4NDDA

X-ray structure of a double mutant of calexcitin - a neuronal calcium-signalling protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARADLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calexcitin
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
molecule tags Signaling protein
total genus 72
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4nddA00
1OOJA 1DJHA 1G33A 3VROA 2KAXA 1CMGA 1KFUS 1L2OB 1S6CA 3BYAA 1LINA 2AAOA 3SG3A 3GK2A 5CSNA 1GGZA 1H4BA 2MAZA 2BBMA 1DJIA 1FBVA 2RGIA 1QVIZ 1OMRA 5DKRA 2ISDA 2K61A 2PASA 2MJWB 2F2OA 1NWDA 2CXJA 4NDCA 2JRFA 1CM4A 2K7CA 3BUWB 2BE6A 1JC2A 2I94A 1TCOB 2NCPA 4GGNA 3BUOB 2FOTA 4NDBA 5ER4X 1E8AA 1CKKA 1WRLA 2JZIA 4XJKA 2ZNEA 4YI9A 2M1UA 4MRXA 1F8HA 3EK8A 2M7NA 4DS7A 2KNEA 1BR1B 3OX5A 2JOJA 1V1GA 1BT6A 1PALA 4ORCB 1J7OA 1TNQA 2F8PA 3CR5X 1H8BA 3O4YA 1MF8B 1JWDA 1KQVA 1B1GA 1TOPA 2OTGC 1F4OA 4M2OA 1HQVA 2K2AA 3O6BA 2WORA 3VRNA 4QJ4B 4WQ3A 1TNXA 3IQOA 2JXCA 3PLFB 1S5GY 3LLEA 1NIWA 3LK0A 1CB1A 2LE9B 4C0JA 1NUBA 3WNXB 1K95A 1QS7A 4XJKB 2H61C 1YVLA 1K2HA 2LVIA 1K96A 4GNKB 5KSZA 4N5XA 4AOMA 1TTXA 3FWCA 4I5JA 3SIAA 2L2EA 3CR4X 1IJ5A 1C07A 1J7RA 3GK1A 3FWBA 1AVSA 1YUSA 4YBHB 3M0WA 2L50A 3DF0B 1YUTA 1NX0A 2Q4UA 1NX3A 1CDMA 1SR6B 4JWQA 1K9KA 2CNPA 2HQ8A 3I5FB 4F0ZB 1F55A 1OQPA 3EKHA 4MSPA 1XYDA 4MZKA 2COLB 1JF2A 5CSFA 3LL8B 1KWOB 2JT0A 5F6TA 1EXRA 1MR8A 1SL7A 2EC6B 3K21A 1BR4B 1DF0A 3D10A 3MSEB 1N2DA 2EHBA 4ORAB 3FS7A 2IS9A 4OCIA 5CSJA 1QIVA 4PHJA 1EG3A 2JT3A 1OMVA 2NZ0A 1SKTA 3TDIA 1XO5A 2AMIA 2JNXA 2O5GA 2KBMA 1ZMZA 2LVKA 1U5IB 2JULA 2MRDA 1GGWA 4N1FA 1CLBA 3NSLA 4OV2A 1C7WA 1X02A 1QTXA 2B1UA 2O60A 4FTGA 2KBIA 3KO0A 2JPTA 4MN0A 1FW4A 1CFDA 1QVIY 2QPTA 1S26D 1B9AA 2KYFA 4DCKA 5HYDA 1A75A 1HT9A 2M0RA 3AAKA 3JVTC 4BY5A 5CSIA 1YRTB 1J55A 1N65A 1RECA 3EVUA 4R1EA 2LANA 4CLNA 5TNCA 5G08A 1K93D 1VRKA 2OTGB 1WRZA 1WDCC 2PVBA 2ZFDA 3AKBA 3CTNA 4PCWA 5K89A 1B4CA 2Y5IA 3I5IC 2JTZA 2OS8C 1EH2A 2PRUA 4YGAA 4GGFA 1EJ3A 1CFCA 2L98A 1QJTA 3SG2A 1BG1A 2KGBC 1BMOA 1B47A 3AAJA 5CPVA 2Q91A 4N1GA 2LAPA 1LA3A 5I2LA 1J1EA 2OPOA 2NCOA 1K9UA 2KI4B 1MUXA 2Y4QA 4HRGA 1W7IB 1M45A 2KDHA 5I2QA 2LLTA 2ZRSA 2BE4A 2EGDA 2WOSA 2ZN9A 1KK8C 1WLZA 1XK4A 2FCEA 1XFUO 4PALA 4Q04A 5JJGA 1KQMC 3JTDB 5D7FA 4DRWA 2E6WA 2K7DA 1M39A 1LVCD 2LLUA 2LP2A 4HRHA 4P2YB 3PM8A 1UHNA 1MWNA 1KK7Z 1CDPA 2CBLA 2I2RE 2WC8A 2P6BB 4PHMA 3SG4A 1QV0A 5AEQA 1XFXO 1ZOTB 3TDZA 1JUOA 1NCXA 2KQYA 1IH0A 2Y1MA 4PHNA 1RK9A 4I5LB 1XFZO 4CIDA 4WQ2A 2LC5A 4PE7A 3I5HB 1CDNA 2M49B 2JU0A 1MXEA 1NYAA 2KQ6A 1QATA 3DF0A 3EVVA 1PRWA 3CGAA 1YUUA 1CFPA 3GK4X 3PSRA 3TS5C 2WCBA 2BL0C 4I5KA 3VGOA 4TNCA 2BCAA 3EK4A 3VRPA 4YGDB 3JVTB 3C1VA 1RTP1 2F3ZA 3IF7A 1SW8A 2GGZA 2JTTA 4OKHA 1C7VA 3OX6A 1B8CA 5AXIA 2L4IA 1DTLA 4CFRA 1CLLA 4P5OE 1DJWA 1A03A 1WDCB 3PALA 4ORBB 1CFFA 2LUCA 3I5IB 1NCYA 1CTRA 2MLEC 1Y0VH 4M2PA 1YR5A 3I5GC 2JC2A 1LKJA 3SG6A 3WHUB 4ICBA 1AJ4A 1U5IA 1G8IA 2KI6C 1TNPA 3TUYB 5B8IB 2F33A 2JWWA 5HKYA 2LUXA 2LNKA 2LP3A 4IL1A 4NDDA 1AK8A 3BUMB 2QACA 1MQ1A 4GPLB 1SPYA 4AQIA 1XFWO 4YI8A 2LMVA 1L7ZA 3FIAA 2JQ6A 3CS1A 3HCMA 3TZ1A 1KK8B 1R2UA 2KFHA 1BU3A 1SMGA 3RLZA 1RROA 1QX5B 1OMDA 3BQ3A 1YTZC 1KQMB 2D8NA 2LHLA 2ZNDA 3A8RA 1NX1A 1FI6A 1UWOA 2NLNA 1JFKA 5IBWA 4XYNA 2K7BA 3OB2B 5KU1A 1MHOA 1OZOA 2PMYA 2ZKMX 3CR2A 1JFJA 1BOCA 1BF5A 4M2QA 4I5NB 1FI5A 1CDLA 4A4CA 3BUNB 2H61A 1V1FA 3DVMA 5AANA 1DGVA 1KSOA 2NXQA 3QRXA 2SASA 1S1EA 4PE0A 1J1DA 1KFXL 2KOTA 2L0PA 2MHHA 3F45A 1CNPA 1K94A 2KI6D 1J7PA 1PVAA 4NQGA 4PE4A 1IKUA 1G4YR 2K0JA 4YGBB 1KK7Y 2M9GA 2VRGA 3TS5B 2BCXA 1SNLA 1QIWA 2M8UA 4GBAA 1DGUA 5AFPA 1SYMA 2BL0B 5ER5A 1W7JB 4C0LA 3SG7A 1DJXA 1AJ5A 3VRRA 5I2OA 1KSMA 1NSHA 1NPQA 2LMTA 1QXPA 2WCEA 4MVFA 2HPSA 1FF1A 3NSIA 1OZSA 4JPZB 5HKWA 4MLWA 3ZWHA 1CMFA 1M63B 2BKHB 1QLKA 3BOWB 2JXLA 3PFVA 2LVVA 1UHHA 3EK7A 1GQMA 3I5GB 2G9BA 3O78A 3DVJA 5DKQA 2M29A 1RWYA 2M3WA 1B7TZ 2AUCA 3RM1A 1SL9A 4UPGA 1F71A 2F3YA 2KSPA 4PHKA 4MZLA 1YRUB 1JSAA 4ETOA 2KFFA 1PSRA 4DUQA 1QV1A 1YURA 1IWQA 3PN7C 1MXLC 1KFXS 4YRUA 5BPJA 1N0YA 1TNWA 1SCMC 4L9MA 2TN4A 2E30A 1RFJA 3D0YA 3NSKA 3KHEA 1WRKA 2GGMA 3KEVA 3OHMB 2LV7A 1EL4A 2WCFA 4ZCVA 1Y1UA 1UUSA 2A4JA 2SCPA 2CT9A 4HREE 1QX7A 2LM5A 1TN4A 2K2FA 4WRIA 2ZRTA 2GV5A 3DD4A 1A2XA 1PK0D 2F2PA 2LLSA 2V53A 1AP4A 1SRAA 4MZJA 3E3RA 3GOFA 4A4BA 5I8NA 3PATA 4PDZA 4CFQA 1ALVA 1AUIB 1IGVA 1QLSA 2M97A 2L4HA 2ZN8A 1BODA 3ICBA 3ZNIA 3BXKA 2LCPA 2K8MB 1RJVA 1CM1A 3D0YB 1JF0A 1IJ6A 1YX8A 3SIBA 1OSAA 2JNFA 4E68A 1NX2A 1DT7B 3SJSA 3IQQA 2MA2A 3KF9A 5FYXA 1Y6WA 5HKZA 1PULA 3A4UB 2OS8B 1FPWA 5J3XA 3AKAA 3HX4A 3DVKA 5JOLA 1S36A 2JT8A 2FCDA 1KCYA 1ZACA 1XFVO 2KYCA 4BY4A 4AQJA 1OE9B 2L51A 1DJYA 4FQOA 3LK1A 3H4SE 1NP8A 1WLMA 4OVNF 3EKJA 1Q80A 1BJFA 3OB1B 1DJZA 4CPVA 5AERA 1IG5A 2KFGA 5D69A 2KI4C 3DVEA 4U8DA 1DJGA 1UHKA 1XVJA 1QASA 2LHIA 1K8UA 1XFYO 4QJ3B 1S3PA 1M31A 3WXAA 1L2OC 1UP5A 1UURA 2FJUB 3SG5A 1SK6D 3O2PA 1IQ3A 3JTDC 4MRYA 2MBXA 4YGCB 1EG4A 1YX7A 4DIRA 1A4PA 4YGEB 3PN7B 1F54A 3CZTX 1TRFA 2Y1NA 1SCMB 2KGRA 5GQQC 3WHTB 4GGFC 1B7TY 1S6JA 1SBJA 2PALA 3EVRA 5KTYA 1ZFSA 1CLMA 2BBNA 4USLA 2HF5A 3NSOA 2LMUA 3OP0A 2DOQA 3BOWA 1K9PA 2LVJA 2CCMA 2K7OA 4QJ5B 1SCVA 2CTNA 1S5GZ 2L5XB 1KFUL 2KHNA 3I5HC 4MEWA 2BECA 1R6PA 1UHJA 1F4QA 1XK4C 2KAVA 4OR9B 2R2IA 1SL8A 1ZUZA 4D1EA 1S6IA 1A29A 3VRQA 1BLQA 1PVBA 1PSBA 1DMOA 1B8RA 2PSRA 3CLNA 3TDUA 1M46A 3LCPC 1SY9A 1DF0B 1F70A 1YVHA 4MBEA 1JBAA 1QX2A 1Y1XA 4ZCUA 4PE1A 1TIZA 2I18A 2M7LA 3KPXA 1XA5A 1Y1AA 2M1KB 2HETA 3NXAA 4HSZA 1WY9A 1AHRA 1ALWA 1ODBA 5HLVA 3CWGA 3BUXB 1IQ5A 1J7QA 1TCFA 1NCZA 2H2KA 1B8LA 4C0KA 1SR6C 2I7AA 1IRJA 4GFTA 5HLOA 3TUYC 1GJYA 3I5FC 2HQWA 2MLFC 5DKNA 2BKIB 4GUKA 1LA0A 4GAOA 1DVIA 1D1OA 2G2BA 2WNDA 1UHIA 1LXFC 2BCBA 1K90D 1KWOC 2KAYA 5PALA 1A75B 4JQ0D 2EC6C
