4NDDA

X-ray structure of a double mutant of calexcitin - a neuronal calcium-signalling protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARADLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
molecule tags Signaling protein
molecule keywords Calexcitin
total genus 72
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4nddA00
2EC6C 1V1GA 3AKBA 3OB1B 1CDPA 1SRAA 3IQOA 4QJ3B 2HQ8A 1UHNA 1NX0A 1QV1A 3OX5A 3TUYB 2L50A 2KFHA 2RGIA 2JT0A 4GNKB 1FW4A 1SYMA 2MAZA 4U8DA 2BBNA 1SBJA 2LV7A 3FWCA 1SCMC 4PDZA 2KAXA 5HYDA 4YI9A 1J7PA 2F2PA 2FJUB 3BQ3A 1K9UA 3DF0A 1DJHA 1IH0A 1OSAA 3PFVA 1YRTB 2NXQA 2KHNA 4N1GA 1QVIZ 5IBWA 1EL4A 1CKKA 3CZTX 4GGNA 2FCEA 1K93D 1WDCC 3O2PA 4M2OA 1IG5A 1R2UA 1ZUZA 2Y5IA 3GK2A 4YGCB 4YRUA 1GJYA 4MN0A 4N1FA 1AHRA 1BU3A 1IJ6A 2LCPA 2PRUA 2ZRTA 1DJYA 1JSAA 3OX6A 3LCPC 5F6TA 2JT8A 3M0WA 1XFZO 1QIVA 2PSRA 4DRWA 3LLEA 2Q91A 4M2QA 4PCWA 3TS5C 5KU1A 4NDCA 3RM1A 1G4YR 2KQ6A 1XO5A 2LMVA 1YUSA 5I2LA 1K2HA 1HT9A 1QXPA 2M29A 1U5IA 4ORAB 2OS8C 1LA0A 1NSHA 1OMRA 4PHNA 4CIDA 1Q80A 1SL9A 1OOJA 5AERA 2L0PA 1E8AA 3LK1A 5CSFA 4XYNA 1ZACA 3BUWB 3NSLA 1YVLA 1AP4A 1DGUA 1F8HA 1C07A 5DKRA 1A75A 1TCOB 1TOPA 2JNFA 3EKJA 5JOLA 1B4CA 4YGEB 1RWYA 4I5LB 2ZNDA 1TTXA 2O5GA 3NXAA 5KSZA 1CFPA 2L98A 3I5IC 4JQ0D 4CLNA 2GGZA 2BCXA 1V1FA 1J1DA 1F55A 2JT3A 1L2OB 1NX2A 4A4BA 3SIAA 5B8IB 3BYAA 1CLLA 1SR6B 1CFCA 2WNDA 1EJ3A 3A4UB 1MXLC 3NSKA 2KAVA 4AQJA 1SMGA 1QJTA 4MBEA 5J3XA 1ALWA 2L4IA 1KK8B 2FCDA 1CDMA 3AAKA 4WRIA 1UHKA 1CDNA 2M1KB 4OR9B 1F70A 2KI4C 1FI5A 3GOFA 1DF0A 3SG3A 3JVTC 1YR5A 4C0JA 1F4QA 1SL8A 4NQGA 2M0RA 1M63B 2PVBA 2WOSA 1YUUA 3SG6A 3DD4A 1Y6WA 2ZKMX 3FWBA 3D0YB 4GUKA 2WORA 3BUMB 4M2PA 1C7VA 4N5XA 4JWQA 2CTNA 5HLOA 3KHEA 1QLKA 1NCZA 2F33A 1MXEA 1NP8A 1DF0B 3BUOB 1BOCA 1JBAA 2F2OA 3LL8B 3DVEA 1UWOA 1BMOA 1KCYA 2L51A 2OTGB 3PLFB 1AK8A 1NCYA 5TNCA 3D0YA 4ETOA 4DUQA 1NYAA 4FQOA 2CNPA 2L2EA 2LVIA 5CPVA 2HPSA 2PALA 3DVMA 1DT7B 3CGAA 1XFYO 2NZ0A 5ER5A 1SK6D 1MWNA 3JTDB 2Y1NA 1OMDA 4CFRA 2LVVA 2WCFA 1L7ZA 2KBIA 5AEQA 1SCVA 1JFJA 1N2DA 5CSNA 1J7OA 1MF8B 2NCPA 3I5FB 4HRHA 3VRRA 1WRLA 2KAYA 2F3YA 2M8UA 4XJKB 4NDDA 1KWOB 2JWWA 2LVJA 4L9MA 4WQ3A 2KNEA 4MRYA 1LINA 2LAPA 4OV2A 1ODBA 1CM4A 1LVCD 3EK4A 1B8RA 2QPTA 5JJGA 1Y1XA 2Q4UA 1PK0D 2I2RE 2MLEC 1KWOC 2L5XB 3SG4A 5KTYA 2LLSA 1SL7A 1KK7Z 3TZ1A 2EHBA 3I5FC 3SG2A 1JF0A 1A29A 5D69A 3O78A 2LUXA 1UP5A 2TN4A 4HREE 4R1EA 5PALA 1K96A 4GPLB 2G9BA 2K61A 2P6BB 1GQMA 3TDUA 3JTDC 1KK7Y 3RLZA 3WNXB 1ZFSA 3TDIA 1UURA 4HRGA 3DVKA 1CFDA 1XYDA 1YRUB 2M97A 1J7QA 2NLNA 1CMFA 1BODA 1IRJA 3BXKA 1G33A 4XJKA 3F45A 1NCXA 2MLFC 1CTRA 2OTGC 1BLQA 1OZOA 2LM5A 4GGFC 2M1UA 1DGVA 2ZNEA 5D7FA 1IWQA 5DKQA 1KFUS 1TNQA 4DCKA 4PE7A 3BUNB 1S36A 2Y1MA 1PALA 2LUCA 3HX4A 2BE6A 4IL1A 1AVSA 1RROA 2LVKA 1KQVA 2I94A 4E68A 1W7JB 1S6JA 3O6BA 3H4SE 2BCAA 4Q04A 1JF2A 1B47A 1NIWA 2PMYA 2ISDA 3BUXB 4MRXA 4ICBA 3WHUB 1PVAA 3JVTB 2M3WA 4MZKA 1DTLA 5AANA 1DJZA 1R6PA 1QX5B 1M39A 2KI4B 2KI6C 5HKZA 3WHTB 1RECA 5K89A 1IQ5A 2K2FA 1CB1A 1KK8C 2FOTA 1K90D 2I7AA 1A03A 1N0YA 3GK4X 4ORCB 1WRZA 1QX2A 4MSPA 3AAJA 5HKWA 4OVNF 4PE0A 4QJ5B 1SR6C 4P5OE 2E6WA 4PE4A 1XFVO 2O60A 1KFXL 1AUIB 1L2OC 1RTP1 1YX8A 1OMVA 2GGMA 1XK4C 2KGBC 3CR2A 4YI8A 5G08A 1YX7A 2LNKA 3I5IB 4JPZB 2LMTA 1JFKA 2JNXA 3EK8A 2HF5A 2WCEA 5BPJA 1W7IB 2M49B 2F3ZA 1BR1B 1QTXA 1SKTA 1XFWO 1EG3A 2B1UA 1AJ4A 3D10A 2MBXA 1CLMA 1HQVA 2H61C 2JQ6A 3FIAA 3ZWHA 3CR4X 4QJ4B 1CFFA 4GBAA 1TNPA 4PHJA 1B7TY 2LC5A 1NWDA 3FS7A 4PE1A 1WRKA 2DOQA 2OS8B 2G2BA 1ALVA 1YURA 2M7LA 1QLSA 5AXIA 1F71A 5I8NA 3WXAA 1J7RA 1MUXA 1U5IB 1QATA 3DF0B 4YGDB 1LXFC 3TS5B 4FTGA 3VGOA 3VROA 2JXLA 1DVIA 1CM1A 2ZN9A 3EVVA 3PSRA 5I2OA 1D1OA 1A4PA 4ZCVA 4AOMA 4P2YB 1RK9A 2BCBA 3SIBA 1F54A 3CR5X 3CTNA 3IF7A 3K21A 3ICBA 1G8IA 3HCMA 1CDLA 1QX7A 1WDCB 1LA3A 2MHHA 2WCBA 2H2KA 1S3PA 4DS7A 2Y4QA 2ZRSA 2K2AA 1IKUA 5HLVA 1S1EA 2BKHB 1AJ5A 1K9KA 1S26D 2JPTA 2VRGA 4MVFA 1B1GA 1Y1AA 2CXJA 4MEWA 4YGBB 3CLNA 2MA2A 1Y0VH 3KF9A 4MLWA 2CBLA 3SG5A 3KPXA 1CMGA 4MZLA 1SCMB 2K0JA 1FBVA 4OKHA 3TUYC 2AAOA 5ER4X 3A8RA 1LKJA 1XFXO 1CLBA 2SASA 1A2XA 1M45A 2KBMA 5DKNA 2EC6B 1PRWA 1PULA 4CPVA 3NSOA 2BL0B 5AFPA 1S5GY 1KSMA 1IJ5A 1TCFA 2R2IA 2KSPA 1DJXA 4UPGA 1N65A 2BKIB 3NSIA 1WLMA 1OZSA 3CWGA 2KQYA 3CS1A 2JTZA 2JXCA 2KI6D 3SJSA 1XVJA 2LANA 2EGDA 5GQQC 1J1EA 1QV0A 3I5HB 1XFUO 1EG4A 4ORBB 4F0ZB 3PATA 1EH2A 2ZN8A 1C7WA 1B8CA 1UHHA 2SCPA 1BR4B 2JOJA 2BE4A 1MHOA 1UUSA 3EVUA 5CSJA 5HKYA 1WLZA 1KQMB 1NPQA 1K95A 2LMUA 3C1VA 2HETA 3PM8A 2K7CA 1SY9A 4C0KA 4WQ2A 1GGZA 1PSRA 1NX3A 2HQWA 1S6IA 1BJFA 1MQ1A 2PASA 4I5NB 2MJWB 3I5GC 2KYFA 4DIRA 2WC8A 1FF1A 1RFJA 1IQ3A 3DVJA 2OPOA 3TDZA 2CT9A 4I5KA 5FYXA 2KFGA 4A4CA 2MRDA 5CSIA 3O4YA 2NCOA 2LE9B 3ZNIA 3VRPA 1Y1UA 4C0LA 2BBMA 3LK0A 3OB2B 2K7BA 1KSOA 1RJVA 1UHJA 2LLTA 4PALA 1IGVA 2K7DA 2V53A 1B8LA 1WY9A 2K8MB 1QIWA 3MSEB 2LP3A 1F4OA 1JC2A 3VRNA 1H4BA 4GGFA 2E30A 1KFXS 1B9AA 1OQPA 3SG7A 5I2QA 3PN7B 2KDHA 3VRQA 2JZIA 1SNLA 2LP2A 3PN7C 2F8PA 2M7NA 1TIZA 1TRFA 3OP0A 1SPYA 1K8UA 4TNCA 4D1EA 1YTZC 4BY5A 1S5GZ 2JTTA 1QVIY 1TN4A 4GFTA 3QRXA 1QASA 1EXRA 1NX1A 3OHMB 1S6CA 1K9PA 4USLA 1ZOTB 2GV5A 1QS7A 3EVRA 2D8NA 2JRFA 2K7OA 2M9GA 4GAOA 1JWDA 4MZJA 3KO0A 2L4HA 1PVBA 2KOTA 1DJIA 1PSBA 3PALA 1YVHA 1A75B 4PHKA 1BF5A 1DMOA 4OCIA 4YBHB 4ZCUA 4CFQA 1BT6A 2ZFDA 3I5GB 1DJGA 1H8BA 4HSZA 3BOWB 1DJWA 3IQQA 1YUTA 2LHIA 4NDBA 2BECA 2A4JA 1NUBA 1VRKA 2JU0A 3AKAA 2COLB 4BY4A 4YGAA 4AQIA 2AMIA 4I5JA 3EK7A 1FI6A 1XA5A 1ZMZA 3GK1A 1KQMC 1M46A 1SW8A 1UHIA 1JUOA 1CNPA 1XK4A 1GGWA 1KFUL 3KEVA 3E3RA 2CCMA 1B7TZ 2LHLA 2KGRA 1TNWA 1OE9B 1X02A 1MR8A 3I5HC 2AUCA 2KFFA 2H61A 2JC2A 2KYCA 1BG1A 1TNXA 2I18A 2IS9A 4PHMA 1M31A 2LLUA 3EKHA 2JULA 1FPWA 1J55A 1K94A 2QACA 2BL0C 3BOWA
