1F70A

Refined solution structure of calmodulin n-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords CALMODULIN
publication title Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.
pubmed doi rcsb
source organism Xenopus laevis
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f70A00
2HF5A 2KHNA 1CDPA 3NSKA 1OZSA 2BE4A 2JXCA 3GK4X 2OS8B 5HKZA 1BG1A 4P5OE 1ALVA 3EVUA 3OB2B 1KQMC 2OPOA 4NDCA 2LMTA 2BBMA 2F8PA 2I18A 3I5FC 1CM1A 1J1DA 1A2XA 3TUYB 3BUWB 1H8BA 2MJWB 4PCWA 2M7LA 2H2KA 1B8CA 1QATA 2JQ6A 1EG3A 1BJFA 2K61A 5CSJA 1B47A 4GGNA 4ZCVA 3ZNIA 3OX5A 1DGVA 3EKJA 3SJSA 2LE9B 4ORAB 2KYCA 1IRJA 5I2QA 1QXPA 2AMIA 1YTZC 1RK9A 1NWDA 1QLKA 1UWOA 2JPTA 2KSPA 3I5HC 4PHJA 3ZWHA 1IG5A 1S6JA 2KDHA 1GGZA 1UHHA 4M2QA 1XK4C 2BBNA 1L2OC 2G9BA 1CFPA 2QACA 2BE6A 1JSAA 3TDIA 1K95A 4C0KA 1KK8B 2H61A 1SR6B 1S6IA 1NUBA 2JU0A 1PSRA 4MVFA 1YX8A 3TS5B 1R6PA 2K7OA 1QX5B 1TRFA 2MBXA 3VRRA 4HSZA 4C0LA 2KFFA 3RLZA 2KAYA 1RFJA 1YX7A 4ETOA 1K93D 4GAOA 1GQMA 2ZFDA 3PLFB 4WRIA 1AP4A 1ZACA 2F33A 2K2FA 2Y4QA 1SBJA 1F54A 1EH2A 3AAKA 3DVKA 1TN4A 3M0WA 2K7DA 2MAZA 3WHTB 3OB1B 3OX6A 2AAOA 4A4CA 1XFWO 2HQ8A 1IQ5A 2CNPA 1A03A 1PVAA 3EVVA 2PSRA 3A8RA 5GQQC 4OCIA 4CPVA 4GGFA 1KFUS 1Y6WA 1SKTA 1HT9A 2M97A 1KFXS 2SASA 1UHJA 3DVJA 4N1FA 2KQYA 1YUTA 4HREE 5BPJA 1XFVO 2V53A 2BL0C 1F8HA 1SPYA 4OKHA 1MWNA 1NX1A 3ICBA 1DT7B 1K9PA 1VRKA 1CMGA 1EG4A 2D8NA 1IKUA 2KI4C 4Q04A 3AKAA 3JTDB 4QJ3B 2KI6C 1SL7A 4DS7A 2M8UA 1W7IB 2KYFA 5F6TA 1S5GY 1TCOB 2EGDA 1NPQA 4NDBA 4MBEA 1KWOB 1TTXA 1OZOA 5ER5A 1UHIA 2LHIA 1K9UA 1MF8B 1DJGA 2QPTA 2CBLA 4M2PA 1LXFC 1BLQA 3VGOA 3WNXB 5I8NA 1TNWA 5CSFA 2KGBC 2ZN9A 1KQVA 2M7NA 1DVIA 1M45A 4U8DA 1J55A 1S6CA 2JWWA 2H61C 4YRUA 4NQGA 3I5GB 3VRNA 1OSAA 1GJYA 3BQ3A 1J7RA 4DCKA 2JTTA 1WDCC 3I5IB 2CCMA 1SMGA 1EL4A 1Y1AA 1NSHA 5KSZA 2LV7A 1JF2A 1DGUA 1RWYA 4MRYA 1S26D 