chains in the Genus database with same CATH superfamily
1OOJA 1DJHA 1G33A 2K60A 2KAXA 3VROA 1CMGA 1KFUS 1L2OB 1S6CA 3BYAA 1LINA 2AAOA 3SG3A 3GK2A 5CSNA 1GGZA 1H4BA 2MAZA 2BBMA 1DJIA 1FBVA 2RGIA 1QVIZ 1OMRA 3NHTA 5DKRA 2ISDA 3D77A 2K61A 2PASA 2MJWB 2F2OA 1NWDA 2CXJA 4NDCA 2JRFA 1CM4A 2K7CA 2PQLA 3BUWB 2BE6A 1JC2A 2I94A 1TCOB 2NCPA 4GGNA 3BUOB 2FOTA 4NDBA 5ER4X 1E8AA 1DEKA 1CKKA 1WRLA 2JZIA 4XJKA 2ZNEA 4YI9A 2M1UA 4MRXA 1F8HA 1DQEA 3EK8A 2M7NA 4DS7A 2KNEA 1BR1B 2YGUA 3OX5A 2JOJA 1V1GA 1BT6A 1PALA 4ORCB 1J7OA 1TNQA 2F8PA 3CR5X 1IIOA 1H8BA 3O4YA 1MF8B 2BAPA 4INWA 3B87A 4JKTA 1JWDA 1KQVA 1B1GA 1TOPA 3CYZA 3DYEA 2OTGC 1F4OA 4M2OA 1HQVA 2K2AA 3O6BA 2WORA 3VRNA 4QJ4B 4WQ3A 1TNXA 3IQOA 2JXCA 3PLFB 1S5GY 3LLEA 1NIWA 3LK0A 1CB1A 2LE9B 4C0JA 1NUBA 3WNXB 1K95A 1QS7A 3K1EA 2H61C 1YVLA 4XJKB 1K2HA 2LVIA 1K96A 4GNKB 1LS8A 5KSZA 4N5XA 3SS3A 1Z2CB 3S0DA 4AOMA 1TTXA 3FWCA 4I5JA 3SIAA 2L2EA 3CR4X 1IJ5A 3D73A 1J7RA 4KYNA 3GK1A 3FWBA 1AVSA 1YUSA 4YBHB 3M0WA 3UNWA 2L50A 3DF0B 1YUTA 1NX0A 2Q4UA 1NX3A 1CDMA 1SR6B 2WCJA 4JWQA 3UO9A 1K9KA 2CNPA 5EL2A 2HQ8A 5FI2A 3I5FB 4F0ZB 1TUZA 1F55A 1OQPA 3EKHA 4MSPA 1XYDA 4MZKA 2COLB 1JF2A 5CSFA 3LL8B 1KWOB 2JT0A 5F6TA 1EXRA 4IJ7A 1MR8A 1SL7A 2EC6B 3K21A 1BR4B 1DF0A 3D10A 3MSEB 3R1OA 1N2DA 2EHBA 4ORAB 2QEVA 3FS7A 2IS9A 4OCIA 5CSJA 1QIVA 4F7FA 4PHJA 1EG3A 2JT3A 1DC1A 1OMVA 2NZ0A 1SKTA 3TDIA 1XO5A 2AMIA 2JNXA 2O5GA 2KBMA 5I94A 1ZMZA 2LVKA 1U5IB 2JULA 2MRDA 1GGWA 4N1FA 1CLBA 2GTEA 3NSLA 4OV2A 2L2CA 1C7WA 1X02A 1QTXA 2B1UA 2QEHA 2O60A 4FTGA 2KBIA 3KO0A 2JPTA 3D78A 4MN0A 1FW4A 1CFDA 1QVIY 2QPTA 1S26D 1B9AA 2KYFA 4DCKA 5HYDA 1A75A 1HT9A 2M0RA 3AAKA 3JVTC 4BY5A 5CSIA 1YRTB 1J55A 1N65A 1RECA 3EVUA 4R1EA 2LANA 4CLNA 5TNCA 5G08A 1K93D 1VRKA 2OTGB 1WRZA 1WDCC 2PVBA 2ZFDA 3AKBA 3CTNA 4PCWA 5K89A 1OOIX 1B4CA 2Y5IA 3I5IC 2QEBA 2JTZA 2OS8C 1EH2A 2PRUA 4YGAA 4GGFA 3SS4A 1EJ3A 2H8VA 1CFCA 1TUJA 2L98A 1QJTA 3SG2A 1BG1A 1SSEB 2L5YA 3OBVA 2KGBC 1BMOA 1B47A 3AAJA 5CPVA 2Q91A 4N1GA 2LAPA 1LA3A 1W9ZA 5I2LA 1J1EA 2OPOA 2NCOA 1K9UA 2KI4B 1MUXA 2Y4QA 4HRGA 1W7IB 1M45A 2KDHA 5I2QA 2LLTA 2ZRSA 2BE4A 2EGDA 2WC5A 2WOSA 2ZN9A 1KK8C 1WLZA 1XK4A 3N7HA 2FCEA 1XFUO 1OOHA 4PALA 4Q04A 5JJGA 1KQMC 3JTDB 5D7FA 4DRWA 2E6WA 2K7DA 1M39A 1LVCD 2LLUA 2LP2A 4HRHA 4P2YB 3PM8A 1UHNA 1MWNA 1KK7Z 1CDPA 2CBLA 2I2RE 2WC8A 2P6BB 3BJHA 3CDNA 4PHMA 3SG4A 5HL1A 1QV0A 5AEQA 1XFXO 3CABA 1ZOTB 3TDZA 1JUOA 1NCXA 2KQYA 1IH0A 2Y1MA 4PHNA 1RK9A 4I5LB 1XFZO 4CIDA 4WQ2A 2LC5A 4PE7A 3I5HB 1ORGA 3FE6A 1CDNA 2M49B 2JU0A 1MXEA 1NYAA 2KQ6A 3VB1A 1QATA 3DF0A 3EVVA 1PRWA 3CGAA 1YUUA 2BNXA 1CFPA 3GK4X 3PSRA 3TS5C 2WCBA 2BL0C 4I5KA 3VGOA 4TNCA 1Z4HA 2BCAA 3EK4A 3R1VA 3VRPA 4YGDB 3JVTB 3C1VA 1RTP1 2F3ZA 3CZ1A 3IF7A 1SW8A 2GGZA 2JTTA 4OKHA 1C7VA 3OX6A 1B8CA 5D3OA 5AXIA 2L4IA 1DTLA 4CFRA 1CLLA 1C3ZA 4P5OE 1DJWA 1A03A 1WDCB 2WCLA 3S0GA 3PALA 4ORBB 1CFFA 2LUCA 3I5IB 3IVTA 1NCYA 1CTRA 2KLEA 2MLEC 3FE8A 1GM0A 1Y0VH 3B6XA 2P70A 4M2PA 1YR5A 3I5GC 2JC2A 1LKJA 3SG6A 3WHUB 4ICBA 1AJ4A 1U5IA 1G8IA 2KI6C 1TNPA 3TUYB 5B8IB 2F33A 2JWWA 5HKYA 3FE9A 2LUXA 2LNKA 2LP3A 4IL1A 4NDDA 1AK8A 3BUMB 2QACA 1MQ1A 4GPLB 1SPYA 4AQIA 1XFWO 4YI8A 2LMVA 1L7ZA 3FIAA 2JQ6A 3CS1A 3HCMA 3TZ1A 1KK8B 1R2UA 2KFHA 1BU3A 1SMGA 2JPOA 3RLZA 1OW4A 1RROA 1QX5B 1OMDA 3BQ3A 1YTZC 1KQMB 2D8NA 2LHLA 2ZNDA 3A8RA 1NX1A 1FI6A 1UWOA 2NLNA 1JFKA 5IBWA 4XYNA 2K7BA 3OB2B 5KU1A 1MHOA 1OZOA 2PMYA 2ZKMX 3CR2A 1JFJA 1BOCA 5FI7A 1BF5A 3QMEA 4I5NB 4M2QA 1FI5A 3Q8IA 1CDLA 3L4AA 4A4CA 3BUNB 2H61A 3S0FA 1V1FA 3DVMA 5AANA 3DZTA 2QDIA 1DGVA 1KSOA 5DICA 2NXQA 3QRXA 2SASA 1S1EA 4PE0A 1J1DA 1KFXL 2KOTA 2L0PA 2MHHA 3F45A 3B86A 1CNPA 1K94A 2KI6D 1J7PA 1PVAA 4NQGA 4PE4A 1IKUA 1G4YR 2K0JA 4YGBB 1KK7Y 2M9GA 2VRGA 3TS5B 2BCXA 1SNLA 1QIWA 2M8UA 4GBAA 1DGUA 5AFPA 1SYMA 2BL0B 3B88A 3BFBA 1W7JB 5ER5A 3SG7A 1DJXA 1AJ5A 3VRRA 4C0LA 5I2OA 1KSMA 1NSHA 1NPQA 2LMTA 1QXPA 2WCEA 4MVFA 2HPSA 1FF1A 4FQTA 3NSIA 3CZ2A 3NGVA 3D75A 4PT1A 1OZSA 4JPZB 5HKWA 4MLWA 3ZWHA 2KPHA 1CMFA 1M63B 2BKHB 1QLKA 3BOWB 2JXLA 2KLDA 3PFVA 2LVVA 1UHHA 1C3YA 3EK7A 1P28A 1GQMA 3I5GB 2G9BA 3O78A 3DVJA 5DKQA 2M29A 1RWYA 2M3WA 1B7TZ 2AUCA 3RM1A 1XFRA 1SL9A 4UPGA 1F71A 2F3YA 2KSPA 4PHKA 4MZLA 1YRUB 1JSAA 4ETOA 2KFFA 1PSRA 4DUQA 1QV1A 1YURA 1IWQA 3PN7C 1OOGA 1MXLC 1KFXS 4YRUA 5BPJA 1N0YA 1TNWA 1SCMC 4L9MA 2TN4A 2E30A 1RFJA 3D0YA 3NSKA 3KHEA 1WRKA 2GGMA 3KEVA 2FJYA 3OHMB 3SS5A 2LV7A 1EL4A 2WCFA 4ZCVA 1Y1UA 1UUSA 2A4JA 1TWOA 2CT9A 2SCPA 4HREE 1QX7A 2LM5A 1TN4A 2K2FA 4WRIA 2ZRTA 3S0BA 2GV5A 1QWVA 3DD4A 3DY9A 1A2XA 1PK0D 2F2PA 1OOFA 2LLSA 2V53A 1AP4A 1SRAA 3CZ0A 4MZJA 2WC6A 4JD9A 3E3RA 3GOFA 4A4BA 5I8NA 3PATA 4PDZA 4CFQA 1ALVA 1AUIB 1IGVA 1QLSA 2M97A 2L4HA 2ZN8A 3RZSA 1BODA 3ICBA 3ZNIA 3BXKA 2LCPA 2K8MB 1RJVA 1CM1A 3D0YB 1JF0A 1IJ6A 1YX8A 3SIBA 1OSAA 2JNFA 4E68A 1NX2A 1DT7B 3SJSA 3IQQA 2MA2A 1DELA 3KF9A 1Y6WA 5FYXA 2WCHA 1PULA 3A4UB 2OS8B 5HKZA 1FPWA 5J3XA 3AKAA 3S0AA 3HX4A 3DVKA 3D74A 5JOLA 1S36A 3EG5B 3D76A 4OZDA 2JT8A 2FCDA 2PYQA 1KCYA 1ZACA 1XFVO 2KYCA 4BY4A 