1F70A

Refined solution structure of calmodulin n-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transport protein
molecule keywords CALMODULIN
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f70A00
1UWOA 1KSOA 3PLFB 1BG1A 3RLZA 1IQ5A 2JOJA 1SBJA 5HYDA 1MF8B 2M8UA 3DVMA 1AUIB 3EVRA 1PRWA 4BY4A 1C07A 2JNXA 1IQ3A 3EK8A 1K9KA 2K7CA 1KWOB 1EG4A 1YURA 2Y5IA 2BE6A 3BOWA 2WC8A 3BUWB 1XFUO 2KDHA 2CTNA 1H8BA 1SRAA 3SJSA 1EXRA 1S5GY 3O78A 1NCZA 2KGRA 1MQ1A 4PHKA 4YGEB 1J55A 1DF0B 1OQPA 5JOLA 2HPSA 1OZOA 5KU1A 1K93D 2LMUA 5DKNA 1RECA 3RM1A 1YTZC 5PALA 5I8NA 4GGFA 1NX0A 1WRZA 2K8MB 2F8PA 2BKIB 1QTXA 1DMOA 1DJXA 2WNDA 4NDBA 1F8HA 2JZIA 3D0YB 1LKJA 2EC6B 1ZMZA 3PATA 4USLA 2M29A 2H61A 3FIAA 1F70A 2LUXA 3I5GC 4GAOA 4C0JA 4GUKA 1Q80A 3AAJA 1N65A 2AMIA 1DT7B 2CT9A 2Q4UA 2JPTA 1YRUB 3EVUA 3SIBA 3GK1A 5ER4X 3SG6A 1AK8A 2F3ZA 2BCXA 2PMYA 4MRXA 4MRYA 1MWNA 2LVVA 2I94A 3EK7A 4M2OA 4NDDA 4HREE 2M1UA 1DF0A 4DCKA 2HQWA 2L50A 3E3RA 1NWDA 5HLOA 1AP4A 3OB2B 1G33A 4MSPA 4ZCVA 3GK2A 3LCPC 5CSJA 2NLNA 1BOCA 5HKWA 3OP0A 3IF7A 1IRJA 1IG5A 1WLMA 2CCMA 2ZNDA 1K90D 2COLB 4A4CA 1F4OA 2JU0A 1R2UA 1UHHA 3EK4A 1L2OB 3SG2A 5CSNA 1B8LA 1TIZA 1S36A 2QACA 2P6BB 4N1FA 4WQ3A 2ZRTA 2K0JA 3JTDC 2KBMA 4AOMA 3VRNA 1OE9B 1TN4A 1A2XA 3BXKA 1NCXA 1CM4A 2BCAA 5AANA 1JF2A 2KI6D 1SKTA 3PN7B 1S3PA 3KO0A 2JC2A 1TOPA 3I5FB 3DF0A 3ZWHA 1BODA 3CGAA 4MZKA 3KPXA 2L2EA 2OS8C 2G9BA 1DJGA 2M0RA 1QVIZ 1B7TY 1MHOA 1RK9A 5CSFA 1SCMC 1GQMA 1ZOTB 1GJYA 2PVBA 2ZN9A 3FWBA 1RWYA 1YX7A 1S26D 3TZ1A 3D10A 1JC2A 2SCPA 3BUMB 1QIVA 2M7LA 4DIRA 1CLMA 2AAOA 3TUYB 3BQ3A 3HCMA 1QV1A 2JXCA 1XO5A 2KHNA 4JQ0D 5AERA 1XK4C 4ORBB 2FCEA 1L7ZA 1ALWA 2PALA 1K9PA 1SYMA 2LV7A 2LAPA 3NXAA 3TDZA 1KK7Y 2OS8B 1SR6C 1CTRA 1F71A 1AVSA 2EHBA 1LINA 4CFRA 4P5OE 1JUOA 4I5NB 1RTP1 1CDPA 3QRXA 1UHKA 2RGIA 1F54A 2ZKMX 2OPOA 2F2OA 1PVAA 1S6CA 4YGCB 3CWGA 1FPWA 2LM5A 1PSRA 1YVHA 5GQQC 1DJHA 3ICBA 3CR5X 2ISDA 3F45A 2OTGC 1OOJA 2H2KA 3NSOA 1OMRA 2F3YA 5HKYA 4QJ5B 2AUCA 1AHRA 1L2OC 1QX7A 1YX8A 4U8DA 3M0WA 2B1UA 1ALVA 1CLBA 1M39A 4R1EA 1UHJA 2FCDA 3DF0B 1Y6WA 1CMGA 2JQ6A 4PHMA 1G8IA 2BBMA 2LLUA 1TCOB 2D8NA 2Y1MA 4A4BA 1J1EA 2JXLA 1W7IB 3WXAA 3PFVA 2QPTA 4E68A 1CDLA 4IL1A 4BY5A 2NZ0A 3SIAA 1OSAA 5CSIA 1NSHA 4ORCB 3TUYC 2LCPA 5J3XA 3TDUA 1J7PA 3LL8B 5F6TA 2CBLA 1BJFA 4PHNA 4GFTA 2H61C 1CLLA 2VRGA 3I5GB 2KAVA 2LNKA 3I5HB 3CLNA 5ER5A 2BL0C 1XFVO 4P2YB 2F2PA 2KNEA 1W7JB 2WCBA 1PSBA 1SK6D 2HQ8A 4YI8A 1CFCA 2PSRA 2KI4B 1J1DA 4DUQA 1CFDA 4OKHA 1UHIA 3PSRA 1FF1A 1XFZO 3AAKA 1SY9A 1G4YR 1VRKA 3OB1B 2IS9A 1K96A 1JSAA 2KQYA 3OX6A 4MBEA 4MEWA 3I5HC 4CIDA 4YRUA 2L5XB 1DTLA 1XK4A 5G08A 2BECA 2LHLA 2BE4A 1SMGA 2I2RE 4ETOA 4M2QA 1N0YA 2I7AA 2LVKA 1KK8B 1XFWO 1B8RA 2M3WA 3PALA 3LLEA 2LMTA 1C7WA 1JWDA 1ODBA 2M1KB 2R2IA 1NX3A 2ZFDA 1IGVA 4MZLA 3VGOA 1FI6A 1NX2A 2EC6C 2L98A 2V53A 1E8AA 2L4HA 3EVVA 1BR4B 1HQVA 2JNFA 1GGWA 4MN0A 3DVEA 2LLTA 4YBHB 1NUBA 1KFXS 1SL8A 3NSKA 1TRFA 5AXIA 1CDMA 4Q04A 1QX5B 1AJ4A 4I5LB 4YI9A 1QIWA 1DVIA 2KBIA 2KI6C 2JWWA 1B1GA 1KQMC 4GGNA 1UUSA 4C0LA 1B4CA 1M31A 3CR2A 2MA2A 1J7OA 1SL9A 1QASA 2MJWB 4PE7A 1XA5A 1K9UA 2JRFA 2WOSA 1YUUA 3AKAA 1XVJA 2GGZA 4UPGA 3PM8A 1BLQA 1EJ3A 1C7VA 3A4UB 2PRUA 2LMVA 4QJ4B 2KOTA 3HX4A 2L0PA 1K94A 3H4SE 5JJGA 1SW8A 3PN7C 1LXFC 2KYCA 4C0KA 5KTYA 2FOTA 2LVIA 5IBWA 1JFJA 1KWOC 2M9GA 2KAXA 2L4IA 1SPYA 2MLFC 2M49B 2K7BA 1M46A 1JBAA 2K2AA 3VRPA 3TS5C 1QLKA 4FTGA 1KK7Z 1EL4A 4QJ3B 4PHJA 2HF5A 1H4BA 3SG4A 3O6BA 5BPJA 2FJUB 1YUTA 3EKJA 1FI5A 1A4PA 2KFGA 3BOWB 1IJ6A 2E30A 2TN4A 4JWQA 3ZNIA 2LUCA 2KYFA 4GGFC 4JPZB 1FW4A 1KFXL 1LVCD 1ZACA 3K21A 2PASA 2ZN8A 1ZFSA 1DJYA 4I5KA 1B7TZ 4WRIA 1QVIY 1BT6A 4I5JA 1SNLA 3DVKA 1WDCB 2KQ6A 2JTTA 4XJKB 1DGVA 1NYAA 1D1OA 5D7FA 3DD4A 4YGDB 4CLNA 3D0YA 3I5IC 4HRGA 1IKUA 1WRKA 5TNCA 2M97A 3CTNA 5HKZA 3OX5A 1TNWA 3SG3A 1V1GA 3AKBA 3BUNB 4PCWA 1BR1B 1YR5A 2K2FA 2L51A 4AQJA 1A03A 1KSMA 1B8CA 3IQOA 1NX1A 2SASA 3LK0A 1SL7A 1NP8A 1SCVA 3MSEB 3WHTB 3OHMB 1A29A 1A75B 4XJKA 4YGBB 1LA3A 2OTGB 4PE1A 3SG7A 2A4JA 1J7QA 1KQVA 1K2HA 4M2PA 2BCBA 1DJWA 2WCEA 5DKRA 1QATA 1WLZA 1TNPA 4ICBA 4NDCA 3BYAA 3CR4X 1B9AA 2KAYA 5HLVA 2NXQA 5K89A 2ZRSA 2MAZA 3CS1A 1S6JA 1V1FA 5I2OA 3WNXB 1A75A 1K8UA 2WCFA 1UURA 2KGBC 1RFJA 1BMOA 1TCFA 3I5FC 4GBAA 4DRWA 1WY9A 2LE9B 3WHUB 5AFPA 1TNXA 1KK8C 1PK0D 3KEVA 3NSLA 3GOFA 2EGDA 2E6WA 1SCMB 2Q91A 3JTDB 4MVFA 1Y1AA 1KFUL 1IH0A 1BF5A 5FYXA 2KFHA 2M7NA 2CXJA 2LLSA 1M45A 3JVTC 1MUXA 3VROA 4ZCUA 1CFFA 1F55A 2JULA 2BKHB 2HETA 3I5IB 4OV2A 1CFPA 1U5IB 1UHNA 1QXPA 1YRTB 2KI4C 2I18A 2WORA 1S5GZ 1TNQA 4CFQA 1WDCC 2JT0A 2BL0B 1OZSA 2K7OA 2GGMA 4TNCA 3KHEA 3A8RA 1B47A 3CZTX 3KF9A 1EG3A 3JVTB 4ORAB 3BUOB 4PDZA 1RROA 1CKKA 1NIWA 3VRRA 1N2DA 3SG5A 4WQ2A 3TDIA 1OMVA 1JFKA 1QV0A 4PE0A 1KCYA 1SR6B 1PVBA 1MXLC 3NSIA 1RJVA 1CDNA 2KFFA 2NCOA 5I2LA 1F4QA 3TS5B 1YVLA 4GPLB 3EKHA 2ZNEA 1R6PA 5CPVA 1TTXA 2LC5A 2F33A 4CPVA 4GNKB 2MHHA 1IJ5A 4HRHA 1XFYO 1XFXO 3LK1A 2G2BA 1NCYA 2Y1NA 1WRLA 1Y1XA 4N5XA 2KSPA 2CNPA 4NQGA 5AEQA 1PULA 1YUSA 2MLEC 1QLSA 1MXEA 1M63B 1FBVA 1KFUS 1XYDA 1Y1UA 4XYNA 1CNPA 4OR9B 4PE4A 2Y4QA 1PALA 1UP5A 2LHIA 2O5GA 1GGZA 1CB1A 1K95A 2MBXA 1HT9A 2BBNA 2LVJA 3O2PA 5D69A 3GK4X 3DVJA 2JTZA 3BUXB 1S6IA 2K61A 1KQMB 1EH2A 4DS7A 3C1VA 1DGUA 2JT8A 1QS7A 2MRDA 1U5IA 3O4YA 2LP2A 1BU3A 5B8IB 4AQIA 4HSZA 1CM1A 1AJ5A 1MR8A 3FS7A 4YGAA 4D1EA 5DKQA 1ZUZA 1LA0A 3VRQA 4MLWA 1X02A 4MZJA 5KSZA 4OVNF 1Y0VH 1JF0A 4N1GA 2O60A 2LP3A 3FWCA 3IQQA 2LANA 1IWQA 5I2QA 1NPQA 1OMDA 2JT3A 1S1EA 2DOQA 4L9MA 4FQOA 1CMFA 1J7RA 4F0ZB 1DJIA 1DJZA 1QJTA 2K7DA 4PALA 1QX2A 2GV5A 4OCIA 2NCPA