2L0PA 3CZTX 2PVBA 4L9MA 4DRWA 1AJ5A 1YRTB 1UHKA 1C7VA 5AFPA 2M1KB 2NCPA 1DF0B 5HKWA 5DKRA 3EK7A 2M0RA 3CS1A 1QS7A 1PULA 1XVJA 1F4OA 1KQMB 2NCOA 2LUXA 1CFCA 3BOWA 3LCPC 3I5FB 2KQ6A 2O60A 5B8IB 4F0ZB 1LA0A 3O4YA 3LL8B 4GGFC 4XYNA 1NCXA 1TOPA 1IJ5A 1CMFA 1OMRA 2P6BB 3E3RA 3BYAA 3SIAA 4YBHB 2GV5A 1S5GZ 3QRXA 4YGBB 1SCMB 1TNQA 5J3XA 1ZMZA 3DVEA 3SG6A 1N2DA 2PASA 3NXAA 1DJWA 3I5HB 1IGVA 3FIAA 1TCFA 3LK0A 1YVHA 3DF0B 1WLMA 4FQOA 2ZRSA 3CR4X 1B1GA 3FS7A 4BY4A 2COLB 3GK1A 1L2OB 1NP8A 1ODBA 1NIWA 1CDNA 1QIVA 1G33A 2LP3A 2PMYA 4PE1A 1N0YA 1FPWA 1MR8A 4IL1A 1BMOA 3D0YB 1V1FA 1SCVA 1N65A 1SL8A 5CPVA 3TDUA 2VRGA 1CLBA 1QVIZ 2FJUB 2ZNEA 3F45A 3SG5A 4I5NB 3MSEB 1SL9A 2JT0A 2LP2A 4PE0A 4CIDA 1ALWA 1QTXA 2KNEA 1IQ3A 3BUXB 1PK0D 3DVMA 1SW8A 1A75A 2ZRTA 3EK8A 3C1VA 1OMDA 1SNLA 4WQ3A 3OP0A 3PN7C 1WRZA 1JFKA 1QLSA 1XFZO 1BR4B 2KBMA 2LNKA 2TN4A 5HYDA 3VROA 1CKKA 3SG3A 1QIWA 4DUQA 2Y5IA 3PM8A 2I2RE 4N5XA 3AKBA 1MUXA 2A4JA 1KCYA 2BL0B 3LK1A 2PRUA 4MLWA 1DJZA 1CLLA 3HCMA 3SG7A 4A4BA 2IS9A 2L4HA 4USLA 3CR5X 2WC8A 1QV0A 4N1GA 2KI4B 1CLMA 1UP5A 4PHMA 4XJKB 5HKYA 2SCPA 1IWQA 2BKHB 1LA3A 2LVKA 1RJVA 3EKHA 1M31A 1QJTA 1QV1A 4ORCB 5AXIA 4AQJA 1YURA 4QJ4B 1U5IA 4JQ0D 3JVTC 1A4PA 2HETA 2RGIA 3D10A 2L5XB 4MZLA 4MZJA 3VRPA 3KO0A 1SK6D 3TDZA 1L7ZA 2NLNA 1M46A 2EC6C 2WORA 5K89A 1K94A 4C0JA 4GPLB 1M39A 1QX2A 1ZOTB 1XA5A 2NZ0A 1HQVA 4DIRA 1MHOA 2KBIA 3NSOA 5PALA 1K2HA 1WDCB 1XYDA 1B9AA 1YR5A 1B7TY 2ZN8A 1KSMA 2E30A 1DJXA 3IQOA 4TNCA 3LLEA 2Y1NA 1R2UA 2OTGC 2CTNA 2Y1MA 4OV2A 4MRXA 2F2OA 3CLNA 3NSLA 2BCXA 4I5KA 5AERA 4YGAA 5D69A 4PHKA 1B8RA 1QVIY 5JOLA 2K0JA 1CB1A 5HLVA 2MLFC 1J1EA 1UUSA 2KAXA 2M49B 3SG4A 3BUOB 2KI6D 3AAJA 1KK7Y 3WXAA 1WY9A 1DJIA 3GK2A 3K21A 4GBAA 4MEWA 2K2AA 1SRAA 1CTRA 4FTGA 1OOJA 3GOFA 2WCEA 2PALA 1LINA 1DJHA 1S1EA 1J7OA 1NYAA 2L51A 1NCYA 3BUMB 2KOTA 5DKNA 1YUSA 2ZNDA 