4AQJA 1OE9B 2L51A 1DJYA 4FQOA 3LK1A 3H4SE 1NP8A 1WLMA 4OVNF 3EKJA 1Q80A 3S0EA 1BJFA 3O4XA 3OB1B 1DJZA 4CPVA 5AERA 1IG5A 3OGNA 2KFGA 5FI6A 5D69A 2KI4C 3DVEA 4U8DA 1DJGA 1UHKA 1XVJA 1QASA 3B7AA 2LHIA 1K8UA 1XFYO 4QJ3B 1S3PA 1M31A 3PM2A 3WXAA 1L2OC 1UP5A 1UURA 2FJUB 3SG5A 1SK6D 3O2PA 1IQ3A 3JTDC 4MRYA 2MBXA 4YGCB 1EG4A 1YX7A 4DIRA 1A4PA 4YGEB 3PN7B 1F54A 3CZTX 1TRFA 2Y1NA 1SCMB 2KGRA 5GQQC 2WCKA 3WHTB 4GGFC 3BFHA 1B7TY 1S6JA 1SBJA 2PALA 3EVRA 5KTYA 1ZFSA 1CLMA 2BBNA 4USLA 2HF5A 3NSOA 2LMUA 3L4LA 3OP0A 2DOQA 3BOWA 1K9PA 2LVJA 2CCMA 2K7OA 4QJ5B 1SCVA 2CTNA 1S5GZ 2ERBA 2L5XB 1KFUL 2KHNA 3I5HC 3R1PA 4MEWA 2BECA 1R6PA 1UHJA 1F4QA 1XK4C 2KAVA 3NHIA 2R2IA 1SL8A 3L47A 1ZUZA 4INXA 4OR9B 3V2LA 4D1EA 1S6IA 1A29A 3VRQA 1BLQA 1PVBA 1PSBA 1DMOA 1B8RA 2PSRA 3CLNA 3TDUA 1M46A 3LCPC 1C07A 1SY9A 3PJIA 1DF0B 1F70A 1YVHA 4MBEA 1JBAA 1QX2A 1Y1XA 4ZCUA 3DXLA 4PE1A 1TIZA 2I18A 2M7LA 3KPXA 1XA5A 1Y1AA 2M1KB 2HETA 3NXAA 4HSZA 1WY9A 1AHRA 1ALWA 1ODBA 5HLVA 2WCMA 3CWGA 3BUXB 1IQ5A 1J7QA 1TCFA 1NCZA 2H2KA 1B8LA 4C0KA 1SR6C 1T14A 2I7AA 1IRJA 4GFTA 5HLOA 3TUYC 1GJYA 3I5FC 2HQWA 2MLFC 5DKNA 2BKIB 4GUKA 1LA0A 4GAOA 2QEOA 1DVIA 1D1OA 2G2BA 2WNDA 1UHIA 1LXFC 2BCBA 1K90D 1KWOC 2KAYA 2P71A 1A75B 3BFAA 3R72A 5PALA 4JQ0D 2EC6C
chains in the Genus database with same CATH topology
1OOJA 1DJHA 1G33A 3VROA 2KAXA 1CMGA 1KFUS 1L2OB 1S6CA 3BYAA 1LINA 2AAOA 3SG3A 3GK2A 5CSNA 1GGZA 1H4BA 2MAZA 2BBMA 1DJIA 1FBVA 2RGIA 1QVIZ 1OMRA 5DKRA 2ISDA 2K61A 2PASA 2MJWB 2F2OA 1NWDA 2CXJA 4NDCA 2JRFA 1CM4A 2K7CA 3BUWB 2BE6A 1JC2A 2I94A 1TCOB 2NCPA 4GGNA 3BUOB 2FOTA 4NDBA 5ER4X 1E8AA 1CKKA 1WRLA 2JZIA 4XJKA 2ZNEA 4YI9A 2M1UA 4MRXA 1F8HA 3EK8A 2M7NA 4DS7A 2KNEA 1BR1B 3OX5A 2JOJA 1V1GA 1BT6A 1PALA 4ORCB 1J7OA 1TNQA 2F8PA 3CR5X 1H8BA 3O4YA 1MF8B 1JWDA 1KQVA 1B1GA 1TOPA 2OTGC 1F4OA 4M2OA 1HQVA 2K2AA 3O6BA 2WORA 3VRNA 4QJ4B 4WQ3A 1TNXA 3IQOA 2JXCA 3PLFB 1S5GY 3LLEA 1NIWA 3LK0A 1CB1A 2LE9B 4C0JA 1NUBA 3WNXB 1K95A 1QS7A 4XJKB 2H61C 1YVLA 1K2HA 2LVIA 1K96A 4GNKB 5KSZA 4N5XA 4AOMA 1TTXA 3FWCA 4I5JA 3SIAA 2L2EA 3CR4X 1IJ5A 1C07A 1J7RA 3GK1A 3FWBA 1AVSA 1YUSA 4YBHB 3M0WA 2L50A 3DF0B 1YUTA 1NX0A 2Q4UA 1NX3A 1CDMA 1SR6B 4JWQA 1K9KA 2CNPA 2HQ8A 3I5FB 4F0ZB 1F55A 1OQPA 3EKHA 4MSPA 1XYDA 4MZKA 2COLB 1JF2A 5CSFA 3LL8B 1KWOB 2JT0A 5F6TA 1EXRA 1MR8A 1SL7A 2EC6B 3K21A 1BR4B 1DF0A 3D10A 3MSEB 1N2DA 2EHBA 4ORAB 3FS7A 2IS9A 4OCIA 5CSJA 1QIVA 4PHJA 1EG3A 2JT3A 1OMVA 2NZ0A 1SKTA 3TDIA 1XO5A 2AMIA 2JNXA 2O5GA 2KBMA 1ZMZA 2LVKA 1U5IB 2JULA 2MRDA 1GGWA 4N1FA 1CLBA 3NSLA 4OV2A 1C7WA 1X02A 1QTXA 2B1UA 2O60A 4FTGA 2KBIA 3KO0A 2JPTA 4MN0A 1FW4A 1CFDA 1QVIY 2QPTA 1S26D 1B9AA 2KYFA 4DCKA 5HYDA 1A75A 1HT9A 2M0RA 3AAKA 3JVTC 4BY5A 5CSIA 1YRTB 1J55A 1N65A 1RECA 3EVUA 4R1EA 2LANA 4CLNA 5TNCA 5G08A 1K93D 1VRKA 2OTGB 1WRZA 1WDCC 2PVBA 2ZFDA 3AKBA 3CTNA 4PCWA 5K89A 1B4CA 2Y5IA 3I5IC 2JTZA 2OS8C 1EH2A 2PRUA 4YGAA 4GGFA 1EJ3A 1CFCA 2L98A 1QJTA 3SG2A 1BG1A 2KGBC 1BMOA 1B47A 3AAJA 5CPVA 2Q91A 4N1GA 2LAPA 1LA3A 5I2LA 1J1EA 2OPOA 2NCOA 1K9UA 2KI4B 1MUXA 2Y4QA 4HRGA 1W7IB 1M45A 2KDHA 5I2QA 2LLTA 2ZRSA 2BE4A 2EGDA 2WOSA 2ZN9A 1KK8C 1WLZA 1XK4A 2FCEA 1XFUO 4PALA 4Q04A 5JJGA 1KQMC 3JTDB 5D7FA 4DRWA 2E6WA 2K7DA 1M39A 1LVCD 2LLUA 2LP2A 4HRHA 4P2YB 3PM8A 1UHNA 1MWNA 1KK7Z 1CDPA 2CBLA 2I2RE 2WC8A 2P6BB 4PHMA 3SG4A 1QV0A 5AEQA 1XFXO 1ZOTB 3TDZA 1JUOA 1NCXA 2KQYA 1IH0A 2Y1MA 4PHNA 1RK9A 4I5LB 1XFZO 4CIDA 4WQ2A 2LC5A 4PE7A 3I5HB 1CDNA 2M49B 2JU0A 1MXEA 1NYAA 2KQ6A 1QATA 3DF0A 3EVVA 1PRWA 3CGAA 1YUUA 1CFPA 3GK4X 3PSRA 3TS5C 2WCBA 2BL0C 4I5KA 3VGOA 4TNCA 2BCAA 3EK4A 3VRPA 4YGDB 3JVTB 3C1VA 1RTP1 2F3ZA 3IF7A 1SW8A 2GGZA 2JTTA 4OKHA 1C7VA 3OX6A 1B8CA 5AXIA 2L4IA 1DTLA 4CFRA 1CLLA 4P5OE 1DJWA 1A03A 1WDCB 3PALA 4ORBB 1CFFA 2LUCA 3I5IB 1NCYA 1CTRA 2MLEC 1Y0VH 4M2PA 1YR5A 3I5GC 2JC2A 1LKJA 3SG6A 3WHUB 4ICBA 1AJ4A 1U5IA 1G8IA 2KI6C 1TNPA 3TUYB 5B8IB 2F33A 2JWWA 5HKYA 2LUXA 2LNKA 2LP3A 4IL1A 4NDDA 1AK8A 3BUMB 2QACA 1MQ1A 4GPLB 1SPYA 4AQIA 1XFWO 4YI8A 2LMVA 1L7ZA 3FIAA 2JQ6A 3CS1A 3HCMA 3TZ1A 1KK8B 1R2UA 2KFHA 1BU3A 1SMGA 3RLZA 1RROA 1QX5B 1OMDA 3BQ3A 1YTZC 1KQMB 2D8NA 2LHLA 2ZNDA 3A8RA 1NX1A 1FI6A 1UWOA 2NLNA 1JFKA 5IBWA 4XYNA 2K7BA 3OB2B 5KU1A 1MHOA 1OZOA 2PMYA 2ZKMX 3CR2A 1JFJA 1BOCA 1BF5A 4M2QA 4I5NB 1FI5A 1CDLA 4A4CA 3BUNB 2H61A 1V1FA 3DVMA 5AANA 1DGVA 1KSOA 2NXQA 3QRXA 2SASA 1S1EA 4PE0A 1J1DA 1KFXL 2KOTA 2L0PA 2MHHA 3F45A 1CNPA 1K94A 2KI6D 1J7PA 1PVAA 4NQGA 4PE4A 1IKUA 1G4YR 2K0JA 4YGBB 1KK7Y 2M9GA 2VRGA 3TS5B 2BCXA 1SNLA 1QIWA 2M8UA 4GBAA 1DGUA 5AFPA 1SYMA 2BL0B 5ER5A 1W7JB 4C0LA 3SG7A 1DJXA 1AJ5A 3VRRA 5I2OA 1KSMA 1NSHA 1NPQA 2LMTA 1QXPA 2WCEA 4MVFA 2HPSA 1FF1A 3NSIA 1OZSA 4JPZB 5HKWA 4MLWA 3ZWHA 1CMFA 1M63B 2BKHB 1QLKA 3BOWB 2JXLA 3PFVA 2LVVA 1UHHA 3EK7A 1GQMA 3I5GB 2G9BA 3O78A 3DVJA 5DKQA 2M29A 1RWYA 2M3WA 1B7TZ 2AUCA 3RM1A 1SL9A 4UPGA 1F71A 2F3YA 2KSPA 4PHKA 4MZLA 1YRUB 1JSAA 4ETOA 2KFFA 1PSRA 4DUQA 1QV1A 1YURA 1IWQA 3PN7C 1MXLC 1KFXS 4YRUA 5BPJA 1N0YA 1TNWA 1SCMC 4L9MA 2TN4A 2E30A 1RFJA 3D0YA 3NSKA 3KHEA 1WRKA 2GGMA 3KEVA 3OHMB 2LV7A 1EL4A 2WCFA 4ZCVA 1Y1UA 1UUSA 2A4JA 2SCPA 2CT9A 4HREE 1QX7A 2LM5A 1TN4A 2K2FA 4WRIA 2ZRTA 2GV5A 3DD4A 1A2XA 1PK0D 2F2PA 2LLSA 2V53A 1AP4A 1SRAA 4MZJA 3E3RA 3GOFA 4A4BA 5I8NA 3PATA 4PDZA 4CFQA 1ALVA 1AUIB 1IGVA 1QLSA 2M97A 2L4HA 2ZN8A 1BODA 3ICBA 3ZNIA 3BXKA 2LCPA 2K8MB 1RJVA 1CM1A 3D0YB 1JF0A 1IJ6A 1YX8A 3SIBA 1OSAA 