4NDDA

X-ray structure of a double mutant of calexcitin - a neuronal calcium-signalling protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARADLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Calexcitin
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
total genus 72
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4nddA00
3H4SE 2KQYA 1DGUA 2KFHA 2K7BA 1IQ5A 2ZKMX 1PSRA 2JT0A 1U5IB 2JT8A 4HRGA 1M46A 2K0JA 1QVIZ 2JNXA 3EVUA 1A03A 2A4JA 1DF0A 2KGBC 2Y1NA 5D7FA 1RROA 3TS5B 1D1OA 2HQWA 3EK4A 3KHEA 1LA3A 1EG3A 1FBVA 2HF5A 3NSIA 1SCVA 1C7VA 2JQ6A 2F3YA 2K7OA 4WQ3A 4ORAB 1YUUA 2ZN8A 1S6JA 3VROA 4P5OE 2BBMA 2MAZA 3E3RA 1IJ6A 1YX8A 1CTRA 1EXRA 1IG5A 2ZRTA 1NUBA 3IQQA 4ZCVA 3BOWA 4XJKA 3FWCA 3BUNB 3NSOA 1DJYA 1QX7A 1J7PA 2HPSA 2M1UA 2BE4A 3MSEB 2CXJA 1JBAA 1X02A 1EH2A 1YRTB 4I5NB 1S6IA 1QIWA 3RM1A 1K8UA 5G08A 1XK4C 5AEQA 1NYAA 1Y0VH 1WLMA 2ZRSA 2KQ6A 1YVHA 1CB1A 3JVTC 1S5GZ 1ZUZA 3DVKA 2WC8A 3CR4X 3KEVA 3EK7A 1SRAA 2MJWB 3CWGA 1CMFA 2MBXA 1K90D 1BLQA 3K21A 3WXAA 3A4UB 4C0KA 1WLZA 2Q4UA 1IKUA 1F54A 4JWQA 1UHHA 1K93D 4OCIA 1YX7A 3HCMA 5K89A 4GNKB 3HX4A 4HSZA 3EK8A 4WRIA 1JUOA 5IBWA 1OMVA 3JTDC 4I5KA 2M7LA 1CKKA 4DCKA 1YUTA 2E30A 3PSRA 3DF0B 2LP3A 1QS7A 3PN7B 4I5LB 2EC6C 2LP2A 2NXQA 4PE0A 1Y1XA 4PALA 1WDCB 1ZFSA 2AUCA 2KAYA 4F0ZB 1B4CA 1CLBA 1SL7A 1S6CA 3CR2A 2JRFA 2QPTA 1BMOA 1ALVA 2WOSA 1MQ1A 4MLWA 1OMRA 1DJXA 3M0WA 3I5IC 1L2OB 1EJ3A 4CLNA 1NWDA 1TNWA 1SPYA 5JOLA 1NX2A 3TUYC 2VRGA 2G2BA 4ICBA 3FS7A 1J7QA 1SMGA 3O78A 2ISDA 1BG1A 1RJVA 2CTNA 1W7JB 1QATA 1PVAA 2BL0B 3BUOB 4YGAA 1AJ5A 3OP0A 3SIBA 1RECA 1TNPA 2Y4QA 1FI6A 3AKAA 3LCPC 3RLZA 4OV2A 4M2QA 1OE9B 2KDHA 2BCAA 1GQMA 1S26D 1IWQA 1XFXO 1SW8A 3OX6A 5HLVA 3SG6A 1L7ZA 2ZN9A 3BQ3A 5HKWA 3KF9A 1TN4A 1J1DA 3CGAA 3LL8B 2LMVA 1NCXA 5D69A 3CLNA 1CNPA 1WRLA 1ZMZA 1XYDA 2IS9A 2MHHA 1KWOC 2CBLA 5CSJA 1TOPA 3DVEA 1XO5A 1ZOTB 1B7TZ 4NDDA 4AOMA 5BPJA 3JTDB 2GV5A 4GBAA 1BR4B 2R2IA 3OB1B 3BUMB 2WCBA 2EC6B 1NCZA 2BKHB 2JNFA 2K61A 2WORA 1AVSA 1K94A 1SKTA 1BJFA 1NX1A 1Y1UA 1YR5A 1YVLA 2RGIA 1F71A 3I5GC 3PM8A 4HRHA 3AAJA 3WNXB 2AMIA 1F4QA 2LE9B 3I5HC 1IH0A 2K7DA 2CNPA 2ZFDA 3WHTB 1K96A 3PATA 1FI5A 4QJ3B 5F6TA 4DUQA 1KK8C 1CFDA 2LLSA 4MEWA 1ALWA 1R2UA 1A4PA 1DJHA 1G8IA 1K9UA 1DF0B 1KFXS 2LM5A 1N65A 4GFTA 1UUSA 2BCBA 2DOQA 4N1GA 3A8RA 4A4CA 3FIAA 1KK7Y 2BBNA 2Q91A 4CIDA 2PALA 2M8UA 1OSAA 2NZ0A 3NSLA 1RK9A 3BUXB 2OTGC 2B1UA 2M9GA 2JWWA 3CTNA 4CFQA 3VGOA 1CM4A 1G4YR 2KYFA 2PSRA 2P6BB 3I5FB 1JSAA 2LHLA 4MVFA 4IL1A 4DRWA 4DS7A 1A29A 2LVIA 1RWYA 2I2RE 5FYXA 2K2AA 3BOWB 4BY5A 1B1GA 1XFVO 3LK0A 2LC5A 3D0YA 3ZNIA 1QV1A 1A2XA 1QLKA 1MXLC 4CPVA 2K2FA 1NX0A 1DJGA 2JPTA 1SBJA 2I7AA 3WHUB 1SR6B 3ICBA 2L51A 4L9MA 1XFYO 3CZTX 3LLEA 1QXPA 5AFPA 1KCYA 4R1EA 5AXIA 1ODBA 3VRPA 3CS1A 1CDPA 2FOTA 3O4YA 4UPGA 1DTLA 1WRZA 2LVVA 3SJSA 5GQQC 4PCWA 4MZKA 1KFXL 5DKQA 3VRNA 3I5HB 1DJIA 1QX2A 1EG4A 3LK1A 1B8LA 4QJ5B 1VRKA 1SL9A 2LAPA 3O2PA 2I94A 1LA0A 2L98A 2KFGA 4N1FA 1XA5A 2V53A 1F4OA 4USLA 5I2LA 2KI4C 4ORBB 2M1KB 1LINA 1XVJA 2Y1MA 1BT6A 1FF1A 1A75B 4MRYA 1WY9A 2M29A 1PRWA 2AAOA 4U8DA 2LNKA 4YGBB 3DF0A 1J7RA 2JU0A 2KI6C 1JF0A 1CM1A 1KQMC 1MXEA 4PE4A 2JTZA 1SCMC 2FJUB 2BKIB 2EGDA 2D8NA 2SCPA 1S1EA 1IRJA 2LCPA 1UURA 2PASA 4HREE 2JT3A 2LVKA 2O5GA 2K8MB 4YRUA 5HKZA 1K95A 2KBIA 2WCFA 3SG5A 3D10A 3EVVA 1H4BA 2M7NA 1SNLA 4PE1A 3QRXA 1PVBA 2O60A 2BECA 1B8RA 1QLSA 3BYAA 1J55A 3JVTB 1JFKA 1QVIY 3TDIA 4CFRA 3TDZA 3TS5C 1CDMA 2M49B 2LUCA 2Y5IA 4DIRA 1J7OA 3CR5X 1SL8A 2KYCA 2BE6A 4N5XA 1QJTA 1TTXA 1AK8A 1TNXA 2TN4A 2CT9A 1JC2A 2MRDA 2OPOA 1MWNA 2K7CA 4MN0A 1LXFC 1GJYA 2JZIA 4PDZA 5HYDA 4C0JA 4BY4A 2G9BA 3SG7A 2NCPA 1Y1AA 1K2HA 1F8HA 1ZACA 2NLNA 2KNEA 5ER5A 1CFCA 1G33A 1FW4A 1H8BA 2JXCA 2L50A 4ETOA 1CLLA 1OZOA 4YGEB 5KTYA 2MA2A 1TNQA 5J3XA 2KI4B 4MBEA 2PMYA 1K9KA 5I2QA 1QTXA 4PHKA 1E8AA 1MR8A 3OX5A 2JC2A 4FTGA 4NQGA 4XYNA 5HLOA 1PSBA 2F2OA 2JTTA 2LLTA 4OVNF 2CCMA 1Q80A 1U5IA 5I8NA 1KFUS 1M45A 4YGCB 3I5IB 1CFFA 1DVIA 4A4BA 1GGZA 3TUYB 1S5GY 3TDUA 1UHIA 2KGRA 2ZNDA 2F8PA 1C07A 1BODA 1HQVA 4GGNA 5B8IB 4PHJA 4Q04A 1M31A 4YI9A 5AERA 1KQVA 2F2PA 4MZLA 4GAOA 3EKJA 5ER4X 1RTP1 1Y6WA 1C7WA 2KFFA 2LMTA 3AKBA 4TNCA 1F55A 1WRKA 4OKHA 3KO0A 4YBHB 3IQOA 3GOFA 4AQIA 1CMGA 1QIVA 1RFJA 1DJWA 1MF8B 3IF7A 3PN7C 1J1EA 4PHNA 3TZ1A 2KAVA 2LMUA 1WDCC 2LVJA 3PALA 1OOJA 4GUKA 1QASA 2MLEC 4YGDB 1YURA 3GK2A 4XJKB 3SG4A 3PLFB 1NP8A 1SYMA 2F3ZA 2JOJA 3GK4X 1IQ3A 2MLFC 2M97A 4GGFC 2OS8C 2LV7A 2L5XB 1GGWA 1KWOB 5I2OA 1AUIB 5CSNA 1L2OC 5DKNA 2E6WA 1N2DA 1CDNA 3GK1A 4MZJA 3D0YB 1NCYA 2JULA 4ZCUA 5HKYA 3OB2B 1KFUL 2KSPA 1YRUB 1EL4A 1NX3A 1BU3A 2M0RA 3SIAA 1QV0A 1AHRA 2JXLA 3SG3A 1B8CA 3I5GB 4JPZB 1CDLA 1OQPA 2F33A 2H61A 2KHNA 2LLUA 3NXAA 4FQOA 2WCEA 1R6PA 2SASA 1S3PA 1BF5A 2BL0C 1OZSA 3KPXA 2HETA 1LVCD 3BXKA 1S36A 1V1GA 4PE7A 4PHMA 1F70A 1KK8B 2KI6D 2KBMA 2L4HA 2ZNEA 5KU1A 3DVJA 1AJ4A 2L4IA 3EKHA 2KAXA 1KK7Z 1FPWA 4GPLB 4NDCA 1LKJA 3OHMB 4WQ2A 1QX5B 4JQ0D 1NSHA 1UHKA 2L0PA 5CPVA 1YTZC 1V1FA 4NDBA 1TRFA 2OTGB 5AANA 1TCFA 4AQJA 5CSIA 1A75A 3F45A 1BOCA 1XFZO 4GGFA 1KSMA 4M2PA 3AAKA 1B7TY 1NIWA 3O6BA 2LUXA 2NCOA 1K9PA 4QJ4B 1PULA 1M63B 1B9AA 1UP5A 1N0YA 1DT7B 1IGVA 2LANA 1DGVA 2GGMA 2L2EA 4C0LA 1MHOA 2OS8B 3EVRA 4MRXA 2H2KA 1HT9A 2KOTA 3NSKA 2GGZA 4YI8A 1XFWO 1BR1B 2FCEA 1XK4A 3C1VA 2COLB 4M2OA 3VRRA 5CSFA 1UHJA 1PK0D 2WNDA 4P2YB 1KSOA 1MUXA 1XFUO 4MSPA 1DMOA 1PALA 2EHBA 3ZWHA 2QACA 3DVMA 3DD4A 2M3WA 1UHNA 2BCXA 1DJZA 1SK6D 1AP4A 4ORCB 3I5FC 3FWBA 2I18A 1JF2A 2PRUA 1M39A 5TNCA 2HQ8A 1SY9A 3BUWB 1OMDA 4D1EA 2LHIA 1TCOB 1NPQA 4I5JA 3VRQA 5KSZA 5DKRA 3SG2A 5JJGA 4E68A 1KQMB 1TIZA 1UWOA 1JWDA 1SCMB 1CLMA 1IJ5A 4OR9B 1B47A 1SR6C 5PALA 1W7IB 3PFVA 1JFJA 1CFPA 2PVBA 2H61C 1YUSA 2FCDA