3H4SE 2NXQA 1JC2A 1CNPA 1RTP1 2JT3A 2AUCA 1OQPA 4GNKB 1EXRA 1YVLA 5HLOA 2JRFA 2CXJA 1XFXO 1S3PA 1B8LA 1A29A 1ZUZA 1F70A 5DKQA 5AANA 1XO5A 5D7FA 1BOCA 1AJ4A 1S36A 5TNCA 4QJ5B 1RECA 2LAPA 2OS8C 1F71A 3IQQA 1CDMA 4ZCUA 3TZ1A 1B7TZ 4OR9B 2LVVA 1DMOA 1PSBA 4XJKA 3TUYC 4WQ2A 1C07A 1K8UA 1NX0A 1M63B 4P2YB 2LHLA 1BT6A 2GGZA 3EK4A 1WRKA 1IJ6A 2LCPA 3HX4A 1WRLA 1SCMC 2M9GA 3DD4A 1KSOA 5KU1A 1X02A 3SIBA 1OMVA 2JULA 2LMVA 3CWGA 4BY5A 1AHRA 1E8AA 1F55A 1XFUO 2JNFA 3PN7B 2ISDA 1KK7Z 2I7AA 5KTYA 2LUCA 1YUUA 2Q4UA 1PRWA 4M2OA 1QASA 1BODA 2JXLA 4PHNA 1TNPA 5CSNA 2LMUA 4YGDB 2LVJA 4D1EA 1RROA 2LM5A 1W7JB 2LLSA 1K96A 1WLZA 2K8MB 2L98A 1JWDA 1UHNA 1KK8C 2K7CA 4ORBB 1SR6C 4UPGA 1G4YR 1CM4A 3BOWB 3PSRA 4I5LB 3TS5C 1BU3A 2R2IA 2LLUA 2GGMA 2L4IA 1JFJA 2F3ZA 2BCBA 3SG2A 1KFUL 1FW4A 1GGWA 2LC5A 4MZKA 1KFXL 3KPXA 2JTZA 1G8IA 2KGRA 5ER4X 1FI5A 4YI9A 1J7PA 3JVTB 4CFQA 2K7BA 2JC2A 1DF0A 4GUKA 2Q91A 2B1UA 3VRQA 2MLEC 3PALA 2M3WA 2LANA 3OHMB 1FF1A 2EC6B 2BECA 2EHBA 3CR2A 4CLNA 5JJGA 3KHEA 1K90D 3RM1A 1Y1UA 2JOJA 2MRDA 4HRGA 4OVNF 1FI6A 2DOQA 1JF0A 1QX7A 2FCDA 2WOSA 1DTLA 2KFGA 3CGAA 1AUIB 3EVRA 1AVSA 1LKJA 1SY9A 2FOTA 5I2OA 5AEQA 1YRUB 2KAVA 2O5GA 4PE7A 2LLTA 3FWBA 4JWQA 3O2PA 2HPSA 2WNDA 2OTGB 1BF5A 3O6BA 3JTDC 4ICBA 5IBWA 5FYXA 3DF0A 3NSIA 1D1OA 2I94A 1F4QA 2WCBA 1NX3A 4R1EA 2JNXA 4E68A 4PALA 1MXLC 1J7QA 1XK4A 1IH0A 3PFVA 3BXKA 2F3YA 1A75B 2L2EA 1FBVA 1KWOC 5I2LA 1MXEA 2JZIA 3A4UB 1PALA 1CDLA 1EJ3A 1CFDA 1MQ1A 1DJYA 2M1UA 4PDZA 1NX2A 1SYMA 4GFTA 4YGEB 4NDDA 1JBAA 2LVIA 3D0YA 1AK8A 4YGCB 2M29A 3WHUB 2KFHA 1UURA 3IF7A 1NCZA 3PATA 1Y0VH 4MN0A 2FCEA 2MHHA 4AOMA 1ZFSA 2E6WA 1LVCD 1C7WA 2WCFA 1K9KA 2BCAA 5CSIA 2HQWA 3I5GC 3O78A 3KEVA 4HRHA 2ZKMX 4YI8A 4MSPA 3BUNB 1TIZA 2MA2A 3I5IC 2BKIB 1BR1B 1V1GA 3KF9A 1Y1XA 4CFRA 3CTNA 2F2PA 1JUOA 1PVBA 4JPZB 2CT9A 4PE4A 1TNXA 1Q80A 2G2BA 2JT8A 3FWCA 4AQIA 1H4BA 2L50A 1OE9B 1XFYO 4I5JA 5G08A 1U5IB 1CFFA 1B4CA