2JNFA 4E68A 1NX2A 1DT7B 3SJSA 3IQQA 2MA2A 3KF9A 5FYXA 1Y6WA 5HKZA 1PULA 3A4UB 2OS8B 1FPWA 5J3XA 3AKAA 3HX4A 3DVKA 5JOLA 1S36A 2JT8A 2FCDA 1KCYA 1ZACA 1XFVO 2KYCA 4BY4A 4AQJA 1OE9B 2L51A 1DJYA 4FQOA 3LK1A 3H4SE 1NP8A 1WLMA 4OVNF 3EKJA 1Q80A 1BJFA 3OB1B 1DJZA 4CPVA 5AERA 1IG5A 2KFGA 5D69A 2KI4C 3DVEA 4U8DA 1DJGA 1UHKA 1XVJA 1QASA 2LHIA 1K8UA 1XFYO 4QJ3B 1S3PA 1M31A 3WXAA 1L2OC 1UP5A 1UURA 2FJUB 3SG5A 1SK6D 3O2PA 1IQ3A 3JTDC 4MRYA 2MBXA 4YGCB 1EG4A 1YX7A 4DIRA 1A4PA 4YGEB 3PN7B 1F54A 3CZTX 1TRFA 2Y1NA 1SCMB 2KGRA 5GQQC 3WHTB 4GGFC 1B7TY 1S6JA 1SBJA 2PALA 3EVRA 5KTYA 1ZFSA 1CLMA 2BBNA 4USLA 2HF5A 3NSOA 2LMUA 3OP0A 2DOQA 3BOWA 1K9PA 2LVJA 2CCMA 2K7OA 4QJ5B 1SCVA 2CTNA 1S5GZ 2L5XB 1KFUL 2KHNA 3I5HC 4MEWA 2BECA 1R6PA 1UHJA 1F4QA 1XK4C 2KAVA 4OR9B 2R2IA 1SL8A 1ZUZA 4D1EA 1S6IA 1A29A 3VRQA 1BLQA 1PVBA 1PSBA 1DMOA 1B8RA 2PSRA 3CLNA 3TDUA 1M46A 3LCPC 1SY9A 1DF0B 1F70A 1YVHA 4MBEA 1JBAA 1QX2A 1Y1XA 4ZCUA 4PE1A 1TIZA 2I18A 2M7LA 3KPXA 1XA5A 1Y1AA 2M1KB 2HETA 3NXAA 4HSZA 1WY9A 1AHRA 1ALWA 1ODBA 5HLVA 3CWGA 3BUXB 1IQ5A 1J7QA 1TCFA 1NCZA 2H2KA 1B8LA 4C0KA 1SR6C 2I7AA 1IRJA 4GFTA 5HLOA 3TUYC 1GJYA 3I5FC 2HQWA 2MLFC 5DKNA 2BKIB 4GUKA 1LA0A 4GAOA 1DVIA 1D1OA 2G2BA 2WNDA 1UHIA 1LXFC 2BCBA 1K90D 1KWOC 2KAYA 5PALA 1A75B 4JQ0D 2EC6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOJ A;  1DJH A;  1G33 A;  3VRO A;  2KAX A;  1CMG A;  1KFU S;  1L2O B;  1S6C A;  3BYA A;  1LIN A;  2AAO A;  3SG3 A;  3GK2 A;  5CSN A;  1GGZ A;  1H4B A;  2MAZ A;  2BBM A;  1DJI A;  1FBV A;  2RGI A;  1QVI Z;  1OMR A;  5DKR A;  2ISD A;  2K61 A;  2PAS A;  2MJW B;  2F2O A;  1NWD A;  2CXJ A;  4NDC A;  2JRF A;  1CM4 A;  2K7C A;  3BUW B;  2BE6 A;  1JC2 A;  2I94 A;  1TCO B;  2NCP A;  4GGN A;  3BUO B;  2FOT A;  4NDB A;  5ER4 X;  1E8A A;  1CKK A;  1WRL A;  2JZI A;  4XJK A;  2ZNE A;  4YI9 A;  2M1U A;  4MRX A;  1F8H A;  3EK8 A;  2M7N A;  4DS7 A;  2KNE A;  1BR1 B;  3OX5 A;  2JOJ A;  1V1G A;  1BT6 A;  1PAL A;  4ORC B;  1J7O A;  1TNQ A;  2F8P A;  3CR5 X;  1H8B A;  3O4Y A;  1MF8 B;  1JWD A;  1KQV A;  1B1G A;  1TOP A;  2OTG C;  1F4O A;  4M2O A;  1HQV A;  2K2A A;  3O6B A;  2WOR A;  3VRN A;  4QJ4 B;  4WQ3 A;  1TNX A;  3IQO A;  2JXC A;  3PLF B;  1S5G Y;  3LLE A;  1NIW A;  3LK0 A;  1CB1 A;  2LE9 B;  4C0J A;  1NUB A;  3WNX B;  1K95 A;  1QS7 A;  4XJK B;  2H61 C;  1YVL A;  1K2H A;  2LVI A;  1K96 A;  4GNK B;  5KSZ A;  4N5X A;  4AOM A;  1TTX A;  3FWC A;  4I5J A;  3SIA A;  2L2E A;  3CR4 X;  1IJ5 A;  1C07 A;  1J7R A;  3GK1 A;  3FWB A;  1AVS A;  1YUS A;  4YBH B;  3M0W A;  2L50 A;  3DF0 B;  1YUT A;  1NX0 A;  2Q4U A;  1NX3 A;  1CDM A;  1SR6 B;  4JWQ A;  1K9K A;  2CNP A;  2HQ8 A;  3I5F B;  4F0Z B;  1F55 A;  1OQP A;  3EKH A;  4MSP A;  1XYD A;  4MZK A;  2COL B;  1JF2 A;  5CSF A;  3LL8 B;  1KWO B;  2JT0 A;  5F6T A;  1EXR A;  1MR8 A;  1SL7 A;  2EC6 B;  3K21 A;  1BR4 B;  1DF0 A;  3D10 A;  3MSE B;  1N2D A;  2EHB A;  4ORA B;  3FS7 A;  2IS9 A;  4OCI A;  5CSJ A;  1QIV A;  4PHJ A;  1EG3 A;  2JT3 A;  1OMV A;  2NZ0 A;  1SKT A;  3TDI A;  1XO5 A;  2AMI A;  2JNX A;  2O5G A;  2KBM A;  1ZMZ A;  2LVK A;  1U5I B;  2JUL A;  2MRD A;  1GGW A;  4N1F A;  1CLB A;  3NSL A;  4OV2 A;  1C7W A;  1X02 A;  1QTX A;  2B1U A;  2O60 A;  4FTG A;  2KBI A;  3KO0 A;  2JPT A;  4MN0 A;  1FW4 A;  1CFD A;  1QVI Y;  2QPT A;  1S26 D;  1B9A A;  2KYF A;  4DCK A;  5HYD A;  1A75 A;  1HT9 A;  2M0R A;  3AAK A;  3JVT C;  4BY5 A;  5CSI A;  1YRT B;  1J55 A;  1N65 A;  1REC A;  3EVU A;  4R1E A;  2LAN A;  4CLN A;  5TNC A;  5G08 A;  1K93 D;  1VRK A;  2OTG B;  1WRZ A;  1WDC C;  2PVB A;  2ZFD A;  3AKB A;  3CTN A;  4PCW A;  5K89 A;  1B4C A;  2Y5I A;  3I5I C;  2JTZ A;  2OS8 C;  1EH2 A;  2PRU A;  4YGA A;  4GGF A;  1EJ3 A;  1CFC A;  2L98 A;  1QJT A;  3SG2 A;  1BG1 A;  2KGB C;  1BMO A;  1B47 A;  3AAJ A;  5CPV A;  2Q91 A;  4N1G A;  2LAP A;  1LA3 A;  5I2L A;  1J1E A;  2OPO A;  2NCO A;  1K9U A;  2KI4 B;  1MUX A;  2Y4Q A;  4HRG A;  1W7I B;  1M45 A;  2KDH A;  5I2Q A;  2LLT A;  2ZRS A;  2BE4 A;  2EGD A;  2WOS A;  2ZN9 A;  1KK8 C;  1WLZ A;  1XK4 A;  2FCE A;  1XFU O;  4PAL A;  4Q04 A;  5JJG A;  1KQM C;  3JTD B;  5D7F A;  4DRW A;  2E6W A;  2K7D A;  1M39 A;  1LVC D;  2LLU A;  2LP2 A;  4HRH A;  4P2Y B;  3PM8 A;  1UHN A;  1MWN A;  1KK7 Z;  1CDP A;  2CBL A;  2I2R E;  2WC8 A;  2P6B B;  4PHM A;  3SG4 A;  1QV0 A;  5AEQ A;  1XFX O;  1ZOT B;  3TDZ A;  1JUO A;  1NCX A;  2KQY A;  1IH0 A;  2Y1M A;  4PHN A;  1RK9 A;  4I5L B;  1XFZ O;  4CID A;  4WQ2 A;  2LC5 A;  4PE7 A;  3I5H B;  1CDN A;  2M49 B;  2JU0 A;  1MXE A;  1NYA A;  2KQ6 A;  1QAT A;  3DF0 A;  3EVV A;  1PRW A;  3CGA A;  1YUU A;  1CFP A;  3GK4 X;  3PSR A;  3TS5 C;  2WCB A;  2BL0 C;  4I5K A;  3VGO A;  4TNC A;  2BCA A;  3EK4 A;  3VRP A;  4YGD B;  3JVT B;  3C1V A;  1RTP 1;  2F3Z A;  3IF7 A;  1SW8 A;  2GGZ A;  2JTT A;  4OKH A;  1C7V A;  3OX6 A;  1B8C A;  5AXI A;  2L4I A;  1DTL A;  4CFR A;  1CLL A;  4P5O E;  1DJW A;  1A03 A;  1WDC B;  3PAL A;  4ORB B;  1CFF A;  2LUC A;  3I5I B;  1NCY A;  1CTR A;  2MLE C;  1Y0V H;  4M2P A;  1YR5 A;  3I5G C;  2JC2 A;  1LKJ A;  3SG6 A;  3WHU B;  4ICB A;  1AJ4 A;  1U5I A;  1G8I A;  2KI6 C;  1TNP A;  3TUY B;  5B8I B;  2F33 A;  2JWW A;  5HKY A;  2LUX A;  2LNK A;  2LP3 A;  4IL1 A;  4NDD A;  1AK8 A;  3BUM B;  2QAC A;  1MQ1 A;  4GPL B;  1SPY A;  4AQI A;  1XFW O;  4YI8 A;  2LMV A;  1L7Z A;  3FIA A;  2JQ6 A;  3CS1 