chains in the Genus database with same CATH superfamily
2EC6C 1V1GA 3AKBA 3OB1B 1CDPA 1SRAA 3IQOA 3O4XA 3S0FA 4QJ3B 2HQ8A 1UHNA 1NX0A 1QV1A 3OX5A 3TUYB 2L50A 2KFHA 2RGIA 2JT0A 4GNKB 1FW4A 1SYMA 2MAZA 4U8DA 2BBNA 1SBJA 2LV7A 3FWCA 1SCMC 3L4LA 2P71A 4PDZA 2QEVA 2KAXA 5HYDA 4YI9A 1J7PA 2F2PA 2FJUB 3BQ3A 1K9UA 3DF0A 1DJHA 1IH0A 1OSAA 3PFVA 1YRTB 2QEOA 2NXQA 3VB1A 2KHNA 4N1GA 1QVIZ 5IBWA 1EL4A 1CKKA 3CZTX 1SSEB 4GGNA 3B88A 2FCEA 1K93D 1WDCC 3O2PA 4M2OA 1IG5A 1R2UA 1ZUZA 2Y5IA 3GK2A 4YGCB 4YRUA 1GJYA 4MN0A 4N1FA 1AHRA 1BU3A 1IJ6A 2LCPA 2PRUA 2WC5A 1DJYA 2ZRTA 1JSAA 3OX6A 3LCPC 5F6TA 2JT8A 3M0WA 1XFZO 1QIVA 2PSRA 4DRWA 3LLEA 2Q91A 4M2QA 4PCWA 3TS5C 5KU1A 4NDCA 3RM1A 1G4YR 3R1PA 2KQ6A 3S0EA 1XO5A 2LMVA 1YUSA 2YGUA 5I2LA 1K2HA 1HT9A 1QXPA 2M29A 1U5IA 2L5YA 4ORAB 2OS8C 1LA0A 1NSHA 1OMRA 4PHNA 4CIDA 1Q80A 1SL9A 1OOJA 5AERA 2L0PA 1E8AA 3BFAA 3LK1A 5CSFA 4XYNA 1ZACA 3BUWB 3NSLA 3D74A 1YVLA 1AP4A 1DGUA 1F8HA 1C07A 5DKRA 1A75A 1TCOB 1TOPA 2JNFA 3EKJA 5JOLA 1B4CA 4YGEB 1RWYA 4I5LB 2ZNDA 1TTXA 2O5GA 3NXAA 5KSZA 1CFPA 2L98A 3I5IC 4JQ0D 4CLNA 1ORGA 2GGZA 2BCXA 1V1FA 1J1DA 1F55A 2JT3A 1L2OB 1NX2A 3FE8A 4A4BA 3SIAA 5B8IB 3BYAA 2KPHA 1CLLA 1SR6B 1CFCA 2WNDA 1EJ3A 3A4UB 1MXLC 3NSKA 2KAVA 4AQJA 1SMGA 1QJTA 4MBEA 3CZ0A 5J3XA 1ALWA 2L4IA 1KK8B 2FCDA 1CDMA 3AAKA 4WRIA 1UHKA 1CDNA 2M1KB 4OR9B 1F70A 2KI4C 1FI5A 3GOFA 1DF0A 3SG3A 3JVTC 1YR5A 3S0GA 4C0JA 1F4QA 1SL8A 4NQGA 2M0RA 1M63B 2PVBA 2WOSA 1YUUA 3SG6A 3DD4A 1Y6WA 2ZKMX 3FWBA 3D0YB 4GUKA 1DC1A 2JPOA 2WORA 3BUMB 4M2PA 1C7VA 4N5XA 4JWQA 3R72A 2CTNA 5HLOA 3KHEA 3UO9A 1QLKA 1NCZA 2F33A 1MXEA 1NP8A 1DF0B 3BUOB 1BOCA 1JBAA 2F2OA 3LL8B 3DVEA 1UWOA 1BMOA 1KCYA 2L51A 2OTGB 3PLFB 1AK8A 1DEKA 1NCYA 5TNCA 3D0YA 4ETOA 4DUQA 1NYAA 4FQOA 2CNPA 2L2EA 2LVIA 3CDNA 2HPSA 2PALA 3CZ2A 3DVMA 5CPVA 1DT7B 3CGAA 1XFYO 2NZ0A 5ER5A 1SK6D 1MWNA 3JTDB 4INWA 2Y1NA 1OMDA 3EG5B 4CFRA 2LVVA 1XFRA 2WCFA 1L7ZA 2KBIA 5AEQA 2WCLA 1SCVA 1JFJA 1N2DA 5CSNA 2BAPA 1J7OA 1MF8B 2NCPA 3I5FB 4HRHA 3VRRA 1WRLA 2KAYA 2F3YA 2M8UA 3UNWA 1C3ZA 4XJKB 4NDDA 1KWOB 2JWWA 2LVJA 4L9MA 4WQ3A 3S0AA 2KNEA 3B86A 4MRYA 1LINA 2LAPA 3BFBA 4KYNA 4OV2A 1ODBA 1CM4A 2BNXA 1LVCD 3EK4A 1B8RA 2QPTA 5JJGA 1Y1XA 2Q4UA 1PK0D 3B87A 2I2RE 2MLEC 1KWOC 2L5XB 4OZDA 3SG4A 5KTYA 2LLSA 3DZTA 1SL7A 1KK7Z 3TZ1A 2EHBA 3SS4A 3NHIA 3I5FC 3SG2A 1JF0A 1A29A 5D69A 3CZ1A 2LUXA 3O78A 1UP5A 2TN4A 4HREE 4R1EA 5PALA 1K96A 4GPLB 2G9BA 2K61A 2P6BB 1GQMA 3TDUA 3JTDC 1KK7Y 3RLZA 3WNXB 1ZFSA 3TDIA 1UURA 4HRGA 4F7FA 3DVKA 1CFDA 1XYDA 1YRUB 2M97A 1J7QA 2NLNA 1CMFA 1BODA 1IRJA 3BXKA 1G33A 4XJKA 3F45A 1NCXA 2MLFC 1CTRA 2OTGC 3RZSA 1OZOA 1BLQA 2LM5A 4GGFC 2M1UA 1DGVA 2ZNEA 5D7FA 1IWQA 5DKQA 1KFUS 1OOHA 1TNQA 4DCKA 4PE7A 3BUNB 1S36A 2Y1MA 1PALA 2LUCA 3HX4A 2BE6A 4IL1A 1AVSA 1RROA 2LVKA 4JD9A 1KQVA 2I94A 4E68A 1W7JB 1S6JA 3NGVA 3O6BA 3H4SE 2BCAA 3B6XA 1JF2A 1B47A 1NIWA 1DQEA 2PMYA 4Q04A 3BUXB 2ISDA 4MRXA 1TUJA 4ICBA 1T14A 3WHUB 2WCJA 1PVAA 2QEHA 3DXLA 3JVTB 2M3WA 4MZKA 1DTLA 5AANA 1DJZA 1R6PA 1QX5B 1M39A 2KI4B 2KI6C 5HKZA 3WHTB 1RECA 5K89A 1IQ5A 2K2FA 1CB1A 1KK8C 2FOTA 1K90D 2I7AA 2WCKA 1A03A 1N0YA 3GK4X 4ORCB 1WRZA 1QX2A 4MSPA 3AAJA 5HKWA 4OVNF 3BFHA 2WCHA 4PE0A 4QJ5B 1SR6C 4P5OE 2E6WA 4PE4A 1XFVO 2QEBA 2O60A 1KFXL 1AUIB 1L2OC 1RTP1 1YX8A 1OMVA 2GGMA 1XK4C 2KGBC 3CR2A 4YI8A 2P70A 5G08A 1YX7A 2LNKA 3I5IB 1OOIX 4JPZB 2LMTA 1JFKA 2JNXA 3EK8A 2HF5A 2WCEA 5BPJA 1W7IB 2M49B 2F3ZA 1BR1B 1QTXA 1SKTA 1XFWO 1EG3A 2B1UA 1AJ4A 3D10A 2MBXA 1CLMA 1HQVA 2H61C 2JQ6A 3FIAA 3ZWHA 3CR4X 4QJ4B 1CFFA 4GBAA 5HL1A 1TNPA 4PHJA 1B7TY 2LC5A 1NWDA 3FS7A 4PE1A 1WRKA 3S0DA 2DOQA 2OS8B 2G2BA 1ALVA 1YURA 2M7LA 1QLSA 5AXIA 1F71A 5I8NA 3WXAA 1J7RA 3QMEA 1MUXA 1U5IB 1QATA 3DF0B 4YGDB 1LXFC 3TS5B 4FTGA 3VGOA 3VROA 2JXLA 1DVIA 1CM1A 2ZN9A 3EVVA 3PSRA 5I2OA 1D1OA 1A4PA 4ZCVA 4AOMA 4P2YB 1RK9A 2BCBA 3SIBA 1F54A 3D76A 3CR5X 3CTNA 3IF7A 3K21A 3ICBA 1G8IA 3HCMA 1CDLA 1QX7A 1WDCB 1LA3A 2MHHA 2WCBA 3BJHA 3D77A 1TWOA 3L4AA 2H2KA 1S3PA 4DS7A 2Y4QA 2ZRSA 2K2AA 1IKUA 2KLEA 5HLVA 1S1EA 2BKHB 1AJ5A 1K9KA 2WCMA 1S26D 2JPTA 2VRGA 3DYEA 4MVFA 1B1GA 1C3YA 1Y1AA 2CXJA 4MEWA 4YGBB 3CLNA 3R1OA 2MA2A 1Y0VH 3KF9A 5I94A 3D73A 4MLWA 2CBLA 3SG5A 3KPXA 1CMGA 5FI7A 4MZLA 1SCMB 2K0JA 1FBVA 4OKHA 1GM0A 3TUYC 2AAOA 5ER4X 3A8RA 1LKJA 1XFXO 1CLBA 2SASA 1A2XA 1M45A 2KBMA 5DKNA 2EC6B 1PRWA 1PULA 4CPVA 3NSOA 2BL0B 5AFPA 1BF5A 3V2LA 1S5GY 1KSMA 1IJ5A 1TCFA 2R2IA 2K60A 2KSPA 1DJXA 3FE6A 4UPGA 1N65A 2BKIB 3NSIA 1WLMA 1OZSA 3CWGA 2KQYA 3CS1A 2JTZA 2JXCA 5EL2A 2KI6D 3SJSA 1XVJA 2LANA 2EGDA 5GQQC 1J1EA 1QV0A 1Z2CB 3I5HB 1XFUO 1EG4A 4ORBB 3NHTA 4F0ZB 3PATA 1EH2A 2ZN8A 1C7WA 1B8CA 3SS5A 1UHHA 2SCPA 1BR4B 2JOJA 2BE4A 1MHOA 1UUSA 3EVUA 5CSJA 5HKYA 1WLZA 1KQMB 1NPQA 2QDIA 1K95A 1LS8A 2LMUA 1OOGA 3K1EA 3C1VA 2HETA 3PM8A 1Z4HA 2K7CA 1SY9A 4C0KA 4WQ2A 1GGZA 1PSRA 1NX3A 1S6IA 2HQWA 1BJFA 1MQ1A 3DY9A 2KLDA 2PASA 4I5NB 4IJ7A 2MJWB 3I5GC 2KYFA 4INXA 4DIRA 2WC8A 1FF1A 1RFJA 1IQ3A 3DVJA 2OPOA 3TDZA 2CT9A 4I5KA 5FYXA 2KFGA 1DELA 4A4CA 2MRDA 3FE9A 3O4YA 2NCOA 2LE9B 5CSIA 3VRPA 