chains in the Genus database with same CATH superfamily
3L4LA 2HF5A 2KHNA 1CDPA 3NSKA 1OZSA 4PT1A 2BE4A 2JXCA 3BFAA 3GK4X 5FI2A 2OS8B 5HKZA 1BG1A 3NHTA 1TUZA 4P5OE 1ALVA 3EVUA 3OB2B 1KQMC 2OPOA 4NDCA 2LMTA 2BBMA 2F8PA 2I18A 3I5FC 1CM1A 1J1DA 1A2XA 3TUYB 3BUWB 1H8BA 2MJWB 4PCWA 2M7LA 1DEKA 1B8CA 2H2KA 1QATA 2JQ6A 1EG3A 1BJFA 2K61A 3CYZA 1B47A 4GGNA 5CSJA 4ZCVA 3OX5A 3ZNIA 1DGVA 3EKJA 2ERBA 1W9ZA 3SJSA 2LE9B 4ORAB 2KYCA 1IRJA 5I2QA 3CZ2A 1QXPA 2AMIA 1YTZC 1RK9A 1NWDA 1QLKA 1UWOA 2JPTA 2KSPA 3I5HC 4PHJA 1XFRA 3ZWHA 1IG5A 1S6JA 2KDHA 1GGZA 1UHHA 4M2QA 1XK4C 2BBNA 1L2OC 2G9BA 1CFPA 2QACA 2QEOA 1DQEA 2BE6A 1JSAA 3TDIA 3SS4A 1K95A 4C0KA 1KK8B 2H61A 1SR6B 2WC6A 1S6IA 3B87A 1NUBA 2JU0A 1PSRA 4MVFA 1YX8A 3TS5B 1R6PA 2K7OA 3D78A 1QX5B 1TRFA 2MBXA 3VRRA 2QEBA 4HSZA 4C0LA 2KFFA 3RLZA 2KAYA 1RFJA 1YX7A 4ETOA 1K93D 4GAOA 1GQMA 2ZFDA 3PLFB 4WRIA 1AP4A 1ZACA 2F33A 2K2FA 2Y4QA 1SBJA 1F54A 1EH2A 3AAKA 3DVKA 1TN4A 3M0WA 2K7DA 2MAZA 3WHTB 3OB1B 3OX6A 2AAOA 4A4CA 1XFWO 2HQ8A 1IQ5A 2CNPA 1A03A 1PVAA 3EVVA 2PSRA 1OOGA 3A8RA 5GQQC 4OZDA 4OCIA 4CPVA 4GGFA 1KFUS 1Y6WA 1SKTA 1HT9A 3FE8A 2M97A 1KFXS 2SASA 1UHJA 3DVJA 4N1FA 2KQYA 1YUTA 4HREE 5BPJA 1XFVO 3DZTA 2V53A 2BL0C 1F8HA 1SPYA 4OKHA 1MWNA 1NX1A 3O4XA 3ICBA 1DT7B 1K9PA 1VRKA 1CMGA 1EG4A 2D8NA 1IKUA 2KI4C 4Q04A 3AKAA 3JTDB 4QJ3B 2KI6C 1SL7A 4DS7A 2M8UA 3B88A 1W7IB 2KYFA 5F6TA 1S5GY 1TCOB 2EGDA 1NPQA 4NDBA 4MBEA 1KWOB 1TTXA 1OZOA 4INWA 1UHIA 5ER5A 2LHIA 1K9UA 1MF8B 1DJGA 2QPTA 2CBLA 4M2PA 1LXFC 3CABA 3VGOA 3WNXB 5I8NA 1TNWA 1BLQA 5CSFA 2KGBC 2ZN9A 1KQVA 2M7NA 1DVIA 1M45A 4U8DA 1J55A 1S6CA 2JWWA 2H61C 4YRUA 4NQGA 3I5GB 5FI7A 3VRNA 1OSAA 1GJYA 4INXA 3BQ3A 1J7RA 4DCKA 2JTTA 1WDCC 3I5IB 2CCMA 1SMGA 1EL4A 1Y1AA 1NSHA 3Q8IA 5KSZA 2LV7A 1JF2A 1DGUA 1RWYA 4MRYA 5D3OA 