KDHA 1NSHA 1GGWA 2K7CA 3NSIA 1S36A 1MWNA 4YGBB 3SG4A 3VGOA 3FWBA 1R6PA 3TUYB 1L2OB 2LMTA 2KQYA 2Y4QA 2BE6A 1GGZA 3CWGA 2JRFA 2Y5IA 3I5HB 2M9GA 1NPQA 2PSRA 4MRXA 4MZJA 4DCKA 4DIRA 1A75B 2IS9A 2NCPA 1HQVA 5KTYA 4MSPA 1RECA 3VRQA 1RROA 2K0JA 3NSLA 5B8IB 5HLVA 5K89A 1B4CA 1K9KA 1JF0A 5TNCA 1A03A 2D8NA 2LVIA 2EC6C 3PATA 2M49B 1S5GZ 3EK8A 3HX4A 1BF5A 2JNFA 1OOJA 2BCXA 2EGDA 2LCPA 1CFDA 1QIWA 4CLNA 3AKAA 1JBAA 2GGZA 4FTGA 4E68A 1QIVA 3WXAA 3AKBA 1V1FA 1YRUB 4OKHA 3ZNIA 4MVFA 4QJ5B 4DS7A 1FPWA 4F0ZB 1NCYA 1N65A 2LM5A 2MHHA 1SYMA 3DVEA 1EJ3A 1H4BA 3PSRA 1F71A 4N1FA 3C1VA 3DVJA 1JFKA 3JTDB 1DGVA 1PALA 1KK8C 1UHJA 3TZ1A 1SCMC 2KBMA 5CSIA 2ISDA 3PALA 1G33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQM C;  2RGI A;  2KYC A;  2AMI A;  3AAK A;  3SG7 A;  2I2R E;  2JOJ A;  1PSB A;  3M0W A;  3SIA A;  1DTL A;  4QJ3 B;  1SR6 B;  1NP8 A;  3EKJ A;  3GK1 A;  1DT7 B;  2FCE A;  3MSE B;  1IKU A;  5AER A;  1XK4 A;  2JXC A;  1XK4 C;  2M7N A;  1OZS A;  2NZ0 A;  2R2I A;  1J7R A;  1XFV O;  2M1K B;  3BUW B;  1BT6 A;  1QS7 A;  3CS1 A;  4PE0 A;  1CM4 A;  2ZKM X;  1GJY A;  2M3W A;  1S26 D;  1FF1 A;  3K21 A;  1AP4 A;  1TOP A;  5HKY A;  3DVK A;  2O60 A;  2WCB A;  3KEV A;  1BR4 B;  2QPT A;  1KFX L;  1UP5 A;  3LK0 A;  3TDZ A;  2KYF A;  1M31 A;  2HPS A;  2K7O A;  2PMY A;  3BOW A;  2I94 A;  4MRY A;  2OS8 C;  2DOQ A;  2JTZ A;  2OTG B;  3I5G B;  3O4Y A;  5DKR A;  1J1D A;  1HT9 A;  2KFG A;  1NUB A;  3EVU A;  2NXQ A;  1SBJ A;  1WRZ A;  4PDZ A;  3F45 A;  1Y1U A;  1TIZ A;  1YX7 A;  2ZN8 A;  2LP3 A;  1ZUZ A;  1MQ1 A;  1YVL A;  2ZN9 A;  1OQP A;  1SPY A;  1K9U A;  1DJI A;  2Q91 A;  4GAO A;  4DUQ A;  1BU3 A;  2OPO A;  4ORB B;  3CZT X;  2BCA A;  2FOT A;  2LNK A;  2LMV A;  1NIW A;  1XVJ A;  2E6W A;  3FIA A;  5AXI A;  3WHU B;  5KU1 A;  4NDD A;  1DJW A;  2JNX A;  2WC8 A;  1KFX S;  1QAT A;  1BJF A;  1CNP A;  3GOF A;  1W7J B;  2JWW A;  1MXL C;  1SRA A;  2EC6 B;  1KK7 Y;  1OZO A;  1G4Y R;  4AQJ A;  1Y6W A;  1F8H A;  4PHM A;  2SAS A;  2M97 A;  1AHR A;  2JUL A;  4PE7 A;  2L98 A;  2ZRS A;  2PAL A;  1OMR A;  2WND A;  1OE9 B;  3KHE A;  4P5O E;  4WQ3 A;  1J1E A;  3CR5 X;  1DJY A;  1CDP A;  2LP2 A;  2NCO A;  2M7L A;  1J7Q A;  2KHN A;  2JU0 A;  4I5L B;  5J3X A;  4FQO A;  1F4O A;  1ZMZ A;  4UPG A;  2L50 A;  1KCY A;  1PUL A;  2L2E A;  1DF0 A;  3JVT C;  1IQ3 A;  5HYD A;  1PVB A;  3BOW B;  3OX5 A;  4IL1 A;  1CFP A;  1N2D A;  4GNK B;  4YGA A;  1ALV A;  1XO5 A;  4MBE A;  5F6T A;  3KO0 A;  3GK4 X;  1C7W A;  1U5I B;  3DVM A;  1KK7 Z;  4GFT A;  3BUM B;  1CLL A;  1TCF A;  3HCM A;  3SIB A;  1DF0 B;  1QV1 A;  1DJH A;  4U8D A;  1V1G A;  2WCF A;  4PAL A;  4GGF A;  2KSP A;  3FS7 A;  3SJS A;  4CFR A;  2KBI A;  2LV7 A;  3ICB A;  2JC2 A;  4P2Y B;  1F55 A;  1PK0 D;  1M46 A;  2I18 A;  2BL0 B;  1B7T Z;  3D10 A;  3RM1 A;  1F54 A;  1UHH A;  5CSF A;  4XYN A;  2KOT A;  3KF9 A;  2H2K A;  4AQI A;  1TNQ A;  4GPL B;  2CTN A;  3SG6 A;  1TNW A;  1QTX A;  1SL7 A;  3SG3 A;  3DD4 A;  3O2P A;  3I5I C;  1K2H A;  4CID A;  2KFF A;  2BL0 C;  1A75 A;  5GQQ C;  5CSJ A;  3QRX A;  4WRI A;  2BBN A;  2L4I A;  4A4C A;  4GUK A;  4MZL A;  2F3Z A;  2JPT A;  4ZCU A;  3WHT B;  2LUC A;  2G2B A;  1TTX A;  2M29 A;  3I5G C;  1FI5 A;  1TCO B;  4M2Q A;  3TS5 B;  2G9B A;  2AAO A;  2SCP