A;  3HCM A;  3TZ1 A;  1KK8 B;  1R2U A;  2KFH A;  1BU3 A;  1SMG A;  3RLZ A;  1RRO A;  1QX5 B;  1OMD A;  3BQ3 A;  1YTZ C;  1KQM B;  2D8N A;  2LHL A;  2ZND A;  3A8R A;  1NX1 A;  1FI6 A;  1UWO A;  2NLN A;  1JFK A;  5IBW A;  4XYN A;  2K7B A;  3OB2 B;  5KU1 A;  1MHO A;  1OZO A;  2PMY A;  2ZKM X;  3CR2 A;  1JFJ A;  1BOC A;  1BF5 A;  4M2Q A;  4I5N B;  1FI5 A;  1CDL A;  4A4C A;  3BUN B;  2H61 A;  1V1F A;  3DVM A;  5AAN A;  1DGV A;  1KSO A;  2NXQ A;  3QRX A;  2SAS A;  1S1E A;  4PE0 A;  1J1D A;  1KFX L;  2KOT A;  2L0P A;  2MHH A;  3F45 A;  1CNP A;  1K94 A;  2KI6 D;  1J7P A;  1PVA A;  4NQG A;  4PE4 A;  1IKU A;  1G4Y R;  2K0J A;  4YGB B;  1KK7 Y;  2M9G A;  2VRG A;  3TS5 B;  2BCX A;  1SNL A;  1QIW A;  2M8U A;  4GBA A;  1DGU A;  5AFP A;  1SYM A;  2BL0 B;  5ER5 A;  1W7J B;  4C0L A;  3SG7 A;  1DJX A;  1AJ5 A;  3VRR A;  5I2O A;  1KSM A;  1NSH A;  1NPQ A;  2LMT A;  1QXP A;  2WCE A;  4MVF A;  2HPS A;  1FF1 A;  3NSI A;  1OZS A;  4JPZ B;  5HKW A;  4MLW A;  3ZWH A;  1CMF A;  1M63 B;  2BKH B;  1QLK A;  3BOW B;  2JXL A;  3PFV A;  2LVV A;  1UHH A;  3EK7 A;  1GQM A;  3I5G B;  2G9B A;  3O78 A;  3DVJ A;  5DKQ A;  2M29 A;  1RWY A;  2M3W A;  1B7T Z;  2AUC A;  3RM1 A;  1SL9 A;  4UPG A;  1F71 A;  2F3Y A;  2KSP A;  4PHK A;  4MZL A;  1YRU B;  1JSA A;  4ETO A;  2KFF A;  1PSR A;  4DUQ A;  1QV1 A;  1YUR A;  1IWQ A;  3PN7 C;  1MXL C;  1KFX S;  4YRU A;  5BPJ A;  1N0Y A;  1TNW A;  1SCM C;  4L9M A;  2TN4 A;  2E30 A;  1RFJ A;  3D0Y A;  3NSK A;  3KHE A;  1WRK A;  2GGM A;  3KEV A;  3OHM B;  2LV7 A;  1EL4 A;  2WCF A;  4ZCV A;  1Y1U A;  1UUS A;  2A4J A;  2SCP A;  2CT9 A;  4HRE E;  1QX7 A;  2LM5 A;  1TN4 A;  2K2F A;  4WRI A;  2ZRT A;  2GV5 A;  3DD4 A;  1A2X A;  1PK0 D;  2F2P A;  2LLS A;  2V53 A;  1AP4 A;  1SRA A;  4MZJ A;  3E3R A;  3GOF A;  4A4B A;  5I8N A;  3PAT A;  4PDZ A;  4CFQ A;  1ALV A;  1AUI B;  1IGV A;  1QLS A;  2M97 A;  2L4H A;  2ZN8 A;  1BOD A;  3ICB A;  3ZNI A;  3BXK A;  2LCP A;  2K8M B;  1RJV A;  1CM1 A;  3D0Y B;  1JF0 A;  1IJ6 A;  1YX8 A;  3SIB A;  1OSA A;  2JNF A;  4E68 A;  1NX2 A;  1DT7 B;  3SJS A;  3IQQ A;  2MA2 A;  3KF9 A;  5FYX A;  1Y6W A;  5HKZ A;  1PUL A;  3A4U B;  2OS8 B;  1FPW A;  5J3X A;  3AKA A;  3HX4 A;  3DVK A;  5JOL A;  1S36 A;  2JT8 A;  2FCD A;  1KCY A;  1ZAC A;  1XFV O;  2KYC A;  4BY4 A;  4AQJ A;  1OE9 B;  2L51 A;  1DJY A;  4FQO A;  3LK1 A;  3H4S E;  1NP8 A;  1WLM A;  4OVN F;  3EKJ A;  1Q80 A;  1BJF A;  3OB1 B;  1DJZ A;  4CPV A;  5AER A;  1IG5 A;  2KFG A;  5D69 A;  2KI4 C;  3DVE A;  4U8D A;  1DJG A;  1UHK A;  1XVJ A;  1QAS A;  2LHI A;  1K8U A;  1XFY O;  4QJ3 B;  1S3P A;  1M31 A;  3WXA A;  1L2O C;  1UP5 A;  1UUR A;  2FJU B;  3SG5 A;  1SK6 D;  3O2P A;  1IQ3 A;  3JTD C;  4MRY A;  2MBX A;  4YGC B;  1EG4 A;  1YX7 A;  4DIR A;  1A4P A;  4YGE B;  3PN7 B;  1F54 A;  3CZT X;  1TRF A;  2Y1N A;  1SCM B;  2KGR A;  5GQQ C;  3WHT B;  4GGF C;  1B7T Y;  1S6J A;  1SBJ A;  2PAL A;  3EVR A;  5KTY A;  1ZFS A;  1CLM A;  2BBN A;  4USL A;  2HF5 A;  3NSO A;  2LMU A;  3OP0 A;  2DOQ A;  3BOW A;  1K9P A;  2LVJ A;  2CCM A;  2K7O A;  4QJ5 B;  1SCV A;  2CTN A;  1S5G Z;  2L5X B;  1KFU L;  2KHN A;  3I5H C;  4MEW A;  2BEC A;  1R6P A;  1UHJ A;  1F4Q A;  1XK4 C;  2KAV A;  4OR9 B;  2R2I A;  1SL8 A;  1ZUZ A;  4D1E A;  1S6I A;  1A29 A;  3VRQ A;  1BLQ A;  1PVB A;  1PSB A;  1DMO A;  1B8R A;  2PSR A;  3CLN A;  3TDU A;  1M46 A;  3LCP C;  1SY9 A;  1DF0 B;  1F70 A;  1YVH A;  4MBE A;  1JBA A;  1QX2 A;  1Y1X A;  4ZCU A;  4PE1 A;  1TIZ A;  2I18 A;  2M7L A;  3KPX A;  1XA5 A;  1Y1A A;  2M1K B;  2HET A;  3NXA A;  4HSZ A;  1WY9 A;  1AHR A;  1ALW A;  1ODB A;  5HLV A;  3CWG A;  3BUX B;  1IQ5 A;  1J7Q A;  1TCF A;  1NCZ A;  2H2K A;  1B8L A;  4C0K A;  1SR6 C;  2I7A A;  1IRJ A;  4GFT A;  5HLO A;  3TUY C;  1GJY A;  3I5F C;  2HQW A;  2MLF C;  5DKN A;  2BKI B;  4GUK A;  1LA0 A;  4GAO A;  1DVI A;  1D1O A;  2G2B A;  2WND A;  1UHI A;  1LXF C;  2BCB A;  1K90 D;  1KWO C;  2KAY A;  5PAL A;  1A75 B;  4JQ0 D;  2EC6 C; 
#chains in the Genus database with same CATH topology
 1OOJ A;  1DJH A;  1G33 A;  2K60 A;  2KAX A;  3VRO A;  1CMG A;  1KFU S;  1L2O B;  1S6C A;  3BYA A;  1LIN A;  2AAO A;  3SG3 A;  3GK2 A;  5CSN A;  1GGZ A;  1H4B A;  2MAZ A;  2BBM A;  1DJI A;  1FBV A;  2RGI A;  1QVI Z;  1OMR A;  3NHT A;  5DKR A;  2ISD A;  3D77 A;  2K61 A;  2PAS A;  2MJW B;  2F2O A;  1NWD A;  2CXJ A;  4NDC A;  2JRF A;  1CM4 A;  2K7C A;  2PQL A;  3BUW B;  2BE6 A;  1JC2 A;  2I94 A;  1TCO B;  2NCP A;  4GGN A;  3BUO B;  2FOT A;  4NDB A;  5ER4 X;  1E8A A;  1DEK A;  1CKK A;  1WRL A;  2JZI A;  4XJK A;  2ZNE A;  4YI9 A;  2M1U A;  4MRX A;  1F8H A;  1DQE A;  3EK8 A;  2M7N A;  4DS7 A;  2KNE A;  1BR1 B;  2YGU A;  3OX5 A;  2JOJ A;  1V1G A;  1BT6 A;  1PAL A;  4ORC B;  1J7O A;  1TNQ A;  2F8P A;  3CR5 X;  1IIO A;  1H8B A;  3O4Y A;  1MF8 B;  2BAP A;  4INW A;  3B87 A;  4JKT A;  1JWD A;  1KQV A;  1B1G A;  1TOP A;  3CYZ A;  3DYE A;  2OTG C;  1F4O A;  4M2O A;  1HQV A;  2K2A A;  3O6B A;  2WOR A;  3VRN A;  4QJ4 B;  4WQ3 A;  1TNX A;  3IQO A;  2JXC A;  3PLF B;  1S5G Y;  3LLE A;  1NIW A;  3LK0 A;  1CB1 A;  2LE9 B;  4C0J A;  1NUB A;  3WNX B;  1K95 A;  1QS7 A;  3K1E A;  2H61 C;  1YVL A;  4XJK B;  1K2H A;  2LVI A;  1K96 A;  4GNK B;  1LS8 A;  5KSZ A;  4N5X A;  3SS3 A;  1Z2C B;  3S0D A;  4AOM A;  1TTX A;  3FWC A;  4I5J A;  3SIA A;  2L2E A;  3CR4 X;  1IJ5 A;  3D73 