1S26D 2L0PA 3CZTX 2PVBA 3N7HA 4L9MA 4DRWA 1AJ5A 4IJ7A 1YRTB 1UHKA 1C7VA 5AFPA 1QWVA 2M1KB 2NCPA 3NGVA 1DF0B 5HKWA 5DKRA 3EK7A 2M0RA 3DYEA 3CS1A 3CDNA 1QS7A 1PULA 1XVJA 1F4OA 1KQMB 2NCOA 2LUXA 1CFCA 3BOWA 3LCPC 3I5FB 2KQ6A 2O60A 5B8IB 3CZ1A 4F0ZB 1LA0A 3O4YA 3LL8B 3DXLA 4GGFC 4XYNA 1NCXA 1SSEB 1TOPA 1IJ5A 1CMFA 1OMRA 2P6BB 3E3RA 3BYAA 3SIAA 3R1PA 4YBHB 2GV5A 2WCJA 1S5GZ 3OGNA 3QRXA 4YGBB 1SCMB 1TNQA 3VB1A 5J3XA 1ZMZA 3DVEA 3SG6A 1N2DA 2PASA 3NXAA 1DJWA 3I5HB 1IGVA 3FIAA 1TCFA 3UO9A 1GM0A 1T14A 3LK0A 1YVHA 3DF0B 1WLMA 4FQOA 2ZRSA 2KLDA 3CR4X 1B1GA 3FS7A 4BY4A 2COLB 3GK1A 1L2OB 1NP8A 1ODBA 1NIWA 1CDNA 1QIVA 1G33A 2LP3A 2PMYA 4PE1A 3S0FA 1N0YA 3NHIA 1FPWA 3D75A 1MR8A 4IL1A 1BMOA 1P28A 2JPOA 3D0YB 1V1FA 3QMEA 1SCVA 1N65A 1SL8A 5CPVA 3TDUA 2VRGA 1C3ZA 1CLBA 1QVIZ 2FJUB 2ZNEA 2KPHA 3F45A 3SG5A 4I5NB 3MSEB 1SL9A 2JT0A 2LP2A 3PM2A 4PE0A 4CIDA 1ALWA 1QTXA 2KNEA 1IQ3A 1C3YA 3B86A 3BUXB 1PK0D 3DVMA 1SW8A 1A75A 2ZRTA 3V2LA 4JD9A 3EK8A 3C1VA 1OMDA 1SNLA 4WQ3A 3OP0A 3PN7C 1WRZA 1JFKA 1QLSA 1XFZO 1BR4B 2KBMA 2LNKA 2TN4A 3S0BA 5HYDA 3VROA 1CKKA 3SG3A 1QIWA 4DUQA 2Y5IA 4AOMA 2PQLA 3PM8A 2QEVA 2I2RE 3S0DA 4N5XA 3AKBA 1MUXA 2A4JA 1KCYA 2BL0B 3LK1A 2PRUA 4MLWA 1DJZA 1CLLA 3HCMA 3SG7A 4A4BA 2IS9A 2L4HA 2WCMA 3CR5X 2WC8A 1QV0A 4USLA 4N1GA 2GTEA 2KI4B 1CLMA 1UP5A 4PHMA 3D76A 4XJKB 5HKYA 2SCPA 1IWQA 2BKHB 2WC5A 1LA3A 2LVKA 1RJVA 3EKHA 1M31A 1ORGA 1QJTA 1QV1A 4ORCB 5AXIA 3SS5A 4AQJA 1YURA 4QJ4B 1U5IA 4JQ0D 3JVTC 1A4PA 2KLEA 2HETA 2RGIA 3D10A 2L5XB 2P71A 3R72A 2WCKA 3KO0A 1SK6D 4MZJA 4MZLA 3VRPA 3RZSA 3TDZA 1L7ZA 2NLNA 1M46A 2EC6C 2WORA 3BFBA 5K89A 1K94A 3S0AA 4C0JA 3S0EA 4GPLB 3CZ0A 1M39A 3D74A 1QX2A 1ZOTB 3S0GA 1XA5A 2NZ0A 1HQVA 4DIRA 1MHOA 2KBIA 3NSOA 5PALA 1K2HA 1WDCB 1XYDA 1B9AA 1YR5A 1B7TY 2ZN8A 1KSMA 2E30A 1DJXA 3SS3A 3IQOA 3R1VA 3DY9A 1IIOA 4TNCA 2YGUA 1OOIX 5FI6A 