A;  1LA0 A;  1SNL A;  4PHN A;  5KSZ A;  2MRD A;  2E30 A;  4YI9 A;  2LHI A;  4C0K A;  2FCD A;  3DF0 A;  1EH2 A;  2K7B A;  5ER4 X;  1LKJ A;  5D7F A;  1CFC A;  4D1E A;  2BCB A;  1WRK A;  4L9M A;  4OVN F;  5G08 A;  3EK4 A;  1YUU A;  2LE9 B;  1A29 A;  1XFU O;  1MR8 A;  5I2L A;  1UUR A;  1Y1A A;  4MEW A;  4MLW A;  1UHN A;  2ZFD A;  1BG1 A;  1IWQ A;  4N5X A;  1UHI A;  2ZRT A;  1CM1 A;  1J7P A;  3TUY C;  1K95 A;  1CDM A;  1Q80 A;  1QVI Z;  1UHK A;  1XFY O;  1YUR A;  1QLK A;  2OTG C;  4XJK B;  1E8A A;  2BKH B;  4YBH B;  1DJX A;  2GV5 A;  1ZAC A;  1QJT A;  4I5J A;  5CSN A;  1UWO A;  5IBW A;  4ZCV A;  1TNP A;  1R2U A;  1QX7 A;  5DKQ A;  1L7Z A;  1ZOT B;  2WCE A;  1IJ5 A;  2LUX A;  2ZNE A;  3CLN A;  3OB2 B;  4BY4 A;  2F33 A;  1S6I A;  3KPX A;  5AEQ A;  2BE4 A;  1WLZ A;  4A4B A;  4TNC A;  1SL9 A;  1IRJ A;  3OHM B;  1CTR A;  1K9P A;  2WOS A;  3JVT B;  1DJZ A;  4OR9 B;  1NX0 A;  2I7A A;  4PHK A;  3PFV A;  1AK8 A;  1LVC D;  1CMF A;  4ORC B;  1DGU A;  3A4U B;  1OMD A;  1K93 D;  1YTZ C;  3O78 A;  4MZK A;  5D69 A;  2KNE A;  4JQ0 D;  2KAX A;  2MAZ A;  1EG3 A;  2LVK A;  1CLB A;  1RFJ A;  2JT3 A;  1B8L A;  2LVV A;  1QXP A;  4HSZ A;  1RK9 A;  5CPV A;  1J55 A;  5I2O A;  1D1O A;  3BUX B;  2LLT A;  1BOD A;  5BPJ A;  3CTN A;  4JWQ A;  1KWO C;  1U5I A;  2Y1N A;  1K90 D;  1SY9 A;  1A4P A;  4GGF C;  1M39 A;  2O5G A;  2MA2 A;  1QAS A;  4JPZ B;  2JT8 A;  1UUS A;  1F4Q A;  2LHL A;  3OP0 A;  4NQG A;  2PAS A;  4YGE B;  4QJ4 B;  1KFU L;  2LMU A;  1QV0 A;  1YR5 A;  4ORA B;  1RTP 1;  5AFP A;  1LXF C;  1KWO B;  2V53 A;  2L4H A;  1CDN A;  1J7O A;  3CGA A;  3AAJ A;  4PE4 A;  2M8U A;  3FWC A;  4WQ2 A;  2P6B B;  5JOL A;  1WLM A;  2HF5 A;  1QX5 B;  2LC5 A;  1H8B A;  1B9A A;  1MF8 B;  2HQW A;  3D0Y B;  4CFQ A;  2BKI B;  3BUN B;  1LIN A;  1MHO A;  1EXR A;  1SK6 D;  3BQ3 A;  3DF0 B;  3JTD C;  1CMG A;  1B47 A;  4YRU A;  1KK8 B;  4OCI A;  2LVJ A;  4ETO A;  1JUO A;  1SCM B;  1NX2 A;  2PRU A;  3IQQ A;  5FYX A;  1WDC C;  1S6C A;  1KQM B;  5I8N A;  2KI6 D;  5ER5 A;  1YVH A;  4C0J A;  1ODB A;  2BBM A;  1LA3 A;  4I5N B;  2HQ8 A;  5JJG A;  1MUX A;  1NWD A;  1WRL A;  4GBA A;  3BXK A;  2KI6 C;  3IQO A;  1TNX A;  4USL A;  2CCM A;  2KGB C;  2ZND A;  4GGN A;  3EK7 A;  1IH0 A;  1K96 A;  4XJK A;  4C0L A;  1CKK A;  2LLS A;  1Y0V H;  4N1G A;  1RJV A;  4YGC B;  5I2Q A;  1PVA A;  1YUS A;  1JFJ A;  1B7T Y;  4M2O A;  1QX2 A;  2KAY A;  1YX8 A;  1IQ5 A;  4MN0 A;  3EVR A;  2EHB A;  1B8C A;  1M45 A;  2A4J A;  2L51 A;  2L5X B;  5DKN A;  1KSM A;  1SMG A;  1FW4 A;  3D0Y A;  1TRF A;  2F3Y A;  2OS8 B;  1OSA A;  2F8P A;  4R1E A;  3I5H C;  3NSK A;  1CFF A;  5HLO A;  2MLF C;  3PN7 C;  4NDB A;  1Y1X A;  2KI4 C;  2GGM A;  3BYA A;  2K8M B;  3IF7 A;  4PHJ A;  3TDU A;  1S6J A;  1SKT A;  2CNP A;  1B8R A;  1S3P A;  1WY9 A;  1ZFS A;  5HKZ A;  1NCX A;  2MBX A;  1SL8 A;  1NX1 A;  2B1U A;  1C7V A;  1KQV A;  3PN7 B;  1CDL A;  1DJG A;  1XA5 A;  4BY5 A;  3VRO A;  1JWD A;  1B1G A;  1K94 A;  1VRK A;  1KFU S;  1N0Y A;  2JZI A;  2MJW B;  4YGD B;  3OX6 A;  1BR1 B;  3PM8 A;  3VRP A;  2KAV A;  3TDI A;  1DVI A;  1A2X A;  2K61 A;  2VRG A;  5HKW A;  4HRE E;  3GK2 A;  3H4S E;  2Q4U A;  1QLS A;  3WNX B;  4NDC A;  3CR4 X;  5PAL A;  1QVI Y;  4HRG A;  3BUO B;  4OV2 A;  3A8R A;  