chains in the Genus database with same CATH superfamily
3H4SE 2KQYA 1DGUA 2GTEA 1DQEA 2KFHA 2K7BA 1IQ5A 2ZKMX 1PSRA 2JT0A 1U5IB 3N7HA 2JT8A 4HRGA 1M46A 2K0JA 1QVIZ 1T14A 2JNXA 3EVUA 3RZSA 3S0AA 1A03A 1OOHA 2A4JA 1DF0A 2KGBC 2Y1NA 4INXA 5D7FA 1RROA 3TS5B 1D1OA 2HQWA 3EK4A 3KHEA 1LA3A 1EG3A 1FBVA 2HF5A 3NSIA 1SCVA 1C7VA 2JQ6A 2F3YA 2K7OA 4WQ3A 4ORAB 1YUUA 2ZN8A 1S6JA 3VROA 4P5OE 2BBMA 3S0FA 2MAZA 3E3RA 1IJ6A 1YX8A 1CTRA 1EXRA 1IG5A 2ZRTA 1NUBA 2WCJA 3IQQA 4ZCVA 3BOWA 4XJKA 3FWCA 3BUNB 3NSOA 1DJYA 1QX7A 1J7PA 2HPSA 2M1UA 2BE4A 3MSEB 2CXJA 1JBAA 1X02A 1EH2A 1YRTB 4I5NB 1S6IA 1QIWA 2FJYA 1K8UA 3RM1A 5G08A 1XK4C 5AEQA 1NYAA 1Y0VH 1TWOA 4KYNA 5FI2A 1WLMA 3D75A 2ZRSA 2KQ6A 1YVHA 1CB1A 3JVTC 3UO9A 1S5GZ 1ZUZA 3DVKA 2WC8A 3CR4X 1QWVA 3KEVA 3EK7A 1SRAA 2MJWB 3CWGA 3SS4A 1CMFA 2MBXA 1K90D 1BLQA 3K21A 3WXAA 3A4UB 4C0KA 1WLZA 2Q4UA 1IKUA 1F54A 1C3YA 4JWQA 2BNXA 1UHHA 1K93D 4OCIA 1YX7A 3CABA 3HCMA 5K89A 4GNKB 3HX4A 4HSZA 3EK8A 4WRIA 1JUOA 5IBWA 1OMVA 3JTDC 4I5KA 2M7LA 1CKKA 3V2LA 1YUTA 2E30A 3PSRA 3DF0B 2LP3A 3B6XA 1QS7A 4DCKA 3PN7B 4I5LB 2EC6C 2LP2A 2NXQA 4PE0A 1Y1XA 4PALA 1WDCB 1ZFSA 2AUCA 2KAYA 4F0ZB 1B4CA 1CLBA 1SL7A 1S6CA 3CR2A 2JRFA 2QPTA 1BMOA 1ALVA 2WOSA 1MQ1A 3R1VA 4MLWA 1XFRA 1OMRA 1DJXA 3M0WA 2WCHA 3I5IC 1L2OB 1EJ3A 4CLNA 3CZ1A 1NWDA 1TNWA 2L2CA 1SPYA 2L5YA 5JOLA 1NX2A 3TUYC 2VRGA 2G2BA 4ICBA 3FS7A 1J7QA 1SMGA 3O78A 2ISDA 3BFAA 1BG1A 1RJVA 2CTNA 1W7JB 1P28A 1QATA 1PVAA 2BL0B 3BUOB 4YGAA 1AJ5A 3OP0A 3SIBA 1RECA 1TNPA 2Y4QA 1FI6A 3AKAA 3NGVA 3LCPC 3RLZA 4OV2A 4M2QA 1OE9B 2KDHA 2BCAA 1GQMA 1S26D 1IWQA 2BAPA 1XFXO 1SW8A 3OX6A 5HLVA 3SG6A 1L7ZA 2ZN9A 3BQ3A 5HKWA 3KF9A 1TN4A 1J1DA 2KLDA 3CGAA 3LL8B 2LMVA 2WC5A 1NCXA 5D69A 3CLNA 1CNPA 1WRLA 1ZMZA 1XYDA 2IS9A 2MHHA 1KWOC 2CBLA 5CSJA 1TOPA 3DVEA 1XO5A 1ZOTB 1B7TZ 4NDDA 4AOMA 5BPJA 3JTDB 2GV5A 4GBAA 1BR4B 2R2IA 1TUZA 3OB1B 3BUMB 2WCBA 2EC6B 1NCZA 2BKHB 2JNFA 2K61A 2WORA 4OZDA 1AVSA 2JPOA 1K94A 1SKTA 1BJFA 1NX1A 1Y1UA 1YR5A 1YVLA 4JKTA 2RGIA 1F71A 3FE8A 3I5GC 3PM8A 4HRHA 3AAJA 3WNXB 2AMIA 3CYZA 5FI7A 1F4QA 2LE9B 3I5HC 1IH0A 2K7DA 2CNPA 2ZFDA 3WHTB 1K96A 3PATA 1FI5A 4QJ3B 5F6TA 4DUQA 1KK8C 1CFDA 2LLSA 4MEWA 1ALWA 1R2UA 1A4PA 1DJHA 3SS5A 1G8IA 1K9UA 1DF0B 1KFXS 2LM5A 1N65A 4GFTA 1UUSA 2BCBA 2DOQA 4N1GA 3A8RA 4A4CA 3FIAA 1KK7Y 2BBNA 2Q91A 1ORGA 2PALA 4CIDA 2M8UA 1OSAA 3L47A 2NZ0A 3NSLA 1RK9A 3BUXB 2OTGC 2B1UA 2M9GA 2JWWA 3CTNA 4CFQA 3VGOA 1CM4A 1G4YR 2KYFA 2PSRA 2P6BB 3I5FB 1JSAA 2LHLA 4MVFA 4IL1A 2P71A 4DRWA 4DS7A 1OW4A 1A29A 2LVIA 1RWYA 3EG5B 2I2RE 5EL2A 5FYXA 2K2AA 3BOWB 4BY5A 1B1GA 1XFVO 3LK0A 2LC5A 3D0YA 3ZNIA 1QV1A 1A2XA 3D77A 1QLKA 1MXLC 3B87A 4CPVA 2K2FA 1NX0A 1DJGA 2JPTA 1SBJA 2I7AA 3WHUB 1SR6B 3ICBA 2L51A 4L9MA 1XFYO 3DZTA 3CZTX 3LLEA 1QXPA 5AFPA 1KCYA 4R1EA 5AXIA 1ODBA 3VRPA 3CS1A 1CDPA 2QEVA 2FOTA 3O4YA 4UPGA 1DTLA 1WRZA 2LVVA 3SJSA 5GQQC 4PCWA 3K1EA 4MZKA 1KFXL 5DKQA 3VRNA 3I5HB 1DJIA 1QX2A 1EG4A 3LK1A 1B8LA 4QJ5B 1VRKA 1SL9A 2LAPA 3O2PA 2I94A 1LA0A 2L98A 2KFGA 4N1FA 1XA5A 2V53A 1F4OA 3O4XA 4USLA 2KI4C 5I2LA 4ORBB 2M1KB 1LINA 1XVJA 2Y1MA 1BT6A 3VB1A 1A75B 1FF1A 4MRYA 1WY9A 2M29A 1PRWA 2AAOA 4U8DA 2LNKA 4YGBB 3DF0A 3S0GA 3BFHA 1J7RA 2JU0A 2KI6C 1JF0A 1CM1A 1KQMC 5DICA 1MXEA 4PE4A 4PT1A 2JTZA 2H8VA 1SCMC 3Q8IA 2FJUB 2BKIB 2EGDA 3S0DA 2D8NA 2SCPA 1S1EA 1IRJA 2LCPA 1UURA 2QEHA 2PASA 4HREE 2KPHA 2JT3A 2LVKA 2O5GA 2K8MB 4YRUA 5HKZA 1K95A 2KBIA 2WCFA 3FE9A 3SG5A 3D10A 3EVVA 1SSEB 1H4BA 2M7NA 1SNLA 4PE1A 1DC1A 1OOIX 1Z2CB 3QRXA 1PVBA 2O60A 2BECA 1B8RA 1QLSA 3BYAA 1J55A 3JVTB 1JFKA 1QVIY 3TDIA 4CFRA 3TDZA 3TS5C 1CDMA 2M49B 2LUCA 2Y5IA 5FI6A 4DIRA 2QDIA 3CR5X 1J7OA 1SL8A 2KYCA 2BE6A 4N5XA 1QJTA 1TTXA 1AK8A 1TNXA 2TN4A 3DYEA 2CT9A 1JC2A 2MRDA 3IVTA 2OPOA 1DELA 1MWNA 2K7CA 4MN0A 5I94A 2WCMA 1LXFC 1GJYA 1LS8A 2JZIA 2YGUA 3R1OA 4PDZA 4C0JA 5HYDA 4BY4A 2G9BA 3SG7A 3FE6A 2NCPA 1Y1AA 1K2HA 1F8HA 1ZACA 2NLNA 3B7AA 3D73A 2KNEA 5ER5A 1CFCA 1G33A 1FW4A 1H8BA 2JXCA 2L50A 4ETOA 1CLLA 1OZOA 4YGEB 5KTYA 2MA2A 1TNQA 5J3XA 2KI4B 4MBEA 2PMYA 1K9KA 5I2QA 1QTXA 3L4LA 1E8AA 4PHKA 1MR8A 3OX5A 2JC2A 4FTGA 4NQGA 4XYNA 5HLOA 1IIOA 1PSBA 2F2OA 2JTTA 2LLTA 3BFBA 4OVNF 2CCMA 2QEBA 1Q80A 1U5IA 3CZ2A 5I8NA 1KFUS 1M45A 4YGCB 3I5IB 1CFFA 4FQTA 1DVIA 4A4BA 3NHTA 1GGZA 3TUYB 1S5GY 3TDUA 1UHIA 2KGRA 2ZNDA 2F8PA 1C07A 1BODA 1HQVA 4GGNA 3UNWA 3DY9A 3OBVA 4PHJA 5B8IB 4Q04A 1M31A 4YI9A 5AERA 1KQVA 2F2PA 3PM2A 4JD9A 4MZLA 2ERBA 4GAOA 3EKJA 5ER4X 1RTP1 1Y6WA 1C7WA 2KFFA 2LMTA 3AKBA 4TNCA 1F55A 1WRKA 4OKHA 3KO0A 4YBHB 3IQOA 3GOFA 4AQIA 1CMGA 1QIVA 1RFJA 1DJWA 1MF8B 3IF7A 3PN7C 1J1EA 4PHNA 3TZ1A 2KAVA 2LMUA 4F7FA 1WDCC 2LVJA 2QEOA 1OOJA 2WC6A 3PALA 4GUKA 1QASA 2MLEC 4YGDB 1YURA 3GK2A 4XJKB 3SG4A 3CDNA 1NP8A 3B86A 1SYMA 2F3ZA 2JOJA 3PLFB 3GK4X 1IQ3A 2MLFC 2M97A 4GGFC 2OS8C 2LV7A 2L5XB 1GGWA 1KWOB 5I2OA 1AUIB 5CSNA 1L2OC 5DKNA 2E6WA 1N2DA 3S0BA 3GK1A 1CDNA 4MZJA 3D0YB 1NCYA 2JULA 4ZCUA 5HKYA 3OB2B 1KFUL 2KSPA 1YRUB 1EL4A 1NX3A 1BU3A 2M0RA 3SIAA 1QV0A 1AHRA 2JXLA 3SG3A 1B8CA 3I5GB 1Z4HA 4JPZB 1CDLA 1OQPA 2F33A 