3LLEA 2Y1NA 1R2UA 2OTGC 2CTNA 2Y1MA 4OV2A 4MRXA 2F2OA 3CLNA 3NSLA 2BCXA 4I5KA 5AERA 4YGAA 1LS8A 5D69A 4PHKA 1B8RA 1QVIY 5JOLA 2K0JA 1CB1A 5HLVA 2MLFC 1J1EA 1UUSA 2KAXA 2M49B 3BFHA 3SG4A 1DC1A 3BUOB 2KI6D 3AAJA 1KK7Y 3WXAA 4F7FA 1WY9A 1DJIA 3GK2A 3K21A 4GBAA 4MEWA 2K2AA 1SRAA 1CTRA 1OW4A 4FTGA 1OOJA 3B6XA 3GOFA 2WCEA 2PALA 1LINA 1DJHA 3K1EA 1S1EA 1J7OA 1NYAA 2L51A 1NCYA 3BUMB 2KOTA 5DKNA 1YUSA 2ZNDA 3H4SE 2NXQA 1JC2A 1CNPA 3D73A 1RTP1 2JT3A 2AUCA 1OQPA 4GNKB 1EXRA 1YVLA 5HLOA 2JRFA 2CXJA 1XFXO 1S3PA 1B8LA 1FF1A 1A29A 1ZUZA 1F70A 5DKQA 5AANA 1XO5A 5D7FA 2BAPA 1BOCA 1AJ4A 3FE6A 1S36A 5TNCA 4QJ5B 1RECA 2LAPA 2OS8C 1F71A 3IQQA 1CDMA 4ZCUA 3TZ1A 1B7TZ 4OR9B 2LVVA 1J7QA 1PSBA 1DMOA 4XJKA 3TUYC 4WQ2A 1C07A 1K8UA 1NX0A 1M63B 4P2YB 2LHLA 3D77A 1BT6A 2GGZA 3EK4A 1WRKA 1IJ6A 2LCPA 3HX4A 1WRLA 1SCMC 2M9GA 3DD4A 1KSOA 5KU1A 1X02A 3SIBA 1OMVA 2JULA 4KYNA 2LMVA 3CWGA 4BY5A 1AHRA 1E8AA 1F55A 1XFUO 2JNFA 3PN7B 2ISDA 1KK7Z 2I7AA 5KTYA 2LUCA 1YUUA 2PYQA 1OOHA 2Q4UA 1PRWA 4M2OA 1QASA 1BODA 2JXLA 4PHNA 1TNPA 5CSNA 2LMUA 4YGDB 2LVJA 4D1EA 1RROA 2LM5A 1W7JB 2LLSA 1K96A 1WLZA 2K8MB 2L98A 1JWDA 1UHNA 1KK8C 2K7CA 4ORBB 1SR6C 4UPGA 1G4YR 1CM4A 2QDIA 2P70A 3BOWB 3PSRA 4I5LB 3TS5C 1BU3A 2R2IA 2LLUA 2GGMA 2L4IA 3OBVA 1JFJA 2F3ZA 2BCBA 3SG2A 1KFUL 1FW4A 3IVTA 1GGWA 2LC5A 4MZKA 1KFXL 1TUJA 3KPXA 5DICA 2JTZA 1G8IA 2KGRA 5ER4X 1FI5A 1DELA 4YI9A 1J7PA 3JVTB 4CFQA 2K7BA 2JC2A 1DF0A 4GUKA 2Q91A 2B1UA 3VRQA 2MLEC 3PALA 2M3WA 2LANA 5I94A 3OHMB 2FJYA 5HL1A 2EC6B 2BECA 2EHBA 3CR2A 4FQTA 4CLNA 5JJGA 3KHEA 1K90D 3RM1A 1Y1UA 2JOJA 2MRDA 4HRGA 4OVNF 1FI6A 2DOQA 1JF0A 1QX7A 2FCDA 2WOSA 1DTLA 2KFGA 3CGAA 1AUIB 3EVRA 1AVSA 1LKJA 1SY9A 2FOTA 5I2OA 5AEQA 1YRUB 2KAVA 2O5GA 2BNXA 4PE7A 2LLTA 3FWBA 4JWQA 3O2PA 2HPSA 2WNDA 2OTGB 1BF5A 3O6BA 3JTDC 3R1OA 4ICBA 5IBWA 5FYXA 3DF0A 2L2CA 3NSIA 1D1OA 2I94A 