4AOM A;  2L0P A;  2LAP A;  2LLU A;  1AJ5 A;  4Q04 A;  1K8U A;  1G8I A;  1KSO A;  1IJ6 A;  2HET A;  2LAN A;  2Y1M A;  4HRH A;  1JC2 A;  4CPV A;  2PVB A;  1JF2 A;  1EL4 A;  1SR6 C;  1XFZ O;  1FI6 A;  2JQ6 A;  4YI8 A;  4M2P A;  1CLM A;  2COL B;  1EG4 A;  3CR2 A;  1AUI B;  1SW8 A;  2MLE C;  2BEC A;  3VRN A;  1BLQ A;  1CB1 A;  2CXJ A;  1OMV A;  1WDC B;  2K2F A;  2K7D A;  3SG2 A;  3I5F C;  1X02 A;  1DMO A;  2H61 C;  1M63 B;  1W7I B;  3LL8 B;  3ZWH A;  1GQM A;  4ICB A;  3SG5 A;  3OB1 B;  3EKH A;  2KGR A;  3EVV A;  4PE1 A;  3O6B A;  1YUT A;  2JTT A;  3I5F B;  1RWY A;  2M0R A;  3PLF B;  1MXE A;  1PRW A;  2JXL A;  4DRW A;  2AUC A;  2H61 A;  1AJ4 A;  1XFX O;  2M1U A;  3I5I B;  1S1E A;  2KQ6 A;  2QAC A;  1AVS A;  1ALW A;  2F2O A;  2CBL A;  1C07 A;  1XYD A;  2CT9 A;  1NYA A;  3LCP C;  5AAN A;  3RLZ A;  2FJU B;  3LK1 A;  1TN4 A;  1PSR A;  3NXA A;  1BOC A;  1NX3 A;  3NSO A;  3TS5 C;  2JT0 A;  1XFW O;  2WOR A;  1F70 A;  1SCV A;  2KI4 B;  3E3R A;  1IGV A;  2F2P A;  2KFH A;  2TN4 A;  3LLE A;  1FBV A;  1JSA A;  1L2O C;  4I5K A;  1S5G Y;  4PCW A;  1YRT B;  2NLN A;  3VRR A;  1IG5 A;  1NCZ A;  2K2A A;  1BMO A;  2KDH A;  1NSH A;  1GGW A;  2K7C A;  3NSI A;  1S36 A;  1MWN A;  4YGB B;  3SG4 A;  3VGO A;  3FWB A;  1R6P A;  3TUY B;  1L2O B;  2LMT A;  2KQY A;  2Y4Q A;  2BE6 A;  1GGZ A;  3CWG A;  2JRF A;  2Y5I A;  3I5H B;  2M9G A;  1NPQ A;  2PSR A;  4MRX A;  4MZJ A;  4DCK A;  4DIR A;  1A75 B;  2IS9 A;  2NCP A;  1HQV A;  5KTY A;  4MSP A;  1REC A;  3VRQ A;  1RRO A;  2K0J A;  3NSL A;  5B8I B;  5HLV A;  5K89 A;  1B4C A;  1K9K A;  1JF0 A;  5TNC A;  1A03 A;  2D8N A;  2LVI A;  2EC6 C;  3PAT A;  2M49 B;  1S5G Z;  3EK8 A;  3HX4 A;  1BF5 A;  2JNF A;  1OOJ A;  2BCX A;  2EGD A;  2LCP A;  1CFD A;  1QIW A;  4CLN A;  3AKA A;  1JBA A;  2GGZ A;  4FTG A;  4E68 A;  1QIV A;  3WXA A;  3AKB A;  1V1F A;  1YRU B;  4OKH A;  3ZNI A;  4MVF A;  4QJ5 B;  4DS7 A;  1FPW A;  4F0Z B;  1NCY A;  1N65 A;  2LM5 A;  2MHH A;  1SYM A;  3DVE A;  1EJ3 A;  1H4B A;  3PSR A;  1F71 A;  4N1F A;  3C1V A;  3DVJ A;  1JFK A;  3JTD B;  1DGV A;  1PAL A;  1KK8 C;  1UHJ A;  3TZ1 A;  1SCM C;  2KBM A;  5CSI A;  2ISD A;  3PAL A;  1G33 A; 
#chains in the Genus database with same CATH topology
 1KQM C;  2RGI A;  2KYC A;  2AMI A;  3AAK A;  3SG7 A;  2I2R E;  2JOJ A;  1PSB A;  3M0W A;  3SIA A;  1DTL A;  4QJ3 B;  1SR6 B;  1NP8 A;  3EKJ A;  3GK1 A;  1DT7 B;  2FCE A;  3MSE B;  1IKU A;  1XFR A;  5AER A;  1XK4 A;  2QEV A;  2JXC A;  1XK4 C;  2M7N A;  1OZS A;  2NZ0 A;  2R2I A;  3BFA A;  1J7R A;  1XFV O;  2M1K B;  3BUW B;  1BT6 A;  1QS7 A;  3CS1 A;  4PE0 A;  1CM4 A;  3DZT A;  2ZKM X;  1GJY A;  2M3W A;  3R1O A;  1S26 D;  1FF1 A;  3K21 A;  1AP4 A;  1TOP A;  3B6X A;  5HKY A;  3DVK A;  2O60 A;  2WCB A;  3KEV A;  1BR4 B;  2QPT A;  1KFX L;  1UP5 A;  3LK0 A;  3NGV A;  3S0G A;  3TDZ A;  3V2L A;  2KYF A;  1M31 A;  2HPS A;  2K7O A;  2PMY A;  3BOW A;  2I94 A;  4MRY A;  2OS8 C;  2DOQ A;  2JTZ A;  2OTG B;  3I5G B;  3O4Y A;  5DKR A;  3SS4 A;  1J1D A;  1HT9 A;  2KFG A;  1NUB A;  3EVU A;  2NXQ A;  1SBJ A;  1WRZ A;  4PDZ A;  2KLD A;  2ERB A;  3F45 A;  3B86 A;  1Y1U A;  1TIZ A;  1IIO A;  1YX7 A;  2ZN8 A;  3CYZ A;  2LP3 A;  1ZUZ A;  1MQ1 A;  1YVL A;  2ZN9 A;  1OQP A;  1SPY A;  1K9U A;  1DJI