3ZNIA 1Y1UA 4C0LA 2BBMA 3LK0A 3OB2B 2K7BA 1KSOA 1RJVA 1UHJA 1OOFA 2LLTA 1IGVA 2K7DA 2V53A 3D75A 4PALA 1B8LA 1WY9A 3SS3A 3L47A 2K8MB 1QIWA 3N7HA 3MSEB 2LP3A 3B7AA 1F4OA 1JC2A 3VRNA 2GTEA 3OGNA 3PM2A 4GGFA 1H4BA 2E30A 1KFXS 2L2CA 1B9AA 1OQPA 5D3OA 3SG7A 5I2QA 3PN7B 1W9ZA 2KDHA 3VRQA 2JZIA 1SNLA 2LP2A 1QWVA 3PN7C 2F8PA 2M7NA 2H8VA 1TIZA 1TRFA 3OP0A 1SPYA 1K8UA 4TNCA 4D1EA 1YTZC 4BY5A 1S5GZ 2JTTA 1QVIY 1TN4A 4GFTA 3QRXA 1QASA 1EXRA 1NX1A 3OHMB 1S6CA 3Q8IA 1K9PA 4USLA 2PQLA 1ZOTB 5FI6A 2GV5A 1QS7A 3EVRA 3IVTA 2D8NA 2JRFA 2K7OA 2M9GA 4GAOA 1JWDA 1TUZA 3S0BA 4MZJA 3KO0A 2PYQA 2L4HA 1PVBA 2KOTA 1DJIA 1P28A 1PSBA 1YVHA 1A75B 3OBVA 3PALA 4FQTA 4PHKA 4OCIA 4YBHB 4ZCUA 4CFQA 1DMOA 1BT6A 2ZFDA 3I5GB 4JKTA 1DJGA 1H8BA 4HSZA 3BOWB 1DJWA 3PJIA 5DICA 3IQQA 3R1VA 4PT1A 1YUTA 2LHIA 4NDBA 2BECA 2A4JA 1NUBA 1VRKA 2JU0A 3AKAA 3D78A 2COLB 2ERBA 4YGAA 4AQIA 4BY4A 2AMIA 4I5JA 3EK7A 1FI6A 2WC6A 1XA5A 1ZMZA 3GK1A 1KQMC 1M46A 1SW8A 1UHIA 1JUOA 1CNPA 1XK4A 1GGWA 1KFUL 3KEVA 3E3RA 2CCMA 1B7TZ 2LHLA 2KGRA 1IIOA 1TNWA 1OE9B 1X02A 1MR8A 3I5HC 5FI2A 2AUCA 3CYZA 2KFFA 2H61A 2JC2A 1OW4A 2KYCA 1BG1A 2FJYA 1TNXA 2I18A 2IS9A 3CABA 4PHMA 1M31A 2LLUA 3EKHA 2JULA 1FPWA 1J55A 1K94A 2QACA 2BL0C 3BOWA
chains in the Genus database with same CATH topology
2EC6C 1V1GA 3AKBA 3OB1B 1CDPA 1SRAA 3IQOA 4QJ3B 2HQ8A 1UHNA 1NX0A 1QV1A 3OX5A 3TUYB 2L50A 2KFHA 2RGIA 2JT0A 4GNKB 1FW4A 1SYMA 2MAZA 4U8DA 2BBNA 1SBJA 2LV7A 3FWCA 1SCMC 4PDZA 2KAXA 5HYDA 4YI9A 1J7PA 2F2PA 2FJUB 3BQ3A 1K9UA 3DF0A 1DJHA 1IH0A 1OSAA 3PFVA 1YRTB 2NXQA 2KHNA 4N1GA 1QVIZ 5IBWA 1EL4A 1CKKA 3CZTX 4GGNA 2FCEA 1K93D 1WDCC 3O2PA 4M2OA 1IG5A 1R2UA 1ZUZA 2Y5IA 3GK2A 4YGCB 4YRUA 1GJYA 4MN0A 4N1FA 1AHRA 1BU3A 1IJ6A 2LCPA 2PRUA 2ZRTA 1DJYA 1JSAA 3OX6A 3LCPC 5F6TA 2JT8A 3M0WA 1XFZO 1QIVA 2PSRA 4DRWA 3LLEA 2Q91A 4M2QA 4PCWA 3TS5C 5KU1A 4NDCA 3RM1A 1G4YR 2KQ6A 1XO5A 2LMVA 1YUSA 5I2LA 1K2HA 1HT9A 1QXPA 2M29A 1U5IA 4ORAB 2OS8C 1LA0A 1NSHA 1OMRA 4PHNA 4CIDA 1Q80A 1SL9A 1OOJA 5AERA 2L0PA 1E8AA 3LK1A 5CSFA 4XYNA 1ZACA 3BUWB 3NSLA 1YVLA 1AP4A 1DGUA 1F8HA 1C07A 5DKRA 1A75A 1TCOB 1TOPA 2JNFA 3EKJA 5JOLA 1B4CA 4YGEB 1RWYA 4I5LB 2ZNDA 1TTXA 2O5GA 3NXAA 5KSZA 1CFPA 2L98A 3I5IC 4JQ0D 4CLNA 2GGZA 2BCXA 1V1FA 1J1DA 1F55A 2JT3A 1L2OB 1NX2A 4A4BA 3SIAA 5B8IB 3BYAA 1CLLA 1SR6B 1CFCA 2WNDA 1EJ3A 3A4UB 1MXLC 3NSKA 2KAVA 4AQJA 1SMGA 1QJTA 4MBEA 5J3XA 1ALWA 2L4IA 1KK8B 2FCDA 1CDMA 3AAKA 4WRIA 1UHKA 1CDNA 2M1KB 4OR9B 1F70A 2KI4C 1FI5A 3GOFA 1DF0A 3SG3A 3JVTC 1YR5A 4C0JA 1F4QA 1SL8A 4NQGA 2M0RA 1M63B 2PVBA 2WOSA 1YUUA 3SG6A 3DD4A 1Y6WA 2ZKMX 3FWBA 3D0YB 4GUKA 2WORA 3BUMB 4M2PA 1C7VA 4N5XA 4JWQA 2CTNA 5HLOA 3KHEA 1QLKA 1NCZA 2F33A 1MXEA 1NP8A 1DF0B 3BUOB 1BOCA 1JBAA 2F2OA 3LL8B 3DVEA 1UWOA 1BMOA 1KCYA 2L51A 2OTGB 3PLFB 1AK8A 1NCYA 5TNCA 3D0YA 4ETOA 4DUQA 1NYAA 4FQOA 2CNPA 2L2EA 2LVIA 5CPVA 2HPSA 2PALA 3DVMA 1DT7B 3CGAA 1XFYO 2NZ0A 5ER5A 1SK6D 1MWNA 3JTDB 2Y1NA 1OMDA 4CFRA 2LVVA 2WCFA 1L7ZA 2KBIA 5AEQA 1SCVA 1JFJA 1N2DA 5CSNA 1J7OA 1MF8B 2NCPA 3I5FB 4HRHA 3VRRA 1WRLA 2KAYA 2F3YA 2M8UA 4XJKB 4NDDA 1KWOB 2JWWA 2LVJA 4L9MA 4WQ3A 2KNEA 4MRYA 1LINA 2LAPA 4OV2A 1ODBA 1CM4A 1LVCD 3EK4A 1B8RA 2QPTA 5JJGA 1Y1XA 2Q4UA 1PK0D 2I2RE 2MLEC 1KWOC 2L5XB 3SG4A 5KTYA 2LLSA 1SL7A 1KK7Z 3TZ1A 2EHBA 3I5FC 3SG2A 1JF0A 1A29A 5D69A 3O78A 2LUXA 1UP5A 2TN4A 4HREE 4R1EA 5PALA 1K96A 4GPLB 2G9BA 2K61A 2P6BB 1GQMA 3TDUA 3JTDC 1KK7Y 3RLZA 3WNXB 1ZFSA 3TDIA 1UURA 4HRGA 3DVKA 1CFDA 1XYDA 1YRUB 2M97A 1J7QA 2NLNA 1CMFA 1BODA 1IRJA 3BXKA 1G33A 4XJKA 3F45A 1NCXA 2MLFC 1CTRA 2OTGC 1BLQA 1OZOA 2LM5A 4GGFC 2M1UA 1DGVA 2ZNEA 5D7FA 1IWQA 5DKQA 1KFUS 1TNQA 4DCKA 4PE7A 3BUNB 1S36A 2Y1MA 1PALA 2LUCA 3HX4A 2BE6A 4IL1A 1AVSA 1RROA 2LVKA 1KQVA 2I94A 4E68A 1W7JB 1S6JA 3O6BA 3H4SE 2BCAA 4Q04A 1JF2A 1B47A 1NIWA 2PMYA 2ISDA 3BUXB 4MRXA 4ICBA 3WHUB 1PVAA 3JVTB 2M3WA 4MZKA 1DTLA 5AANA 1DJZA 1R6PA 1QX5B 1M39A 2KI4B 2KI6C 5HKZA 3WHTB 1RECA 5K89A 1IQ5A 2K2FA 1CB1A 1KK8C 2FOTA 1K90D 2I7AA 1A03A 1N0YA 3GK4X 4ORCB 1WRZA 1QX2A 4MSPA 3AAJA 5HKWA 4OVNF 4PE0A 4QJ5B 1SR6C 4P5OE 2E6WA 4PE4A 1XFVO 2O60A 1KFXL 1AUIB 1L2OC 1RTP1 1YX8A 1OMVA 2GGMA 1XK4C 2KGBC 3CR2A 4YI8A 5G08A 1YX7A 2LNKA 3I5IB 4JPZB 2LMTA 1JFKA 2JNXA 3EK8A 2HF5A 2WCEA 5BPJA 1W7IB 2M49B 2F3ZA 1BR1B 1QTXA 1SKTA 1XFWO 1EG3A 2B1UA 1AJ4A 3D10A 2MBXA 1CLMA 1HQVA 2H61C 2JQ6A 3FIAA 3ZWHA 3CR4X 4QJ4B 1CFFA 4GBAA 1TNPA 4PHJA 1B7TY 2LC5A 1NWDA 3FS7A 4PE1A 1WRKA 2DOQA 2OS8B 2G2BA 1ALVA 1YURA 2M7LA 1QLSA 5AXIA 1F71A 5I8NA 3WXAA 1J7RA 1MUXA 1U5IB 1QATA 3DF0B 4YGDB 1LXFC 3TS5B 4FTGA 3VGOA 3VROA 2JXLA 1DVIA 1CM1A 2ZN9A 3EVVA 3PSRA 5I2OA 1D1OA 1A4PA 4ZCVA 4AOMA 4P2YB 1RK9A 2BCBA 3SIBA 1F54A 3CR5X 3CTNA 3IF7A 3K21A 3ICBA 1G8IA 3HCMA 1CDLA 1QX7A 1WDCB 1LA3A 2MHHA 2WCBA 2H2KA 1S3PA 4DS7A 2Y4QA 2ZRSA 2K2AA 1IKUA 5HLVA 1S1EA 2BKHB 1AJ5A 1K9KA 1S26D 2JPTA 2VRGA 4MVFA 1B1GA 1Y1AA 2CXJA 4MEWA 4YGBB 3CLNA 2MA2A 1Y0VH 3KF9A 4MLWA 2CBLA 3SG5A 3KPXA 1CMGA 4MZLA 1SCMB 2K0JA 1FBVA 4OKHA 3TUYC 2AAOA 5ER4X 3A8RA 1LKJA 1XFXO 1CLBA 2SASA 1A2XA 1M45A 2KBMA 5DKNA 2EC6B 1PRWA 1PULA 4CPVA 3NSOA 2BL0B 5AFPA 1S5GY 1KSMA 1IJ5A 1TCFA 2R2IA 2KSPA 1DJXA 4UPGA 1N65A 2BKIB 3NSIA 1WLMA 1OZSA 3CWGA 2KQYA 3CS1A 2JTZA 2JXCA 2KI6D 3SJSA 1XVJA 2LANA 2EGDA 5GQQC 1J1EA 1QV0A 3I5HB 1XFUO 1EG4A 4ORBB 4F0ZB 3PATA 1EH2A 2ZN8A 1C7WA 1B8CA 1UHHA 2SCPA 1BR4B 2JOJA 2BE4A 1MHOA 1UUSA 3EVUA 5CSJA 5HKYA 