1F4QA 2WCBA 1NX3A 4R1EA 2JNXA 3UNWA 4PALA 1MXLC 4E68A 1XK4A 1IH0A 3PFVA 3BXKA 2F3YA 1A75B 2L2EA 1FBVA 1KWOC 4JKTA 5I2LA 1MXEA 2JZIA 3A4UB 1PALA 1CDLA 1EJ3A 2L5YA 1CFDA 1MQ1A 1DJYA 2M1UA 4PDZA 1NX2A 1SYMA 4GFTA 4YGEB 1Z2CB 4NDDA 1JBAA 2LVIA 3D0YA 2QEHA 1AK8A 4YGCB 2M29A 3WHUB 2KFHA 1UURA 3IF7A 1NCZA 3PATA 1Y0VH 3L4AA 2FCEA 2MHHA 2WCLA 3BJHA 1ZFSA 3EG5B 2E6WA 4MN0A 1LVCD 1C7WA 2WCFA 1K9KA 2BCAA 3B7AA 5CSIA 2HQWA 3I5GC 3O78A 3KEVA 3PJIA 4HRHA 1OOFA 2ZKMX 4YI8A 4MSPA 3BUNB 1TIZA 2MA2A 3I5IC 2BKIB 1BR1B 1V1GA 3KF9A 1Y1XA 4CFRA 3CTNA 2F2PA 1JUOA 1PVBA 4JPZB 2K60A 2CT9A 5EL2A 4PE4A 1Z4HA 1TNXA 1Q80A 2G2BA 2JT8A 3FWCA 4AQIA 1H4BA 2L50A 1OE9B 1TWOA 2WCHA 3L47A 1XFYO 2H8VA 4I5JA 5G08A 3FE9A 1U5IB 1CFFA 1B4CA
chains in the Genus database with same CATH topology
2HF5A 2KHNA 1CDPA 3NSKA 1OZSA 2BE4A 2JXCA 3GK4X 2OS8B 5HKZA 1BG1A 4P5OE 1ALVA 3EVUA 3OB2B 1KQMC 2OPOA 4NDCA 2LMTA 2BBMA 2F8PA 2I18A 3I5FC 1CM1A 1J1DA 1A2XA 3TUYB 3BUWB 1H8BA 2MJWB 4PCWA 2M7LA 2H2KA 1B8CA 1QATA 2JQ6A 1EG3A 1BJFA 2K61A 5CSJA 1B47A 4GGNA 4ZCVA 3ZNIA 3OX5A 1DGVA 3EKJA 3SJSA 2LE9B 4ORAB 2KYCA 1IRJA 5I2QA 1QXPA 2AMIA 1YTZC 1RK9A 1NWDA 1QLKA 1UWOA 2JPTA 2KSPA 3I5HC 4PHJA 3ZWHA 1IG5A 1S6JA 2KDHA 1GGZA 1UHHA 4M2QA 1XK4C 2BBNA 1L2OC 2G9BA 1CFPA 2QACA 2BE6A 1JSAA 3TDIA 1K95A 4C0KA 1KK8B 2H61A 1SR6B 1S6IA 1NUBA 2JU0A 1PSRA 4MVFA 1YX8A 3TS5B 1R6PA 2K7OA 1QX5B 1TRFA 2MBXA 3VRRA 4HSZA 4C0LA 2KFFA 3RLZA 2KAYA 1RFJA 1YX7A 4ETOA 1K93D 4GAOA 1GQMA 2ZFDA 3PLFB 4WRIA 1AP4A 1ZACA 2F33A 2K2FA 2Y4QA 1SBJA 1F54A 1EH2A 3AAKA 3DVKA 1TN4A 3M0WA 2K7DA 2MAZA 3WHTB 3OB1B 3OX6A 2AAOA 4A4CA 1XFWO 2HQ8A 1IQ5A 2CNPA 1A03A 1PVAA 3EVVA 2PSRA 3A8RA 5GQQC 4OCIA 4CPVA 4GGFA 1KFUS 1Y6WA 1SKTA 1HT9A 2M97A 1KFXS 2SASA 1UHJA 3DVJA 4N1FA 2KQYA 1YUTA 4HREE 5BPJA 1XFVO 2V53A 2BL0C 1F8HA 1SPYA 4OKHA 1MWNA 1NX1A 3ICBA 1DT7B 1K9PA 