chains in the Genus database with same CATH superfamily
1UWOA 1KSOA 3PLFB 1BG1A 3RLZA 3DXLA 1IQ5A 2JOJA 1SBJA 5HYDA 1MF8B 2M8UA 3DVMA 5FI7A 1AUIB 3EVRA 1PRWA 3FE6A 5FI6A 4BY4A 1C07A 2JNXA 2KPHA 1IQ3A 3EK8A 1K9KA 2K7CA 1KWOB 1EG4A 1YURA 3CABA 2Y5IA 2BE6A 3BOWA 2WC8A 3BUWB 3PM2A 1XFUO 2KDHA 2CTNA 1H8BA 1SRAA 3SJSA 1EXRA 1S5GY 3O78A 1NCZA 2KGRA 1MQ1A 4PHKA 4YGEB 1ORGA 1J55A 1DF0B 1OQPA 5JOLA 2HPSA 1OZOA 5KU1A 1K93D 2LMUA 5DKNA 1RECA 3SS3A 3RM1A 1YTZC 5PALA 5I8NA 4GGFA 1NX0A 1WRZA 2K8MB 2F8PA 2BKIB 1QTXA 1DMOA 1DJXA 2WNDA 4NDBA 1F8HA 2JZIA 3D0YB 1LKJA 2EC6B 3B7AA 3BFBA 1ZMZA 3PATA 4USLA 2M29A 2H61A 3FIAA 1F70A 2LUXA 3I5GC 4GAOA 4C0JA 4GUKA 1Q80A 3AAJA 1N65A 2AMIA 1DT7B 2CT9A 2Q4UA 2JPTA 3NGVA 1YRUB 3EVUA 5FI2A 3SIBA 3GK1A 5ER4X 3SG6A 3BJHA 2F3ZA 2BCXA 2PMYA 4MRXA 1AK8A 4MRYA 1MWNA 2LVVA 2I94A 3EK7A 4M2OA 4NDDA 4HREE 2M1UA 1DF0A 4DCKA 2HQWA 2L50A 3E3RA 1NWDA 5HLOA 1AP4A 3OB2B 1G33A 3B88A 4MSPA 4ZCVA 3GK2A 3LCPC 5CSJA 2NLNA 1BOCA 5HKWA 3B87A 3OP0A 1IIOA 3IF7A 1IRJA 1IG5A 1WLMA 2CCMA 2ZNDA 1K90D 2PYQA 4JD9A 2COLB 4A4CA 1F4OA 2JU0A 1R2UA 1UHHA 3EK4A 1L2OB 1Z2CB 3S0GA 3SG2A 5CSNA 1B8LA 1TIZA 1S36A 2QACA 4INWA 2P6BB 4N1FA 4WQ3A 2ZRTA 2K0JA 3JTDC 2KBMA 4AOMA 3VRNA 1OE9B 1TN4A 1A2XA 3BXKA 1NCXA 1CM4A 2BCAA 5AANA 1JF2A 2KI6D 1SKTA 3PN7B 1S3PA 3KO0A 2JC2A 1TOPA 3I5FB 3DF0A 3ZWHA 1BODA 3CGAA 4MZKA 3KPXA 2L2EA 1W9ZA 2OS8C 2G9BA 1DJGA 2M0RA 1QVIZ 1B7TY 1MHOA 2P70A 1RK9A 5CSFA 1SCMC 1GQMA 1ZOTB 1GJYA 1DEKA 2PVBA 2ZN9A 3FWBA 1YX7A 1RWYA 1TWOA 1S26D 3TZ1A 3D10A 1JC2A 2SCPA 3BUMB 1QIVA 2M7LA 1P28A 4DIRA 1CLMA 2AAOA 5D3OA 3TUYB 3BQ3A 3HCMA 1QV1A 2JXCA 1XO5A 2KHNA 4JQ0D 5AERA 1XK4C 4ORBB 2FCEA 1L7ZA 1ALWA 3B6XA 2PALA 2H8VA 1K9PA 1SYMA 2LV7A 2LAPA 3D75A 3NXAA 3TDZA 1KK7Y 2OS8B 1SR6C 2KLEA 3D76A 4OZDA 1CTRA 1F71A 1AVSA 2EHBA 1LINA 4CFRA 4P5OE 1JUOA 4I5NB 1RTP1 1CDPA 3QRXA 1UHKA 1C3YA 2RGIA 1F54A 2ZKMX 2OPOA 2F2OA 3S0EA 1PVAA 1S6CA 4YGCB 3CWGA 2BAPA 1FPWA 2LM5A 1PSRA 1YVHA 5GQQC 1DJHA 3ICBA 3CR5X 2ISDA 3F45A 2OTGC 1OOJA 2H2KA 3S0DA 3NSOA 1OMRA 3B86A 2F3YA 5HKYA 4QJ5B 2AUCA 1AHRA 1L2OC 1QX7A 1YX8A 4U8DA 3M0WA 2B1UA 1ALVA 1CLBA 1M39A 4R1EA 1UHJA 2FCDA 3PJIA 3SS4A 3DF0B 1Y6WA 1CMGA 2JQ6A 4PHMA 1G8IA 2BBMA 2LLUA 1TCOB 1QWVA 2D8NA 2WCJA 2Y1MA 4A4BA 1J1EA 2JXLA 1W7IB 4JKTA 3WXAA 3PFVA 2QPTA 4E68A 1CDLA 1OOGA 4IL1A 4BY5A 2ERBA 2NZ0A 3SIAA 1OSAA 5CSIA 1NSHA 4ORCB 3D73A 3D74A 2LCPA 3TUYC 5J3XA 3TDUA 1J7PA 3LL8B 2QEHA 5F6TA 1C3ZA 2CBLA 1BJFA 4IJ7A 4PHNA 4GFTA 3IVTA 2WCKA 2H61C 1CLLA 2VRGA 3I5GB 2KAVA 3L4LA 2LNKA 3I5HB 3CLNA 5ER5A 2BL0C 3D77A 1XFVO 4P2YB 1XFRA 2F2PA 2KNEA 1W7JB 2WCBA 1PSBA 1SK6D 2HQ8A 4YI8A 1CFCA 2PSRA 3EG5B 2KI4B 3V2LA 1J1DA 4DUQA 1CFDA 4OKHA 1UHIA 3PSRA 1FF1A 1TUJA 1XFZO 3AAKA 1SY9A 4FQTA 1G4YR 3DYEA 1VRKA 3OB1B 2IS9A 1K96A 1JSAA 1OW4A 2KQYA 3OX6A 4MBEA 4MEWA 3I5HC 4CIDA 4YRUA 2L5XB 1DTLA 1XK4A 5G08A 2BECA 4INXA 2LHLA 2BE4A 1SMGA 3UO9A 2I2RE 4ETOA 4M2QA 4F7FA 1N0YA 2I7AA 2LVKA 1KK8B 1XFWO 1B8RA 2M3WA 3PALA 3LLEA 2LMTA 1C7WA 3K1EA 1ODBA 2M1KB 2R2IA 3VB1A 1JWDA 1NX3A 2ZFDA 1IGVA 4MZLA 3VGOA 1FI6A 1NX2A 2EC6C 3Q8IA 2L98A 2V53A 1E8AA 2L4HA 3EVVA 5I94A 1BR4B 1HQVA 2JNFA 1GGWA 4MN0A 3O4XA 3DVEA 2LLTA 4YBHB 1NUBA 1KFXS 1DQEA 1SL8A 3L4AA 3NSKA 1TRFA 3QMEA 1CDMA 2GTEA 5AXIA 4Q04A 1QX5B 1AJ4A 4I5LB 4YI9A 1QIWA 1DVIA 2KBIA 2KI6C 3R1OA 2JWWA 1B1GA 1KQMC 4GGNA 1UUSA 2YGUA 4C0LA 1B4CA 2L5YA 1M31A 3CR2A 3BFAA 3BFHA 2MA2A 1J7OA 1SL9A 1QASA 3S0FA 2MJWB 4PE7A 1XA5A 2WCMA 1K9UA 2JRFA 2WOSA 1YUUA 3AKAA 1XVJA 2GGZA 3CZ2A 3PM8A 4UPGA 1EJ3A 1BLQA 1C7VA 3A4UB 2PRUA 2LMVA 4QJ4B 2KOTA 3HX4A 2L0PA 1K94A 5DICA 3H4SE 2L2CA 5JJGA 1SW8A 3PN7C 1LXFC 2KYCA 4C0KA 5KTYA 2FOTA 2LVIA 5IBWA 1SSEB 1KWOC 2M9GA 1JFJA 2KAXA 2L4IA 1SPYA 2MLFC 2M49B 2K7BA 1M46A 1JBAA 2K2AA 3VRPA 3TS5C 1QLKA 4FTGA 1KK7Z 1EL4A 4QJ3B 4PHJA 2HF5A 1H4BA 3SG4A 3O6BA 1DELA 5BPJA 2FJUB 1YUTA 3EKJA 1FI5A 1A4PA 2KFGA 3BOWB 1IJ6A 2E30A 1GM0A 2TN4A 4JWQA 3ZNIA 2LUCA 2KYFA 4GGFC 4JPZB 2QEOA 1FW4A 1KFXL 1LVCD 1ZACA 3K21A 2PASA 2ZN8A 1ZFSA 3FE9A 1DJYA 4I5KA 1B7TZ 4WRIA 1QVIY 1BT6A 4I5JA 1SNLA 3DVKA 1WDCB 2KQ6A 2JTTA 4XJKB 1DGVA 1NYAA 1D1OA 5D7FA 3DD4A 4YGDB 4CLNA 3D0YA 3I5IC 4HRGA 1IKUA 1WRKA 5TNCA 2M97A 3CTNA 1OOFA 5HKZA 3OX5A 2K60A 1TNWA 3SG3A 1V1GA 3AKBA 3BUNB 4PCWA 1BR1B 1YR5A 2K2FA 2L51A 4AQJA 1A03A 1KSMA 3DZTA 1B8CA 3IQOA 1NX1A 2SASA 3LK0A 1SL7A 1NP8A 1SCVA 3MSEB 3WHTB 3OHMB 1A29A 2WC6A 1A75B 4XJKA 4YGBB 1LA3A 2OTGB 4PE1A 3SG7A 2A4JA 1J7QA 1KQVA 1K2HA 4M2PA 2BCBA 1DJWA 2WCEA 5DKRA 1QATA 1WLZA 1TNPA 2PQLA 3R1PA 4ICBA 4NDCA 3BYAA 3CR4X 1B9AA 2KAYA 5HLVA 2NXQA 5K89A 2ZRSA 2MAZA 3CS1A 1S6JA 1V1FA 3DY9A 3R1VA 5I2OA 3L47A 3WNXB 1A75A 1K8UA 2WCFA 1Z4HA 1UURA 2KGBC 1RFJA 1BMOA 1TCFA 3I5FC 4GBAA 4DRWA 1WY9A 2LE9B 3S0AA 3WHUB 5AFPA 1TNXA 1KK8C 1PK0D 3KEVA 3NSLA 3GOFA 2EGDA 2E6WA 1SCMB 2Q91A 3JTDB 4MVFA 1T14A 1Y1AA 1KFUL 1IH0A 1BF5A 5FYXA 2KFHA 4KYNA 2M7NA 2CXJA 2LLSA 1M45A 3JVTC 1MUXA 3VROA 4ZCUA 1CFFA 1OOIX 1F55A 2JULA 2BKHB 2HETA 3I5IB 4OV2A 1CFPA 1U5IB 1UHNA 1QXPA 1YRTB 2KI4C 2I18A 2KLDA 1S5GZ 1TNQA 2WORA 4CFQA 2BNXA 1WDCC 3N7HA 2JT0A 2P71A 2BL0B 3CYZA 1OZSA 2K7OA 2GGMA 4TNCA 3KHEA 3A8RA 1B47A 