A;  1J7R A;  4KYN A;  3GK1 A;  3FWB A;  1AVS A;  1YUS A;  4YBH B;  3M0W A;  3UNW A;  2L50 A;  3DF0 B;  1YUT A;  1NX0 A;  2Q4U A;  1NX3 A;  1CDM A;  1SR6 B;  2WCJ A;  4JWQ A;  3UO9 A;  1K9K A;  2CNP A;  5EL2 A;  2HQ8 A;  5FI2 A;  3I5F B;  4F0Z B;  1TUZ A;  1F55 A;  1OQP A;  3EKH A;  4MSP A;  1XYD A;  4MZK A;  2COL B;  1JF2 A;  5CSF A;  3LL8 B;  1KWO B;  2JT0 A;  5F6T A;  1EXR A;  4IJ7 A;  1MR8 A;  1SL7 A;  2EC6 B;  3K21 A;  1BR4 B;  1DF0 A;  3D10 A;  3MSE B;  3R1O A;  1N2D A;  2EHB A;  4ORA B;  2QEV A;  3FS7 A;  2IS9 A;  4OCI A;  5CSJ A;  1QIV A;  4F7F A;  4PHJ A;  1EG3 A;  2JT3 A;  1DC1 A;  1OMV A;  2NZ0 A;  1SKT A;  3TDI A;  1XO5 A;  2AMI A;  2JNX A;  2O5G A;  2KBM A;  5I94 A;  1ZMZ A;  2LVK A;  1U5I B;  2JUL A;  2MRD A;  1GGW A;  4N1F A;  1CLB A;  2GTE A;  3NSL A;  4OV2 A;  2L2C A;  1C7W A;  1X02 A;  1QTX A;  2B1U A;  2QEH A;  2O60 A;  4FTG A;  2KBI A;  3KO0 A;  2JPT A;  3D78 A;  4MN0 A;  1FW4 A;  1CFD A;  1QVI Y;  2QPT A;  1S26 D;  1B9A A;  2KYF A;  4DCK A;  5HYD A;  1A75 A;  1HT9 A;  2M0R A;  3AAK A;  3JVT C;  4BY5 A;  5CSI A;  1YRT B;  1J55 A;  1N65 A;  1REC A;  3EVU A;  4R1E A;  2LAN A;  4CLN A;  5TNC A;  5G08 A;  1K93 D;  1VRK A;  2OTG B;  1WRZ A;  1WDC C;  2PVB A;  2ZFD A;  3AKB A;  3CTN A;  4PCW A;  5K89 A;  1OOI X;  1B4C A;  2Y5I A;  3I5I C;  2QEB A;  2JTZ A;  2OS8 C;  1EH2 A;  2PRU A;  4YGA A;  4GGF A;  3SS4 A;  1EJ3 A;  2H8V A;  1CFC A;  1TUJ A;  2L98 A;  1QJT A;  3SG2 A;  1BG1 A;  1SSE B;  2L5Y A;  3OBV A;  2KGB C;  1BMO A;  1B47 A;  3AAJ A;  5CPV A;  2Q91 A;  4N1G A;  2LAP A;  1LA3 A;  1W9Z A;  5I2L A;  1J1E A;  2OPO A;  2NCO A;  1K9U A;  2KI4 B;  1MUX A;  2Y4Q A;  4HRG A;  1W7I B;  1M45 A;  2KDH A;  5I2Q A;  2LLT A;  2ZRS A;  2BE4 A;  2EGD A;  2WC5 A;  2WOS A;  2ZN9 A;  1KK8 C;  1WLZ A;  1XK4 A;  3N7H A;  2FCE A;  1XFU O;  1OOH A;  4PAL A;  4Q04 A;  5JJG A;  1KQM C;  3JTD B;  5D7F A;  4DRW A;  2E6W A;  2K7D A;  1M39 A;  1LVC D;  2LLU A;  2LP2 A;  4HRH A;  4P2Y B;  3PM8 A;  1UHN A;  1MWN A;  1KK7 Z;  1CDP A;  2CBL A;  2I2R E;  2WC8 A;  2P6B B;  3BJH A;  3CDN A;  4PHM A;  3SG4 A;  5HL1 A;  1QV0 A;  5AEQ A;  1XFX O;  3CAB A;  1ZOT B;  3TDZ A;  1JUO A;  1NCX A;  2KQY A;  1IH0 A;  2Y1M A;  4PHN A;  1RK9 A;  4I5L B;  1XFZ O;  4CID A;  4WQ2 A;  2LC5 A;  4PE7 A;  3I5H B;  1ORG A;  3FE6 A;  1CDN A;  2M49 B;  2JU0 A;  1MXE A;  1NYA A;  2KQ6 A;  3VB1 A;  1QAT A;  3DF0 A;  3EVV A;  1PRW A;  3CGA A;  1YUU A;  2BNX A;  1CFP A;  3GK4 X;  3PSR A;  3TS5 C;  2WCB A;  2BL0 C;  4I5K A;  3VGO A;  4TNC A;  1Z4H A;  2BCA A;  3EK4 A;  3R1V A;  3VRP A;  4YGD B;  3JVT B;  3C1V A;  1RTP 1;  2F3Z A;  3CZ1 A;  3IF7 A;  1SW8 A;  2GGZ A;  2JTT A;  4OKH A;  1C7V A;  3OX6 A;  1B8C A;  5D3O A;  5AXI A;  2L4I A;  1DTL A;  4CFR A;  1CLL A;  1C3Z A;  4P5O E;  1DJW A;  1A03 A;  1WDC B;  2WCL A;  3S0G A;  3PAL A;  4ORB B;  1CFF A;  2LUC A;  3I5I B;  3IVT A;  1NCY A;  1CTR A;  2KLE A;  2MLE C;  3FE8 A;  1GM0 A;  1Y0V H;  3B6X A;  2P70 A;  4M2P A;  1YR5 A;  3I5G C;  2JC2 A;  1LKJ A;  3SG6 A;  3WHU B;  4ICB A;  1AJ4 A;  1U5I A;  1G8I A;  2KI6 C;  1TNP A;  3TUY B;  5B8I B;  2F33 A;  2JWW A;  5HKY A;  3FE9 A;  2LUX A;  2LNK A;  2LP3 A;  4IL1 A;  4NDD A;  1AK8 A;  3BUM B;  2QAC A;  1MQ1 A;  4GPL B;  1SPY A;  4AQI A;  1XFW O;  4YI8 A;  2LMV A;  1L7Z A;  3FIA A;  2JQ6 A;  3CS1 A;  3HCM A;  3TZ1 A;  1KK8 B;  1R2U A;  2KFH A;  1BU3 A;  1SMG A;  2JPO A;  3RLZ A;  1OW4 A;  1RRO A;  1QX5 B;  1OMD A;  3BQ3 A;  1YTZ C;  1KQM B;  2D8N A;  2LHL A;  2ZND A;  3A8R A;  1NX1 A;  1FI6 A;  1UWO A;  2NLN A;  1JFK A;  5IBW A;  4XYN A;  2K7B A;  3OB2 B;  5KU1 A;  1MHO A;  1OZO A;  2PMY A;  2ZKM X;  3CR2 A;  1JFJ A;  1BOC A;  5FI7 A;  1BF5 A;  3QME A;  4I5N B;  4M2Q A;  1FI5 A;  3Q8I A;  1CDL A;  3L4A A;  4A4C A;  3BUN B;  2H61 A;  3S0F A;  1V1F A;  3DVM A;  5AAN A;  3DZT A;  2QDI A;  1DGV A;  1KSO A;  5DIC A;  2NXQ A;  3QRX A;  2SAS A;  1S1E A;  4PE0 A;  1J1D A;  1KFX L;  2KOT A;  2L0P A;  2MHH A;  3F45 A;  3B86 A;  1CNP A;  1K94 A;  2KI6 D;  1J7P A;  1PVA A;  4NQG A;  4PE4 A;  1IKU A;  1G4Y R;  2K0J A;  4YGB B;  1KK7 Y;  2M9G A;  2VRG A;  3TS5 B;  2BCX A;  1SNL A;  1QIW A;  2M8U A;  4GBA A;  1DGU A;  5AFP A;  1SYM A;  2BL0 B;  3B88 A;  3BFB A;  1W7J B;  5ER5 A;  3SG7 A;  1DJX A;  1AJ5 A;  3VRR A;  4C0L A;  5I2O A;  1KSM A;  1NSH A;  1NPQ A;  2LMT A;  1QXP A;  2WCE A;  4MVF A;  2HPS A;  1FF1 A;  4FQT A;  3NSI A;  3CZ2 A;  3NGV A;  3D75 A;  4PT1 A;  1OZS A;  4JPZ B;  5HKW A;  4MLW A;  3ZWH A;  2KPH A;  1CMF A;  1M63 B;  2BKH B;  1QLK A;  3BOW B;  2JXL A;  2KLD A;  3PFV A;  2LVV A;  1UHH A;  1C3Y A;  3EK7 A;  1P28 A;  1GQM A;  3I5G B;  2G9B A;  3O78 A;  3DVJ A;  5DKQ A;  2M29 A;  1RWY A;  2M3W A;  1B7T Z;  2AUC A;  3RM1 A;  1XFR A;  1SL9 A;  4UPG A;  1F71 A;  2F3Y A;  2KSP A;  4PHK A;  4MZL A;  1YRU B;  1JSA A;  4ETO A;  2KFF A;  1PSR A;  4DUQ A;  1QV1 A;  1YUR A;  1IWQ A;  3PN7 C;  1OOG A;  1MXL C;  1KFX S;  4YRU A;  5BPJ A;  1N0Y A;  1TNW A;  1SCM C;  4L9M A;  2TN4 A;  2E30 A;  1RFJ A;  3D0Y A;  3NSK A;  3KHE A;  1WRK A;  2GGM A;  3KEV A;  2FJY A;  3OHM B;  3SS5 A;  2LV7 A;  1EL4 A;  2WCF A;  4ZCV A;  1Y1U A;  1UUS A;  2A4J A;  1TWO A;  2CT9 A;  2SCP A;  4HRE E;  1QX7 A;  2LM5 A;  1TN4 A;  2K2F A;  4WRI A;  2ZRT A;  3S0B A;  2GV5 A;  1QWV A;  3DD4 A;  3DY9 A;  1A2X A;  