1WLZA 1KQMB 1NPQA 1K95A 2LMUA 3C1VA 2HETA 3PM8A 2K7CA 1SY9A 4C0KA 4WQ2A 1GGZA 1PSRA 1NX3A 2HQWA 1S6IA 1BJFA 1MQ1A 2PASA 4I5NB 2MJWB 3I5GC 2KYFA 4DIRA 2WC8A 1FF1A 1RFJA 1IQ3A 3DVJA 2OPOA 3TDZA 2CT9A 4I5KA 5FYXA 2KFGA 4A4CA 2MRDA 5CSIA 3O4YA 2NCOA 2LE9B 3ZNIA 3VRPA 1Y1UA 4C0LA 2BBMA 3LK0A 3OB2B 2K7BA 1KSOA 1RJVA 1UHJA 2LLTA 4PALA 1IGVA 2K7DA 2V53A 1B8LA 1WY9A 2K8MB 1QIWA 3MSEB 2LP3A 1F4OA 1JC2A 3VRNA 1H4BA 4GGFA 2E30A 1KFXS 1B9AA 1OQPA 3SG7A 5I2QA 3PN7B 2KDHA 3VRQA 2JZIA 1SNLA 2LP2A 3PN7C 2F8PA 2M7NA 1TIZA 1TRFA 3OP0A 1SPYA 1K8UA 4TNCA 4D1EA 1YTZC 4BY5A 1S5GZ 2JTTA 1QVIY 1TN4A 4GFTA 3QRXA 1QASA 1EXRA 1NX1A 3OHMB 1S6CA 1K9PA 4USLA 1ZOTB 2GV5A 1QS7A 3EVRA 2D8NA 2JRFA 2K7OA 2M9GA 4GAOA 1JWDA 4MZJA 3KO0A 2L4HA 1PVBA 2KOTA 1DJIA 1PSBA 3PALA 1YVHA 1A75B 4PHKA 1BF5A 1DMOA 4OCIA 4YBHB 4ZCUA 4CFQA 1BT6A 2ZFDA 3I5GB 1DJGA 1H8BA 4HSZA 3BOWB 1DJWA 3IQQA 1YUTA 2LHIA 4NDBA 2BECA 2A4JA 1NUBA 1VRKA 2JU0A 3AKAA 2COLB 4BY4A 4YGAA 4AQIA 2AMIA 4I5JA 3EK7A 1FI6A 1XA5A 1ZMZA 3GK1A 1KQMC 1M46A 1SW8A 1UHIA 1JUOA 1CNPA 1XK4A 1GGWA 1KFUL 3KEVA 3E3RA 2CCMA 1B7TZ 2LHLA 2KGRA 1TNWA 1OE9B 1X02A 1MR8A 3I5HC 2AUCA 2KFFA 2H61A 2JC2A 2KYCA 1BG1A 1TNXA 2I18A 2IS9A 4PHMA 1M31A 2LLUA 3EKHA 2JULA 1FPWA 1J55A 1K94A 2QACA 2BL0C 3BOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 C;  1V1G A;  3AKB A;  3OB1 B;  1CDP A;  1SRA A;  3IQO A;  4QJ3 B;  2HQ8 A;  1UHN A;  1NX0 A;  1QV1 A;  3OX5 A;  3TUY B;  2L50 A;  2KFH A;  2RGI A;  2JT0 A;  4GNK B;  1FW4 A;  1SYM A;  2MAZ A;  4U8D A;  2BBN A;  1SBJ A;  2LV7 A;  3FWC A;  1SCM C;  4PDZ A;  2KAX A;  5HYD A;  4YI9 A;  1J7P A;  2F2P A;  2FJU B;  3BQ3 A;  1K9U A;  3DF0 A;  1DJH A;  1IH0 A;  1OSA A;  3PFV A;  1YRT B;  2NXQ A;  2KHN A;  4N1G A;  1QVI Z;  5IBW A;  1EL4 A;  1CKK A;  3CZT X;  4GGN A;  2FCE A;  1K93 D;  1WDC C;  3O2P A;  4M2O A;  1IG5 A;  1R2U A;  1ZUZ A;  2Y5I A;  3GK2 A;  4YGC B;  4YRU A;  1GJY A;  4MN0 A;  4N1F A;  1AHR A;  1BU3 A;  1IJ6 A;  2LCP A;  2PRU A;  2ZRT A;  1DJY A;  1JSA A;  3OX6 A;  3LCP C;  5F6T A;  2JT8 A;  3M0W A;  1XFZ O;  1QIV A;  2PSR A;  4DRW A;  3LLE A;  2Q91 A;  4M2Q A;  4PCW A;  3TS5 C;  5KU1 A;  4NDC A;  3RM1 A;  1G4Y R;  2KQ6 A;  1XO5 A;  2LMV A;  1YUS A;  5I2L A;  1K2H A;  1HT9 A;  1QXP A;  2M29 A;  1U5I A;  4ORA B;  2OS8 C;  1LA0 A;  1NSH A;  1OMR A;  4PHN A;  4CID A;  1Q80 A;  1SL9 A;  1OOJ A;  5AER A;  2L0P A;  1E8A A;  3LK1 A;  5CSF A;  4XYN A;  1ZAC A;  3BUW B;  3NSL A;  1YVL A;  1AP4 A;  1DGU A;  1F8H A;  1C07 A;  5DKR A;  1A75 A;  1TCO B;  1TOP A;  2JNF A;  3EKJ A;  5JOL A;  1B4C A;  4YGE B;  1RWY A;  4I5L B;  2ZND A;  1TTX A;  2O5G A;  3NXA A;  5KSZ A;  1CFP A;  2L98 A;  3I5I C;  4JQ0 D;  4CLN A;  2GGZ A;  2BCX A;  1V1F A;  1J1D A;  1F55 A;  2JT3 A;  1L2O B;  1NX2 A;  4A4B A;  3SIA A;  5B8I B;  3BYA A;  1CLL A;  1SR6 B;  1CFC A;  2WND A;  1EJ3 A;  3A4U B;  1MXL C;  3NSK A;  2KAV A;  4AQJ A;  1SMG A;  1QJT A;  4MBE A;  5J3X A;  1ALW A;  2L4I A;  1KK8 B;  2FCD A;  1CDM A;  3AAK A;  4WRI A;  1UHK A;  1CDN A;  2M1K B;  4OR9 B;  1F70 A;  2KI4 C;  1FI5 A;  3GOF A;  1DF0 A;  3SG3 A;  3JVT C;  1YR5 A;  4C0J A;  1F4Q A;  1SL8 A;  4NQG A;  2M0R A;  1M63 B;  2PVB A;  2WOS A;  1YUU A;  3SG6 A;  3DD4 A;  1Y6W A;  2ZKM X;  3FWB A;  3D0Y B;  4GUK A;  2WOR A;  3BUM B;  4M2P A;  1C7V A;  4N5X A;  4JWQ A;  2CTN A;  5HLO A;  3KHE A;  1QLK A;  1NCZ A;  2F33 A;  1MXE A;  1NP8 A;  1DF0 B;  3BUO B;  1BOC A;  1JBA A;  2F2O A;  3LL8 B;  3DVE A;  1UWO A;  1BMO A;  1KCY A;  2L51 A;  2OTG B;  3PLF B;  1AK8 A;  1NCY A;  5TNC A;  3D0Y A;  4ETO A;  4DUQ A;  1NYA A;  4FQO A;  2CNP A;  2L2E A;  2LVI A;  5CPV A;  2HPS A;  2PAL A;  3DVM A;  1DT7 B;  3CGA A;  1XFY O;  2NZ0 A;  5ER5 A;  1SK6 D;  1MWN A;  3JTD B;  2Y1N A;  1OMD A;  4CFR A;  2LVV A;  2WCF A;  1L7Z A;  2KBI A;  5AEQ A;  1SCV A;  1JFJ A;  1N2D A;  5CSN A;  1J7O A;  1MF8 B;  2NCP A;  3I5F B;  4HRH A;  3VRR A;  1WRL A;  2KAY A;  2F3Y A;  2M8U A;  4XJK B;  4NDD A;  1KWO B;  2JWW A;  2LVJ A;  4L9M A;  4WQ3 A;  2KNE A;  4MRY A;  1LIN A;  2LAP A;  4OV2 A;  1ODB A;  1CM4 A;  1LVC D;  3EK4 A;  1B8R A;  2QPT A;  5JJG A;  1Y1X A;  2Q4U A;  1PK0 D;  2I2R E;  2MLE C;  1KWO C;  2L5X B;  3SG4 A;  5KTY A;  2LLS A;  1SL7 A;  1KK7 Z;  3TZ1 A;  2EHB A;  3I5F C;  3SG2 A;  1JF0 A;  1A29 A;  5D69 A;  3O78 A;  2LUX A;  1UP5 A;  2TN4 A;  4HRE E;  4R1E A;  5PAL A;  1K96 A;  4GPL B;  2G9B A;  2K61 A;  2P6B B;  1GQM A;  3TDU A;  3JTD C;  1KK7 Y;  3RLZ A;  3WNX B;  1ZFS A;  3TDI A;  1UUR A;  4HRG A;  3DVK A;  1CFD A;  1XYD A;  1YRU B;  2M97 A;  1J7Q A;  2NLN A;  1CMF A;  1BOD A;  1IRJ A;  3BXK A;  1G33 A;  4XJK A;  3F45 A;  1NCX A;  2MLF C;  1CTR A;  2OTG C;  1BLQ A;  1OZO A;  2LM5 A;  4GGF C;  2M1U A;  1DGV A;  2ZNE A;  5D7F A;  1IWQ A;  5DKQ A;  1KFU S;  1TNQ A;  4DCK A;  4PE7 A;  3BUN B;  1S36 A;  2Y1M A;  1PAL A;  2LUC A;  3HX4 A;  2BE6 A;  4IL1 A;  1AVS A;  1RRO A;  2LVK A;  1KQV A;  2I94 A;  4E68 A;  1W7J B;  1S6J A;  3O6B A;  3H4S E;  2BCA A;  4Q04 A;  1JF2 A;  1B47 A;  1NIW A;  2PMY A;  2ISD A;  3BUX B;  4MRX A;  4ICB A;  3WHU B;  1PVA A;  3JVT B;  2M3W A;  4MZK A;  1DTL A;  5AAN A;  1DJZ A;  1R6P A;  1QX5 B;  1M39 A;  2KI4 B;  2KI6 C;  5HKZ A;  3WHT B;  1REC A;  5K89 A;  1IQ5 A;  2K2F A;  1CB1 A;  1KK8 C;  2FOT A;  1K90 D;  2I7A A;  1A03 A;  1N0Y A;  3GK4 X;  4ORC