3CZTX 3KF9A 1EG3A 3JVTB 4ORAB 3BUOB 4PDZA 1RROA 1CKKA 1NIWA 3VRRA 1N2DA 3SG5A 1OOHA 4WQ2A 3TDIA 1OMVA 1JFKA 2QDIA 1QV0A 4PE0A 1KCYA 1SR6B 1PVBA 1MXLC 3NSIA 1RJVA 1CDNA 2KFFA 3CZ1A 2NCOA 3NHIA 1F4QA 5I2LA 3TS5B 1YVLA 4GPLB 3EKHA 3OGNA 2ZNEA 1R6PA 5CPVA 1TTXA 2LC5A 2F33A 4CPVA 4GNKB 2MHHA 1IJ5A 4HRHA 1XFYO 1XFXO 3LK1A 2G2BA 2QEVA 1NCYA 1LS8A 2Y1NA 1WRLA 1Y1XA 5HL1A 4N5XA 2KSPA 2CNPA 2JPOA 4NQGA 5AEQA 1PULA 3RZSA 1YUSA 2MLEC 1QLSA 1MXEA 1M63B 1FBVA 1KFUS 1XYDA 1Y1UA 2FJYA 4XYNA 4OR9B 4PE4A 1CNPA 2WCHA 2Y4QA 1PALA 1UP5A 2LHIA 2O5GA 1GGZA 1CB1A 3CZ0A 1K95A 2MBXA 1HT9A 2BBNA 2WC5A 2LVJA 3O2PA 3UNWA 1TUZA 5D69A 3SS5A 3GK4X 3DVJA 2JTZA 3R72A 3BUXB 1S6IA 2K61A 1KQMB 1EH2A 4DS7A 3CDNA 3C1VA 1DGUA 2JT8A 1QS7A 2MRDA 1U5IA 3O4YA 2LP2A 1BU3A 5B8IB 1DC1A 3S0BA 4AQIA 3FE8A 4HSZA 3D78A 1CM1A 1AJ5A 1MR8A 3FS7A 4YGAA 4D1EA 3NHTA 5DKQA 1ZUZA 1LA0A 2WCLA 4MLWA 5EL2A 1X02A 3VRQA 4MZJA 5KSZA 4OVNF 1Y0VH 1JF0A 4N1GA 2O60A 2LP3A 3FWCA 3IQQA 4PT1A 2LANA 2QEBA 1IWQA 5I2QA 1NPQA 1OMDA 2JT3A 1S1EA 2DOQA 4L9MA 4FQOA 1CMFA 1J7RA 3OBVA 4F0ZB 1DJIA 1DJZA 1QJTA 2K7DA 4PALA 1QX2A 2GV5A 4OCIA 2NCPA
chains in the Genus database with same CATH topology
1UWOA 1KSOA 3PLFB 1BG1A 3RLZA 1IQ5A 2JOJA 1SBJA 5HYDA 1MF8B 2M8UA 3DVMA 1AUIB 3EVRA 1PRWA 4BY4A 1C07A 2JNXA 1IQ3A 3EK8A 1K9KA 2K7CA 1KWOB 1EG4A 1YURA 2Y5IA 2BE6A 3BOWA 2WC8A 3BUWB 1XFUO 2KDHA 2CTNA 1H8BA 1SRAA 3SJSA 1EXRA 1S5GY 3O78A 1NCZA 2KGRA 1MQ1A 4PHKA 4YGEB 1J55A 1DF0B 1OQPA 5JOLA 2HPSA 1OZOA 5KU1A 1K93D 2LMUA 5DKNA 1RECA 3RM1A 1YTZC 5PALA 5I8NA 4GGFA 1NX0A 1WRZA 2K8MB 2F8PA 2BKIB 1QTXA 1DMOA 1DJXA 2WNDA 4NDBA 1F8HA 2JZIA 3D0YB 1LKJA 2EC6B 1ZMZA 3PATA 4USLA 2M29A 2H61A 3FIAA 1F70A 2LUXA 3I5GC 4GAOA 4C0JA 4GUKA 1Q80A 3AAJA 1N65A 2AMIA 1DT7B 2CT9A 2Q4UA 2JPTA 1YRUB 3EVUA 3SIBA 3GK1A 5ER4X 3SG6A 1AK8A 2F3ZA 2BCXA 2PMYA 4MRXA 4MRYA 1MWNA 2LVVA 2I94A 3EK7A 4M2OA 4NDDA 4HREE 2M1UA 1DF0A 4DCKA 2HQWA 2L50A 3E3RA 1NWDA 5HLOA 1AP4A 3OB2B 1G33A 4MSPA 4ZCVA 3GK2A 3LCPC 5CSJA 2NLNA 1BOCA 5HKWA 3OP0A 3IF7A 1IRJA 1IG5A 1WLMA 2CCMA 2ZNDA 1K90D 2COLB 4A4CA 1F4OA 2JU0A 1R2UA 1UHHA 3EK4A 1L2OB 3SG2A 5CSNA 1B8LA 1TIZA 1S36A 2QACA 2P6BB 4N1FA 4WQ3A 2ZRTA 2K0JA 3JTDC 2KBMA 4AOMA 3VRNA 1OE9B 1TN4A 1A2XA 3BXKA 1NCXA 1CM4A 2BCAA 5AANA 1JF2A 2KI6D 1SKTA 3PN7B 1S3PA 3KO0A 2JC2A 1TOPA 3I5FB 3DF0A 3ZWHA 1BODA 3CGAA 4MZKA 3KPXA 2L2EA 2OS8C 2G9BA 1DJGA 2M0RA 1QVIZ 1B7TY 1MHOA 1RK9A 5CSFA 1SCMC 1GQMA 1ZOTB 1GJYA 2PVBA 2ZN9A 3FWBA 1RWYA 1YX7A 1S26D 3TZ1A 3D10A 1JC2A 2SCPA 3BUMB 1QIVA 2M7LA 4DIRA 1CLMA 2AAOA 3TUYB 3BQ3A 3HCMA 1QV1A 2JXCA 1XO5A 2KHNA 4JQ0D 5AERA 1XK4C 4ORBB 2FCEA 1L7ZA 1ALWA 2PALA 1K9PA 1SYMA 2LV7A 2LAPA 3NXAA 3TDZA 1KK7Y 2OS8B 1SR6C 1CTRA 1F71A 1AVSA 2EHBA 1LINA 4CFRA 4P5OE 1JUOA 4I5NB 1RTP1 1CDPA 3QRXA 1UHKA 2RGIA 1F54A 2ZKMX 2OPOA 2F2OA 1PVAA 1S6CA 4YGCB 3CWGA 1FPWA 2LM5A 1PSRA 1YVHA 5GQQC 1DJHA 3ICBA 3CR5X 2ISDA 3F45A 2OTGC 1OOJA 2H2KA 3NSOA 1OMRA 2F3YA 5HKYA 4QJ5B 2AUCA 1AHRA 1L2OC 1QX7A 1YX8A 4U8DA 3M0WA 2B1UA 1ALVA 1CLBA 1M39A 4R1EA 1UHJA 2FCDA 3DF0B 1Y6WA 1CMGA 2JQ6A 4PHMA 1G8IA 2BBMA 2LLUA 1TCOB 2D8NA 2Y1MA 4A4BA 1J1EA 2JXLA 1W7IB 3WXAA 3PFVA 2QPTA 4E68A 1CDLA 4IL1A 4BY5A 2NZ0A 3SIAA 1OSAA 5CSIA 1NSHA 4ORCB 3TUYC 2LCPA 5J3XA 3TDUA 1J7PA 3LL8B 5F6TA 2CBLA 1BJFA 4PHNA 4GFTA 2H61C 1CLLA 2VRGA 3I5GB 2KAVA 2LNKA 3I5HB 3CLNA 5ER5A 2BL0C 1XFVO 4P2YB 2F2PA 2KNEA 1W7JB 2WCBA 1PSBA 1SK6D 2HQ8A 4YI8A 1CFCA 2PSRA 2KI4B 1J1DA 4DUQA 1CFDA 4OKHA 1UHIA 3PSRA 1FF1A 1XFZO 3AAKA 1SY9A 1G4YR 1VRKA 3OB1B 2IS9A 1K96A 1JSAA 2KQYA 3OX6A 4MBEA 4MEWA 3I5HC 4CIDA 4YRUA 2L5XB 1DTLA 1XK4A 5G08A 2BECA 2LHLA 2BE4A 1SMGA 2I2RE 4ETOA 4M2QA 1N0YA 2I7AA 2LVKA 1KK8B 1XFWO 1B8RA 2M3WA 3PALA 3LLEA 2LMTA 1C7WA 1JWDA 1ODBA 2M1KB 2R2IA 1NX3A 2ZFDA 1IGVA 4MZLA 3VGOA 1FI6A 1NX2A 2EC6C 2L98A 2V53A 1E8AA 2L4HA 3EVVA 1BR4B 1HQVA 2JNFA 1GGWA 4MN0A 3DVEA 2LLTA 4YBHB 1NUBA 1KFXS 1SL8A 3NSKA 1TRFA 5AXIA 1CDMA 4Q04A 1QX5B 1AJ4A 4I5LB 4YI9A 1QIWA 1DVIA 2KBIA 2KI6C 2JWWA 1B1GA 1KQMC 4GGNA 1UUSA 4C0LA 1B4CA 1M31A 3CR2A 2MA2A 1J7OA 1SL9A 1QASA 2MJWB 4PE7A 1XA5A 1K9UA 2JRFA 2WOSA 1YUUA 3AKAA 1XVJA 2GGZA 4UPGA 3PM8A 1BLQA 1EJ3A 1C7VA 3A4UB 2PRUA 2LMVA 4QJ4B 2KOTA 3HX4A 2L0PA 1K94A 3H4SE 5JJGA 1SW8A 3PN7C 1LXFC 2KYCA 4C0KA 5KTYA 2FOTA 2LVIA 5IBWA 1JFJA 1KWOC 2M9GA 2KAXA 2L4IA 1SPYA 2MLFC 2M49B 2K7BA 1M46A 1JBAA 2K2AA 3VRPA 3TS5C 1QLKA 4FTGA 1KK7Z 1EL4A 4QJ3B 4PHJA 2HF5A 1H4BA 3SG4A 3O6BA 5BPJA 2FJUB 1YUTA 3EKJA 1FI5A 1A4PA 2KFGA 3BOWB 1IJ6A 2E30A 2TN4A 4JWQA 3ZNIA 2LUCA 2KYFA 4GGFC 4JPZB 1FW4A 1KFXL 1LVCD 1ZACA 3K21A 2PASA 2ZN8A 1ZFSA 1DJYA 4I5KA 1B7TZ 4WRIA 1QVIY 1BT6A 4I5JA 1SNLA 3DVKA 1WDCB 2KQ6A 2JTTA 4XJKB 1DGVA 1NYAA 1D1OA 5D7FA 3DD4A 4YGDB 4CLNA 3D0YA 3I5IC 4HRGA 1IKUA 1WRKA 5TNCA 2M97A 3CTNA 5HKZA 3OX5A 1TNWA 3SG3A 1V1GA 3AKBA 3BUNB 4PCWA 1BR1B 1YR5A 2K2FA 2L51A 4AQJA 1A03A 1KSMA 1B8CA 3IQOA 1NX1A 2SASA 3LK0A 1SL7A 1NP8A 1SCVA 3MSEB 3WHTB 3OHMB 1A29A 1A75B 4XJKA 4YGBB 1LA3A 2OTGB 4PE1A 3SG7A 2A4JA 1J7QA 1KQVA 1K2HA 4M2PA 2BCBA 1DJWA 2WCEA 5DKRA 1QATA 1WLZA 1TNPA 4ICBA 4NDCA 3BYAA 3CR4X 1B9AA 2KAYA 5HLVA 2NXQA 5K89A 2ZRSA 2MAZA 3CS1A 1S6JA 1V1FA 5I2OA 3WNXB 1A75A 1K8UA 2WCFA 1UURA 2KGBC 1RFJA 1BMOA 1TCFA 3I5FC 4GBAA 4DRWA 1WY9A 2LE9B 3WHUB 5AFPA 1TNXA 1KK8C 1PK0D 3KEVA 3NSLA 3GOFA 2EGDA 2E6WA 1SCMB 2Q91A 3JTDB 4MVFA 1Y1AA 1KFUL 1IH0A 1BF5A 5FYXA 