1PK0 D;  2F2P A;  1OOF A;  2LLS A;  2V53 A;  1AP4 A;  1SRA A;  3CZ0 A;  4MZJ A;  2WC6 A;  4JD9 A;  3E3R A;  3GOF A;  4A4B A;  5I8N A;  3PAT A;  4PDZ A;  4CFQ A;  1ALV A;  1AUI B;  1IGV A;  1QLS A;  2M97 A;  2L4H A;  2ZN8 A;  3RZS A;  1BOD A;  3ICB A;  3ZNI A;  3BXK A;  2LCP A;  2K8M B;  1RJV A;  1CM1 A;  3D0Y B;  1JF0 A;  1IJ6 A;  1YX8 A;  3SIB A;  1OSA A;  2JNF A;  4E68 A;  1NX2 A;  1DT7 B;  3SJS A;  3IQQ A;  2MA2 A;  1DEL A;  3KF9 A;  1Y6W A;  5FYX A;  2WCH A;  1PUL A;  3A4U B;  2OS8 B;  5HKZ A;  1FPW A;  5J3X A;  3AKA A;  3S0A A;  3HX4 A;  3DVK A;  3D74 A;  5JOL A;  1S36 A;  3EG5 B;  3D76 A;  4OZD A;  2JT8 A;  2FCD A;  2PYQ A;  1KCY A;  1ZAC A;  1XFV O;  2KYC A;  4BY4 A;  4AQJ A;  1OE9 B;  2L51 A;  1DJY A;  4FQO A;  3LK1 A;  3H4S E;  1NP8 A;  1WLM A;  4OVN F;  3EKJ A;  1Q80 A;  3S0E A;  1BJF A;  3O4X A;  3OB1 B;  1DJZ A;  4CPV A;  5AER A;  1IG5 A;  3OGN A;  2KFG A;  5FI6 A;  5D69 A;  2KI4 C;  3DVE A;  4U8D A;  1DJG A;  1UHK A;  1XVJ A;  1QAS A;  3B7A A;  2LHI A;  1K8U A;  1XFY O;  4QJ3 B;  1S3P A;  1M31 A;  3PM2 A;  3WXA A;  1L2O C;  1UP5 A;  1UUR A;  2FJU B;  3SG5 A;  1SK6 D;  3O2P A;  1IQ3 A;  3JTD C;  4MRY A;  2MBX A;  4YGC B;  1EG4 A;  1YX7 A;  4DIR A;  1A4P A;  4YGE B;  3PN7 B;  1F54 A;  3CZT X;  1TRF A;  2Y1N A;  1SCM B;  2KGR A;  5GQQ C;  2WCK A;  3WHT B;  4GGF C;  3BFH A;  1B7T Y;  1S6J A;  1SBJ A;  2PAL A;  3EVR A;  5KTY A;  1ZFS A;  1CLM A;  2BBN A;  4USL A;  2HF5 A;  3NSO A;  2LMU A;  3L4L A;  3OP0 A;  2DOQ A;  3BOW A;  1K9P A;  2LVJ A;  2CCM A;  2K7O A;  4QJ5 B;  1SCV A;  2CTN A;  1S5G Z;  2ERB A;  2L5X B;  1KFU L;  2KHN A;  3I5H C;  3R1P A;  4MEW A;  2BEC A;  1R6P A;  1UHJ A;  1F4Q A;  1XK4 C;  2KAV A;  3NHI A;  2R2I A;  1SL8 A;  3L47 A;  1ZUZ A;  4INX A;  4OR9 B;  3V2L A;  4D1E A;  1S6I A;  1A29 A;  3VRQ A;  1BLQ A;  1PVB A;  1PSB A;  1DMO A;  1B8R A;  2PSR A;  3CLN A;  3TDU A;  1M46 A;  3LCP C;  1C07 A;  1SY9 A;  3PJI A;  1DF0 B;  1F70 A;  1YVH A;  4MBE A;  1JBA A;  1QX2 A;  1Y1X A;  4ZCU A;  3DXL A;  4PE1 A;  1TIZ A;  2I18 A;  2M7L A;  3KPX A;  1XA5 A;  1Y1A A;  2M1K B;  2HET A;  3NXA A;  4HSZ A;  1WY9 A;  1AHR A;  1ALW A;  1ODB A;  5HLV A;  2WCM A;  3CWG A;  3BUX B;  1IQ5 A;  1J7Q A;  1TCF A;  1NCZ A;  2H2K A;  1B8L A;  4C0K A;  1SR6 C;  1T14 A;  2I7A A;  1IRJ A;  4GFT A;  5HLO A;  3TUY C;  1GJY A;  3I5F C;  2HQW A;  2MLF C;  5DKN A;  2BKI B;  4GUK A;  1LA0 A;  4GAO A;  2QEO A;  1DVI A;  1D1O A;  2G2B A;  2WND A;  1UHI A;  1LXF C;  2BCB A;  1K90 D;  1KWO C;  2KAY A;  2P71 A;  1A75 B;  3BFA A;  3R72 A;  5PAL A;  4JQ0 D;  2EC6 C; 
#chains in the Genus database with same CATH homology
 1OOJ A;  1DJH A;  1G33 A;  3VRO A;  2KAX A;  1CMG A;  1KFU S;  1L2O B;  1S6C A;  3BYA A;  1LIN A;  2AAO A;  3SG3 A;  3GK2 A;  5CSN A;  1GGZ A;  1H4B A;  2MAZ A;  2BBM A;  1DJI A;  1FBV A;  2RGI A;  1QVI Z;  1OMR A;  5DKR A;  2ISD A;  2K61 A;  2PAS A;  2MJW B;  2F2O A;  1NWD A;  2CXJ A;  4NDC A;  2JRF A;  1CM4 A;  2K7C A;  3BUW B;  2BE6 A;  1JC2 A;  2I94 A;  1TCO B;  2NCP A;  4GGN A;  3BUO B;  2FOT A;  4NDB A;  5ER4 X;  1E8A A;  1CKK A;  1WRL A;  2JZI A;  4XJK A;  2ZNE A;  4YI9 A;  2M1U A;  4MRX A;  1F8H A;  3EK8 A;  2M7N A;  4DS7 A;  2KNE A;  1BR1 B;  3OX5 A;  2JOJ A;  1V1G A;  1BT6 A;  1PAL A;  4ORC B;  1J7O A;  1TNQ A;  2F8P A;  3CR5 X;  1H8B A;  3O4Y A;  1MF8 B;  1JWD A;  1KQV A;  1B1G A;  1TOP A;  2OTG C;  1F4O A;  4M2O A;  1HQV A;  2K2A A;  3O6B A;  2WOR A;  3VRN A;  4QJ4 B;  4WQ3 A;  1TNX A;  3IQO A;  2JXC A;  3PLF B;  1S5G Y;  3LLE A;  1NIW A;  3LK0 A;  1CB1 A;  2LE9 B;  4C0J A;  1NUB A;  3WNX B;  1K95 A;  1QS7 A;  4XJK B;  2H61 C;  1YVL A;  1K2H A;  2LVI A;  1K96 A;  4GNK B;  5KSZ A;  4N5X A;  4AOM A;  1TTX A;  3FWC A;  4I5J A;  3SIA A;  2L2E A;  3CR4 X;  1IJ5 A;  1C07 A;  1J7R A;  3GK1 A;  3FWB A;  1AVS A;  1YUS A;  4YBH B;  3M0W A;  2L50 A;  3DF0 B;  1YUT A;  1NX0 A;  2Q4U A;  1NX3 A;  1CDM A;  1SR6 B;  4JWQ A;  1K9K A;  2CNP A;  2HQ8 A;  3I5F B;  4F0Z B;  1F55 A;  1OQP A;  3EKH A;  4MSP A;  1XYD A;  4MZK A;  2COL B;  1JF2 A;  5CSF A;  3LL8 B;  1KWO B;  2JT0 A;  5F6T A;  1EXR A;  1MR8 A;  1SL7 A;  2EC6 B;  3K21 A;  1BR4 B;  1DF0 A;  3D10 A;  3MSE B;  1N2D A;  2EHB A;  4ORA B;  3FS7 A;  2IS9 A;  4OCI A;  5CSJ A;  1QIV A;  4PHJ A;  1EG3 A;  2JT3 A;  1OMV A;  2NZ0 A;  1SKT A;  3TDI A;  1XO5 A;  2AMI A;  2JNX A;  2O5G A;  2KBM A;  1ZMZ A;  2LVK A;  1U5I B;  2JUL A;  2MRD A;  1GGW A;  4N1F A;  1CLB A;  3NSL A;  4OV2 A;  1C7W A;  1X02 A;  1QTX A;  2B1U A;  2O60 A;  4FTG A;  2KBI A;  3KO0 A;  2JPT A;  4MN0 A;  1FW4 A;  1CFD A;  1QVI Y;  2QPT A;  1S26 D;  1B9A A;  2KYF A;  4DCK A;  5HYD A;  1A75 A;  1HT9 A;  2M0R A;  3AAK A;  3JVT C;  4BY5 A;  5CSI A;  1YRT B;  1J55 A;  1N65 A;  1REC A;  3EVU A;  4R1E A;  2LAN A;  4CLN A;  5TNC A;  5G08 A;  1K93 D;  1VRK A;  2OTG B;  1WRZ A;  1WDC C;  2PVB A;  2ZFD A;  3AKB A;  3CTN A;  4PCW A;  5K89 A;  1B4C A;  2Y5I A;  3I5I C;  2JTZ A;  2OS8 C;  1EH2 A;  2PRU A;  4YGA A;  4GGF A;  1EJ3 A;  1CFC A;  2L98 A;  1QJT A;  3SG2 A;  1BG1 A;  2KGB C;  1BMO A;  1B47 A;  3AAJ A;  5CPV A;  2Q91 A;  4N1G A;  2LAP A;  1LA3 A;  5I2L A;  1J1E A;  2OPO A;  2NCO A;  1K9U A;  2KI4 B;  1MUX A;  2Y4Q A;  4HRG A;  1W7I B;  1M45 A;  2KDH A;  5I2Q A;  2LLT A;  2ZRS A;  2BE4 A;  2EGD A;  2WOS A;  2ZN9 A;  1KK8 C;  