B;  1WRZ A;  1QX2 A;  4MSP A;  3AAJ A;  5HKW A;  4OVN F;  4PE0 A;  4QJ5 B;  1SR6 C;  4P5O E;  2E6W A;  4PE4 A;  1XFV O;  2O60 A;  1KFX L;  1AUI B;  1L2O C;  1RTP 1;  1YX8 A;  1OMV A;  2GGM A;  1XK4 C;  2KGB C;  3CR2 A;  4YI8 A;  5G08 A;  1YX7 A;  2LNK A;  3I5I B;  4JPZ B;  2LMT A;  1JFK A;  2JNX A;  3EK8 A;  2HF5 A;  2WCE A;  5BPJ A;  1W7I B;  2M49 B;  2F3Z A;  1BR1 B;  1QTX A;  1SKT A;  1XFW O;  1EG3 A;  2B1U A;  1AJ4 A;  3D10 A;  2MBX A;  1CLM A;  1HQV A;  2H61 C;  2JQ6 A;  3FIA A;  3ZWH A;  3CR4 X;  4QJ4 B;  1CFF A;  4GBA A;  1TNP A;  4PHJ A;  1B7T Y;  2LC5 A;  1NWD A;  3FS7 A;  4PE1 A;  1WRK A;  2DOQ A;  2OS8 B;  2G2B A;  1ALV A;  1YUR A;  2M7L A;  1QLS A;  5AXI A;  1F71 A;  5I8N A;  3WXA A;  1J7R A;  1MUX A;  1U5I B;  1QAT A;  3DF0 B;  4YGD B;  1LXF C;  3TS5 B;  4FTG A;  3VGO A;  3VRO A;  2JXL A;  1DVI A;  1CM1 A;  2ZN9 A;  3EVV A;  3PSR A;  5I2O A;  1D1O A;  1A4P A;  4ZCV A;  4AOM A;  4P2Y B;  1RK9 A;  2BCB A;  3SIB A;  1F54 A;  3CR5 X;  3CTN A;  3IF7 A;  3K21 A;  3ICB A;  1G8I A;  3HCM A;  1CDL A;  1QX7 A;  1WDC B;  1LA3 A;  2MHH A;  2WCB A;  2H2K A;  1S3P A;  4DS7 A;  2Y4Q A;  2ZRS A;  2K2A A;  1IKU A;  5HLV A;  1S1E A;  2BKH B;  1AJ5 A;  1K9K A;  1S26 D;  2JPT A;  2VRG A;  4MVF A;  1B1G A;  1Y1A A;  2CXJ A;  4MEW A;  4YGB B;  3CLN A;  2MA2 A;  1Y0V H;  3KF9 A;  4MLW A;  2CBL A;  3SG5 A;  3KPX A;  1CMG A;  4MZL A;  1SCM B;  2K0J A;  1FBV A;  4OKH A;  3TUY C;  2AAO A;  5ER4 X;  3A8R A;  1LKJ A;  1XFX O;  1CLB A;  2SAS A;  1A2X A;  1M45 A;  2KBM A;  5DKN A;  2EC6 B;  1PRW A;  1PUL A;  4CPV A;  3NSO A;  2BL0 B;  5AFP A;  1S5G Y;  1KSM A;  1IJ5 A;  1TCF A;  2R2I A;  2KSP A;  1DJX A;  4UPG A;  1N65 A;  2BKI B;  3NSI A;  1WLM A;  1OZS A;  3CWG A;  2KQY A;  3CS1 A;  2JTZ A;  2JXC A;  2KI6 D;  3SJS A;  1XVJ A;  2LAN A;  2EGD A;  5GQQ C;  1J1E A;  1QV0 A;  3I5H B;  1XFU O;  1EG4 A;  4ORB B;  4F0Z B;  3PAT A;  1EH2 A;  2ZN8 A;  1C7W A;  1B8C A;  1UHH A;  2SCP A;  1BR4 B;  2JOJ A;  2BE4 A;  1MHO A;  1UUS A;  3EVU A;  5CSJ A;  5HKY A;  1WLZ A;  1KQM B;  1NPQ A;  1K95 A;  2LMU A;  3C1V A;  2HET A;  3PM8 A;  2K7C A;  1SY9 A;  4C0K A;  4WQ2 A;  1GGZ A;  1PSR A;  1NX3 A;  2HQW A;  1S6I A;  1BJF A;  1MQ1 A;  2PAS A;  4I5N B;  2MJW B;  3I5G C;  2KYF A;  4DIR A;  2WC8 A;  1FF1 A;  1RFJ A;  1IQ3 A;  3DVJ A;  2OPO A;  3TDZ A;  2CT9 A;  4I5K A;  5FYX A;  2KFG A;  4A4C A;  2MRD A;  5CSI A;  3O4Y A;  2NCO A;  2LE9 B;  3ZNI A;  3VRP A;  1Y1U A;  4C0L A;  2BBM A;  3LK0 A;  3OB2 B;  2K7B A;  1KSO A;  1RJV A;  1UHJ A;  2LLT A;  4PAL A;  1IGV A;  2K7D A;  2V53 A;  1B8L A;  1WY9 A;  2K8M B;  1QIW A;  3MSE B;  2LP3 A;  1F4O A;  1JC2 A;  3VRN A;  1H4B A;  4GGF A;  2E30 A;  1KFX S;  1B9A A;  1OQP A;  3SG7 A;  5I2Q A;  3PN7 B;  2KDH A;  3VRQ A;  2JZI A;  1SNL A;  2LP2 A;  3PN7 C;  2F8P A;  2M7N A;  1TIZ A;  1TRF A;  3OP0 A;  1SPY A;  1K8U A;  4TNC A;  4D1E A;  1YTZ C;  4BY5 A;  1S5G Z;  2JTT A;  1QVI Y;  1TN4 A;  4GFT A;  3QRX A;  1QAS A;  1EXR A;  1NX1 A;  3OHM B;  1S6C A;  1K9P A;  4USL A;  1ZOT B;  2GV5 A;  1QS7 A;  3EVR A;  2D8N A;  2JRF A;  2K7O A;  2M9G A;  4GAO A;  1JWD A;  4MZJ A;  3KO0 A;  2L4H A;  1PVB A;  2KOT A;  1DJI A;  1PSB A;  3PAL A;  1YVH A;  1A75 B;  4PHK A;  1BF5 A;  1DMO A;  4OCI A;  4YBH B;  4ZCU A;  4CFQ A;  1BT6 A;  2ZFD A;  3I5G B;  1DJG A;  1H8B A;  4HSZ A;  3BOW B;  1DJW A;  3IQQ A;  1YUT A;  2LHI A;  4NDB A;  2BEC A;  2A4J A;  1NUB A;  1VRK A;  2JU0 A;  3AKA A;  2COL B;  4BY4 A;  4YGA A;  4AQI A;  2AMI A;  4I5J A;  3EK7 A;  1FI6 A;  1XA5 A;  1ZMZ A;  3GK1 A;  1KQM C;  1M46 A;  1SW8 A;  1UHI A;  1JUO A;  1CNP A;  1XK4 A;  1GGW A;  1KFU L;  3KEV A;  3E3R A;  2CCM A;  1B7T Z;  2LHL A;  2KGR A;  1TNW A;  1OE9 B;  1X02 A;  1MR8 A;  3I5H C;  2AUC A;  2KFF A;  2H61 A;  2JC2 A;  2KYC A;  1BG1 A;  1TNX A;  2I18 A;  2IS9 A;  4PHM A;  1M31 A;  2LLU A;  3EKH A;  2JUL A;  1FPW A;  1J55 A;  1K94 A;  2QAC A;  2BL0 C;  3BOW A; 
#chains in the Genus database with same CATH topology
 2EC6 C;  1V1G A;  3AKB A;  3OB1 B;  1CDP A;  1SRA A;  3IQO A;  3O4X A;  3S0F A;  4QJ3 B;  2HQ8 A;  1UHN A;  1NX0 A;  1QV1 A;  3OX5 A;  3TUY B;  2L50 A;  2KFH A;  2RGI A;  2JT0 A;  4GNK B;  1FW4 A;  1SYM A;  2MAZ A;  4U8D A;  2BBN A;  1SBJ A;  2LV7 A;  3FWC A;  1SCM C;  3L4L A;  2P71 A;  4PDZ A;  2QEV A;  2KAX A;  5HYD A;  4YI9 A;  1J7P A;  2F2P A;  2FJU B;  3BQ3 A;  1K9U A;  3DF0 A;  1DJH A;  1IH0 A;  1OSA A;  3PFV A;  1YRT B;  2QEO A;  2NXQ A;  3VB1 A;  2KHN A;  4N1G A;  1QVI Z;  5IBW A;  1EL4 A;  1CKK A;  3CZT X;  1SSE B;  4GGN A;  3B88 A;  2FCE A;  1K93 D;  1WDC C;  3O2P A;  4M2O A;  1IG5 A;  1R2U A;  1ZUZ A;  2Y5I A;  3GK2 A;  4YGC B;  4YRU A;  1GJY A;  4MN0 A;  4N1F A;  1AHR A;  1BU3 A;  1IJ6 A;  2LCP A;  2PRU A;  2WC5 A;  1DJY A;  2ZRT A;  1JSA A;  3OX6 A;  3LCP C;  5F6T A;  2JT8 A;  3M0W A;  1XFZ O;  1QIV A;  2PSR A;  4DRW A;  3LLE A;  2Q91 A;  4M2Q A;  4PCW A;  3TS5 C;  5KU1 A;  4NDC A;  3RM1 A;  1G4Y R;  3R1P A;  2KQ6 A;  3S0E A;  1XO5 A;  2LMV A;  1YUS A;  2YGU A;  5I2L A;  1K2H A;  1HT9 A;  1QXP A;  2M29 A;  1U5I A;  2L5Y A;  4ORA B;  2OS8 C;  1LA0 A;  1NSH A;  1OMR A;  4PHN A;  4CID A;  1Q80 A;  1SL9 A;  1OOJ A;  5AER A;  2L0P A;  1E8A A;  3BFA A;  3LK1 A;  5CSF A;  4XYN A;  1ZAC A;  3BUW B;  3NSL A;  3D74 A;  1YVL A;  1AP4 A;  1DGU A;  1F8H A;  