2KFHA 2M7NA 2CXJA 2LLSA 1M45A 3JVTC 1MUXA 3VROA 4ZCUA 1CFFA 1F55A 2JULA 2BKHB 2HETA 3I5IB 4OV2A 1CFPA 1U5IB 1UHNA 1QXPA 1YRTB 2KI4C 2I18A 2WORA 1S5GZ 1TNQA 4CFQA 1WDCC 2JT0A 2BL0B 1OZSA 2K7OA 2GGMA 4TNCA 3KHEA 3A8RA 1B47A 3CZTX 3KF9A 1EG3A 3JVTB 4ORAB 3BUOB 4PDZA 1RROA 1CKKA 1NIWA 3VRRA 1N2DA 3SG5A 4WQ2A 3TDIA 1OMVA 1JFKA 1QV0A 4PE0A 1KCYA 1SR6B 1PVBA 1MXLC 3NSIA 1RJVA 1CDNA 2KFFA 2NCOA 5I2LA 1F4QA 3TS5B 1YVLA 4GPLB 3EKHA 2ZNEA 1R6PA 5CPVA 1TTXA 2LC5A 2F33A 4CPVA 4GNKB 2MHHA 1IJ5A 4HRHA 1XFYO 1XFXO 3LK1A 2G2BA 1NCYA 2Y1NA 1WRLA 1Y1XA 4N5XA 2KSPA 2CNPA 4NQGA 5AEQA 1PULA 1YUSA 2MLEC 1QLSA 1MXEA 1M63B 1FBVA 1KFUS 1XYDA 1Y1UA 4XYNA 1CNPA 4OR9B 4PE4A 2Y4QA 1PALA 1UP5A 2LHIA 2O5GA 1GGZA 1CB1A 1K95A 2MBXA 1HT9A 2BBNA 2LVJA 3O2PA 5D69A 3GK4X 3DVJA 2JTZA 3BUXB 1S6IA 2K61A 1KQMB 1EH2A 4DS7A 3C1VA 1DGUA 2JT8A 1QS7A 2MRDA 1U5IA 3O4YA 2LP2A 1BU3A 5B8IB 4AQIA 4HSZA 1CM1A 1AJ5A 1MR8A 3FS7A 4YGAA 4D1EA 5DKQA 1ZUZA 1LA0A 3VRQA 4MLWA 1X02A 4MZJA 5KSZA 4OVNF 1Y0VH 1JF0A 4N1GA 2O60A 2LP3A 3FWCA 3IQQA 2LANA 1IWQA 5I2QA 1NPQA 1OMDA 2JT3A 1S1EA 2DOQA 4L9MA 4FQOA 1CMFA 1J7RA 4F0ZB 1DJIA 1DJZA 1QJTA 2K7DA 4PALA 1QX2A 2GV5A 4OCIA 2NCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWO A;  1KSO A;  3PLF B;  1BG1 A;  3RLZ A;  1IQ5 A;  2JOJ A;  1SBJ A;  5HYD A;  1MF8 B;  2M8U A;  3DVM A;  1AUI B;  3EVR A;  1PRW A;  4BY4 A;  1C07 A;  2JNX A;  1IQ3 A;  3EK8 A;  1K9K A;  2K7C A;  1KWO B;  1EG4 A;  1YUR A;  2Y5I A;  2BE6 A;  3BOW A;  2WC8 A;  3BUW B;  1XFU O;  2KDH A;  2CTN A;  1H8B A;  1SRA A;  3SJS A;  1EXR A;  1S5G Y;  3O78 A;  1NCZ A;  2KGR A;  1MQ1 A;  4PHK A;  4YGE B;  1J55 A;  1DF0 B;  1OQP A;  5JOL A;  2HPS A;  1OZO A;  5KU1 A;  1K93 D;  2LMU A;  5DKN A;  1REC A;  3RM1 A;  1YTZ C;  5PAL A;  5I8N A;  4GGF A;  1NX0 A;  1WRZ A;  2K8M B;  2F8P A;  2BKI B;  1QTX A;  1DMO A;  1DJX A;  2WND A;  4NDB A;  1F8H A;  2JZI A;  3D0Y B;  1LKJ A;  2EC6 B;  1ZMZ A;  3PAT A;  4USL A;  2M29 A;  2H61 A;  3FIA A;  1F70 A;  2LUX A;  3I5G C;  4GAO A;  4C0J A;  4GUK A;  1Q80 A;  3AAJ A;  1N65 A;  2AMI A;  1DT7 B;  2CT9 A;  2Q4U A;  2JPT A;  1YRU B;  3EVU A;  3SIB A;  3GK1 A;  5ER4 X;  3SG6 A;  1AK8 A;  2F3Z A;  2BCX A;  2PMY A;  4MRX A;  4MRY A;  1MWN A;  2LVV A;  2I94 A;  3EK7 A;  4M2O A;  4NDD A;  4HRE E;  2M1U A;  1DF0 A;  4DCK A;  2HQW A;  2L50 A;  3E3R A;  1NWD A;  5HLO A;  1AP4 A;  3OB2 B;  1G33 A;  4MSP A;  4ZCV A;  3GK2 A;  3LCP C;  5CSJ A;  2NLN A;  1BOC A;  5HKW A;  3OP0 A;  3IF7 A;  1IRJ A;  1IG5 A;  1WLM A;  2CCM A;  2ZND A;  1K90 D;  2COL B;  4A4C A;  1F4O A;  2JU0 A;  1R2U A;  1UHH A;  3EK4 A;  1L2O B;  3SG2 A;  5CSN A;  1B8L A;  1TIZ A;  1S36 A;  2QAC A;  2P6B B;  4N1F A;  4WQ3 A;  2ZRT A;  2K0J A;  3JTD C;  2KBM A;  4AOM A;  3VRN A;  1OE9 B;  1TN4 A;  1A2X A;  3BXK A;  1NCX A;  1CM4 A;  2BCA A;  5AAN A;  1JF2 A;  2KI6 D;  1SKT A;  3PN7 B;  1S3P A;  3KO0 A;  2JC2 A;  1TOP A;  3I5F B;  3DF0 A;  3ZWH A;  1BOD A;  3CGA A;  4MZK A;  3KPX A;  2L2E A;  2OS8 C;  2G9B A;  1DJG A;  2M0R A;  1QVI Z;  1B7T Y;  1MHO A;  1RK9 A;  5CSF A;  1SCM C;  1GQM A;  1ZOT B;  1GJY A;  2PVB A;  2ZN9 A;  3FWB A;  1RWY A;  1YX7 A;  1S26 D;  3TZ1 A;  3D10 A;  1JC2 A;  2SCP A;  3BUM B;  1QIV A;  2M7L A;  4DIR A;  1CLM A;  2AAO A;  3TUY B;  3BQ3 A;  3HCM A;  1QV1 A;  2JXC A;  1XO5 A;  2KHN A;  4JQ0 D;  5AER A;  1XK4 C;  4ORB B;  2FCE A;  1L7Z A;  1ALW A;  2PAL A;  1K9P A;  1SYM A;  2LV7 A;  2LAP A;  3NXA A;  3TDZ A;  1KK7 Y;  2OS8 B;  1SR6 C;  1CTR A;  1F71 A;  1AVS A;  2EHB A;  1LIN A;  4CFR A;  4P5O E;  1JUO A;  4I5N B;  1RTP 1;  1CDP A;  3QRX A;  1UHK A;  2RGI A;  1F54 A;  2ZKM X;  2OPO A;  2F2O A;  1PVA A;  1S6C A;  4YGC B;  3CWG A;  1FPW A;  2LM5 A;  1PSR A;  1YVH A;  5GQQ C;  1DJH A;  3ICB A;  3CR5 X;  2ISD A;  3F45 A;  2OTG C;  1OOJ A;  2H2K A;  3NSO A;  1OMR A;  2F3Y A;  5HKY A;  4QJ5 B;  2AUC A;  1AHR A;  1L2O C;  1QX7 A;  1YX8 A;  4U8D A;  3M0W A;  2B1U A;  1ALV A;  1CLB A;  1M39 A;  4R1E A;  1UHJ A;  2FCD A;  3DF0 B;  1Y6W A;  1CMG A;  2JQ6 A;  4PHM A;  1G8I A;  2BBM A;  2LLU A;  1TCO B;  2D8N A;  2Y1M A;  4A4B A;  1J1E A;  2JXL A;  1W7I B;  3WXA A;  3PFV A;  2QPT A;  4E68 A;  1CDL A;  4IL1 A;  4BY5 A;  2NZ0 A;  3SIA A;  1OSA A;  5CSI A;  1NSH A;  4ORC B;  3TUY C;  2LCP A;  5J3X A;  3TDU A;  1J7P A;  3LL8 B;  5F6T A;  2CBL A;  1BJF A;  4PHN A;  4GFT A;  2H61 C;  1CLL A;  2VRG A;  3I5G B;  2KAV A;  2LNK A;  3I5H B;  3CLN A;  5ER5 A;  2BL0 C;  1XFV O;  4P2Y B;  2F2P A;  2KNE A;  1W7J B;  2WCB A;  1PSB A;  1SK6 D;  2HQ8 A;  4YI8 A;  1CFC A;  2PSR A;  2KI4 B;  1J1D A;  4DUQ A;  1CFD A;  4OKH A;  1UHI A;  3PSR A;  1FF1 A;  1XFZ O;  3AAK A;  1SY9 A;  1G4Y R;  1VRK A;  3OB1 B;  2IS9 A;  1K96 A;  1JSA A;  2KQY A;  3OX6 A;  4MBE A;  4MEW A;  3I5H C;  4CID A;  4YRU A;  2L5X B;  1DTL A;  1XK4 A;  5G08 A;  2BEC A;  2LHL A;  2BE4 A;  1SMG A;  2I2R E;  4ETO A;  4M2Q A;  1N0Y A;  2I7A A;  2LVK A;  1KK8 B;  1XFW O;  1B8R A;  2M3W A;  3PAL A;  3LLE A;  2LMT A;  1C7W A;  1JWD A;  1ODB A;  2M1K B;  2R2I A;  1NX3 A;  2ZFD A;  1IGV A;  4MZL A;  3VGO A;  1FI6 A;  1NX2 A;  2EC6 C;  2L98 A;  2V53 A;  1E8A A;  2L4H A;  3EVV A;  1BR4 B;  1HQV A;  2JNF A;  1GGW A;  4MN0 A;  3DVE A;  2LLT A;  4YBH B;  1NUB A;  1KFX S;  1SL8 A;  3NSK A;  1TRF A;  5AXI A;  1CDM A;  4Q04 A;  1QX5 B;  