2H61A 2KHNA 1OOFA 2LLUA 3NXAA 4FQOA 2WCEA 1R6PA 2SASA 1S3PA 3S0EA 1BF5A 2BL0C 1OZSA 3QMEA 3KPXA 2HETA 1LVCD 3BXKA 1S36A 1V1GA 4PE7A 4PHMA 1F70A 1KK8B 2KI6D 2KBMA 2L4HA 2ZNEA 5KU1A 3DVJA 4INWA 1AJ4A 2L4IA 3EKHA 2KAXA 3CZ0A 1KK7Z 3L4AA 1FPWA 4GPLB 4NDCA 1LKJA 3OHMB 4WQ2A 1QX5B 4JQ0D 1DEKA 1NSHA 1UHKA 5D3OA 1TUJA 2L0PA 5CPVA 1YTZC 1V1FA 1C3ZA 4NDBA 1TRFA 2OTGB 5AANA 1TCFA 4AQJA 5CSIA 1A75A 2K60A 3F45A 1BOCA 1XFZO 4GGFA 1KSMA 2KLEA 4M2PA 3AAKA 3D74A 1B7TY 1NIWA 2PYQA 2LUXA 3O6BA 2NCOA 1K9PA 4QJ4B 1PULA 3BJHA 1M63B 1B9AA 1UP5A 2PQLA 1N0YA 1DT7B 1IGVA 2LANA 1DGVA 2GGMA 4IJ7A 2L2EA 4C0LA 1MHOA 2OS8B 3EVRA 4MRXA 2H2KA 1HT9A 2KOTA 3NSKA 2GGZA 4YI8A 1XFWO 3B88A 1BR1B 2FCEA 1XK4A 3OGNA 3C1VA 2COLB 3D78A 4M2OA 5CSFA 3VRRA 1UHJA 1PK0D 2WNDA 4P2YB 1KSOA 1MUXA 1XFUO 3D76A 4MSPA 1DMOA 1PALA 2EHBA 3ZWHA 2QACA 3DVMA 3DD4A 2M3WA 3R72A 1UHNA 2BCXA 3SS3A 1DJZA 3DXLA 5HL1A 2WCLA 3NHIA 1SK6D 1AP4A 4ORCB 3I5FC 3FWBA 2I18A 1JF2A 2PRUA 1M39A 2WCKA 5TNCA 2HQ8A 3PJIA 1SY9A 1W9ZA 3BUWB 1OMDA 4D1EA 2LHIA 1GM0A 1TCOB 1OOGA 1NPQA 4I5JA 3VRQA 5KSZA 5DKRA 3SG2A 5JJGA 4E68A 1KQMB 1TIZA 1UWOA 1JWDA 3R1PA 2P70A 1SCMB 1CLMA 1IJ5A 4OR9B 1B47A 1SR6C 5PALA 1W7IB 3PFVA 1JFJA 1CFPA 2PVBA 2H61C 1YUSA 2FCDA
chains in the Genus database with same CATH topology
3H4SE 2KQYA 1DGUA 2KFHA 2K7BA 1IQ5A 2ZKMX 1PSRA 2JT0A 1U5IB 2JT8A 4HRGA 1M46A 2K0JA 1QVIZ 2JNXA 3EVUA 1A03A 2A4JA 1DF0A 2KGBC 2Y1NA 5D7FA 1RROA 3TS5B 1D1OA 2HQWA 3EK4A 3KHEA 1LA3A 1EG3A 1FBVA 2HF5A 3NSIA 1SCVA 1C7VA 2JQ6A 2F3YA 2K7OA 4WQ3A 4ORAB 1YUUA 2ZN8A 1S6JA 3VROA 4P5OE 2BBMA 2MAZA 3E3RA 1IJ6A 1YX8A 1CTRA 1EXRA 1IG5A 2ZRTA 1NUBA 3IQQA 4ZCVA 3BOWA 4XJKA 3FWCA 3BUNB 3NSOA 1DJYA 1QX7A 1J7PA 2HPSA 2M1UA 2BE4A 3MSEB 2CXJA 1JBAA 1X02A 1EH2A 1YRTB 4I5NB 1S6IA 1QIWA 3RM1A 1K8UA 5G08A 1XK4C 5AEQA 1NYAA 1Y0VH 1WLMA 2ZRSA 2KQ6A 1YVHA 1CB1A 3JVTC 1S5GZ 1ZUZA 3DVKA 2WC8A 3CR4X 3KEVA 3EK7A 1SRAA 2MJWB 3CWGA 1CMFA 2MBXA 1K90D 1BLQA 3K21A 3WXAA 3A4UB 4C0KA 1WLZA 2Q4UA 1IKUA 1F54A 4JWQA 1UHHA 1K93D 4OCIA 1YX7A 3HCMA 5K89A 4GNKB 3HX4A 4HSZA 3EK8A 4WRIA 1JUOA 5IBWA 1OMVA 3JTDC 4I5KA 2M7LA 1CKKA 4DCKA 1YUTA 2E30A 3PSRA 3DF0B 2LP3A 1QS7A 3PN7B 4I5LB 2EC6C 2LP2A 2NXQA 4PE0A 1Y1XA 4PALA 1WDCB 1ZFSA 2AUCA 2KAYA 4F0ZB 1B4CA 1CLBA 1SL7A 1S6CA 3CR2A 2JRFA 2QPTA 1BMOA 1ALVA 2WOSA 1MQ1A 4MLWA 1OMRA 1DJXA 3M0WA 3I5IC 1L2OB 1EJ3A 4CLNA 1NWDA 1TNWA 1SPYA 5JOLA 1NX2A 3TUYC 2VRGA 2G2BA 4ICBA 3FS7A 1J7QA 1SMGA 3O78A 2ISDA 1BG1A 1RJVA 2CTNA 1W7JB 1QATA 1PVAA 2BL0B 3BUOB 4YGAA 1AJ5A 3OP0A 3SIBA 1RECA 1TNPA 2Y4QA 1FI6A 3AKAA 3LCPC 3RLZA 4OV2A 4M2QA 1OE9B 2KDHA 2BCAA 1GQMA 1S26D 1IWQA 1XFXO 1SW8A 3OX6A 5HLVA 3SG6A 1L7ZA 2ZN9A 3BQ3A 5HKWA 3KF9A 1TN4A 1J1DA 3CGAA 3LL8B 2LMVA 1NCXA 5D69A 3CLNA 1CNPA 1WRLA 1ZMZA 1XYDA 2IS9A 2MHHA 1KWOC 2CBLA 5CSJA 1TOPA 3DVEA 1XO5A 1ZOTB 1B7TZ 4NDDA 4AOMA 5BPJA 3JTDB 2GV5A 4GBAA 1BR4B 2R2IA 3OB1B 3BUMB 2WCBA 2EC6B 1NCZA 2BKHB 2JNFA 2K61A 2WORA 1AVSA 1K94A 1SKTA 1BJFA 1NX1A 1Y1UA 1YR5A 1YVLA 2RGIA 1F71A 3I5GC 3PM8A 4HRHA 3AAJA 3WNXB 2AMIA 1F4QA 2LE9B 3I5HC 1IH0A 2K7DA 2CNPA 2ZFDA 3WHTB 1K96A 3PATA 1FI5A 4QJ3B 5F6TA 4DUQA 1KK8C 1CFDA 2LLSA 4MEWA 1ALWA 1R2UA 1A4PA 1DJHA 1G8IA 1K9UA 1DF0B 1KFXS 2LM5A 1N65A 4GFTA 1UUSA 2BCBA 2DOQA 4N1GA 3A8RA 4A4CA 3FIAA 1KK7Y 2BBNA 2Q91A 4CIDA 2PALA 2M8UA 1OSAA 2NZ0A 3NSLA 1RK9A 3BUXB 2OTGC 2B1UA 2M9GA 2JWWA 3CTNA 4CFQA 3VGOA 1CM4A 1G4YR 2KYFA 2PSRA 2P6BB 3I5FB 1JSAA 2LHLA 4MVFA 4IL1A 4DRWA 4DS7A 1A29A 2LVIA 1RWYA 2I2RE 5FYXA 2K2AA 3BOWB 4BY5A 1B1GA 1XFVO 3LK0A 2LC5A 3D0YA 3ZNIA 1QV1A 1A2XA 1QLKA 1MXLC 4CPVA 2K2FA 1NX0A 1DJGA 2JPTA 1SBJA 2I7AA 3WHUB 1SR6B 3ICBA 2L51A 4L9MA 1XFYO 3CZTX 3LLEA 1QXPA 5AFPA 1KCYA 4R1EA 5AXIA 1ODBA 3VRPA 3CS1A 1CDPA 2FOTA 3O4YA 4UPGA 1DTLA 1WRZA 2LVVA 3SJSA 5GQQC 4PCWA 4MZKA 1KFXL 5DKQA 3VRNA 3I5HB 1DJIA 1QX2A 1EG4A 3LK1A 1B8LA 4QJ5B 1VRKA 1SL9A 2LAPA 3O2PA 2I94A 1LA0A 2L98A 2KFGA 4N1FA 1XA5A 2V53A 1F4OA 4USLA 5I2LA 2KI4C 4ORBB 2M1KB 1LINA 1XVJA 2Y1MA 1BT6A 1FF1A 1A75B 4MRYA 1WY9A 2M29A 1PRWA 2AAOA 4U8DA 2LNKA 4YGBB 3DF0A 1J7RA 2JU0A 2KI6C 1JF0A 1CM1A 1KQMC 1MXEA 4PE4A 2JTZA 1SCMC 2FJUB 2BKIB 2EGDA 2D8NA 2SCPA 1S1EA 1IRJA 2LCPA 1UURA 2PASA 4HREE 2JT3A 2LVKA 2O5GA 2K8MB 4YRUA 5HKZA 1K95A 2KBIA 2WCFA 3SG5A 3D10A 3EVVA 1H4BA 2M7NA 1SNLA 4PE1A 3QRXA 1PVBA 2O60A 2BECA 1B8RA 1QLSA 3BYAA 1J55A 3JVTB 1JFKA 1QVIY 3TDIA 4CFRA 3TDZA 3TS5C 1CDMA 2M49B 2LUCA 2Y5IA 4DIRA 1J7OA 3CR5X 1SL8A 2KYCA 2BE6A 4N5XA 1QJTA 1TTXA 1AK8A 1TNXA 2TN4A 2CT9A 1JC2A 2MRDA 2OPOA 1MWNA 2K7CA 4MN0A 1LXFC 1GJYA 2JZIA 4PDZA 5HYDA 4C0JA 4BY4A 2G9BA 3SG7A 2NCPA 1Y1AA 1K2HA 1F8HA 1ZACA 2NLNA 2KNEA 5ER5A 1CFCA 1G33A 1FW4A 1H8BA 2JXCA 2L50A 4ETOA 1CLLA 1OZOA 4YGEB 5KTYA 2MA2A 1TNQA 5J3XA 2KI4B 4MBEA 2PMYA 1K9KA 5I2QA 1QTXA 4PHKA 1E8AA 1MR8A 3OX5A 2JC2A 4FTGA 4NQGA 4XYNA 5HLOA 1PSBA 2F2OA 2JTTA 2LLTA 4OVNF 2CCMA 1Q80A 1U5IA 5I8NA 1KFUS 1M45A 4YGCB 3I5IB 1CFFA 1DVIA 4A4BA 1GGZA 3TUYB 1S5GY 3TDUA 1UHIA 2KGRA 2ZNDA 2F8PA 1C07A 1BODA 1HQVA 4GGNA 5B8IB 4PHJA 4Q04A 1M31A 4YI9A 5AERA 1KQVA 2F2PA 4MZLA 4GAOA 3EKJA 5ER4X 1RTP1 1Y6WA 1C7WA 2KFFA 2LMTA 3AKBA 4TNCA 1F55A 1WRKA 4OKHA 3KO0A 4YBHB 3IQOA 3GOFA 4AQIA 1CMGA 1QIVA 1RFJA 1DJWA 1MF8B 3IF7A 3PN7C 1J1EA 4PHNA 3TZ1A 2KAVA 2LMUA 1WDCC 2LVJA 3PALA 1OOJA 4GUKA 1QASA 2MLEC 4YGDB 1YURA 3GK2A 4XJKB 3SG4A 3PLFB 1NP8A 1SYMA 2F3ZA 2JOJA 3GK4X 1IQ3A 2MLFC 2M97A 4GGFC 