1C07 A;  5DKR A;  1A75 A;  1TCO B;  1TOP A;  2JNF A;  3EKJ A;  5JOL A;  1B4C A;  4YGE B;  1RWY A;  4I5L B;  2ZND A;  1TTX A;  2O5G A;  3NXA A;  5KSZ A;  1CFP A;  2L98 A;  3I5I C;  4JQ0 D;  4CLN A;  1ORG A;  2GGZ A;  2BCX A;  1V1F A;  1J1D A;  1F55 A;  2JT3 A;  1L2O B;  1NX2 A;  3FE8 A;  4A4B A;  3SIA A;  5B8I B;  3BYA A;  2KPH A;  1CLL A;  1SR6 B;  1CFC A;  2WND A;  1EJ3 A;  3A4U B;  1MXL C;  3NSK A;  2KAV A;  4AQJ A;  1SMG A;  1QJT A;  4MBE A;  3CZ0 A;  5J3X A;  1ALW A;  2L4I A;  1KK8 B;  2FCD A;  1CDM A;  3AAK A;  4WRI A;  1UHK A;  1CDN A;  2M1K B;  4OR9 B;  1F70 A;  2KI4 C;  1FI5 A;  3GOF A;  1DF0 A;  3SG3 A;  3JVT C;  1YR5 A;  3S0G A;  4C0J A;  1F4Q A;  1SL8 A;  4NQG A;  2M0R A;  1M63 B;  2PVB A;  2WOS A;  1YUU A;  3SG6 A;  3DD4 A;  1Y6W A;  2ZKM X;  3FWB A;  3D0Y B;  4GUK A;  1DC1 A;  2JPO A;  2WOR A;  3BUM B;  4M2P A;  1C7V A;  4N5X A;  4JWQ A;  3R72 A;  2CTN A;  5HLO A;  3KHE A;  3UO9 A;  1QLK A;  1NCZ A;  2F33 A;  1MXE A;  1NP8 A;  1DF0 B;  3BUO B;  1BOC A;  1JBA A;  2F2O A;  3LL8 B;  3DVE A;  1UWO A;  1BMO A;  1KCY A;  2L51 A;  2OTG B;  3PLF B;  1AK8 A;  1DEK A;  1NCY A;  5TNC A;  3D0Y A;  4ETO A;  4DUQ A;  1NYA A;  4FQO A;  2CNP A;  2L2E A;  2LVI A;  3CDN A;  2HPS A;  2PAL A;  3CZ2 A;  3DVM A;  5CPV A;  1DT7 B;  3CGA A;  1XFY O;  2NZ0 A;  5ER5 A;  1SK6 D;  1MWN A;  3JTD B;  4INW A;  2Y1N A;  1OMD A;  3EG5 B;  4CFR A;  2LVV A;  1XFR A;  2WCF A;  1L7Z A;  2KBI A;  5AEQ A;  2WCL A;  1SCV A;  1JFJ A;  1N2D A;  5CSN A;  2BAP A;  1J7O A;  1MF8 B;  2NCP A;  3I5F B;  4HRH A;  3VRR A;  1WRL A;  2KAY A;  2F3Y A;  2M8U A;  3UNW A;  1C3Z A;  4XJK B;  4NDD A;  1KWO B;  2JWW A;  2LVJ A;  4L9M A;  4WQ3 A;  3S0A A;  2KNE A;  3B86 A;  4MRY A;  1LIN A;  2LAP A;  3BFB A;  4KYN A;  4OV2 A;  1ODB A;  1CM4 A;  2BNX A;  1LVC D;  3EK4 A;  1B8R A;  2QPT A;  5JJG A;  1Y1X A;  2Q4U A;  1PK0 D;  3B87 A;  2I2R E;  2MLE C;  1KWO C;  2L5X B;  4OZD A;  3SG4 A;  5KTY A;  2LLS A;  3DZT A;  1SL7 A;  1KK7 Z;  3TZ1 A;  2EHB A;  3SS4 A;  3NHI A;  3I5F C;  3SG2 A;  1JF0 A;  1A29 A;  5D69 A;  3CZ1 A;  2LUX A;  3O78 A;  1UP5 A;  2TN4 A;  4HRE E;  4R1E A;  5PAL A;  1K96 A;  4GPL B;  2G9B A;  2K61 A;  2P6B B;  1GQM A;  3TDU A;  3JTD C;  1KK7 Y;  3RLZ A;  3WNX B;  1ZFS A;  3TDI A;  1UUR A;  4HRG A;  4F7F A;  3DVK A;  1CFD A;  1XYD A;  1YRU B;  2M97 A;  1J7Q A;  2NLN A;  1CMF A;  1BOD A;  1IRJ A;  3BXK A;  1G33 A;  4XJK A;  3F45 A;  1NCX A;  2MLF C;  1CTR A;  2OTG C;  3RZS A;  1OZO A;  1BLQ A;  2LM5 A;  4GGF C;  2M1U A;  1DGV A;  2ZNE A;  5D7F A;  1IWQ A;  5DKQ A;  1KFU S;  1OOH A;  1TNQ A;  4DCK A;  4PE7 A;  3BUN B;  1S36 A;  2Y1M A;  1PAL A;  2LUC A;  3HX4 A;  2BE6 A;  4IL1 A;  1AVS A;  1RRO A;  2LVK A;  4JD9 A;  1KQV A;  2I94 A;  4E68 A;  1W7J B;  1S6J A;  3NGV A;  3O6B A;  3H4S E;  2BCA A;  3B6X A;  1JF2 A;  1B47 A;  1NIW A;  1DQE A;  2PMY A;  4Q04 A;  3BUX B;  2ISD A;  4MRX A;  1TUJ A;  4ICB A;  1T14 A;  3WHU B;  2WCJ A;  1PVA A;  2QEH A;  3DXL A;  3JVT B;  2M3W A;  4MZK A;  1DTL A;  5AAN A;  1DJZ A;  1R6P A;  1QX5 B;  1M39 A;  2KI4 B;  2KI6 C;  5HKZ A;  3WHT B;  1REC A;  5K89 A;  1IQ5 A;  2K2F A;  1CB1 A;  1KK8 C;  2FOT A;  1K90 D;  2I7A A;  2WCK A;  1A03 A;  1N0Y A;  3GK4 X;  4ORC B;  1WRZ A;  1QX2 A;  4MSP A;  3AAJ A;  5HKW A;  4OVN F;  3BFH A;  2WCH A;  4PE0 A;  4QJ5 B;  1SR6 C;  4P5O E;  2E6W A;  4PE4 A;  1XFV O;  2QEB A;  2O60 A;  1KFX L;  1AUI B;  1L2O C;  1RTP 1;  1YX8 A;  1OMV A;  2GGM A;  1XK4 C;  2KGB C;  3CR2 A;  4YI8 A;  2P70 A;  5G08 A;  1YX7 A;  2LNK A;  3I5I B;  1OOI X;  4JPZ B;  2LMT A;  1JFK A;  2JNX A;  3EK8 A;  2HF5 A;  2WCE A;  5BPJ A;  1W7I B;  2M49 B;  2F3Z A;  1BR1 B;  1QTX A;  1SKT A;  1XFW O;  1EG3 A;  2B1U A;  1AJ4 A;  3D10 A;  2MBX A;  1CLM A;  1HQV A;  2H61 C;  2JQ6 A;  3FIA A;  3ZWH A;  3CR4 X;  4QJ4 B;  1CFF A;  4GBA A;  5HL1 A;  1TNP A;  4PHJ A;  1B7T Y;  2LC5 A;  1NWD A;  3FS7 A;  4PE1 A;  1WRK A;  3S0D A;  2DOQ A;  2OS8 B;  2G2B A;  1ALV A;  1YUR A;  2M7L A;  1QLS A;  5AXI A;  1F71 A;  5I8N A;  3WXA A;  1J7R A;  3QME A;  1MUX A;  1U5I B;  1QAT A;  3DF0 B;  4YGD B;  1LXF C;  3TS5 B;  4FTG A;  3VGO A;  3VRO A;  2JXL A;  1DVI A;  1CM1 A;  2ZN9 A;  3EVV A;  3PSR A;  5I2O A;  1D1O A;  1A4P A;  4ZCV A;  4AOM A;  4P2Y B;  1RK9 A;  2BCB A;  3SIB A;  1F54 A;  3D76 A;  3CR5 X;  3CTN A;  3IF7 A;  3K21 A;  3ICB A;  1G8I A;  3HCM A;  1CDL A;  1QX7 A;  1WDC B;  1LA3 A;  2MHH A;  2WCB A;  3BJH A;  3D77 A;  1TWO A;  3L4A A;  2H2K A;  1S3P A;  4DS7 A;  2Y4Q A;  2ZRS A;  2K2A A;  1IKU A;  2KLE A;  5HLV A;  1S1E A;  2BKH B;  1AJ5 A;  1K9K A;  2WCM A;  1S26 D;  2JPT A;  2VRG A;  3DYE A;  4MVF A;  1B1G A;  1C3Y A;  1Y1A A;  2CXJ A;  4MEW A;  4YGB B;  3CLN A;  3R1O A;  2MA2 A;  1Y0V H;  3KF9 A;  5I94 A;  3D73 A;  4MLW A;  2CBL A;  3SG5 A;  3KPX A;  1CMG A;  5FI7 A;  4MZL A;  1SCM B;  2K0J A;  1FBV A;  4OKH A;  1GM0 A;  3TUY C;  2AAO A;  5ER4 X;  3A8R A;  1LKJ A;  1XFX O;  1CLB A;  2SAS A;  1A2X A;  1M45 A;  2KBM A;  5DKN A;  2EC6 B;  1PRW A;  1PUL A;  4CPV A;  3NSO A;  2BL0 B;  5AFP A;  1BF5 A;  3V2L A;  1S5G Y;  1KSM A;  1IJ5 A;  1TCF A;  2R2I A;  2K60 A;  2KSP A;  1DJX A;  3FE6 A;  4UPG A;  1N65 A;  2BKI B;  3NSI A;  1WLM A;  1OZS A;  3CWG A;  2KQY A;  3CS1 A;  2JTZ A;  2JXC A;  5EL2 A;  2KI6 D;  3SJS A;  1XVJ A;  2LAN A;  2EGD A;  