1AJ4 A;  4I5L B;  4YI9 A;  1QIW A;  1DVI A;  2KBI A;  2KI6 C;  2JWW A;  1B1G A;  1KQM C;  4GGN A;  1UUS A;  4C0L A;  1B4C A;  1M31 A;  3CR2 A;  2MA2 A;  1J7O A;  1SL9 A;  1QAS A;  2MJW B;  4PE7 A;  1XA5 A;  1K9U A;  2JRF A;  2WOS A;  1YUU A;  3AKA A;  1XVJ A;  2GGZ A;  4UPG A;  3PM8 A;  1BLQ A;  1EJ3 A;  1C7V A;  3A4U B;  2PRU A;  2LMV A;  4QJ4 B;  2KOT A;  3HX4 A;  2L0P A;  1K94 A;  3H4S E;  5JJG A;  1SW8 A;  3PN7 C;  1LXF C;  2KYC A;  4C0K A;  5KTY A;  2FOT A;  2LVI A;  5IBW A;  1JFJ A;  1KWO C;  2M9G A;  2KAX A;  2L4I A;  1SPY A;  2MLF C;  2M49 B;  2K7B A;  1M46 A;  1JBA A;  2K2A A;  3VRP A;  3TS5 C;  1QLK A;  4FTG A;  1KK7 Z;  1EL4 A;  4QJ3 B;  4PHJ A;  2HF5 A;  1H4B A;  3SG4 A;  3O6B A;  5BPJ A;  2FJU B;  1YUT A;  3EKJ A;  1FI5 A;  1A4P A;  2KFG A;  3BOW B;  1IJ6 A;  2E30 A;  2TN4 A;  4JWQ A;  3ZNI A;  2LUC A;  2KYF A;  4GGF C;  4JPZ B;  1FW4 A;  1KFX L;  1LVC D;  1ZAC A;  3K21 A;  2PAS A;  2ZN8 A;  1ZFS A;  1DJY A;  4I5K A;  1B7T Z;  4WRI A;  1QVI Y;  1BT6 A;  4I5J A;  1SNL A;  3DVK A;  1WDC B;  2KQ6 A;  2JTT A;  4XJK B;  1DGV A;  1NYA A;  1D1O A;  5D7F A;  3DD4 A;  4YGD B;  4CLN A;  3D0Y A;  3I5I C;  4HRG A;  1IKU A;  1WRK A;  5TNC A;  2M97 A;  3CTN A;  5HKZ A;  3OX5 A;  1TNW A;  3SG3 A;  1V1G A;  3AKB A;  3BUN B;  4PCW A;  1BR1 B;  1YR5 A;  2K2F A;  2L51 A;  4AQJ A;  1A03 A;  1KSM A;  1B8C A;  3IQO A;  1NX1 A;  2SAS A;  3LK0 A;  1SL7 A;  1NP8 A;  1SCV A;  3MSE B;  3WHT B;  3OHM B;  1A29 A;  1A75 B;  4XJK A;  4YGB B;  1LA3 A;  2OTG B;  4PE1 A;  3SG7 A;  2A4J A;  1J7Q A;  1KQV A;  1K2H A;  4M2P A;  2BCB A;  1DJW A;  2WCE A;  5DKR A;  1QAT A;  1WLZ A;  1TNP A;  4ICB A;  4NDC A;  3BYA A;  3CR4 X;  1B9A A;  2KAY A;  5HLV A;  2NXQ A;  5K89 A;  2ZRS A;  2MAZ A;  3CS1 A;  1S6J A;  1V1F A;  5I2O A;  3WNX B;  1A75 A;  1K8U A;  2WCF A;  1UUR A;  2KGB C;  1RFJ A;  1BMO A;  1TCF A;  3I5F C;  4GBA A;  4DRW A;  1WY9 A;  2LE9 B;  3WHU B;  5AFP A;  1TNX A;  1KK8 C;  1PK0 D;  3KEV A;  3NSL A;  3GOF A;  2EGD A;  2E6W A;  1SCM B;  2Q91 A;  3JTD B;  4MVF A;  1Y1A A;  1KFU L;  1IH0 A;  1BF5 A;  5FYX A;  2KFH A;  2M7N A;  2CXJ A;  2LLS A;  1M45 A;  3JVT C;  1MUX A;  3VRO A;  4ZCU A;  1CFF A;  1F55 A;  2JUL A;  2BKH B;  2HET A;  3I5I B;  4OV2 A;  1CFP A;  1U5I B;  1UHN A;  1QXP A;  1YRT B;  2KI4 C;  2I18 A;  2WOR A;  1S5G Z;  1TNQ A;  4CFQ A;  1WDC C;  2JT0 A;  2BL0 B;  1OZS A;  2K7O A;  2GGM A;  4TNC A;  3KHE A;  3A8R A;  1B47 A;  3CZT X;  3KF9 A;  1EG3 A;  3JVT B;  4ORA B;  3BUO B;  4PDZ A;  1RRO A;  1CKK A;  1NIW A;  3VRR A;  1N2D A;  3SG5 A;  4WQ2 A;  3TDI A;  1OMV A;  1JFK A;  1QV0 A;  4PE0 A;  1KCY A;  1SR6 B;  1PVB A;  1MXL C;  3NSI A;  1RJV A;  1CDN A;  2KFF A;  2NCO A;  5I2L A;  1F4Q A;  3TS5 B;  1YVL A;  4GPL B;  3EKH A;  2ZNE A;  1R6P A;  5CPV A;  1TTX A;  2LC5 A;  2F33 A;  4CPV A;  4GNK B;  2MHH A;  1IJ5 A;  4HRH A;  1XFY O;  1XFX O;  3LK1 A;  2G2B A;  1NCY A;  2Y1N A;  1WRL A;  1Y1X A;  4N5X A;  2KSP A;  2CNP A;  4NQG A;  5AEQ A;  1PUL A;  1YUS A;  2MLE C;  1QLS A;  1MXE A;  1M63 B;  1FBV A;  1KFU S;  1XYD A;  1Y1U A;  4XYN A;  1CNP A;  4OR9 B;  4PE4 A;  2Y4Q A;  1PAL A;  1UP5 A;  2LHI A;  2O5G A;  1GGZ A;  1CB1 A;  1K95 A;  2MBX A;  1HT9 A;  2BBN A;  2LVJ A;  3O2P A;  5D69 A;  3GK4 X;  3DVJ A;  2JTZ A;  3BUX B;  1S6I A;  2K61 A;  1KQM B;  1EH2 A;  4DS7 A;  3C1V A;  1DGU A;  2JT8 A;  1QS7 A;  2MRD A;  1U5I A;  3O4Y A;  2LP2 A;  1BU3 A;  5B8I B;  4AQI A;  4HSZ A;  1CM1 A;  1AJ5 A;  1MR8 A;  3FS7 A;  4YGA A;  4D1E A;  5DKQ A;  1ZUZ A;  1LA0 A;  3VRQ A;  4MLW A;  1X02 A;  4MZJ A;  5KSZ A;  4OVN F;  1Y0V H;  1JF0 A;  4N1G A;  2O60 A;  2LP3 A;  3FWC A;  3IQQ A;  2LAN A;  1IWQ A;  5I2Q A;  1NPQ A;  1OMD A;  2JT3 A;  1S1E A;  2DOQ A;  4L9M A;  4FQO A;  1CMF A;  1J7R A;  4F0Z B;  1DJI A;  1DJZ A;  1QJT A;  2K7D A;  4PAL A;  1QX2 A;  2GV5 A;  4OCI A;  2NCP A; 
#chains in the Genus database with same CATH topology
 1UWO A;  1KSO A;  3PLF B;  1BG1 A;  3RLZ A;  3DXL A;  1IQ5 A;  2JOJ A;  1SBJ A;  5HYD A;  1MF8 B;  2M8U A;  3DVM A;  5FI7 A;  1AUI B;  3EVR A;  1PRW A;  3FE6 A;  5FI6 A;  4BY4 A;  1C07 A;  2JNX A;  2KPH A;  1IQ3 A;  3EK8 A;  1K9K A;  2K7C A;  1KWO B;  1EG4 A;  1YUR A;  3CAB A;  2Y5I A;  2BE6 A;  3BOW A;  2WC8 A;  3BUW B;  3PM2 A;  1XFU O;  2KDH A;  2CTN A;  1H8B A;  1SRA A;  3SJS A;  1EXR A;  1S5G Y;  3O78 A;  1NCZ A;  2KGR A;  1MQ1 A;  4PHK A;  4YGE B;  1ORG A;  1J55 A;  1DF0 B;  1OQP A;  5JOL A;  2HPS A;  1OZO A;  5KU1 A;  1K93 D;  2LMU A;  5DKN A;  1REC A;  3SS3 A;  3RM1 A;  1YTZ C;  5PAL A;  5I8N A;  4GGF A;  1NX0 A;  1WRZ A;  2K8M B;  2F8P A;  2BKI B;  1QTX A;  1DMO A;  1DJX A;  2WND A;  4NDB A;  1F8H A;  2JZI A;  3D0Y B;  1LKJ A;  2EC6 B;  3B7A A;  3BFB A;  1ZMZ A;  3PAT A;  4USL A;  2M29 A;  2H61 A;  3FIA A;  1F70 A;  2LUX A;  3I5G C;  4GAO A;  4C0J A;  4GUK A;  1Q80 A;  3AAJ A;  1N65 A;  2AMI A;  1DT7 B;  2CT9 A;  2Q4U A;  2JPT A;  3NGV A;  1YRU B;  3EVU A;  5FI2 A;  3SIB A;  3GK1 A;  5ER4 X;  3SG6 A;  3BJH A;  2F3Z A;  2BCX A;  2PMY A;  4MRX A;  1AK8 A;  4MRY A;  1MWN A;  2LVV A;  2I94 A;  3EK7 A;  4M2O A;  4NDD A;  4HRE E;  2M1U A;  1DF0 A;  4DCK A;  2HQW A;  2L50 A;  3E3R A;  1NWD A;  5HLO A;  1AP4 A;  3OB2 B;  1G33 A;  3B88 A;  4MSP A;  4ZCV A;  3GK2 A;  3LCP C;  5CSJ A;  2NLN A;  1BOC A;  