1WLZ A;  1XK4 A;  2FCE A;  1XFU O;  4PAL A;  4Q04 A;  5JJG A;  1KQM C;  3JTD B;  5D7F A;  4DRW A;  2E6W A;  2K7D A;  1M39 A;  1LVC D;  2LLU A;  2LP2 A;  4HRH A;  4P2Y B;  3PM8 A;  1UHN A;  1MWN A;  1KK7 Z;  1CDP A;  2CBL A;  2I2R E;  2WC8 A;  2P6B B;  4PHM A;  3SG4 A;  1QV0 A;  5AEQ A;  1XFX O;  1ZOT B;  3TDZ A;  1JUO A;  1NCX A;  2KQY A;  1IH0 A;  2Y1M A;  4PHN A;  1RK9 A;  4I5L B;  1XFZ O;  4CID A;  4WQ2 A;  2LC5 A;  4PE7 A;  3I5H B;  1CDN A;  2M49 B;  2JU0 A;  1MXE A;  1NYA A;  2KQ6 A;  1QAT A;  3DF0 A;  3EVV A;  1PRW A;  3CGA A;  1YUU A;  1CFP A;  3GK4 X;  3PSR A;  3TS5 C;  2WCB A;  2BL0 C;  4I5K A;  3VGO A;  4TNC A;  2BCA A;  3EK4 A;  3VRP A;  4YGD B;  3JVT B;  3C1V A;  1RTP 1;  2F3Z A;  3IF7 A;  1SW8 A;  2GGZ A;  2JTT A;  4OKH A;  1C7V A;  3OX6 A;  1B8C A;  5AXI A;  2L4I A;  1DTL A;  4CFR A;  1CLL A;  4P5O E;  1DJW A;  1A03 A;  1WDC B;  3PAL A;  4ORB B;  1CFF A;  2LUC A;  3I5I B;  1NCY A;  1CTR A;  2MLE C;  1Y0V H;  4M2P A;  1YR5 A;  3I5G C;  2JC2 A;  1LKJ A;  3SG6 A;  3WHU B;  4ICB A;  1AJ4 A;  1U5I A;  1G8I A;  2KI6 C;  1TNP A;  3TUY B;  5B8I B;  2F33 A;  2JWW A;  5HKY A;  2LUX A;  2LNK A;  2LP3 A;  4IL1 A;  4NDD A;  1AK8 A;  3BUM B;  2QAC A;  1MQ1 A;  4GPL B;  1SPY A;  4AQI A;  1XFW O;  4YI8 A;  2LMV A;  1L7Z A;  3FIA A;  2JQ6 A;  3CS1 A;  3HCM A;  3TZ1 A;  1KK8 B;  1R2U A;  2KFH A;  1BU3 A;  1SMG A;  3RLZ A;  1RRO A;  1QX5 B;  1OMD A;  3BQ3 A;  1YTZ C;  1KQM B;  2D8N A;  2LHL A;  2ZND A;  3A8R A;  1NX1 A;  1FI6 A;  1UWO A;  2NLN A;  1JFK A;  5IBW A;  4XYN A;  2K7B A;  3OB2 B;  5KU1 A;  1MHO A;  1OZO A;  2PMY A;  2ZKM X;  3CR2 A;  1JFJ A;  1BOC A;  1BF5 A;  4M2Q A;  4I5N B;  1FI5 A;  1CDL A;  4A4C A;  3BUN B;  2H61 A;  1V1F A;  3DVM A;  5AAN A;  1DGV A;  1KSO A;  2NXQ A;  3QRX A;  2SAS A;  1S1E A;  4PE0 A;  1J1D A;  1KFX L;  2KOT A;  2L0P A;  2MHH A;  3F45 A;  1CNP A;  1K94 A;  2KI6 D;  1J7P A;  1PVA A;  4NQG A;  4PE4 A;  1IKU A;  1G4Y R;  2K0J A;  4YGB B;  1KK7 Y;  2M9G A;  2VRG A;  3TS5 B;  2BCX A;  1SNL A;  1QIW A;  2M8U A;  4GBA A;  1DGU A;  5AFP A;  1SYM A;  2BL0 B;  5ER5 A;  1W7J B;  4C0L A;  3SG7 A;  1DJX A;  1AJ5 A;  3VRR A;  5I2O A;  1KSM A;  1NSH A;  1NPQ A;  2LMT A;  1QXP A;  2WCE A;  4MVF A;  2HPS A;  1FF1 A;  3NSI A;  1OZS A;  4JPZ B;  5HKW A;  4MLW A;  3ZWH A;  1CMF A;  1M63 B;  2BKH B;  1QLK A;  3BOW B;  2JXL A;  3PFV A;  2LVV A;  1UHH A;  3EK7 A;  1GQM A;  3I5G B;  2G9B A;  3O78 A;  3DVJ A;  5DKQ A;  2M29 A;  1RWY A;  2M3W A;  1B7T Z;  2AUC A;  3RM1 A;  1SL9 A;  4UPG A;  1F71 A;  2F3Y A;  2KSP A;  4PHK A;  4MZL A;  1YRU B;  1JSA A;  4ETO A;  2KFF A;  1PSR A;  4DUQ A;  1QV1 A;  1YUR A;  1IWQ A;  3PN7 C;  1MXL C;  1KFX S;  4YRU A;  5BPJ A;  1N0Y A;  1TNW A;  1SCM C;  4L9M A;  2TN4 A;  2E30 A;  1RFJ A;  3D0Y A;  3NSK A;  3KHE A;  1WRK A;  2GGM A;  3KEV A;  3OHM B;  2LV7 A;  1EL4 A;  2WCF A;  4ZCV A;  1Y1U A;  1UUS A;  2A4J A;  2SCP A;  2CT9 A;  4HRE E;  1QX7 A;  2LM5 A;  1TN4 A;  2K2F A;  4WRI A;  2ZRT A;  2GV5 A;  3DD4 A;  1A2X A;  1PK0 D;  2F2P A;  2LLS A;  2V53 A;  1AP4 A;  1SRA A;  4MZJ A;  3E3R A;  3GOF A;  4A4B A;  5I8N A;  3PAT A;  4PDZ A;  4CFQ A;  1ALV A;  1AUI B;  1IGV A;  1QLS A;  2M97 A;  2L4H A;  2ZN8 A;  1BOD A;  3ICB A;  3ZNI A;  3BXK A;  2LCP A;  2K8M B;  1RJV A;  1CM1 A;  3D0Y B;  1JF0 A;  1IJ6 A;  1YX8 A;  3SIB A;  1OSA A;  2JNF A;  4E68 A;  1NX2 A;  1DT7 B;  3SJS A;  3IQQ A;  2MA2 A;  3KF9 A;  5FYX A;  1Y6W A;  5HKZ A;  1PUL A;  3A4U B;  2OS8 B;  1FPW A;  5J3X A;  3AKA A;  3HX4 A;  3DVK A;  5JOL A;  1S36 A;  2JT8 A;  2FCD A;  1KCY A;  1ZAC A;  1XFV O;  2KYC A;  4BY4 A;  4AQJ A;  1OE9 B;  2L51 A;  1DJY A;  4FQO A;  3LK1 A;  3H4S E;  1NP8 A;  1WLM A;  4OVN F;  3EKJ A;  1Q80 A;  1BJF A;  3OB1 B;  1DJZ A;  4CPV A;  5AER A;  1IG5 A;  2KFG A;  5D69 A;  2KI4 C;  3DVE A;  4U8D A;  1DJG A;  1UHK A;  1XVJ A;  1QAS A;  2LHI A;  1K8U A;  1XFY O;  4QJ3 B;  1S3P A;  1M31 A;  3WXA A;  1L2O C;  1UP5 A;  1UUR A;  2FJU B;  3SG5 A;  1SK6 D;  3O2P A;  1IQ3 A;  3JTD C;  4MRY A;  2MBX A;  4YGC B;  1EG4 A;  1YX7 A;  4DIR A;  1A4P A;  4YGE B;  3PN7 B;  1F54 A;  3CZT X;  1TRF A;  2Y1N A;  1SCM B;  2KGR A;  5GQQ C;  3WHT B;  4GGF C;  1B7T Y;  1S6J A;  1SBJ A;  2PAL A;  3EVR A;  5KTY A;  1ZFS A;  1CLM A;  2BBN A;  4USL A;  2HF5 A;  3NSO A;  2LMU A;  3OP0 A;  2DOQ A;  3BOW A;  1K9P A;  2LVJ A;  2CCM A;  2K7O A;  4QJ5 B;  1SCV A;  2CTN A;  1S5G Z;  2L5X B;  1KFU L;  2KHN A;  3I5H C;  4MEW A;  2BEC A;  1R6P A;  1UHJ A;  1F4Q A;  1XK4 C;  2KAV A;  4OR9 B;  2R2I A;  1SL8 A;  1ZUZ A;  4D1E A;  1S6I A;  1A29 A;  3VRQ A;  1BLQ A;  1PVB A;  1PSB A;  1DMO A;  1B8R A;  2PSR A;  3CLN A;  3TDU A;  1M46 A;  3LCP C;  1SY9 A;  1DF0 B;  1F70 A;  1YVH A;  4MBE A;  1JBA A;  1QX2 A;  1Y1X A;  4ZCU A;  4PE1 A;  1TIZ A;  2I18 A;  2M7L A;  3KPX A;  1XA5 A;  1Y1A A;  2M1K B;  2HET A;  3NXA A;  4HSZ A;  1WY9 A;  1AHR A;  1ALW A;  1ODB A;  5HLV A;  3CWG A;  3BUX B;  1IQ5 A;  1J7Q A;  1TCF A;  1NCZ A;  2H2K A;  1B8L A;  4C0K A;  1SR6 C;  2I7A A;  1IRJ A;  4GFT A;  5HLO A;  3TUY C;  1GJY A;  3I5F C;  2HQW A;  2MLF C;  5DKN A;  2BKI B;  4GUK A;  1LA0 A;  4GAO A;  1DVI A;  1D1O A;  2G2B A;  2WND A;  1UHI A;  1LXF C;  2BCB A;  1K90 D;  1KWO C;  2KAY A;  5PAL A;  1A75 B;  4JQ0 D;  2EC6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...