5GQQ C;  1J1E A;  1QV0 A;  1Z2C B;  3I5H B;  1XFU O;  1EG4 A;  4ORB B;  3NHT A;  4F0Z B;  3PAT A;  1EH2 A;  2ZN8 A;  1C7W A;  1B8C A;  3SS5 A;  1UHH A;  2SCP A;  1BR4 B;  2JOJ A;  2BE4 A;  1MHO A;  1UUS A;  3EVU A;  5CSJ A;  5HKY A;  1WLZ A;  1KQM B;  1NPQ A;  2QDI A;  1K95 A;  1LS8 A;  2LMU A;  1OOG A;  3K1E A;  3C1V A;  2HET A;  3PM8 A;  1Z4H A;  2K7C A;  1SY9 A;  4C0K A;  4WQ2 A;  1GGZ A;  1PSR A;  1NX3 A;  1S6I A;  2HQW A;  1BJF A;  1MQ1 A;  3DY9 A;  2KLD A;  2PAS A;  4I5N B;  4IJ7 A;  2MJW B;  3I5G C;  2KYF A;  4INX A;  4DIR A;  2WC8 A;  1FF1 A;  1RFJ A;  1IQ3 A;  3DVJ A;  2OPO A;  3TDZ A;  2CT9 A;  4I5K A;  5FYX A;  2KFG A;  1DEL A;  4A4C A;  2MRD A;  3FE9 A;  3O4Y A;  2NCO A;  2LE9 B;  5CSI A;  3VRP A;  3ZNI A;  1Y1U A;  4C0L A;  2BBM A;  3LK0 A;  3OB2 B;  2K7B A;  1KSO A;  1RJV A;  1UHJ A;  1OOF A;  2LLT A;  1IGV A;  2K7D A;  2V53 A;  3D75 A;  4PAL A;  1B8L A;  1WY9 A;  3SS3 A;  3L47 A;  2K8M B;  1QIW A;  3N7H A;  3MSE B;  2LP3 A;  3B7A A;  1F4O A;  1JC2 A;  3VRN A;  2GTE A;  3OGN A;  3PM2 A;  4GGF A;  1H4B A;  2E30 A;  1KFX S;  2L2C A;  1B9A A;  1OQP A;  5D3O A;  3SG7 A;  5I2Q A;  3PN7 B;  1W9Z A;  2KDH A;  3VRQ A;  2JZI A;  1SNL A;  2LP2 A;  1QWV A;  3PN7 C;  2F8P A;  2M7N A;  2H8V A;  1TIZ A;  1TRF A;  3OP0 A;  1SPY A;  1K8U A;  4TNC A;  4D1E A;  1YTZ C;  4BY5 A;  1S5G Z;  2JTT A;  1QVI Y;  1TN4 A;  4GFT A;  3QRX A;  1QAS A;  1EXR A;  1NX1 A;  3OHM B;  1S6C A;  3Q8I A;  1K9P A;  4USL A;  2PQL A;  1ZOT B;  5FI6 A;  2GV5 A;  1QS7 A;  3EVR A;  3IVT A;  2D8N A;  2JRF A;  2K7O A;  2M9G A;  4GAO A;  1JWD A;  1TUZ A;  3S0B A;  4MZJ A;  3KO0 A;  2PYQ A;  2L4H A;  1PVB A;  2KOT A;  1DJI A;  1P28 A;  1PSB A;  1YVH A;  1A75 B;  3OBV A;  3PAL A;  4FQT A;  4PHK A;  4OCI A;  4YBH B;  4ZCU A;  4CFQ A;  1DMO A;  1BT6 A;  2ZFD A;  3I5G B;  4JKT A;  1DJG A;  1H8B A;  4HSZ A;  3BOW B;  1DJW A;  3PJI A;  5DIC A;  3IQQ A;  3R1V A;  4PT1 A;  1YUT A;  2LHI A;  4NDB A;  2BEC A;  2A4J A;  1NUB A;  1VRK A;  2JU0 A;  3AKA A;  3D78 A;  2COL B;  2ERB A;  4YGA A;  4AQI A;  4BY4 A;  2AMI A;  4I5J A;  3EK7 A;  1FI6 A;  2WC6 A;  1XA5 A;  1ZMZ A;  3GK1 A;  1KQM C;  1M46 A;  1SW8 A;  1UHI A;  1JUO A;  1CNP A;  1XK4 A;  1GGW A;  1KFU L;  3KEV A;  3E3R A;  2CCM A;  1B7T Z;  2LHL A;  2KGR A;  1IIO A;  1TNW A;  1OE9 B;  1X02 A;  1MR8 A;  3I5H C;  5FI2 A;  2AUC A;  3CYZ A;  2KFF A;  2H61 A;  2JC2 A;  1OW4 A;  2KYC A;  1BG1 A;  2FJY A;  1TNX A;  2I18 A;  2IS9 A;  3CAB A;  4PHM A;  1M31 A;  2LLU A;  3EKH A;  2JUL A;  1FPW A;  1J55 A;  1K94 A;  2QAC A;  2BL0 C;  3BOW A; 
#chains in the Genus database with same CATH homology
 2EC6 C;  1V1G A;  3AKB A;  3OB1 B;  1CDP A;  1SRA A;  3IQO A;  4QJ3 B;  2HQ8 A;  1UHN A;  1NX0 A;  1QV1 A;  3OX5 A;  3TUY B;  2L50 A;  2KFH A;  2RGI A;  2JT0 A;  4GNK B;  1FW4 A;  1SYM A;  2MAZ A;  4U8D A;  2BBN A;  1SBJ A;  2LV7 A;  3FWC A;  1SCM C;  4PDZ A;  2KAX A;  5HYD A;  4YI9 A;  1J7P A;  2F2P A;  2FJU B;  3BQ3 A;  1K9U A;  3DF0 A;  1DJH A;  1IH0 A;  1OSA A;  3PFV A;  1YRT B;  2NXQ A;  2KHN A;  4N1G A;  1QVI Z;  5IBW A;  1EL4 A;  1CKK A;  3CZT X;  4GGN A;  2FCE A;  1K93 D;  1WDC C;  3O2P A;  4M2O A;  1IG5 A;  1R2U A;  1ZUZ A;  2Y5I A;  3GK2 A;  4YGC B;  4YRU A;  1GJY A;  4MN0 A;  4N1F A;  1AHR A;  1BU3 A;  1IJ6 A;  2LCP A;  2PRU A;  2ZRT A;  1DJY A;  1JSA A;  3OX6 A;  3LCP C;  5F6T A;  2JT8 A;  3M0W A;  1XFZ O;  1QIV A;  2PSR A;  4DRW A;  3LLE A;  2Q91 A;  4M2Q A;  4PCW A;  3TS5 C;  5KU1 A;  4NDC A;  3RM1 A;  1G4Y R;  2KQ6 A;  1XO5 A;  2LMV A;  1YUS A;  5I2L A;  1K2H A;  1HT9 A;  1QXP A;  2M29 A;  1U5I A;  4ORA B;  2OS8 C;  1LA0 A;  1NSH A;  1OMR A;  4PHN A;  4CID A;  1Q80 A;  1SL9 A;  1OOJ A;  5AER A;  2L0P A;  1E8A A;  3LK1 A;  5CSF A;  4XYN A;  1ZAC A;  3BUW B;  3NSL A;  1YVL A;  1AP4 A;  1DGU A;  1F8H A;  1C07 A;  5DKR A;  1A75 A;  1TCO B;  1TOP A;  2JNF A;  3EKJ A;  5JOL A;  1B4C A;  4YGE B;  1RWY A;  4I5L B;  2ZND A;  1TTX A;  2O5G A;  3NXA A;  5KSZ A;  1CFP A;  2L98 A;  3I5I C;  4JQ0 D;  4CLN A;  2GGZ A;  2BCX A;  1V1F A;  1J1D A;  1F55 A;  2JT3 A;  1L2O B;  1NX2 A;  4A4B A;  3SIA A;  5B8I B;  3BYA A;  1CLL A;  1SR6 B;  1CFC A;  2WND A;  1EJ3 A;  3A4U B;  1MXL C;  3NSK A;  2KAV A;  4AQJ A;  1SMG A;  1QJT A;  4MBE A;  5J3X A;  1ALW A;  2L4I A;  1KK8 B;  2FCD A;  1CDM A;  3AAK A;  4WRI A;  1UHK A;  1CDN A;  2M1K B;  4OR9 B;  1F70 A;  2KI4 C;  1FI5 A;  3GOF A;  1DF0 A;  3SG3 A;  3JVT C;  1YR5 A;  4C0J A;  1F4Q A;  1SL8 A;  4NQG A;  2M0R A;  1M63 B;  2PVB A;  2WOS A;  1YUU A;  3SG6 A;  3DD4 A;  1Y6W A;  2ZKM X;  3FWB A;  3D0Y B;  4GUK A;  2WOR A;  3BUM B;  4M2P A;  1C7V A;  4N5X A;  4JWQ A;  2CTN A;  5HLO A;  3KHE A;  1QLK A;  1NCZ A;  2F33 A;  1MXE A;  1NP8 A;  1DF0 B;  3BUO B;  1BOC A;  1JBA A;  2F2O A;  3LL8 B;  3DVE A;  1UWO A;  1BMO A;  1KCY A;  2L51 A;  2OTG B;  3PLF B;  1AK8 A;  1NCY A;  5TNC A;  3D0Y A;  4ETO A;  4DUQ A;  1NYA A;  4FQO A;  2CNP A;  2L2E A;  2LVI A;  5CPV A;  2HPS A;  2PAL A;  3DVM A;  1DT7 B;  3CGA A;  1XFY O;  2NZ0 A;  5ER5 A;  1SK6 D;  1MWN A;  3JTD B;  2Y1N A;  1OMD A;  4CFR A;  2LVV A;  2WCF A;  1L7Z A;  2KBI A;  5AEQ A;  1SCV A;  1JFJ A;  1N2D A;  5CSN A;  1J7O A;  1MF8 B;  2NCP A;  3I5F B;  4HRH A;  3VRR A;  1WRL A;  2KAY A;  2F3Y A;  2M8U A;  4XJK B;  4NDD A;  1KWO B;  2JWW A;  2LVJ A;  