5HKW A;  3B87 A;  3OP0 A;  1IIO A;  3IF7 A;  1IRJ A;  1IG5 A;  1WLM A;  2CCM A;  2ZND A;  1K90 D;  2PYQ A;  4JD9 A;  2COL B;  4A4C A;  1F4O A;  2JU0 A;  1R2U A;  1UHH A;  3EK4 A;  1L2O B;  1Z2C B;  3S0G A;  3SG2 A;  5CSN A;  1B8L A;  1TIZ A;  1S36 A;  2QAC A;  4INW A;  2P6B B;  4N1F A;  4WQ3 A;  2ZRT A;  2K0J A;  3JTD C;  2KBM A;  4AOM A;  3VRN A;  1OE9 B;  1TN4 A;  1A2X A;  3BXK A;  1NCX A;  1CM4 A;  2BCA A;  5AAN A;  1JF2 A;  2KI6 D;  1SKT A;  3PN7 B;  1S3P A;  3KO0 A;  2JC2 A;  1TOP A;  3I5F B;  3DF0 A;  3ZWH A;  1BOD A;  3CGA A;  4MZK A;  3KPX A;  2L2E A;  1W9Z A;  2OS8 C;  2G9B A;  1DJG A;  2M0R A;  1QVI Z;  1B7T Y;  1MHO A;  2P70 A;  1RK9 A;  5CSF A;  1SCM C;  1GQM A;  1ZOT B;  1GJY A;  1DEK A;  2PVB A;  2ZN9 A;  3FWB A;  1YX7 A;  1RWY A;  1TWO A;  1S26 D;  3TZ1 A;  3D10 A;  1JC2 A;  2SCP A;  3BUM B;  1QIV A;  2M7L A;  1P28 A;  4DIR A;  1CLM A;  2AAO A;  5D3O A;  3TUY B;  3BQ3 A;  3HCM A;  1QV1 A;  2JXC A;  1XO5 A;  2KHN A;  4JQ0 D;  5AER A;  1XK4 C;  4ORB B;  2FCE A;  1L7Z A;  1ALW A;  3B6X A;  2PAL A;  2H8V A;  1K9P A;  1SYM A;  2LV7 A;  2LAP A;  3D75 A;  3NXA A;  3TDZ A;  1KK7 Y;  2OS8 B;  1SR6 C;  2KLE A;  3D76 A;  4OZD A;  1CTR A;  1F71 A;  1AVS A;  2EHB A;  1LIN A;  4CFR A;  4P5O E;  1JUO A;  4I5N B;  1RTP 1;  1CDP A;  3QRX A;  1UHK A;  1C3Y A;  2RGI A;  1F54 A;  2ZKM X;  2OPO A;  2F2O A;  3S0E A;  1PVA A;  1S6C A;  4YGC B;  3CWG A;  2BAP A;  1FPW A;  2LM5 A;  1PSR A;  1YVH A;  5GQQ C;  1DJH A;  3ICB A;  3CR5 X;  2ISD A;  3F45 A;  2OTG C;  1OOJ A;  2H2K A;  3S0D A;  3NSO A;  1OMR A;  3B86 A;  2F3Y A;  5HKY A;  4QJ5 B;  2AUC A;  1AHR A;  1L2O C;  1QX7 A;  1YX8 A;  4U8D A;  3M0W A;  2B1U A;  1ALV A;  1CLB A;  1M39 A;  4R1E A;  1UHJ A;  2FCD A;  3PJI A;  3SS4 A;  3DF0 B;  1Y6W A;  1CMG A;  2JQ6 A;  4PHM A;  1G8I A;  2BBM A;  2LLU A;  1TCO B;  1QWV A;  2D8N A;  2WCJ A;  2Y1M A;  4A4B A;  1J1E A;  2JXL A;  1W7I B;  4JKT A;  3WXA A;  3PFV A;  2QPT A;  4E68 A;  1CDL A;  1OOG A;  4IL1 A;  4BY5 A;  2ERB A;  2NZ0 A;  3SIA A;  1OSA A;  5CSI A;  1NSH A;  4ORC B;  3D73 A;  3D74 A;  2LCP A;  3TUY C;  5J3X A;  3TDU A;  1J7P A;  3LL8 B;  2QEH A;  5F6T A;  1C3Z A;  2CBL A;  1BJF A;  4IJ7 A;  4PHN A;  4GFT A;  3IVT A;  2WCK A;  2H61 C;  1CLL A;  2VRG A;  3I5G B;  2KAV A;  3L4L A;  2LNK A;  3I5H B;  3CLN A;  5ER5 A;  2BL0 C;  3D77 A;  1XFV O;  4P2Y B;  1XFR A;  2F2P A;  2KNE A;  1W7J B;  2WCB A;  1PSB A;  1SK6 D;  2HQ8 A;  4YI8 A;  1CFC A;  2PSR A;  3EG5 B;  2KI4 B;  3V2L A;  1J1D A;  4DUQ A;  1CFD A;  4OKH A;  1UHI A;  3PSR A;  1FF1 A;  1TUJ A;  1XFZ O;  3AAK A;  1SY9 A;  4FQT A;  1G4Y R;  3DYE A;  1VRK A;  3OB1 B;  2IS9 A;  1K96 A;  1JSA A;  1OW4 A;  2KQY A;  3OX6 A;  4MBE A;  4MEW A;  3I5H C;  4CID A;  4YRU A;  2L5X B;  1DTL A;  1XK4 A;  5G08 A;  2BEC A;  4INX A;  2LHL A;  2BE4 A;  1SMG A;  3UO9 A;  2I2R E;  4ETO A;  4M2Q A;  4F7F A;  1N0Y A;  2I7A A;  2LVK A;  1KK8 B;  1XFW O;  1B8R A;  2M3W A;  3PAL A;  3LLE A;  2LMT A;  1C7W A;  3K1E A;  1ODB A;  2M1K B;  2R2I A;  3VB1 A;  1JWD A;  1NX3 A;  2ZFD A;  1IGV A;  4MZL A;  3VGO A;  1FI6 A;  1NX2 A;  2EC6 C;  3Q8I A;  2L98 A;  2V53 A;  1E8A A;  2L4H A;  3EVV A;  5I94 A;  1BR4 B;  1HQV A;  2JNF A;  1GGW A;  4MN0 A;  3O4X A;  3DVE A;  2LLT A;  4YBH B;  1NUB A;  1KFX S;  1DQE A;  1SL8 A;  3L4A A;  3NSK A;  1TRF A;  3QME A;  1CDM A;  2GTE A;  5AXI A;  4Q04 A;  1QX5 B;  1AJ4 A;  4I5L B;  4YI9 A;  1QIW A;  1DVI A;  2KBI A;  2KI6 C;  3R1O A;  2JWW A;  1B1G A;  1KQM C;  4GGN A;  1UUS A;  2YGU A;  4C0L A;  1B4C A;  2L5Y A;  1M31 A;  3CR2 A;  3BFA A;  3BFH A;  2MA2 A;  1J7O A;  1SL9 A;  1QAS A;  3S0F A;  2MJW B;  4PE7 A;  1XA5 A;  2WCM A;  1K9U A;  2JRF A;  2WOS A;  1YUU A;  3AKA A;  1XVJ A;  2GGZ A;  3CZ2 A;  3PM8 A;  4UPG A;  1EJ3 A;  1BLQ A;  1C7V A;  3A4U B;  2PRU A;  2LMV A;  4QJ4 B;  2KOT A;  3HX4 A;  2L0P A;  1K94 A;  5DIC A;  3H4S E;  2L2C A;  5JJG A;  1SW8 A;  3PN7 C;  1LXF C;  2KYC A;  4C0K A;  5KTY A;  2FOT A;  2LVI A;  5IBW A;  1SSE B;  1KWO C;  2M9G A;  1JFJ A;  2KAX A;  2L4I A;  1SPY A;  2MLF C;  2M49 B;  2K7B A;  1M46 A;  1JBA A;  2K2A A;  3VRP A;  3TS5 C;  1QLK A;  4FTG A;  1KK7 Z;  1EL4 A;  4QJ3 B;  4PHJ A;  2HF5 A;  1H4B A;  3SG4 A;  3O6B A;  1DEL A;  5BPJ A;  2FJU B;  1YUT A;  3EKJ A;  1FI5 A;  1A4P A;  2KFG A;  3BOW B;  1IJ6 A;  2E30 A;  1GM0 A;  2TN4 A;  4JWQ A;  3ZNI A;  2LUC A;  2KYF A;  4GGF C;  4JPZ B;  2QEO A;  1FW4 A;  1KFX L;  1LVC D;  1ZAC A;  3K21 A;  2PAS A;  2ZN8 A;  1ZFS A;  3FE9 A;  1DJY A;  4I5K A;  1B7T Z;  4WRI A;  1QVI Y;  1BT6 A;  4I5J A;  1SNL A;  3DVK A;  1WDC B;  2KQ6 A;  2JTT A;  4XJK B;  1DGV A;  1NYA A;  1D1O A;  5D7F A;  3DD4 A;  4YGD B;  4CLN A;  3D0Y A;  3I5I C;  4HRG A;  1IKU A;  1WRK A;  5TNC A;  2M97 A;  3CTN A;  1OOF A;  5HKZ A;  3OX5 A;  2K60 A;  1TNW A;  3SG3 A;  1V1G A;  3AKB A;  3BUN B;  4PCW A;  1BR1 B;  1YR5 A;  2K2F A;  2L51 A;  4AQJ A;  1A03 A;  1KSM A;  3DZT A;  1B8C A;  3IQO A;  1NX1 A;  2SAS A;  3LK0 A;  1SL7 A;  1NP8 A;  1SCV A;  3MSE B;  3WHT B;  3OHM B;  1A29 A;  2WC6 A;  1A75 B;  4XJK A;  4YGB B;  1LA3 A;  2OTG B;  4PE1 A;  3SG7 A;  2A4J A;  1J7Q A;  1KQV A;  1K2H A;  4M2P A;  2BCB A;  1DJW A;  2WCE A;  5DKR A;  1QAT A;  1WLZ A;  1TNP A;  2PQL A;  3R1P A;  4ICB A;  4NDC A;  3BYA A;  3CR4 X;  1B9A A;  2KAY