A;  2Q91 A;  4GAO A;  4DUQ A;  1BU3 A;  2OPO A;  4ORB B;  3CZT X;  1OW4 A;  2BCA A;  2FOT A;  2LNK A;  2LMV A;  3SS3 A;  1NIW A;  1XVJ A;  2E6W A;  3FIA A;  5AXI A;  3WHU B;  5KU1 A;  4NDD A;  1DJW A;  2H8V A;  2JNX A;  1KFX S;  1QAT A;  1BJF A;  2WC8 A;  3GOF A;  1T14 A;  1CNP A;  1W7J B;  2JWW A;  1MXL C;  1SRA A;  1OOG A;  2EC6 B;  1KK7 Y;  1OZO A;  3S0E A;  1G4Y R;  4AQJ A;  1Y6W A;  1F8H A;  1OOH A;  4PHM A;  2SAS A;  2M97 A;  1AHR A;  2JUL A;  4PE7 A;  2L98 A;  3BFH A;  2ZRS A;  2PAL A;  1OMR A;  2WND A;  1OE9 B;  3D74 A;  3KHE A;  4P5O E;  4WQ3 A;  1J1E A;  3CR5 X;  1DJY A;  1CDP A;  2LP2 A;  2KPH A;  2NCO A;  2M7L A;  1J7Q A;  2KHN A;  2JU0 A;  4I5L B;  5J3X A;  4FQO A;  1F4O A;  1ZMZ A;  4UPG A;  2L50 A;  1KCY A;  1DEK A;  1PUL A;  2L2E A;  1DF0 A;  3JVT C;  1IQ3 A;  5HYD A;  1PVB A;  3BOW B;  3OX5 A;  1C3Z A;  4IL1 A;  1CFP A;  1N2D A;  4GNK B;  1QWV A;  4YGA A;  1ALV A;  1XO5 A;  2JPO A;  4MBE A;  3KO0 A;  3GK4 X;  1C7W A;  5F6T A;  1U5I B;  3DVM A;  1KK7 Z;  4GFT A;  3BUM B;  1CLL A;  1TCF A;  3HCM A;  3SIB A;  3S0A A;  1DF0 B;  1QV1 A;  1DJH A;  4U8D A;  1V1G A;  2WCF A;  4PAL A;  2WC5 A;  2KSP A;  3FS7 A;  4GGF A;  3SJS A;  2KBI A;  4CFR A;  2LV7 A;  3ICB A;  2JC2 A;  4P2Y B;  3BJH A;  1F55 A;  1PK0 D;  1M46 A;  2I18 A;  2BL0 B;  1B7T Z;  3D10 A;  3PJI A;  3RM1 A;  1F54 A;  1DEL A;  1UHH A;  5CSF A;  4XYN A;  2KOT A;  3KF9 A;  2H2K A;  5FI2 A;  1TNQ A;  3R1V A;  4AQI A;  4GPL B;  2CTN A;  3SG6 A;  1TNW A;  1QTX A;  1SL7 A;  3SG3 A;  3DD4 A;  3O2P A;  3I5I C;  1C3Y A;  1K2H A;  4CID A;  2KFF A;  2BL0 C;  1A75 A;  5GQQ C;  5CSJ A;  3QRX A;  4WRI A;  2BBN A;  2L4I A;  3DY9 A;  4A4C A;  4GUK A;  4MZL A;  1W9Z A;  2F3Z A;  2JPT A;  4ZCU A;  3WHT B;  3Q8I A;  2LUC A;  2G2B A;  1TTX A;  2M29 A;  3I5G C;  2PYQ A;  1FI5 A;  1TCO B;  4M2Q A;  3TS5 B;  2G9B A;  2AAO A;  2SCP A;  1LA0 A;  2QDI A;  1SNL A;  4PHN A;  5KSZ A;  2MRD A;  2E30 A;  2QEB A;  4YI9 A;  2LHI A;  4C0K A;  2FCD A;  3DF0 A;  1EH2 A;  2K7B A;  5ER4 X;  1LKJ A;  2GTE A;  3R1P A;  5D7F A;  4D1E A;  1CFC A;  2BCB A;  1WRK A;  3S0B A;  4L9M A;  4OVN F;  5G08 A;  3EK4 A;  1YUU A;  2LE9 B;  3S0F A;  1A29 A;  1XFU O;  1MR8 A;  5I2L A;  1UUR A;  1Y1A A;  4MEW A;  4F7F A;  4MLW A;  1UHN A;  2ZFD A;  1BG1 A;  1IWQ A;  4N5X A;  1UHI A;  3EG5 B;  2ZRT A;  1CM1 A;  1J7P A;  3TUY C;  1K95 A;  1CDM A;  1Q80 A;  1QVI Z;  1UHK A;  1XFY O;  1YUR A;  1QLK A;  2OTG C;  4XJK B;  3B87 A;  1E8A A;  2BKH B;  4YBH B;  1DJX A;  2GV5 A;  1ZAC A;  1QJT A;  4I5J A;  5CSN A;  1UWO A;  5IBW A;  4ZCV A;  1TNP A;  1R2U A;  1QX7 A;  5DKQ A;  1L7Z A;  2FJY A;  1ZOT B;  2WCE A;  1IJ5 A;  1OOF A;  2LUX A;  2ZNE A;  3CLN A;  3OB2 B;  4BY4 A;  2F33 A;  3N7H A;  3D73 A;  1S6I A;  3IVT A;  3KPX A;  5AEQ A;  4OZD A;  2BE4 A;  1WLZ A;  4A4B A;  2BAP A;  4TNC A;  1SL9 A;  1IRJ A;  3OHM B;  1CTR A;  1K9P A;  2WOS A;  3JVT B;  1DJZ A;  4OR9 B;  2L2C A;  1NX0 A;  2I7A A;  4PHK A;  3PFV A;  1AK8 A;  1LVC D;  1CMF A;  4ORC B;  1DGU A;  2P71 A;  3A4U B;  1OMD A;  1K93 D;  3R72 A;  1YTZ C;  3O78 A;  4MZK A;  5D69 A;  2KNE A;  4JQ0 D;  2KAX A;  2MAZ A;  3D77 A;  1EG3 A;  2LVK A;  1CLB A;  1RFJ A;  2JT3 A;  1B8L A;  2LVV A;  1P28 A;  1QXP A;  1RK9 A;  