2OS8C 2LV7A 2L5XB 1GGWA 1KWOB 5I2OA 1AUIB 5CSNA 1L2OC 5DKNA 2E6WA 1N2DA 1CDNA 3GK1A 4MZJA 3D0YB 1NCYA 2JULA 4ZCUA 5HKYA 3OB2B 1KFUL 2KSPA 1YRUB 1EL4A 1NX3A 1BU3A 2M0RA 3SIAA 1QV0A 1AHRA 2JXLA 3SG3A 1B8CA 3I5GB 4JPZB 1CDLA 1OQPA 2F33A 2H61A 2KHNA 2LLUA 3NXAA 4FQOA 2WCEA 1R6PA 2SASA 1S3PA 1BF5A 2BL0C 1OZSA 3KPXA 2HETA 1LVCD 3BXKA 1S36A 1V1GA 4PE7A 4PHMA 1F70A 1KK8B 2KI6D 2KBMA 2L4HA 2ZNEA 5KU1A 3DVJA 1AJ4A 2L4IA 3EKHA 2KAXA 1KK7Z 1FPWA 4GPLB 4NDCA 1LKJA 3OHMB 4WQ2A 1QX5B 4JQ0D 1NSHA 1UHKA 2L0PA 5CPVA 1YTZC 1V1FA 4NDBA 1TRFA 2OTGB 5AANA 1TCFA 4AQJA 5CSIA 1A75A 3F45A 1BOCA 1XFZO 4GGFA 1KSMA 4M2PA 3AAKA 1B7TY 1NIWA 3O6BA 2LUXA 2NCOA 1K9PA 4QJ4B 1PULA 1M63B 1B9AA 1UP5A 1N0YA 1DT7B 1IGVA 2LANA 1DGVA 2GGMA 2L2EA 4C0LA 1MHOA 2OS8B 3EVRA 4MRXA 2H2KA 1HT9A 2KOTA 3NSKA 2GGZA 4YI8A 1XFWO 1BR1B 2FCEA 1XK4A 3C1VA 2COLB 4M2OA 3VRRA 5CSFA 1UHJA 1PK0D 2WNDA 4P2YB 1KSOA 1MUXA 1XFUO 4MSPA 1DMOA 1PALA 2EHBA 3ZWHA 2QACA 3DVMA 3DD4A 2M3WA 1UHNA 2BCXA 1DJZA 1SK6D 1AP4A 4ORCB 3I5FC 3FWBA 2I18A 1JF2A 2PRUA 1M39A 5TNCA 2HQ8A 1SY9A 3BUWB 1OMDA 4D1EA 2LHIA 1TCOB 1NPQA 4I5JA 3VRQA 5KSZA 5DKRA 3SG2A 5JJGA 4E68A 1KQMB 1TIZA 1UWOA 1JWDA 1SCMB 1CLMA 1IJ5A 4OR9B 1B47A 1SR6C 5PALA 1W7IB 3PFVA 1JFJA 1CFPA 2PVBA 2H61C 1YUSA 2FCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4S E;  2KQY A;  1DGU A;  2KFH A;  2K7B A;  1IQ5 A;  2ZKM X;  1PSR A;  2JT0 A;  1U5I B;  2JT8 A;  4HRG A;  1M46 A;  2K0J A;  1QVI Z;  2JNX A;  3EVU A;  1A03 A;  2A4J A;  1DF0 A;  2KGB C;  2Y1N A;  5D7F A;  1RRO A;  3TS5 B;  1D1O A;  2HQW A;  3EK4 A;  3KHE A;  1LA3 A;  1EG3 A;  1FBV A;  2HF5 A;  3NSI A;  1SCV A;  1C7V A;  2JQ6 A;  2F3Y A;  2K7O A;  4WQ3 A;  4ORA B;  1YUU A;  2ZN8 A;  1S6J A;  3VRO A;  4P5O E;  2BBM A;  2MAZ A;  3E3R A;  1IJ6 A;  1YX8 A;  1CTR A;  1EXR A;  1IG5 A;  2ZRT A;  1NUB A;  3IQQ A;  4ZCV A;  3BOW A;  4XJK A;  3FWC A;  3BUN B;  3NSO A;  1DJY A;  1QX7 A;  1J7P A;  2HPS A;  2M1U A;  2BE4 A;  3MSE B;  2CXJ A;  1JBA A;  1X02 A;  1EH2 A;  1YRT B;  4I5N B;  1S6I A;  1QIW A;  3RM1 A;  1K8U A;  5G08 A;  1XK4 C;  5AEQ A;  1NYA A;  1Y0V H;  1WLM A;  2ZRS A;  2KQ6 A;  1YVH A;  1CB1 A;  3JVT C;  1S5G Z;  1ZUZ A;  3DVK A;  2WC8 A;  3CR4 X;  3KEV A;  3EK7 A;  1SRA A;  2MJW B;  3CWG A;  1CMF A;  2MBX A;  1K90 D;  1BLQ A;  3K21 A;  3WXA A;  3A4U B;  4C0K A;  1WLZ A;  2Q4U A;  1IKU A;  1F54 A;  4JWQ A;  1UHH A;  1K93 D;  4OCI A;  1YX7 A;  3HCM A;  5K89 A;  4GNK B;  3HX4 A;  4HSZ A;  3EK8 A;  4WRI A;  1JUO A;  5IBW A;  1OMV A;  3JTD C;  4I5K A;  2M7L A;  1CKK A;  4DCK A;  1YUT A;  2E30 A;  3PSR A;  3DF0 B;  2LP3 A;  1QS7 A;  3PN7 B;  4I5L B;  2EC6 C;  2LP2 A;  2NXQ A;  4PE0 A;  1Y1X A;  4PAL A;  1WDC B;  1ZFS A;  2AUC A;  2KAY A;  4F0Z B;  1B4C A;  1CLB A;  1SL7 A;  1S6C A;  3CR2 A;  2JRF A;  2QPT A;  1BMO A;  1ALV A;  2WOS A;  1MQ1 A;  4MLW A;  1OMR A;  1DJX A;  3M0W A;  3I5I C;  1L2O B;  1EJ3 A;  4CLN A;  1NWD A;  1TNW A;  1SPY A;  5JOL A;  1NX2 A;  3TUY C;  2VRG A;  2G2B A;  4ICB A;  3FS7 A;  1J7Q A;  1SMG A;  3O78 A;  2ISD A;  1BG1 A;  1RJV A;  2CTN A;  1W7J B;  1QAT A;  1PVA A;  2BL0 B;  3BUO B;  4YGA A;  1AJ5 A;  3OP0 A;  3SIB A;  1REC A;  1TNP A;  2Y4Q A;  1FI6 A;  3AKA A;  3LCP C;  3RLZ A;  4OV2 A;  4M2Q A;  1OE9 B;  2KDH A;  2BCA A;  1GQM A;  1S26 D;  1IWQ A;  1XFX O;  1SW8 A;  3OX6 A;  5HLV A;  3SG6 A;  1L7Z A;  2ZN9 A;  3BQ3 A;  5HKW A;  3KF9 A;  1TN4 A;  1J1D A;  3CGA A;  3LL8 B;  2LMV A;  1NCX A;  5D69 A;  3CLN A;  1CNP A;  1WRL A;  1ZMZ A;  1XYD A;  2IS9 A;  2MHH A;  1KWO C;  2CBL A;  5CSJ A;  1TOP A;  3DVE A;  1XO5 A;  1ZOT B;  1B7T Z;  4NDD A;  4AOM A;  5BPJ A;  3JTD B;  2GV5 A;  4GBA A;  1BR4 B;  2R2I A;  3OB1 B;  3BUM B;  2WCB A;  2EC6 B;  1NCZ A;  2BKH B;  2JNF A;  2K61 A;  2WOR A;  1AVS A;  1K94 A;  1SKT A;  1BJF A;  1NX1 A;  1Y1U A;  1YR5 A;  1YVL A;  2RGI A;  1F71 A;  3I5G C;  3PM8 A;  4HRH A;  3AAJ A;  3WNX B;  2AMI A;  1F4Q A;  2LE9 B;  3I5H C;  1IH0 A;  2K7D A;  2CNP A;  2ZFD A;  3WHT B;  1K96 A;  3PAT A;  1FI5 A;  4QJ3 B;  5F6T A;  4DUQ A;  1KK8 C;  1CFD A;  2LLS A;  4MEW A;  1ALW A;  1R2U A;  1A4P A;  1DJH A;  1G8I A;  1K9U A;  1DF0 B;  1KFX S;  2LM5 A;  1N65 A;  4GFT A;  1UUS A;  2BCB A;  2DOQ A;  4N1G A;  3A8R A;  4A4C A;  3FIA A;  1KK7 Y;  2BBN A;  2Q91 A;  4CID A;  2PAL A;  2M8U A;  1OSA A;  2NZ0 A;  3NSL A;  1RK9 A;  3BUX B;  2OTG C;  2B1U A;  2M9G A;  2JWW A;  3CTN A;  4CFQ A;  3VGO A;  1CM4 A;  1G4Y R;  2KYF A;  2PSR A;  2P6B B;  3I5F B;  1JSA A;  2LHL A;  4MVF A;  4IL1 A;  4DRW A;  4DS7 A;  1A29 A;  2LVI A;  1RWY A;  2I2R E;  5FYX A;  2K2A A;  3BOW B;  4BY5 A;  1B1G A;  1XFV O;  3LK0 A;  2LC5 A;  3D0Y A;  3ZNI A;  1QV1 A;  1A2X A;  1QLK A;  1MXL C;  4CPV A;  2K2F A;  1NX0 A;  1DJG A;  2JPT A;  1SBJ A;  2I7A A;  3WHU B;  1SR6 B;  3ICB A;  2L51 A;  4L9M A;  1XFY O;  3CZT X;  3LLE A;  1QXP A;  5AFP A;  1KCY A;  4R1E A;  5AXI A;  1ODB A;  3VRP A;  3CS1 A;  1CDP A;  2FOT A;  3O4Y A;  4UPG A;  1DTL A;  1WRZ A;  2LVV A;  3SJS A;  5GQQ C;  4PCW A;  4MZK A;  1KFX L;  5DKQ A;  3VRN A;  3I5H B;  1DJI A;  1QX2 A;  1EG4 A;  3LK1 A;  1B8L A;  4QJ5 B;  1VRK A;  1SL9 A;  2LAP A;  3O2P A;  2I94 A;  1LA0 A;  2L98 A;  2KFG A;  4N1F A;  1XA5 A;  2V53 A;  1F4O A;  4USL A;  5I2L A;  2KI4 C;  4ORB B;  2M1K B;  1LIN A;  1XVJ A;  2Y1M A;  1BT6 A;  1FF1 A;  1A75 B;  4MRY