4L9M A;  4WQ3 A;  2KNE A;  4MRY A;  1LIN A;  2LAP A;  4OV2 A;  1ODB A;  1CM4 A;  1LVC D;  3EK4 A;  1B8R A;  2QPT A;  5JJG A;  1Y1X A;  2Q4U A;  1PK0 D;  2I2R E;  2MLE C;  1KWO C;  2L5X B;  3SG4 A;  5KTY A;  2LLS A;  1SL7 A;  1KK7 Z;  3TZ1 A;  2EHB A;  3I5F C;  3SG2 A;  1JF0 A;  1A29 A;  5D69 A;  3O78 A;  2LUX A;  1UP5 A;  2TN4 A;  4HRE E;  4R1E A;  5PAL A;  1K96 A;  4GPL B;  2G9B A;  2K61 A;  2P6B B;  1GQM A;  3TDU A;  3JTD C;  1KK7 Y;  3RLZ A;  3WNX B;  1ZFS A;  3TDI A;  1UUR A;  4HRG A;  3DVK A;  1CFD A;  1XYD A;  1YRU B;  2M97 A;  1J7Q A;  2NLN A;  1CMF A;  1BOD A;  1IRJ A;  3BXK A;  1G33 A;  4XJK A;  3F45 A;  1NCX A;  2MLF C;  1CTR A;  2OTG C;  1BLQ A;  1OZO A;  2LM5 A;  4GGF C;  2M1U A;  1DGV A;  2ZNE A;  5D7F A;  1IWQ A;  5DKQ A;  1KFU S;  1TNQ A;  4DCK A;  4PE7 A;  3BUN B;  1S36 A;  2Y1M A;  1PAL A;  2LUC A;  3HX4 A;  2BE6 A;  4IL1 A;  1AVS A;  1RRO A;  2LVK A;  1KQV A;  2I94 A;  4E68 A;  1W7J B;  1S6J A;  3O6B A;  3H4S E;  2BCA A;  4Q04 A;  1JF2 A;  1B47 A;  1NIW A;  2PMY A;  2ISD A;  3BUX B;  4MRX A;  4ICB A;  3WHU B;  1PVA A;  3JVT B;  2M3W A;  4MZK A;  1DTL A;  5AAN A;  1DJZ A;  1R6P A;  1QX5 B;  1M39 A;  2KI4 B;  2KI6 C;  5HKZ A;  3WHT B;  1REC A;  5K89 A;  1IQ5 A;  2K2F A;  1CB1 A;  1KK8 C;  2FOT A;  1K90 D;  2I7A A;  1A03 A;  1N0Y A;  3GK4 X;  4ORC B;  1WRZ A;  1QX2 A;  4MSP A;  3AAJ A;  5HKW A;  4OVN F;  4PE0 A;  4QJ5 B;  1SR6 C;  4P5O E;  2E6W A;  4PE4 A;  1XFV O;  2O60 A;  1KFX L;  1AUI B;  1L2O C;  1RTP 1;  1YX8 A;  1OMV A;  2GGM A;  1XK4 C;  2KGB C;  3CR2 A;  4YI8 A;  5G08 A;  1YX7 A;  2LNK A;  3I5I B;  4JPZ B;  2LMT A;  1JFK A;  2JNX A;  3EK8 A;  2HF5 A;  2WCE A;  5BPJ A;  1W7I B;  2M49 B;  2F3Z A;  1BR1 B;  1QTX A;  1SKT A;  1XFW O;  1EG3 A;  2B1U A;  1AJ4 A;  3D10 A;  2MBX A;  1CLM A;  1HQV A;  2H61 C;  2JQ6 A;  3FIA A;  3ZWH A;  3CR4 X;  4QJ4 B;  1CFF A;  4GBA A;  1TNP A;  4PHJ A;  1B7T Y;  2LC5 A;  1NWD A;  3FS7 A;  4PE1 A;  1WRK A;  2DOQ A;  2OS8 B;  2G2B A;  1ALV A;  1YUR A;  2M7L A;  1QLS A;  5AXI A;  1F71 A;  5I8N A;  3WXA A;  1J7R A;  1MUX A;  1U5I B;  1QAT A;  3DF0 B;  4YGD B;  1LXF C;  3TS5 B;  4FTG A;  3VGO A;  3VRO A;  2JXL A;  1DVI A;  1CM1 A;  2ZN9 A;  3EVV A;  3PSR A;  5I2O A;  1D1O A;  1A4P A;  4ZCV A;  4AOM A;  4P2Y B;  1RK9 A;  2BCB A;  3SIB A;  1F54 A;  3CR5 X;  3CTN A;  3IF7 A;  3K21 A;  3ICB A;  1G8I A;  3HCM A;  1CDL A;  1QX7 A;  1WDC B;  1LA3 A;  2MHH A;  2WCB A;  2H2K A;  1S3P A;  4DS7 A;  2Y4Q A;  2ZRS A;  2K2A A;  1IKU A;  5HLV A;  1S1E A;  2BKH B;  1AJ5 A;  1K9K A;  1S26 D;  2JPT A;  2VRG A;  4MVF A;  1B1G A;  1Y1A A;  2CXJ A;  4MEW A;  4YGB B;  3CLN A;  2MA2 A;  1Y0V H;  3KF9 A;  4MLW A;  2CBL A;  3SG5 A;  3KPX A;  1CMG A;  4MZL A;  1SCM B;  2K0J A;  1FBV A;  4OKH A;  3TUY C;  2AAO A;  5ER4 X;  3A8R A;  1LKJ A;  1XFX O;  1CLB A;  2SAS A;  1A2X A;  1M45 A;  2KBM A;  5DKN A;  2EC6 B;  1PRW A;  1PUL A;  4CPV A;  3NSO A;  2BL0 B;  5AFP A;  1S5G Y;  1KSM A;  1IJ5 A;  1TCF A;  2R2I A;  2KSP A;  1DJX A;  4UPG A;  1N65 A;  2BKI B;  3NSI A;  1WLM A;  1OZS A;  3CWG A;  2KQY A;  3CS1 A;  2JTZ A;  2JXC A;  2KI6 D;  3SJS A;  1XVJ A;  2LAN A;  2EGD A;  5GQQ C;  1J1E A;  1QV0 A;  3I5H B;  1XFU O;  1EG4 A;  4ORB B;  4F0Z B;  3PAT A;  1EH2 A;  2ZN8 A;  1C7W A;  1B8C A;  1UHH A;  2SCP A;  1BR4 B;  2JOJ A;  2BE4 A;  1MHO A;  1UUS A;  3EVU A;  5CSJ A;  5HKY A;  1WLZ A;  1KQM B;  1NPQ A;  1K95 A;  2LMU A;  3C1V A;  2HET A;  3PM8 A;  2K7C A;  1SY9 A;  4C0K A;  4WQ2 A;  1GGZ A;  1PSR A;  1NX3 A;  2HQW A;  1S6I A;  1BJF A;  1MQ1 A;  2PAS A;  4I5N B;  2MJW B;  3I5G C;  2KYF A;  4DIR A;  2WC8 A;  1FF1 A;  1RFJ A;  1IQ3 A;  3DVJ A;  2OPO A;  3TDZ A;  2CT9 A;  4I5K A;  5FYX A;  2KFG A;  4A4C A;  2MRD A;  5CSI A;  3O4Y A;  2NCO A;  2LE9 B;  3ZNI A;  3VRP A;  1Y1U A;  4C0L A;  2BBM A;  3LK0 A;  3OB2 B;  2K7B A;  1KSO A;  1RJV A;  1UHJ A;  2LLT A;  4PAL A;  1IGV A;  2K7D A;  2V53 A;  1B8L A;  1WY9 A;  2K8M B;  1QIW A;  3MSE B;  2LP3 A;  1F4O A;  1JC2 A;  3VRN A;  1H4B A;  4GGF A;  2E30 A;  1KFX S;  1B9A A;  1OQP A;  3SG7 A;  5I2Q A;  3PN7 B;  2KDH A;  3VRQ A;  2JZI A;  1SNL A;  2LP2 A;  3PN7 C;  2F8P A;  2M7N A;  1TIZ A;  1TRF A;  3OP0 A;  1SPY A;  1K8U A;  4TNC A;  4D1E A;  1YTZ C;  4BY5 A;  1S5G Z;  2JTT A;  1QVI Y;  1TN4 A;  4GFT A;  3QRX A;  1QAS A;  1EXR A;  1NX1 A;  3OHM B;  1S6C A;  1K9P A;  4USL A;  1ZOT B;  2GV5 A;  1QS7 A;  3EVR A;  2D8N A;  2JRF A;  2K7O A;  2M9G A;  4GAO A;  1JWD A;  4MZJ A;  3KO0 A;  2L4H A;  1PVB A;  2KOT A;  1DJI A;  1PSB A;  3PAL A;  1YVH A;  1A75 B;  4PHK A;  1BF5 A;  1DMO A;  4OCI A;  4YBH B;  4ZCU A;  4CFQ A;  1BT6 A;  2ZFD A;  3I5G B;  1DJG A;  1H8B A;  4HSZ A;  3BOW B;  1DJW A;  3IQQ A;  1YUT A;  2LHI A;  4NDB A;  2BEC A;  2A4J A;  1NUB A;  1VRK A;  2JU0 A;  3AKA A;  2COL B;  4BY4 A;  4YGA A;  4AQI A;  2AMI A;  4I5J A;  3EK7 A;  1FI6 A;  1XA5 A;  1ZMZ A;  3GK1 A;  1KQM C;  1M46 A;  1SW8 A;  1UHI A;  1JUO A;  1CNP A;  1XK4 A;  1GGW A;  1KFU L;  3KEV A;  3E3R A;  2CCM A;  1B7T Z;  2LHL A;  2KGR A;  1TNW A;  1OE9 B;  1X02 A;  1MR8 A;  3I5H C;  2AUC A;  2KFF A;  2H61 A;  2JC2 A;  2KYC A;  1BG1 A;  1TNX A;  2I18 A;  2IS9 A;  4PHM A;  1M31 A;  2LLU A;  3EKH A;  2JUL A;  1FPW A;  1J55 A;  1K94 A;  2QAC A;  2BL0 C;  3BOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...