A;  5HLV A;  2NXQ A;  5K89 A;  2ZRS A;  2MAZ A;  3CS1 A;  1S6J A;  1V1F A;  3DY9 A;  3R1V A;  5I2O A;  3L47 A;  3WNX B;  1A75 A;  1K8U A;  2WCF A;  1Z4H A;  1UUR A;  2KGB C;  1RFJ A;  1BMO A;  1TCF A;  3I5F C;  4GBA A;  4DRW A;  1WY9 A;  2LE9 B;  3S0A A;  3WHU B;  5AFP A;  1TNX A;  1KK8 C;  1PK0 D;  3KEV A;  3NSL A;  3GOF A;  2EGD A;  2E6W A;  1SCM B;  2Q91 A;  3JTD B;  4MVF A;  1T14 A;  1Y1A A;  1KFU L;  1IH0 A;  1BF5 A;  5FYX A;  2KFH A;  4KYN A;  2M7N A;  2CXJ A;  2LLS A;  1M45 A;  3JVT C;  1MUX A;  3VRO A;  4ZCU A;  1CFF A;  1OOI X;  1F55 A;  2JUL A;  2BKH B;  2HET A;  3I5I B;  4OV2 A;  1CFP A;  1U5I B;  1UHN A;  1QXP A;  1YRT B;  2KI4 C;  2I18 A;  2KLD A;  1S5G Z;  1TNQ A;  2WOR A;  4CFQ A;  2BNX A;  1WDC C;  3N7H A;  2JT0 A;  2P71 A;  2BL0 B;  3CYZ A;  1OZS A;  2K7O A;  2GGM A;  4TNC A;  3KHE A;  3A8R A;  1B47 A;  3CZT X;  3KF9 A;  1EG3 A;  3JVT B;  4ORA B;  3BUO B;  4PDZ A;  1RRO A;  1CKK A;  1NIW A;  3VRR A;  1N2D A;  3SG5 A;  1OOH A;  4WQ2 A;  3TDI A;  1OMV A;  1JFK A;  2QDI A;  1QV0 A;  4PE0 A;  1KCY A;  1SR6 B;  1PVB A;  1MXL C;  3NSI A;  1RJV A;  1CDN A;  2KFF A;  3CZ1 A;  2NCO A;  3NHI A;  1F4Q A;  5I2L A;  3TS5 B;  1YVL A;  4GPL B;  3EKH A;  3OGN A;  2ZNE A;  1R6P A;  5CPV A;  1TTX A;  2LC5 A;  2F33 A;  4CPV A;  4GNK B;  2MHH A;  1IJ5 A;  4HRH A;  1XFY O;  1XFX O;  3LK1 A;  2G2B A;  2QEV A;  1NCY A;  1LS8 A;  2Y1N A;  1WRL A;  1Y1X A;  5HL1 A;  4N5X A;  2KSP A;  2CNP A;  2JPO A;  4NQG A;  5AEQ A;  1PUL A;  3RZS A;  1YUS A;  2MLE C;  1QLS A;  1MXE A;  1M63 B;  1FBV A;  1KFU S;  1XYD A;  1Y1U A;  2FJY A;  4XYN A;  4OR9 B;  4PE4 A;  1CNP A;  2WCH A;  2Y4Q A;  1PAL A;  1UP5 A;  2LHI A;  2O5G A;  1GGZ A;  1CB1 A;  3CZ0 A;  1K95 A;  2MBX A;  1HT9 A;  2BBN A;  2WC5 A;  2LVJ A;  3O2P A;  3UNW A;  1TUZ A;  5D69 A;  3SS5 A;  3GK4 X;  3DVJ A;  2JTZ A;  3R72 A;  3BUX B;  1S6I A;  2K61 A;  1KQM B;  1EH2 A;  4DS7 A;  3CDN A;  3C1V A;  1DGU A;  2JT8 A;  1QS7 A;  2MRD A;  1U5I A;  3O4Y A;  2LP2 A;  1BU3 A;  5B8I B;  1DC1 A;  3S0B A;  4AQI A;  3FE8 A;  4HSZ A;  3D78 A;  1CM1 A;  1AJ5 A;  1MR8 A;  3FS7 A;  4YGA A;  4D1E A;  3NHT A;  5DKQ A;  1ZUZ A;  1LA0 A;  2WCL A;  4MLW A;  5EL2 A;  1X02 A;  3VRQ A;  4MZJ A;  5KSZ A;  4OVN F;  1Y0V H;  1JF0 A;  4N1G A;  2O60 A;  2LP3 A;  3FWC A;  3IQQ A;  4PT1 A;  2LAN A;  2QEB A;  1IWQ A;  5I2Q A;  1NPQ A;  1OMD A;  2JT3 A;  1S1E A;  2DOQ A;  4L9M A;  4FQO A;  1CMF A;  1J7R A;  3OBV A;  4F0Z B;  1DJI A;  1DJZ A;  1QJT A;  2K7D A;  4PAL A;  1QX2 A;  2GV5 A;  4OCI A;  2NCP A; 
#chains in the Genus database with same CATH homology
 1UWO A;  1KSO A;  3PLF B;  1BG1 A;  3RLZ A;  1IQ5 A;  2JOJ A;  1SBJ A;  5HYD A;  1MF8 B;  2M8U A;  3DVM A;  1AUI B;  3EVR A;  1PRW A;  4BY4 A;  1C07 A;  2JNX A;  1IQ3 A;  3EK8 A;  1K9K A;  2K7C A;  1KWO B;  1EG4 A;  1YUR A;  2Y5I A;  2BE6 A;  3BOW A;  2WC8 A;  3BUW B;  1XFU O;  2KDH A;  2CTN A;  1H8B A;  1SRA A;  3SJS A;  1EXR A;  1S5G Y;  3O78 A;  1NCZ A;  2KGR A;  1MQ1 A;  4PHK A;  4YGE B;  1J55 A;  1DF0 B;  1OQP A;  5JOL A;  2HPS A;  1OZO A;  5KU1 A;  1K93 D;  2LMU A;  5DKN A;  1REC A;  3RM1 A;  1YTZ C;  5PAL A;  5I8N A;  4GGF A;  1NX0 A;  1WRZ A;  2K8M B;  2F8P A;  2BKI B;  1QTX A;  1DMO A;  1DJX A;  2WND A;  4NDB A;  1F8H A;  2JZI A;  3D0Y B;  1LKJ A;  2EC6 B;  1ZMZ A;  3PAT A;  4USL A;  2M29 A;  2H61 A;  3FIA A;  1F70 A;  2LUX A;  3I5G C;  4GAO A;  4C0J A;  4GUK A;  1Q80 A;  3AAJ A;  1N65 A;  2AMI A;  1DT7 B;  2CT9 A;  2Q4U A;  2JPT A;  1YRU B;  3EVU A;  3SIB A;  3GK1 A;  5ER4 X;  3SG6 A;  1AK8 A;  2F3Z A;  2BCX A;  2PMY A;  4MRX A;  4MRY A;  1MWN A;  2LVV A;  2I94 A;  3EK7 A;  4M2O A;  4NDD A;  4HRE E;  2M1U A;  1DF0 A;  4DCK A;  2HQW A;  2L50 A;  3E3R A;  1NWD A;  5HLO A;  1AP4 A;  3OB2 B;  1G33 A;  4MSP A;  4ZCV A;  3GK2 A;  3LCP C;  5CSJ A;  2NLN A;  1BOC A;  5HKW A;  3OP0 A;  3IF7 A;  1IRJ A;  1IG5 A;  1WLM A;  2CCM A;  2ZND A;  1K90 D;  2COL B;  4A4C A;  1F4O A;  2JU0 A;  1R2U A;  1UHH A;  3EK4 A;  1L2O B;  3SG2 A;  5CSN A;  1B8L A;  1TIZ A;  1S36 A;  2QAC A;  2P6B B;  4N1F A;  4WQ3 A;  2ZRT A;  2K0J A;  3JTD C;  2KBM A;  4AOM A;  3VRN A;  1OE9 B;  1TN4 A;  1A2X A;  3BXK A;  1NCX A;  1CM4 A;  2BCA A;  5AAN A;  1JF2 A;  2KI6 D;  1SKT A;  3PN7 B;  1S3P A;  3KO0 A;  2JC2 A;  1TOP A;  3I5F B;  3DF0 A;  3ZWH A;  1BOD A;  3CGA A;  4MZK A;  3KPX A;  2L2E A;  2OS8 C;  2G9B A;  1DJG A;  2M0R A;  1QVI Z;  1B7T Y;  1MHO A;  1RK9 A;  5CSF A;  1SCM C;  1GQM A;  1ZOT B;  1GJY A;  2PVB A;  2ZN9 A;  3FWB A;  1RWY A;  1YX7 A;  1S26 D;  3TZ1 A;  3D10 A;  1JC2 A;  2SCP A;  3BUM B;  1QIV A;  2M7L A;  4DIR A;  1CLM A;  2AAO A;  3TUY B;  3BQ3 A;  3HCM A;  1QV1 A;  2JXC A;  1XO5 A;  2KHN A;  4JQ0 D;  5AER A;  1XK4 C;  4ORB B;  2FCE A;  1L7Z A;  1ALW A;  2PAL A;  1K9P A;  1SYM A;  2LV7 A;  2LAP A;  3NXA A;  3TDZ A;  1KK7 Y;  2OS8 B;  1SR6 C;  1CTR A;  1F71 A;  1AVS A;  2EHB A;  1LIN A;  4CFR A;  4P5O E;  1JUO A;  4I5N B;  1RTP 1;  1CDP A;  3QRX A;  1UHK A;  2RGI A;  1F54 A;  2ZKM X;  2OPO A;  2F2O A;  1PVA A;  1S6C A;  4YGC B;  3CWG A;  1FPW A;  2LM5 A;  1PSR A;  1YVH A;  5GQQ C;  1DJH A;  3ICB A;  3CR5 X;  2ISD A;  3F45 A;  2OTG C;  1OOJ A;  2H2K A;  3NSO A;  1OMR A;  2F3Y A;  5HKY A;  4QJ5 B;  2AUC A;  1AHR A;  1L2O C;  1QX7 A;  1YX8 A;  4U8D A;  3M0W A;  