A;  1WY9 A;  2M29 A;  1PRW A;  2AAO A;  4U8D A;  2LNK A;  4YGB B;  3DF0 A;  1J7R A;  2JU0 A;  2KI6 C;  1JF0 A;  1CM1 A;  1KQM C;  1MXE A;  4PE4 A;  2JTZ A;  1SCM C;  2FJU B;  2BKI B;  2EGD A;  2D8N A;  2SCP A;  1S1E A;  1IRJ A;  2LCP A;  1UUR A;  2PAS A;  4HRE E;  2JT3 A;  2LVK A;  2O5G A;  2K8M B;  4YRU A;  5HKZ A;  1K95 A;  2KBI A;  2WCF A;  3SG5 A;  3D10 A;  3EVV A;  1H4B A;  2M7N A;  1SNL A;  4PE1 A;  3QRX A;  1PVB A;  2O60 A;  2BEC A;  1B8R A;  1QLS A;  3BYA A;  1J55 A;  3JVT B;  1JFK A;  1QVI Y;  3TDI A;  4CFR A;  3TDZ A;  3TS5 C;  1CDM A;  2M49 B;  2LUC A;  2Y5I A;  4DIR A;  1J7O A;  3CR5 X;  1SL8 A;  2KYC A;  2BE6 A;  4N5X A;  1QJT A;  1TTX A;  1AK8 A;  1TNX A;  2TN4 A;  2CT9 A;  1JC2 A;  2MRD A;  2OPO A;  1MWN A;  2K7C A;  4MN0 A;  1LXF C;  1GJY A;  2JZI A;  4PDZ A;  5HYD A;  4C0J A;  4BY4 A;  2G9B A;  3SG7 A;  2NCP A;  1Y1A A;  1K2H A;  1F8H A;  1ZAC A;  2NLN A;  2KNE A;  5ER5 A;  1CFC A;  1G33 A;  1FW4 A;  1H8B A;  2JXC A;  2L50 A;  4ETO A;  1CLL A;  1OZO A;  4YGE B;  5KTY A;  2MA2 A;  1TNQ A;  5J3X A;  2KI4 B;  4MBE A;  2PMY A;  1K9K A;  5I2Q A;  1QTX A;  4PHK A;  1E8A A;  1MR8 A;  3OX5 A;  2JC2 A;  4FTG A;  4NQG A;  4XYN A;  5HLO A;  1PSB A;  2F2O A;  2JTT A;  2LLT A;  4OVN F;  2CCM A;  1Q80 A;  1U5I A;  5I8N A;  1KFU S;  1M45 A;  4YGC B;  3I5I B;  1CFF A;  1DVI A;  4A4B A;  1GGZ A;  3TUY B;  1S5G Y;  3TDU A;  1UHI A;  2KGR A;  2ZND A;  2F8P A;  1C07 A;  1BOD A;  1HQV A;  4GGN A;  5B8I B;  4PHJ A;  4Q04 A;  1M31 A;  4YI9 A;  5AER A;  1KQV A;  2F2P A;  4MZL A;  4GAO A;  3EKJ A;  5ER4 X;  1RTP 1;  1Y6W A;  1C7W A;  2KFF A;  2LMT A;  3AKB A;  4TNC A;  1F55 A;  1WRK A;  4OKH A;  3KO0 A;  4YBH B;  3IQO A;  3GOF A;  4AQI A;  1CMG A;  1QIV A;  1RFJ A;  1DJW A;  1MF8 B;  3IF7 A;  3PN7 C;  1J1E A;  4PHN A;  3TZ1 A;  2KAV A;  2LMU A;  1WDC C;  2LVJ A;  3PAL A;  1OOJ A;  4GUK A;  1QAS A;  2MLE C;  4YGD B;  1YUR A;  3GK2 A;  4XJK B;  3SG4 A;  3PLF B;  1NP8 A;  1SYM A;  2F3Z A;  2JOJ A;  3GK4 X;  1IQ3 A;  2MLF C;  2M97 A;  4GGF C;  2OS8 C;  2LV7 A;  2L5X B;  1GGW A;  1KWO B;  5I2O A;  1AUI B;  5CSN A;  1L2O C;  5DKN A;  2E6W A;  1N2D A;  1CDN A;  3GK1 A;  4MZJ A;  3D0Y B;  1NCY A;  2JUL A;  4ZCU A;  5HKY A;  3OB2 B;  1KFU L;  2KSP A;  1YRU B;  1EL4 A;  1NX3 A;  1BU3 A;  2M0R A;  3SIA A;  1QV0 A;  1AHR A;  2JXL A;  3SG3 A;  1B8C A;  3I5G B;  4JPZ B;  1CDL A;  1OQP A;  2F33 A;  2H61 A;  2KHN A;  2LLU A;  3NXA A;  4FQO A;  2WCE A;  1R6P A;  2SAS A;  1S3P A;  1BF5 A;  2BL0 C;  1OZS A;  3KPX A;  2HET A;  1LVC D;  3BXK A;  1S36 A;  1V1G A;  4PE7 A;  4PHM A;  1F70 A;  1KK8 B;  2KI6 D;  2KBM A;  2L4H A;  2ZNE A;  5KU1 A;  3DVJ A;  1AJ4 A;  2L4I A;  3EKH A;  2KAX A;  1KK7 Z;  1FPW A;  4GPL B;  4NDC A;  1LKJ A;  3OHM B;  4WQ2 A;  1QX5 B;  4JQ0 D;  1NSH A;  1UHK A;  2L0P A;  5CPV A;  1YTZ C;  1V1F A;  4NDB A;  1TRF A;  2OTG B;  5AAN A;  1TCF A;  4AQJ A;  5CSI A;  1A75 A;  3F45 A;  1BOC A;  1XFZ O;  4GGF A;  1KSM A;  4M2P A;  3AAK A;  1B7T Y;  1NIW A;  3O6B A;  2LUX A;  2NCO A;  1K9P A;  4QJ4 B;  1PUL A;  1M63 B;  1B9A A;  1UP5 A;  1N0Y A;  1DT7 B;  1IGV A;  2LAN A;  1DGV A;  2GGM A;  2L2E A;  4C0L A;  1MHO A;  2OS8 B;  3EVR A;  4MRX A;  2H2K A;  1HT9 A;  2KOT A;  3NSK A;  2GGZ A;  4YI8 A;  1XFW O;  1BR1 B;  2FCE A;  1XK4 A;  3C1V A;  2COL B;  4M2O A;  3VRR A;  5CSF A;  1UHJ A;  1PK0 D;  2WND A;  4P2Y B;  1KSO A;  1MUX A;  1XFU O;  4MSP A;  1DMO A;  1PAL A;  2EHB A;  3ZWH A;  2QAC A;  3DVM A;  3DD4 A;  2M3W A;  1UHN A;  2BCX A;  1DJZ A;  1SK6 D;  1AP4 A;  4ORC B;  3I5F C;  3FWB A;  2I18 A;  1JF2 A;  2PRU A;  1M39 A;  5TNC A;  2HQ8 A;  1SY9 A;  3BUW B;  1OMD A;  4D1E A;  2LHI A;  1TCO B;  1NPQ A;  4I5J A;  3VRQ A;  5KSZ A;  5DKR A;  3SG2 A;  5JJG A;  4E68 A;  1KQM B;  1TIZ A;  1UWO A;  1JWD A;  1SCM B;  1CLM A;  1IJ5 A;  4OR9 B;  1B47 A;  1SR6 C;  5PAL A;  1W7I B;  3PFV A;  1JFJ A;  1CFP A;  2PVB A;  2H61 C;  1YUS A;  2FCD A; 
#chains in the Genus database with same CATH topology
 3H4S E;  2KQY A;  1DGU A;  2GTE A;  1DQE A;  2KFH A;  2K7B A;  1IQ5 A;  2ZKM X;  1PSR A;  2JT0 A;  1U5I B;  3N7H A;  2JT8 A;  4HRG A;  1M46 A;  2K0J A;  1QVI Z;  1T14 A;  2JNX A;  3EVU A;  3RZS A;  3S0A A;  1A03 A;  1OOH A;  2A4J A;  1DF0 A;  2KGB C;  2Y1N A;  4INX A;  5D7F A;  1RRO A;  3TS5 B;  1D1O A;  2HQW A;  3EK4 A;  3KHE A;  1LA3 A;  1EG3 A;  1FBV A;  2HF5 A;  3NSI A;  1SCV A;  1C7V A;  2JQ6 A;  2F3Y A;  2K7O A;  4WQ3 A;  4ORA B;  1YUU A;  2ZN8 A;  1S6J A;  3VRO A;  4P5O E;  2BBM A;  3S0F A;  2MAZ A;  3E3R A;  1IJ6 A;  1YX8 A;  1CTR A;  1EXR A;  1IG5 A;  2ZRT A;  1NUB A;  2WCJ A;  3IQQ A;  4ZCV A;  3BOW A;  4XJK A;  3FWC A;  3BUN B;  3NSO A;  1DJY A;  1QX7 A;  1J7P A;  2HPS A;  2M1U A;  2BE4 A;  3MSE B;  2CXJ A;  1JBA A;  1X02 A;  1EH2 A;  1YRT B;  4I5N B;  1S6I A;  1QIW A;  2FJY A;  1K8U A;  3RM1 A;  5G08 A;  1XK4 C;  5AEQ A;  1NYA A;  1Y0V H;  1TWO A;  4KYN A;  5FI2 A;  1WLM A;  3D75 A;  2ZRS A;  2KQ6 A;  1YVH A;  1CB1 A;  3JVT C;  3UO9 A;  1S5G Z;  1ZUZ A;  3DVK A;  2WC8 A;  3CR4 X;  1QWV A;  3KEV A;  3EK7 A;  1SRA A;  2MJW B;  3CWG A;  3SS4 A;  1CMF A;  2MBX A;  1K90 D;  1BLQ A;  3K21 A;  3WXA A;  3A4U B;  4C0K A;  1WLZ A;  2Q4U A;  1IKU A;  1F54 A;  1C3Y A;  4JWQ A;  2BNX A;  1UHH A;  1K93 D;  4OCI A;  1YX7 A;  3CAB A;  3HCM A;  5K89 A;  4GNK