4HSZ A;  1J55 A;  4INX A;  5CPV A;  5I2O A;  1D1O A;  3BUX B;  2LLT A;  1BOD A;  5BPJ A;  2WCK A;  3CTN A;  4JWQ A;  1KWO C;  1U5I A;  2Y1N A;  1K90 D;  1SY9 A;  3D75 A;  1A4P A;  4GGF C;  1M39 A;  2O5G A;  4JKT A;  4FQT A;  3UO9 A;  2MA2 A;  3L4A A;  1QAS A;  3FE8 A;  4JPZ B;  2JT8 A;  1UUS A;  1F4Q A;  2LHL A;  3OP0 A;  4NQG A;  3SS5 A;  2PAS A;  4YGE B;  4QJ4 B;  3K1E A;  1KFU L;  2LMU A;  1QV0 A;  1YR5 A;  4ORA B;  1RTP 1;  5AFP A;  1LXF C;  1KWO B;  2V53 A;  2L4H A;  2KLE A;  1CDN A;  1J7O A;  3CGA A;  3AAJ A;  4PE4 A;  2M8U A;  3FWC A;  4WQ2 A;  2P6B B;  3OGN A;  5JOL A;  1WLM A;  2HF5 A;  1QX5 B;  2LC5 A;  1H8B A;  1B9A A;  1MF8 B;  2HQW A;  3BFB A;  2WCH A;  2BKI B;  3D0Y B;  4CFQ A;  3BUN B;  1LIN A;  1MHO A;  1EXR A;  1SK6 D;  2WCJ A;  3BQ3 A;  3DF0 B;  3JTD C;  1B47 A;  3FE6 A;  4YRU A;  1KK8 B;  4OCI A;  2LVJ A;  4ETO A;  1JUO A;  1SCM B;  1NX2 A;  2PRU A;  3IQQ A;  5FYX A;  1WDC C;  1S6C A;  1KQM B;  5I8N A;  2KI6 D;  5ER5 A;  1YVH A;  4C0J A;  1ODB A;  2BBM A;  1LA3 A;  4I5N B;  2HQ8 A;  5JJG A;  1MUX A;  1NWD A;  1WRL A;  4GBA A;  3BXK A;  2KI6 C;  3IQO A;  1TNX A;  4USL A;  2CCM A;  2KGB C;  3CZ2 A;  2ZND A;  4GGN A;  3EK7 A;  1IH0 A;  1K96 A;  4XJK A;  4C0L A;  1CKK A;  2LLS A;  1Y0V H;  4N1G A;  1RJV A;  4YGC B;  5I2Q A;  1PVA A;  1YUS A;  5D3O A;  1JFJ A;  1B7T Y;  4M2O A;  5DIC A;  1QX2 A;  3NHI A;  2KAY A;  1YX8 A;  1IQ5 A;  4MN0 A;  4JD9 A;  3EVR A;  2EHB A;  1B8C A;  1M45 A;  2A4J A;  2L51 A;  2L5X B;  5DKN A;  1KSM A;  1SMG A;  3QME A;  1FW4 A;  3D0Y A;  2BNX A;  1Z4H A;  1TRF A;  2F3Y A;  2OS8 B;  1OSA A;  2F8P A;  4R1E A;  3I5H C;  3NSK A;  1CFF A;  5HLO A;  2MLF C;  3PN7 C;  4NDB A;  1Y1X A;  2KI4 C;  2GGM A;  3BYA A;  2K8M B;  3IF7 A;  1GM0 A;  4PHJ A;  3TDU A;  1S6J A;  1SKT A;  2CNP A;  1B8R A;  1S3P A;  1WY9 A;  1LS8 A;  1ZFS A;  5HKZ A;  1NCX A;  2MBX A;  1SL8 A;  1NX1 A;  2B1U A;  1C7V A;  3DYE A;  1KQV A;  3PN7 B;  1CDL A;  1DJG A;  1XA5 A;  4BY5 A;  3VRO A;  3UNW A;  1JWD A;  1B1G A;  1K94 A;  1VRK A;  1DC1 A;  1KFU S;  1N0Y A;  2JZI A;  2MJW B;  3CAB A;  4YGD B;  3OX6 A;  5FI7 A;  1DQE A;  1BR1 B;  3PM8 A;  3VRP A;  2KAV A;  3TDI A;  1DVI A;  1A2X A;  3S0D A;  2WCL A;  2K61 A;  2VRG A;  5HKW A;  4HRE E;  3GK2 A;  3O4X A;  2YGU A;  3H4S E;  2Q4U A;  3OBV A;  1QLS A;  3WNX B;  4NDC A;  3CR4 X;  5PAL A;  1QVI Y;  4HRG A;  3BUO B;  4OV2 A;  3A8R A;  4AOM A;  2L0P A;  2LAP A;  2LLU A;  3B7A A;  1AJ5 A;  4KYN A;  4Q04 A;  1K8U A;  1G8I A;  1KSO A;  1IJ6 A;  4PT1 A;  2L5Y A;  2HET A;  2K60 A;  2LAN A;  2Y1M A;  4HRH A;  1JC2 A;  4CPV A;  2PVB A;  1JF2 A;  1EL4 A;  1SR6 C;  1XFZ O;  1FI6 A;  2JQ6 A;  4YI8 A;  4M2P A;  1CLM A;  2COL B;  1EG4 A;  3CR2 A;  5HL1 A;  1AUI B;  1SW8 A;  2MLE C;  2BEC A;  3VRN A;  1BLQ A;  1CB1 A;  2CXJ A;  1OMV A;  1WDC B;  2K2F A;  2K7D A;  3SG2 A;  3I5F C;  1X02 A;  3B88 A;  2H61 C;  1DMO A;  1M63 B;  1W7I B;  3LL8 B;  3ZWH A;  1GQM A;  4ICB A;  3SG5 A;  3OB1 B;  3EKH A;  2KGR A;  3EVV A;  5EL2 A;  3D78 A;  4PE1 A;  3O6B A;  1YUT A;  2JTT A;  3I5F B;  1RWY A;  2M0R A;  3PLF B;  1MXE A;  3L47 A;  2WCM A;  1PRW A;  5FI6 A;  1OOI X;  2JXL A;  4DRW A;  2AUC A;  2H61 A;  1AJ4 A;  1XFX O;  4IJ7 A;  2M1U A;  3I5I B;  1S1E