2B1U A;  1ALV A;  1CLB A;  1M39 A;  4R1E A;  1UHJ A;  2FCD A;  3DF0 B;  1Y6W A;  1CMG A;  2JQ6 A;  4PHM A;  1G8I A;  2BBM A;  2LLU A;  1TCO B;  2D8N A;  2Y1M A;  4A4B A;  1J1E A;  2JXL A;  1W7I B;  3WXA A;  3PFV A;  2QPT A;  4E68 A;  1CDL A;  4IL1 A;  4BY5 A;  2NZ0 A;  3SIA A;  1OSA A;  5CSI A;  1NSH A;  4ORC B;  3TUY C;  2LCP A;  5J3X A;  3TDU A;  1J7P A;  3LL8 B;  5F6T A;  2CBL A;  1BJF A;  4PHN A;  4GFT A;  2H61 C;  1CLL A;  2VRG A;  3I5G B;  2KAV A;  2LNK A;  3I5H B;  3CLN A;  5ER5 A;  2BL0 C;  1XFV O;  4P2Y B;  2F2P A;  2KNE A;  1W7J B;  2WCB A;  1PSB A;  1SK6 D;  2HQ8 A;  4YI8 A;  1CFC A;  2PSR A;  2KI4 B;  1J1D A;  4DUQ A;  1CFD A;  4OKH A;  1UHI A;  3PSR A;  1FF1 A;  1XFZ O;  3AAK A;  1SY9 A;  1G4Y R;  1VRK A;  3OB1 B;  2IS9 A;  1K96 A;  1JSA A;  2KQY A;  3OX6 A;  4MBE A;  4MEW A;  3I5H C;  4CID A;  4YRU A;  2L5X B;  1DTL A;  1XK4 A;  5G08 A;  2BEC A;  2LHL A;  2BE4 A;  1SMG A;  2I2R E;  4ETO A;  4M2Q A;  1N0Y A;  2I7A A;  2LVK A;  1KK8 B;  1XFW O;  1B8R A;  2M3W A;  3PAL A;  3LLE A;  2LMT A;  1C7W A;  1JWD A;  1ODB A;  2M1K B;  2R2I A;  1NX3 A;  2ZFD A;  1IGV A;  4MZL A;  3VGO A;  1FI6 A;  1NX2 A;  2EC6 C;  2L98 A;  2V53 A;  1E8A A;  2L4H A;  3EVV A;  1BR4 B;  1HQV A;  2JNF A;  1GGW A;  4MN0 A;  3DVE A;  2LLT A;  4YBH B;  1NUB A;  1KFX S;  1SL8 A;  3NSK A;  1TRF A;  5AXI A;  1CDM A;  4Q04 A;  1QX5 B;  1AJ4 A;  4I5L B;  4YI9 A;  1QIW A;  1DVI A;  2KBI A;  2KI6 C;  2JWW A;  1B1G A;  1KQM C;  4GGN A;  1UUS A;  4C0L A;  1B4C A;  1M31 A;  3CR2 A;  2MA2 A;  1J7O A;  1SL9 A;  1QAS A;  2MJW B;  4PE7 A;  1XA5 A;  1K9U A;  2JRF A;  2WOS A;  1YUU A;  3AKA A;  1XVJ A;  2GGZ A;  4UPG A;  3PM8 A;  1BLQ A;  1EJ3 A;  1C7V A;  3A4U B;  2PRU A;  2LMV A;  4QJ4 B;  2KOT A;  3HX4 A;  2L0P A;  1K94 A;  3H4S E;  5JJG A;  1SW8 A;  3PN7 C;  1LXF C;  2KYC A;  4C0K A;  5KTY A;  2FOT A;  2LVI A;  5IBW A;  1JFJ A;  1KWO C;  2M9G A;  2KAX A;  2L4I A;  1SPY A;  2MLF C;  2M49 B;  2K7B A;  1M46 A;  1JBA A;  2K2A A;  3VRP A;  3TS5 C;  1QLK A;  4FTG A;  1KK7 Z;  1EL4 A;  4QJ3 B;  4PHJ A;  2HF5 A;  1H4B A;  3SG4 A;  3O6B A;  5BPJ A;  2FJU B;  1YUT A;  3EKJ A;  1FI5 A;  1A4P A;  2KFG A;  3BOW B;  1IJ6 A;  2E30 A;  2TN4 A;  4JWQ A;  3ZNI A;  2LUC A;  2KYF A;  4GGF C;  4JPZ B;  1FW4 A;  1KFX L;  1LVC D;  1ZAC A;  3K21 A;  2PAS A;  2ZN8 A;  1ZFS A;  1DJY A;  4I5K A;  1B7T Z;  4WRI A;  1QVI Y;  1BT6 A;  4I5J A;  1SNL A;  3DVK A;  1WDC B;  2KQ6 A;  2JTT A;  4XJK B;  1DGV A;  1NYA A;  1D1O A;  5D7F A;  3DD4 A;  4YGD B;  4CLN A;  3D0Y A;  3I5I C;  4HRG A;  1IKU A;  1WRK A;  5TNC A;  2M97 A;  3CTN A;  5HKZ A;  3OX5 A;  1TNW A;  3SG3 A;  1V1G A;  3AKB A;  3BUN B;  4PCW A;  1BR1 B;  1YR5 A;  2K2F A;  2L51 A;  4AQJ A;  1A03 A;  1KSM A;  1B8C A;  3IQO A;  1NX1 A;  2SAS A;  3LK0 A;  1SL7 A;  1NP8 A;  1SCV A;  3MSE B;  3WHT B;  3OHM B;  1A29 A;  1A75 B;  4XJK A;  4YGB B;  1LA3 A;  2OTG B;  4PE1 A;  3SG7 A;  2A4J A;  1J7Q A;  1KQV A;  1K2H A;  4M2P A;  2BCB A;  1DJW A;  2WCE A;  5DKR A;  1QAT A;  1WLZ A;  1TNP A;  4ICB A;  4NDC A;  3BYA A;  3CR4 X;  1B9A A;  2KAY A;  5HLV A;  2NXQ A;  5K89 A;  2ZRS A;  2MAZ A;  3CS1 A;  1S6J A;  1V1F A;  5I2O A;  3WNX B;  1A75 A;  1K8U A;  2WCF A;  1UUR A;  2KGB C;  1RFJ A;  1BMO A;  1TCF A;  3I5F C;  4GBA A;  4DRW A;  1WY9 A;  2LE9 B;  3WHU B;  5AFP A;  1TNX A;  1KK8 C;  1PK0 D;  3KEV A;  3NSL A;  3GOF A;  2EGD A;  2E6W A;  1SCM B;  2Q91 A;  3JTD B;  4MVF A;  1Y1A A;  1KFU L;  1IH0 A;  1BF5 A;  5FYX A;  2KFH A;  2M7N A;  2CXJ A;  2LLS A;  1M45 A;  3JVT C;  1MUX A;  3VRO A;  4ZCU A;  1CFF A;  1F55 A;  2JUL A;  2BKH B;  2HET A;  3I5I B;  4OV2 A;  1CFP A;  1U5I B;  1UHN A;  1QXP A;  1YRT B;  2KI4 C;  2I18 A;  2WOR A;  1S5G Z;  1TNQ A;  4CFQ A;  1WDC C;  2JT0 A;  2BL0 B;  1OZS A;  2K7O A;  2GGM A;  4TNC A;  3KHE A;  3A8R A;  1B47 A;  3CZT X;  3KF9 A;  1EG3 A;  3JVT B;  4ORA B;  3BUO B;  4PDZ A;  1RRO A;  1CKK A;  1NIW A;  3VRR A;  1N2D A;  3SG5 A;  4WQ2 A;  3TDI A;  1OMV A;  1JFK A;  1QV0 A;  4PE0 A;  1KCY A;  1SR6 B;  1PVB A;  1MXL C;  3NSI A;  1RJV A;  1CDN A;  2KFF A;  2NCO A;  5I2L A;  1F4Q A;  3TS5 B;  1YVL A;  4GPL B;  3EKH A;  2ZNE A;  1R6P A;  5CPV A;  1TTX A;  2LC5 A;  2F33 A;  4CPV A;  4GNK B;  2MHH A;  1IJ5 A;  4HRH A;  1XFY O;  1XFX O;  3LK1 A;  2G2B A;  1NCY A;  2Y1N A;  1WRL A;  1Y1X A;  4N5X A;  2KSP A;  2CNP A;  4NQG A;  5AEQ A;  1PUL A;  1YUS A;  2MLE C;  1QLS A;  1MXE A;  1M63 B;  1FBV A;  1KFU S;  1XYD A;  1Y1U A;  4XYN A;  1CNP A;  4OR9 B;  4PE4 A;  2Y4Q A;  1PAL A;  1UP5 A;  2LHI A;  2O5G A;  1GGZ A;  1CB1 A;  1K95 A;  2MBX A;  1HT9 A;  2BBN A;  2LVJ A;  3O2P A;  5D69 A;  3GK4 X;  3DVJ A;  2JTZ A;  3BUX B;  1S6I A;  2K61 A;  1KQM B;  1EH2 A;  4DS7 A;  3C1V A;  1DGU A;  2JT8 A;  1QS7 A;  2MRD A;  1U5I A;  3O4Y A;  2LP2 A;  1BU3 A;  5B8I B;  4AQI A;  4HSZ A;  1CM1 A;  1AJ5 A;  1MR8 A;  3FS7 A;  4YGA A;  4D1E A;  5DKQ A;  1ZUZ A;  1LA0 A;  3VRQ A;  4MLW A;  1X02 A;  4MZJ A;  5KSZ A;  4OVN F;  1Y0V H;  1JF0 A;  4N1G A;  2O60 A;  2LP3 A;  3FWC A;  3IQQ A;  2LAN A;  1IWQ A;  5I2Q A;  1NPQ A;  1OMD A;  2JT3 A;  1S1E A;  2DOQ A;  4L9M A;  4FQO A;  1CMF A;  1J7R A;  4F0Z B;  1DJI A;  1DJZ A;  1QJT A;  2K7D A;  4PAL A;  1QX2 A;  2GV5 A;  4OCI A;  2NCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...