B;  3HX4 A;  4HSZ A;  3EK8 A;  4WRI A;  1JUO A;  5IBW A;  1OMV A;  3JTD C;  4I5K A;  2M7L A;  1CKK A;  3V2L A;  1YUT A;  2E30 A;  3PSR A;  3DF0 B;  2LP3 A;  3B6X A;  1QS7 A;  4DCK A;  3PN7 B;  4I5L B;  2EC6 C;  2LP2 A;  2NXQ A;  4PE0 A;  1Y1X A;  4PAL A;  1WDC B;  1ZFS A;  2AUC A;  2KAY A;  4F0Z B;  1B4C A;  1CLB A;  1SL7 A;  1S6C A;  3CR2 A;  2JRF A;  2QPT A;  1BMO A;  1ALV A;  2WOS A;  1MQ1 A;  3R1V A;  4MLW A;  1XFR A;  1OMR A;  1DJX A;  3M0W A;  2WCH A;  3I5I C;  1L2O B;  1EJ3 A;  4CLN A;  3CZ1 A;  1NWD A;  1TNW A;  2L2C A;  1SPY A;  2L5Y A;  5JOL A;  1NX2 A;  3TUY C;  2VRG A;  2G2B A;  4ICB A;  3FS7 A;  1J7Q A;  1SMG A;  3O78 A;  2ISD A;  3BFA A;  1BG1 A;  1RJV A;  2CTN A;  1W7J B;  1P28 A;  1QAT A;  1PVA A;  2BL0 B;  3BUO B;  4YGA A;  1AJ5 A;  3OP0 A;  3SIB A;  1REC A;  1TNP A;  2Y4Q A;  1FI6 A;  3AKA A;  3NGV A;  3LCP C;  3RLZ A;  4OV2 A;  4M2Q A;  1OE9 B;  2KDH A;  2BCA A;  1GQM A;  1S26 D;  1IWQ A;  2BAP A;  1XFX O;  1SW8 A;  3OX6 A;  5HLV A;  3SG6 A;  1L7Z A;  2ZN9 A;  3BQ3 A;  5HKW A;  3KF9 A;  1TN4 A;  1J1D A;  2KLD A;  3CGA A;  3LL8 B;  2LMV A;  2WC5 A;  1NCX A;  5D69 A;  3CLN A;  1CNP A;  1WRL A;  1ZMZ A;  1XYD A;  2IS9 A;  2MHH A;  1KWO C;  2CBL A;  5CSJ A;  1TOP A;  3DVE A;  1XO5 A;  1ZOT B;  1B7T Z;  4NDD A;  4AOM A;  5BPJ A;  3JTD B;  2GV5 A;  4GBA A;  1BR4 B;  2R2I A;  1TUZ A;  3OB1 B;  3BUM B;  2WCB A;  2EC6 B;  1NCZ A;  2BKH B;  2JNF A;  2K61 A;  2WOR A;  4OZD A;  1AVS A;  2JPO A;  1K94 A;  1SKT A;  1BJF A;  1NX1 A;  1Y1U A;  1YR5 A;  1YVL A;  4JKT A;  2RGI A;  1F71 A;  3FE8 A;  3I5G C;  3PM8 A;  4HRH A;  3AAJ A;  3WNX B;  2AMI A;  3CYZ A;  5FI7 A;  1F4Q A;  2LE9 B;  3I5H C;  1IH0 A;  2K7D A;  2CNP A;  2ZFD A;  3WHT B;  1K96 A;  3PAT A;  1FI5 A;  4QJ3 B;  5F6T A;  4DUQ A;  1KK8 C;  1CFD A;  2LLS A;  4MEW A;  1ALW A;  1R2U A;  1A4P A;  1DJH A;  3SS5 A;  1G8I A;  1K9U A;  1DF0 B;  1KFX S;  2LM5 A;  1N65 A;  4GFT A;  1UUS A;  2BCB A;  2DOQ A;  4N1G A;  3A8R A;  4A4C A;  3FIA A;  1KK7 Y;  2BBN A;  2Q91 A;  1ORG A;  2PAL A;  4CID A;  2M8U A;  1OSA A;  3L47 A;  2NZ0 A;  3NSL A;  1RK9 A;  3BUX B;  2OTG C;  2B1U A;  2M9G A;  2JWW A;  3CTN A;  4CFQ A;  3VGO A;  1CM4 A;  1G4Y R;  2KYF A;  2PSR A;  2P6B B;  3I5F B;  1JSA A;  2LHL A;  4MVF A;  4IL1 A;  2P71 A;  4DRW A;  4DS7 A;  1OW4 A;  1A29 A;  2LVI A;  1RWY A;  3EG5 B;  2I2R E;  5EL2 A;  5FYX A;  2K2A A;  3BOW B;  4BY5 A;  1B1G A;  1XFV O;  3LK0 A;  2LC5 A;  3D0Y A;  3ZNI A;  1QV1 A;  1A2X A;  3D77 A;  1QLK A;  1MXL C;  3B87 A;  4CPV A;  2K2F A;  1NX0 A;  1DJG A;  2JPT A;  1SBJ A;  2I7A A;  3WHU B;  1SR6 B;  3ICB A;  2L51 A;  4L9M A;  1XFY O;  3DZT A;  3CZT X;  3LLE A;  1QXP A;  5AFP A;  1KCY A;  4R1E A;  5AXI A;  1ODB A;  3VRP A;  3CS1 A;  1CDP A;  2QEV A;  2FOT A;  3O4Y A;  4UPG A;  1DTL A;  1WRZ A;  2LVV A;  3SJS A;  5GQQ C;  4PCW A;  3K1E A;  4MZK A;  1KFX L;  5DKQ A;  3VRN A;  3I5H B;  1DJI A;  1QX2 A;  1EG4 A;  3LK1 A;  1B8L A;  4QJ5 B;  1VRK A;  1SL9 A;  2LAP A;  3O2P A;  2I94 A;  1LA0 A;  2L98 A;  2KFG A;  4N1F A;  1XA5 A;  2V53 A;  1F4O A;  3O4X A;  4USL A;  2KI4 C;  5I2L A;  4ORB B;  2M1K B;  1LIN A;  1XVJ A;  2Y1M A;  1BT6 A;  3VB1 A;  1A75 B;  1FF1 A;  4MRY A;  1WY9 A;  2M29 A;  1PRW A;  2AAO A;  4U8D A;  2LNK A;  4YGB B;  3DF0 A;  3S0G A;  3BFH A;  1J7R A;  2JU0 A;  2KI6 C;  1JF0 A;  1CM1 A;  1KQM C;  5DIC A;  1MXE A;  4PE4 A;  4PT1 A;  2JTZ A;  2H8V A;  1SCM C;  3Q8I A;  2FJU B;  2BKI B;  2EGD A;  3S0D A;  2D8N A;  2SCP A;  1S1E A;  1IRJ A;  2LCP A;  1UUR A;  2QEH A;  2PAS A;  4HRE E;  2KPH A;  2JT3 A;  2LVK A;  2O5G A;  2K8M B;  4YRU A;  5HKZ A;  1K95 A;  2KBI A;  2WCF A;  3FE9 A;  3SG5 A;  3D10 A;  3EVV A;  1SSE B;  1H4B A;  2M7N A;  1SNL A;  4PE1 A;  1DC1 A;  1OOI X;  1Z2C B;  3QRX A;  1PVB A;  2O60 A;  2BEC A;  1B8R A;  1QLS A;  3BYA A;  1J55 A;  3JVT B;  1JFK A;  1QVI Y;  3TDI A;  4CFR A;  3TDZ A;  3TS5 C;  1CDM A;  2M49 B;  2LUC A;  2Y5I A;  5FI6 A;  4DIR A;  2QDI A;  3CR5 X;  1J7O A;  1SL8 A;  2KYC A;  2BE6 A;  4N5X A;  1QJT A;  1TTX A;  1AK8 A;  1TNX A;  2TN4 A;  3DYE A;  2CT9 A;  1JC2 A;  2MRD A;  3IVT A;  2OPO A;  1DEL A;  1MWN A;  2K7C A;  4MN0 A;  5I94 A;  2WCM A;  1LXF C;  1GJY A;  1LS8 A;  2JZI A;  2YGU A;  3R1O A;  4PDZ A;  4C0J A;  5HYD A;  4BY4 A;  2G9B A;  3SG7 A;  3FE6 A;  2NCP A;  1Y1A A;  1K2H A;  1F8H A;  1ZAC A;  2NLN A;  3B7A A;  3D73 A;  2KNE A;  5ER5 A;  1CFC A;  1G33 A;  1FW4 A;  1H8B A;  2JXC A;  2L50 A;  4ETO A;  1CLL A;  1OZO A;  4YGE B;  5KTY A;  2MA2 A;  1TNQ A;  5J3X A;  2KI4 B;  4MBE A;  2PMY A;  1K9K A;  5I2Q A;  1QTX A;  3L4L A;  1E8A A;  4PHK A;  1MR8 A;  3OX5 A;  2JC2 A;  4FTG A;  4NQG A;  4XYN A;  5HLO A;  1IIO A;  1PSB A;  2F2O A;  2JTT A;  2LLT A;  3BFB A;  4OVN F;  2CCM A;  2QEB A;  1Q80 A;  1U5I A;  3CZ2 A;  5I8N A;  1KFU S;  1M45 A;  4YGC B;  3I5I B;  1CFF A;  4FQT A;  1DVI A;  4A4B A;  3NHT A;  1GGZ A;  3TUY B;  1S5G Y;  3TDU A;  1UHI A;  2KGR A;  2ZND A;  2F8P A;  1C07 A;  1BOD A;  1HQV A;  4GGN A;  3UNW A;  3DY9 A;  3OBV A;  4PHJ A;  5B8I B;  4Q04 A;  1M31 A;  4YI9 A;  5AER A;  1KQV A;  2F2P A;  3PM2 A;  4JD9 A;  4MZL A;  2ERB A;  4GAO A;  3EKJ A;  5ER4 X;  1RTP 1;  1Y6W A;  1C7W A;  2KFF A;  2LMT A;  3AKB A;  4TNC A;  1F55 A;  1WRK A;  4OKH A;  3KO0 A;  4YBH B;  3IQO A;  3GOF A;  4AQI A;  1CMG A;  