A;  2KQ6 A;  2QAC A;  1AVS A;  1ALW A;  2F2O A;  3PM2 A;  2CBL A;  1C07 A;  1XYD A;  2CT9 A;  2QEH A;  1NYA A;  3LCP C;  5AAN A;  3RLZ A;  2FJU B;  3LK1 A;  1TN4 A;  1PSR A;  3NXA A;  1BOC A;  1NX3 A;  2QEO A;  3NSO A;  1TWO A;  1ORG A;  2JT0 A;  3CDN A;  3TS5 C;  3VB1 A;  1XFW O;  2WOR A;  1F70 A;  1SCV A;  2KI4 B;  3E3R A;  1IGV A;  2F2P A;  2KFH A;  2TN4 A;  3LLE A;  3NHT A;  1FBV A;  1JSA A;  1L2O C;  4I5K A;  1S5G Y;  4PCW A;  1YRT B;  2NLN A;  3L4L A;  3VRR A;  1IG5 A;  1NCZ A;  2K2A A;  1BMO A;  2KDH A;  1NSH A;  1GGW A;  2K7C A;  3NSI A;  1S36 A;  1MWN A;  4YGB B;  3SG4 A;  3VGO A;  3FWB A;  1R6P A;  1TUJ A;  3D76 A;  3TUY B;  1L2O B;  3CZ0 A;  2LMT A;  2KQY A;  2Y4Q A;  2BE6 A;  1GGZ A;  3CWG A;  2JRF A;  1Z2C B;  1TUZ A;  2Y5I A;  3I5H B;  2M9G A;  1NPQ A;  2PSR A;  4MRX A;  4MZJ A;  4DCK A;  3RZS A;  4DIR A;  1A75 B;  3FE9 A;  2IS9 A;  2NCP A;  1HQV A;  5KTY A;  4MSP A;  1REC A;  3VRQ A;  1RRO A;  2K0J A;  3NSL A;  5B8I B;  5HLV A;  5K89 A;  1B4C A;  1K9K A;  1JF0 A;  5TNC A;  1A03 A;  2D8N A;  2LVI A;  1CMG A;  2EC6 C;  2WC6 A;  3PAT A;  2M49 B;  1S5G Z;  3EK8 A;  3HX4 A;  4INW A;  1BF5 A;  2JNF A;  3CZ1 A;  1OOJ A;  2BCX A;  2EGD A;  1SSE B;  2LCP A;  1CFD A;  1QIW A;  4CLN A;  2PQL A;  3AKA A;  1JBA A;  2GGZ A;  4FTG A;  4E68 A;  1QIV A;  3WXA A;  3AKB A;  1V1F A;  1YRU B;  4OKH A;  3ZNI A;  4MVF A;  4QJ5 B;  4DS7 A;  1FPW A;  4F0Z B;  1NCY A;  1N65 A;  2LM5 A;  2MHH A;  1SYM A;  2P70 A;  1EJ3 A;  3DVE A;  1H4B A;  3PSR A;  1F71 A;  4N1F A;  3C1V A;  3DVJ A;  1JFK A;  3JTD B;  1DGV A;  3DXL A;  1PAL A;  1KK8 C;  1UHJ A;  3TZ1 A;  1SCM C;  5I94 A;  2KBM A;  5CSI A;  2ISD A;  3PAL A;  1G33 A; 
#chains in the Genus database with same CATH homology
 1KQM C;  2RGI A;  2KYC A;  2AMI A;  3AAK A;  3SG7 A;  2I2R E;  2JOJ A;  1PSB A;  3M0W A;  3SIA A;  1DTL A;  4QJ3 B;  1SR6 B;  1NP8 A;  3EKJ A;  3GK1 A;  1DT7 B;  2FCE A;  3MSE B;  1IKU A;  5AER A;  1XK4 A;  2JXC A;  1XK4 C;  2M7N A;  1OZS A;  2NZ0 A;  2R2I A;  1J7R A;  1XFV O;  2M1K B;  3BUW B;  1BT6 A;  1QS7 A;  3CS1 A;  4PE0 A;  1CM4 A;  2ZKM X;  1GJY A;  2M3W A;  1S26 D;  1FF1 A;  3K21 A;  1AP4 A;  1TOP A;  5HKY A;  3DVK A;  2O60 A;  2WCB A;  3KEV A;  1BR4 B;  2QPT A;  1KFX L;  1UP5 A;  3LK0 A;  3TDZ A;  2KYF A;  1M31 A;  2HPS A;  2K7O A;  2PMY A;  3BOW A;  2I94 A;  4MRY A;  2OS8 C;  2DOQ A;  2JTZ A;  2OTG B;  3I5G B;  3O4Y A;  5DKR A;  1J1D A;  1HT9 A;  2KFG A;  1NUB A;  3EVU A;  2NXQ A;  1SBJ A;  1WRZ A;  4PDZ A;  3F45 A;  1Y1U A;  1TIZ A;  1YX7 A;  2ZN8 A;  2LP3 A;  1ZUZ A;  1MQ1 A;  1YVL A;  2ZN9 A;  1OQP A;  1SPY A;  1K9U A;  1DJI A;  2Q91 A;  4GAO A;  4DUQ A;  1BU3 A;  2OPO A;  4ORB B;  3CZT X;  2BCA A;  2FOT A;  2LNK A;  2LMV A;  1NIW A;  1XVJ A;  2E6W A;  3FIA A;  5AXI A;  3WHU B;  5KU1 A;  4NDD A;  1DJW A;  2JNX A;  2WC8 A;  1KFX S;  1QAT A;  1BJF A;  1CNP A;  3GOF A;  1W7J B;  2JWW A;  1MXL C;  1SRA A;  2EC6 B;  1KK7 Y;  1OZO A;  1G4Y R;  4AQJ A;  1Y6W A;  1F8H A;  4PHM A;  2SAS A;  2M97 A;  1AHR A;  2JUL A;  4PE7 A;  2L98 A;  2ZRS A;  2PAL A;  1OMR A;  2WND A;  1OE9 B;  3KHE A;  4P5O E;  4WQ3 A;  1J1E A;  3CR5 X;  1DJY A;  1CDP A;  2LP2 A;  2NCO A;  2M7L A;  1J7Q A;  2KHN A;  2JU0 A;  4I5L B;  5J3X