1QIV A;  1RFJ A;  1DJW A;  1MF8 B;  3IF7 A;  3PN7 C;  1J1E A;  4PHN A;  3TZ1 A;  2KAV A;  2LMU A;  4F7F A;  1WDC C;  2LVJ A;  2QEO A;  1OOJ A;  2WC6 A;  3PAL A;  4GUK A;  1QAS A;  2MLE C;  4YGD B;  1YUR A;  3GK2 A;  4XJK B;  3SG4 A;  3CDN A;  1NP8 A;  3B86 A;  1SYM A;  2F3Z A;  2JOJ A;  3PLF B;  3GK4 X;  1IQ3 A;  2MLF C;  2M97 A;  4GGF C;  2OS8 C;  2LV7 A;  2L5X B;  1GGW A;  1KWO B;  5I2O A;  1AUI B;  5CSN A;  1L2O C;  5DKN A;  2E6W A;  1N2D A;  3S0B A;  3GK1 A;  1CDN A;  4MZJ A;  3D0Y B;  1NCY A;  2JUL A;  4ZCU A;  5HKY A;  3OB2 B;  1KFU L;  2KSP A;  1YRU B;  1EL4 A;  1NX3 A;  1BU3 A;  2M0R A;  3SIA A;  1QV0 A;  1AHR A;  2JXL A;  3SG3 A;  1B8C A;  3I5G B;  1Z4H A;  4JPZ B;  1CDL A;  1OQP A;  2F33 A;  2H61 A;  2KHN A;  1OOF A;  2LLU A;  3NXA A;  4FQO A;  2WCE A;  1R6P A;  2SAS A;  1S3P A;  3S0E A;  1BF5 A;  2BL0 C;  1OZS A;  3QME A;  3KPX A;  2HET A;  1LVC D;  3BXK A;  1S36 A;  1V1G A;  4PE7 A;  4PHM A;  1F70 A;  1KK8 B;  2KI6 D;  2KBM A;  2L4H A;  2ZNE A;  5KU1 A;  3DVJ A;  4INW A;  1AJ4 A;  2L4I A;  3EKH A;  2KAX A;  3CZ0 A;  1KK7 Z;  3L4A A;  1FPW A;  4GPL B;  4NDC A;  1LKJ A;  3OHM B;  4WQ2 A;  1QX5 B;  4JQ0 D;  1DEK A;  1NSH A;  1UHK A;  5D3O A;  1TUJ A;  2L0P A;  5CPV A;  1YTZ C;  1V1F A;  1C3Z A;  4NDB A;  1TRF A;  2OTG B;  5AAN A;  1TCF A;  4AQJ A;  5CSI A;  1A75 A;  2K60 A;  3F45 A;  1BOC A;  1XFZ O;  4GGF A;  1KSM A;  2KLE A;  4M2P A;  3AAK A;  3D74 A;  1B7T Y;  1NIW A;  2PYQ A;  2LUX A;  3O6B A;  2NCO A;  1K9P A;  4QJ4 B;  1PUL A;  3BJH A;  1M63 B;  1B9A A;  1UP5 A;  2PQL A;  1N0Y A;  1DT7 B;  1IGV A;  2LAN A;  1DGV A;  2GGM A;  4IJ7 A;  2L2E A;  4C0L A;  1MHO A;  2OS8 B;  3EVR A;  4MRX A;  2H2K A;  1HT9 A;  2KOT A;  3NSK A;  2GGZ A;  4YI8 A;  1XFW O;  3B88 A;  1BR1 B;  2FCE A;  1XK4 A;  3OGN A;  3C1V A;  2COL B;  3D78 A;  4M2O A;  5CSF A;  3VRR A;  1UHJ A;  1PK0 D;  2WND A;  4P2Y B;  1KSO A;  1MUX A;  1XFU O;  3D76 A;  4MSP A;  1DMO A;  1PAL A;  2EHB A;  3ZWH A;  2QAC A;  3DVM A;  3DD4 A;  2M3W A;  3R72 A;  1UHN A;  2BCX A;  3SS3 A;  1DJZ A;  3DXL A;  5HL1 A;  2WCL A;  3NHI A;  1SK6 D;  1AP4 A;  4ORC B;  3I5F C;  3FWB A;  2I18 A;  1JF2 A;  2PRU A;  1M39 A;  2WCK A;  5TNC A;  2HQ8 A;  3PJI A;  1SY9 A;  1W9Z A;  3BUW B;  1OMD A;  4D1E A;  2LHI A;  1GM0 A;  1TCO B;  1OOG A;  1NPQ A;  4I5J A;  3VRQ A;  5KSZ A;  5DKR A;  3SG2 A;  5JJG A;  4E68 A;  1KQM B;  1TIZ A;  1UWO A;  1JWD A;  3R1P A;  2P70 A;  1SCM B;  1CLM A;  1IJ5 A;  4OR9 B;  1B47 A;  1SR6 C;  5PAL A;  1W7I B;  3PFV A;  1JFJ A;  1CFP A;  2PVB A;  2H61 C;  1YUS A;  2FCD A; 
#chains in the Genus database with same CATH homology
 3H4S E;  2KQY A;  1DGU A;  2KFH A;  2K7B A;  1IQ5 A;  2ZKM X;  1PSR A;  2JT0 A;  1U5I B;  2JT8 A;  4HRG A;  1M46 A;  2K0J A;  1QVI Z;  2JNX A;  3EVU A;  1A03 A;  2A4J A;  1DF0 A;  2KGB C;  2Y1N A;  5D7F A;  1RRO A;  3TS5 B;  1D1O A;  2HQW A;  3EK4 A;  3KHE A;  1LA3 A;  1EG3 A;  1FBV A;  2HF5 A;  3NSI A;  1SCV A;  1C7V A;  2JQ6 A;  2F3Y A;  2K7O A;  4WQ3 A;  4ORA B;  1YUU A;  2ZN8 A;  1S6J A;  3VRO A;  4P5O E;  2BBM A;  2MAZ A;  3E3R A;  1IJ6 A;  1YX8 A;  1CTR A;  1EXR A;  1IG5 A;  2ZRT A;  1NUB A;  3IQQ A;  4ZCV A;  3BOW A;  4XJK A;  3FWC A;  3BUN B;  3NSO A;  1DJY A;  1QX7 A;  1J7P A;  2HPS A;  2M1U A;  2BE4 A;  3MSE B;  2CXJ A;  1JBA A;  1X02 A;  1EH2 A;  1YRT B;  4I5N B;  1S6I A;  1QIW A;  3RM1 A;  1K8U A;  5G08 A;  1XK4 C;  5AEQ A;  1NYA A;  1Y0V H;  1WLM A;  2ZRS A;  2KQ6 A;  1YVH A;  1CB1 A;  3JVT C;  1S5G Z;  1ZUZ A;  3DVK A;  2WC8 A;  3CR4 X;  3KEV A;  3EK7 A;  1SRA A;  2MJW B;  3CWG A;  1CMF A;  2MBX A;  1K90 D;  1BLQ A;  3K21 A;  3WXA A;  3A4U B;  4C0K A;  1WLZ A;  2Q4U A;  1IKU A;  1F54 A;  4JWQ A;  1UHH A;  1K93 D;  4OCI A;  1YX7 A;  3HCM A;  5K89 A;  4GNK B;  3HX4 A;  4HSZ A;  3EK8 A;  4WRI A;  1JUO A;  5IBW A;  1OMV A;  3JTD C;  4I5K A;  2M7L A;  1CKK A;  4DCK A;  1YUT A;  2E30 A;  3PSR A;  3DF0 B;  2LP3 A;  1QS7 A;  3PN7 B;  4I5L B;  2EC6 C;  2LP2 A;  2NXQ A;  4PE0 A;  1Y1X A;  4PAL A;  1WDC B;  1ZFS A;  2AUC A;  2KAY A;  4F0Z B;  1B4C A;  1CLB A;  1SL7 A;  1S6C A;  3CR2 A;  2JRF A;  2QPT A;  1BMO A;  1ALV A;  2WOS A;  1MQ1 A;  4MLW A;  1OMR A;  1DJX A;  3M0W A;  3I5I C;  1L2O B;  1EJ3 A;  4CLN A;  1NWD A;  1TNW A;  1SPY A;  5JOL A;  1NX2 A;  3TUY C;  2VRG A;  2G2B A;  4ICB A;  3FS7 A;  1J7Q A;  1SMG A;  3O78 A;  2ISD A;  1BG1 A;  1RJV A;  2CTN A;  1W7J B;  1QAT A;  1PVA A;  2BL0 B;  3BUO B;  4YGA A;  1AJ5 A;  3OP0 A;  3SIB A;  1REC A;  1TNP A;  2Y4Q A;  1FI6 A;  3AKA A;  3LCP C;  3RLZ A;  4OV2 A;  4M2Q A;  1OE9 B;  2KDH A;  2BCA A;  1GQM A;  1S26 D;  1IWQ A;  1XFX O;  1SW8 A;  3OX6 A;  5HLV A;  3SG6 A;  1L7Z A;  2ZN9 A;  3BQ3 A;  5HKW A;  3KF9 A;  1TN4 A;  1J1D A;  3CGA A;  3LL8 B;  2LMV A;  1NCX A;  5D69 A;  3CLN A;  1CNP A;  1WRL A;  1ZMZ A;  1XYD A;  2IS9 A;  2MHH A;  1KWO C;  2CBL A;  5CSJ A;  1TOP A;  3DVE A;  1XO5 A;  1ZOT B;  1B7T Z;  4NDD A;  4AOM A;  5BPJ A;  3JTD B;  2GV5 A;  4GBA A;  1BR4 B;  2R2I A;  3OB1 B;  3BUM B;  2WCB A;  2EC6 B;  1NCZ A;  2BKH B;  2JNF A;  2K61 A;  2WOR A;  1AVS A;  1K94 A;  1SKT A;  1BJF A;  1NX1 A;  1Y1U A;  1YR5 A;  1YVL A;  2RGI A;  1F71 A;  3I5G C;  3PM8 A;  4HRH A;  3AAJ A;  3WNX B;  2AMI A;  1F4Q A;  2LE9 B;  3I5H C;  1IH0 A;  2K7D A;  2CNP A;  2ZFD A;  3WHT B;  1K96 A;  