A;  4FQO A;  1F4O A;  1ZMZ A;  4UPG A;  2L50 A;  1KCY A;  1PUL A;  2L2E A;  1DF0 A;  3JVT C;  1IQ3 A;  5HYD A;  1PVB A;  3BOW B;  3OX5 A;  4IL1 A;  1CFP A;  1N2D A;  4GNK B;  4YGA A;  1ALV A;  1XO5 A;  4MBE A;  5F6T A;  3KO0 A;  3GK4 X;  1C7W A;  1U5I B;  3DVM A;  1KK7 Z;  4GFT A;  3BUM B;  1CLL A;  1TCF A;  3HCM A;  3SIB A;  1DF0 B;  1QV1 A;  1DJH A;  4U8D A;  1V1G A;  2WCF A;  4PAL A;  4GGF A;  2KSP A;  3FS7 A;  3SJS A;  4CFR A;  2KBI A;  2LV7 A;  3ICB A;  2JC2 A;  4P2Y B;  1F55 A;  1PK0 D;  1M46 A;  2I18 A;  2BL0 B;  1B7T Z;  3D10 A;  3RM1 A;  1F54 A;  1UHH A;  5CSF A;  4XYN A;  2KOT A;  3KF9 A;  2H2K A;  4AQI A;  1TNQ A;  4GPL B;  2CTN A;  3SG6 A;  1TNW A;  1QTX A;  1SL7 A;  3SG3 A;  3DD4 A;  3O2P A;  3I5I C;  1K2H A;  4CID A;  2KFF A;  2BL0 C;  1A75 A;  5GQQ C;  5CSJ A;  3QRX A;  4WRI A;  2BBN A;  2L4I A;  4A4C A;  4GUK A;  4MZL A;  2F3Z A;  2JPT A;  4ZCU A;  3WHT B;  2LUC A;  2G2B A;  1TTX A;  2M29 A;  3I5G C;  1FI5 A;  1TCO B;  4M2Q A;  3TS5 B;  2G9B A;  2AAO A;  2SCP A;  1LA0 A;  1SNL A;  4PHN A;  5KSZ A;  2MRD A;  2E30 A;  4YI9 A;  2LHI A;  4C0K A;  2FCD A;  3DF0 A;  1EH2 A;  2K7B A;  5ER4 X;  1LKJ A;  5D7F A;  1CFC A;  4D1E A;  2BCB A;  1WRK A;  4L9M A;  4OVN F;  5G08 A;  3EK4 A;  1YUU A;  2LE9 B;  1A29 A;  1XFU O;  1MR8 A;  5I2L A;  1UUR A;  1Y1A A;  4MEW A;  4MLW A;  1UHN A;  2ZFD A;  1BG1 A;  1IWQ A;  4N5X A;  1UHI A;  2ZRT A;  1CM1 A;  1J7P A;  3TUY C;  1K95 A;  1CDM A;  1Q80 A;  1QVI Z;  1UHK A;  1XFY O;  1YUR A;  1QLK A;  2OTG C;  4XJK B;  1E8A A;  2BKH B;  4YBH B;  1DJX A;  2GV5 A;  1ZAC A;  1QJT A;  4I5J A;  5CSN A;  1UWO A;  5IBW A;  4ZCV A;  1TNP A;  1R2U A;  1QX7 A;  5DKQ A;  1L7Z A;  1ZOT B;  2WCE A;  1IJ5 A;  2LUX A;  2ZNE A;  3CLN A;  3OB2 B;  4BY4 A;  2F33 A;  1S6I A;  3KPX A;  5AEQ A;  2BE4 A;  1WLZ A;  4A4B A;  4TNC A;  1SL9 A;  1IRJ A;  3OHM B;  1CTR A;  1K9P A;  2WOS A;  3JVT B;  1DJZ A;  4OR9 B;  1NX0 A;  2I7A A;  4PHK A;  3PFV A;  1AK8 A;  1LVC D;  1CMF A;  4ORC B;  1DGU A;  3A4U B;  1OMD A;  1K93 D;  1YTZ C;  3O78 A;  4MZK A;  5D69 A;  2KNE A;  4JQ0 D;  2KAX A;  2MAZ A;  1EG3 A;  2LVK A;  1CLB A;  1RFJ A;  2JT3 A;  1B8L A;  2LVV A;  1QXP A;  4HSZ A;  1RK9 A;  5CPV A;  1J55 A;  5I2O A;  1D1O A;  3BUX B;  2LLT A;  1BOD A;  5BPJ A;  3CTN A;  4JWQ A;  1KWO C;  1U5I A;  2Y1N A;  1K90 D;  1SY9 A;  1A4P A;  4GGF C;  1M39 A;  2O5G A;  2MA2 A;  1QAS A;  4JPZ B;  2JT8 A;  1UUS A;  1F4Q A;  2LHL A;  3OP0 A;  4NQG A;  2PAS A;  4YGE B;  4QJ4 B;  1KFU L;  2LMU A;  1QV0 A;  1YR5 A;  4ORA B;  1RTP 1;  5AFP A;  1LXF C;  1KWO B;  2V53 A;  2L4H A;  1CDN A;  1J7O A;  3CGA A;  3AAJ A;  4PE4 A;  2M8U A;  3FWC A;  4WQ2 A;  2P6B B;  5JOL A;  1WLM A;  2HF5 A;  1QX5 B;  2LC5 A;  1H8B A;  1B9A A;  1MF8 B;  2HQW A;  3D0Y B;  4CFQ A;  2BKI B;  3BUN B;  1LIN A;  1MHO A;  1EXR A;  1SK6 D;  3BQ3 A;  3DF0 B;  3JTD C;  1CMG A;  1B47 A;  4YRU A;  1KK8 B;  4OCI A;  2LVJ A;  4ETO A;  1JUO A;  1SCM B;  1NX2 A;  2PRU A;  3IQQ A;  5FYX A;  1WDC C;  1S6C A;  1KQM B;  5I8N A;  2KI6 D;  5ER5 A;  1YVH A;  4C0J A;  1ODB A;  2BBM A;  1LA3 A;  4I5N B;  2HQ8 A;  5JJG A;  1MUX A;  1NWD A;  1WRL A;  4GBA A;  3BXK A;  2KI6 C;  3IQO A;  1TNX A;  4USL A;  2CCM A;  2KGB C;  2ZND A;  4GGN A;  3EK7 A;  1IH0 A;  1K96 A;  4XJK A;  4C0L A;  1CKK A;  2LLS A;  1Y0V H;  4N1G A;  1RJV A;  4YGC B;  5I2Q A;  1PVA A;  1YUS A;  1JFJ A;  1B7T Y;  4M2O A;  1QX2 A;  2KAY A;  1YX8 A;  1IQ5 A;  4MN0 A;  3EVR A;  2EHB A;  1B8C A;  1M45 A;  2A4J A;  2L51 A;  2L5X B;  5DKN A;  1KSM A;  1SMG A;  1FW4 A;  3D0Y A;  1TRF A;  2F3Y A;  2OS8 B;  1OSA A;  2F8P A;  4R1E A;  3I5H C;  3NSK A;  1CFF A;  5HLO A;  2MLF C;  3PN7 C;  4NDB A;  1Y1X A;  2KI4 C;  2GGM A;  3BYA A;  2K8M B;  3IF7 A;  4PHJ A;  3TDU A;  1S6J A;  1SKT A;  2CNP A;  1B8R A;  1S3P A;  1WY9 A;  1ZFS A;  5HKZ A;  1NCX A;  2MBX A;  1SL8 A;  1NX1 A;  2B1U A;  1C7V A;  1KQV A;  3PN7 B;  1CDL A;  1DJG A;  1XA5 A;  4BY5 A;  3VRO A;  1JWD A;  1B1G A;  1K94 A;  1VRK A;  1KFU S;  1N0Y A;  2JZI A;  2MJW B;  4YGD B;  3OX6 A;  1BR1 B;  3PM8 A;  3VRP A;  2KAV A;  3TDI A;  1DVI A;  1A2X A;  2K61 A;  2VRG A;  5HKW A;  4HRE E;  3GK2 A;  3H4S E;  2Q4U A;  1QLS A;  3WNX B;  4NDC A;  3CR4 X;  5PAL A;  1QVI Y;  4HRG A;  3BUO B;  4OV2 A;  3A8R A;  4AOM A;  2L0P A;  2LAP A;  2LLU A;  1AJ5 A;  4Q04 A;  1K8U A;  1G8I A;  1KSO A;  1IJ6 A;  2HET A;  2LAN A;  2Y1M A;  4HRH A;  1JC2 A;  4CPV A;  2PVB A;  1JF2 A;  1EL4 A;  1SR6 C;  1XFZ O;  1FI6 A;  2JQ6 A;  4YI8 A;  4M2P A;  1CLM A;  2COL B;  1EG4 A;  3CR2 A;  1AUI B;  1SW8 A;  2MLE C;  2BEC A;  3VRN A;  1BLQ A;  1CB1 A;  2CXJ A;  1OMV A;  1WDC B;  2K2F A;  2K7D A;  3SG2 A;  3I5F C;  1X02 A;  1DMO A;  2H61 C;  1M63 B;  1W7I B;  3LL8 B;  3ZWH A;  1GQM A;  4ICB A;  3SG5 A;  3OB1 B;  3EKH A;  2KGR A;  3EVV A;  4PE1 A;  3O6B A;  1YUT A;  2JTT A;  3I5F B;  1RWY A;  2M0R A;  3PLF B;  1MXE A;  1PRW A;  2JXL A;  4DRW A;  2AUC A;  2H61 A;  1AJ4 A;  1XFX O;  2M1U A;  3I5I B;  1S1E A;  2KQ6 A;  2QAC A;  1AVS A;  1ALW A;  2F2O A;  2CBL A;  1C07 A;  1XYD A;  2CT9 A;  1NYA A;  3LCP C;  5AAN A;  3RLZ A;  2FJU B;  3LK1 A;  1TN4 A;  1PSR A;  3NXA A;  1BOC A;  1NX3 A;  3NSO A;  3TS5 C;  2JT0 A;  1XFW O;  2WOR A;  1F70 A;  1SCV A;  2KI4 B;  3E3R A;  1IGV A;  2F2P A;  2KFH A;  2TN4 A;  3LLE A;  1FBV A;  1JSA A;  1L2O C;  4I5K A;  1S5G Y;  4PCW A;  1YRT B;  2NLN A;  3VRR A;  1IG5 A;  1NCZ A;  2K2A A;  1BMO A;  2KDH A;  1NSH A;  1GGW A;  2K7C A;  3NSI A;  1S36 A;  1MWN A;  4YGB B;  3SG4 A;  3VGO A;  3FWB A;  1R6P A;  3TUY B;  1L2O B;  2LMT A;  2KQY A;  2Y4Q A;  2BE6 A;  1GGZ A;  3CWG A;  2JRF A;  2Y5I A;  3I5H B;  2M9G A;  1NPQ A;  2PSR A;  4MRX A;  4MZJ A;  4DCK A;  4DIR A;  1A75 B;  2IS9 A;  2NCP A;  1HQV A;  5KTY A;  4MSP A;  1REC A;  3VRQ A;  1RRO A;  2K0J A;  3NSL A;  5B8I B;  5HLV A;  5K89 A;  1B4C A;  1K9K A;  1JF0 A;  5TNC A;  1A03 A;  2D8N A;  2LVI A;  2EC6 C;  3PAT A;  2M49 B;  1S5G Z;  3EK8 A;  3HX4 A;  1BF5 A;  2JNF A;  1OOJ A;  2BCX A;  2EGD A;  2LCP A;  1CFD A;  1QIW A;  4CLN A;  3AKA A;  1JBA A;  2GGZ A;  4FTG A;  4E68 A;  1QIV A;  3WXA A;  3AKB A;  1V1F A;  1YRU B;  4OKH A;  3ZNI A;  4MVF A;  4QJ5 B;  4DS7 A;  1FPW A;  4F0Z B;  1NCY A;  1N65 A;  2LM5 A;  2MHH A;  1SYM A;  3DVE A;  1EJ3 A;  1H4B A;  3PSR A;  1F71 A;  4N1F A;  3C1V A;  3DVJ A;  1JFK A;  3JTD B;  1DGV A;  1PAL A;  1KK8 C;  1UHJ A;  3TZ1 A;  1SCM C;  2KBM A;  5CSI A;  2ISD A;  3PAL A;  1G33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...