3PAT A;  1FI5 A;  4QJ3 B;  5F6T A;  4DUQ A;  1KK8 C;  1CFD A;  2LLS A;  4MEW A;  1ALW A;  1R2U A;  1A4P A;  1DJH A;  1G8I A;  1K9U A;  1DF0 B;  1KFX S;  2LM5 A;  1N65 A;  4GFT A;  1UUS A;  2BCB A;  2DOQ A;  4N1G A;  3A8R A;  4A4C A;  3FIA A;  1KK7 Y;  2BBN A;  2Q91 A;  4CID A;  2PAL A;  2M8U A;  1OSA A;  2NZ0 A;  3NSL A;  1RK9 A;  3BUX B;  2OTG C;  2B1U A;  2M9G A;  2JWW A;  3CTN A;  4CFQ A;  3VGO A;  1CM4 A;  1G4Y R;  2KYF A;  2PSR A;  2P6B B;  3I5F B;  1JSA A;  2LHL A;  4MVF A;  4IL1 A;  4DRW A;  4DS7 A;  1A29 A;  2LVI A;  1RWY A;  2I2R E;  5FYX A;  2K2A A;  3BOW B;  4BY5 A;  1B1G A;  1XFV O;  3LK0 A;  2LC5 A;  3D0Y A;  3ZNI A;  1QV1 A;  1A2X A;  1QLK A;  1MXL C;  4CPV A;  2K2F A;  1NX0 A;  1DJG A;  2JPT A;  1SBJ A;  2I7A A;  3WHU B;  1SR6 B;  3ICB A;  2L51 A;  4L9M A;  1XFY O;  3CZT X;  3LLE A;  1QXP A;  5AFP A;  1KCY A;  4R1E A;  5AXI A;  1ODB A;  3VRP A;  3CS1 A;  1CDP A;  2FOT A;  3O4Y A;  4UPG A;  1DTL A;  1WRZ A;  2LVV A;  3SJS A;  5GQQ C;  4PCW A;  4MZK A;  1KFX L;  5DKQ A;  3VRN A;  3I5H B;  1DJI A;  1QX2 A;  1EG4 A;  3LK1 A;  1B8L A;  4QJ5 B;  1VRK A;  1SL9 A;  2LAP A;  3O2P A;  2I94 A;  1LA0 A;  2L98 A;  2KFG A;  4N1F A;  1XA5 A;  2V53 A;  1F4O A;  4USL A;  5I2L A;  2KI4 C;  4ORB B;  2M1K B;  1LIN A;  1XVJ A;  2Y1M A;  1BT6 A;  1FF1 A;  1A75 B;  4MRY A;  1WY9 A;  2M29 A;  1PRW A;  2AAO A;  4U8D A;  2LNK A;  4YGB B;  3DF0 A;  1J7R A;  2JU0 A;  2KI6 C;  1JF0 A;  1CM1 A;  1KQM C;  1MXE A;  4PE4 A;  2JTZ A;  1SCM C;  2FJU B;  2BKI B;  2EGD A;  2D8N A;  2SCP A;  1S1E A;  1IRJ A;  2LCP A;  1UUR A;  2PAS A;  4HRE E;  2JT3 A;  2LVK A;  2O5G A;  2K8M B;  4YRU A;  5HKZ A;  1K95 A;  2KBI A;  2WCF A;  3SG5 A;  3D10 A;  3EVV A;  1H4B A;  2M7N A;  1SNL A;  4PE1 A;  3QRX A;  1PVB A;  2O60 A;  2BEC A;  1B8R A;  1QLS A;  3BYA A;  1J55 A;  3JVT B;  1JFK A;  1QVI Y;  3TDI A;  4CFR A;  3TDZ A;  3TS5 C;  1CDM A;  2M49 B;  2LUC A;  2Y5I A;  4DIR A;  1J7O A;  3CR5 X;  1SL8 A;  2KYC A;  2BE6 A;  4N5X A;  1QJT A;  1TTX A;  1AK8 A;  1TNX A;  2TN4 A;  2CT9 A;  1JC2 A;  2MRD A;  2OPO A;  1MWN A;  2K7C A;  4MN0 A;  1LXF C;  1GJY A;  2JZI A;  4PDZ A;  5HYD A;  4C0J A;  4BY4 A;  2G9B A;  3SG7 A;  2NCP A;  1Y1A A;  1K2H A;  1F8H A;  1ZAC A;  2NLN A;  2KNE A;  5ER5 A;  1CFC A;  1G33 A;  1FW4 A;  1H8B A;  2JXC A;  2L50 A;  4ETO A;  1CLL A;  1OZO A;  4YGE B;  5KTY A;  2MA2 A;  1TNQ A;  5J3X A;  2KI4 B;  4MBE A;  2PMY A;  1K9K A;  5I2Q A;  1QTX A;  4PHK A;  1E8A A;  1MR8 A;  3OX5 A;  2JC2 A;  4FTG A;  4NQG A;  4XYN A;  5HLO A;  1PSB A;  2F2O A;  2JTT A;  2LLT A;  4OVN F;  2CCM A;  1Q80 A;  1U5I A;  5I8N A;  1KFU S;  1M45 A;  4YGC B;  3I5I B;  1CFF A;  1DVI A;  4A4B A;  1GGZ A;  3TUY B;  1S5G Y;  3TDU A;  1UHI A;  2KGR A;  2ZND A;  2F8P A;  1C07 A;  1BOD A;  1HQV A;  4GGN A;  5B8I B;  4PHJ A;  4Q04 A;  1M31 A;  4YI9 A;  5AER A;  1KQV A;  2F2P A;  4MZL A;  4GAO A;  3EKJ A;  5ER4 X;  1RTP 1;  1Y6W A;  1C7W A;  2KFF A;  2LMT A;  3AKB A;  4TNC A;  1F55 A;  1WRK A;  4OKH A;  3KO0 A;  4YBH B;  3IQO A;  3GOF A;  4AQI A;  1CMG A;  1QIV A;  1RFJ A;  1DJW A;  1MF8 B;  3IF7 A;  3PN7 C;  1J1E A;  4PHN A;  3TZ1 A;  2KAV A;  2LMU A;  1WDC C;  2LVJ A;  3PAL A;  1OOJ A;  4GUK A;  1QAS A;  2MLE C;  4YGD B;  1YUR A;  3GK2 A;  4XJK B;  3SG4 A;  3PLF B;  1NP8 A;  1SYM A;  2F3Z A;  2JOJ A;  3GK4 X;  1IQ3 A;  2MLF C;  2M97 A;  4GGF C;  2OS8 C;  2LV7 A;  2L5X B;  1GGW A;  1KWO B;  5I2O A;  1AUI B;  5CSN A;  1L2O C;  5DKN A;  2E6W A;  1N2D A;  1CDN A;  3GK1 A;  4MZJ A;  3D0Y B;  1NCY A;  2JUL A;  4ZCU A;  5HKY A;  3OB2 B;  1KFU L;  2KSP A;  1YRU B;  1EL4 A;  1NX3 A;  1BU3 A;  2M0R A;  3SIA A;  1QV0 A;  1AHR A;  2JXL A;  3SG3 A;  1B8C A;  3I5G B;  4JPZ B;  1CDL A;  1OQP A;  2F33 A;  2H61 A;  2KHN A;  2LLU A;  3NXA A;  4FQO A;  2WCE A;  1R6P A;  2SAS A;  1S3P A;  1BF5 A;  2BL0 C;  1OZS A;  3KPX A;  2HET A;  1LVC D;  3BXK A;  1S36 A;  1V1G A;  4PE7 A;  4PHM A;  1F70 A;  1KK8 B;  2KI6 D;  2KBM A;  2L4H A;  2ZNE A;  5KU1 A;  3DVJ A;  1AJ4 A;  2L4I A;  3EKH A;  2KAX A;  1KK7 Z;  1FPW A;  4GPL B;  4NDC A;  1LKJ A;  3OHM B;  4WQ2 A;  1QX5 B;  4JQ0 D;  1NSH A;  1UHK A;  2L0P A;  5CPV A;  1YTZ C;  1V1F A;  4NDB A;  1TRF A;  2OTG B;  5AAN A;  1TCF A;  4AQJ A;  5CSI A;  1A75 A;  3F45 A;  1BOC A;  1XFZ O;  4GGF A;  1KSM A;  4M2P A;  3AAK A;  1B7T Y;  1NIW A;  3O6B A;  2LUX A;  2NCO A;  1K9P A;  4QJ4 B;  1PUL A;  1M63 B;  1B9A A;  1UP5 A;  1N0Y A;  1DT7 B;  1IGV A;  2LAN A;  1DGV A;  2GGM A;  2L2E A;  4C0L A;  1MHO A;  2OS8 B;  3EVR A;  4MRX A;  2H2K A;  1HT9 A;  2KOT A;  3NSK A;  2GGZ A;  4YI8 A;  1XFW O;  1BR1 B;  2FCE A;  1XK4 A;  3C1V A;  2COL B;  4M2O A;  3VRR A;  5CSF A;  1UHJ A;  1PK0 D;  2WND A;  4P2Y B;  1KSO A;  1MUX A;  1XFU O;  4MSP A;  1DMO A;  1PAL A;  2EHB A;  3ZWH A;  2QAC A;  3DVM A;  3DD4 A;  2M3W A;  1UHN A;  2BCX A;  1DJZ A;  1SK6 D;  1AP4 A;  4ORC B;  3I5F C;  3FWB A;  2I18 A;  1JF2 A;  2PRU A;  1M39 A;  5TNC A;  2HQ8 A;  1SY9 A;  3BUW B;  1OMD A;  4D1E A;  2LHI A;  1TCO B;  1NPQ A;  4I5J A;  3VRQ A;  5KSZ A;  5DKR A;  3SG2 A;  5JJG A;  4E68 A;  1KQM B;  1TIZ A;  1UWO A;  1JWD A;  1SCM B;  1CLM A;  1IJ5 A;  4OR9 B;  1B47 A;  1SR6 C;  5PAL A;  1W7I B;  3PFV A;  1JFJ A;  1CFP A;  2PVB A;  2H61 C;  1YUS A;  2FCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...