1VRKA 1CMGA 1EG4A 2D8NA 1IKUA 2KI4C 4Q04A 3AKAA 3JTDB 4QJ3B 2KI6C 1SL7A 4DS7A 2M8UA 1W7IB 2KYFA 5F6TA 1S5GY 1TCOB 2EGDA 1NPQA 4NDBA 4MBEA 1KWOB 1TTXA 1OZOA 5ER5A 1UHIA 2LHIA 1K9UA 1MF8B 1DJGA 2QPTA 2CBLA 4M2PA 1LXFC 1BLQA 3VGOA 3WNXB 5I8NA 1TNWA 5CSFA 2KGBC 2ZN9A 1KQVA 2M7NA 1DVIA 1M45A 4U8DA 1J55A 1S6CA 2JWWA 2H61C 4YRUA 4NQGA 3I5GB 3VRNA 1OSAA 1GJYA 3BQ3A 1J7RA 4DCKA 2JTTA 1WDCC 3I5IB 2CCMA 1SMGA 1EL4A 1Y1AA 1NSHA 5KSZA 2LV7A 1JF2A 1DGUA 1RWYA 4MRYA 1S26D 2L0PA 3CZTX 2PVBA 4L9MA 4DRWA 1AJ5A 1YRTB 1UHKA 1C7VA 5AFPA 2M1KB 2NCPA 1DF0B 5HKWA 5DKRA 3EK7A 2M0RA 3CS1A 1QS7A 1PULA 1XVJA 1F4OA 1KQMB 2NCOA 2LUXA 1CFCA 3BOWA 3LCPC 3I5FB 2KQ6A 2O60A 5B8IB 4F0ZB 1LA0A 3O4YA 3LL8B 4GGFC 4XYNA 1NCXA 1TOPA 1IJ5A 1CMFA 1OMRA 2P6BB 3E3RA 3BYAA 3SIAA 4YBHB 2GV5A 1S5GZ 3QRXA 4YGBB 1SCMB 1TNQA 5J3XA 1ZMZA 3DVEA 3SG6A 1N2DA 2PASA 3NXAA 1DJWA 3I5HB 1IGVA 3FIAA 1TCFA 3LK0A 1YVHA 3DF0B 1WLMA 4FQOA 2ZRSA 3CR4X 1B1GA 3FS7A 4BY4A 2COLB 3GK1A 1L2OB 1NP8A 1ODBA 1NIWA 1CDNA 1QIVA 1G33A 2LP3A 2PMYA 4PE1A 1N0YA 1FPWA 1MR8A 4IL1A 1BMOA 3D0YB 1V1FA 1SCVA 1N65A 1SL8A 5CPVA 3TDUA 2VRGA 1CLBA 1QVIZ 2FJUB 2ZNEA 3F45A 3SG5A 4I5NB 3MSEB 1SL9A 2JT0A 2LP2A 4PE0A 4CIDA 1ALWA 1QTXA 2KNEA 1IQ3A 3BUXB 1PK0D 3DVMA 1SW8A 1A75A 2ZRTA 3EK8A 3C1VA 1OMDA 1SNLA 4WQ3A 3OP0A 3PN7C 1WRZA 1JFKA 1QLSA 1XFZO 1BR4B 2KBMA 2LNKA 2TN4A 5HYDA 3VROA 1CKKA 3SG3A 1QIWA 4DUQA 2Y5IA 3PM8A 2I2RE 4N5XA 3AKBA 1MUXA 2A4JA 1KCYA 2BL0B 3LK1A 2PRUA 4MLWA 1DJZA 1CLLA 3HCMA 3SG7A 4A4BA 2IS9A 2L4HA 4USLA 3CR5X 2WC8A 1QV0A 4N1GA 2KI4B 1CLMA 1UP5A 4PHMA 4XJKB 5HKYA 2SCPA 1IWQA 2BKHB 1LA3A 2LVKA 1RJVA 3EKHA 1M31A 1QJTA 1QV1A 4ORCB 5AXIA 4AQJA 1YURA 4QJ4B 1U5IA 4JQ0D 3JVTC 1A4PA 2HETA 2RGIA 3D10A 2L5XB 4MZLA 4MZJA 3VRPA 3KO0A 1SK6D 3TDZA 1L7ZA 2NLNA 1M46A 2EC6C 2WORA 5K89A 1K94A 4C0JA 4GPLB 1M39A 1QX2A 1ZOTB 1XA5A 2NZ0A 1HQVA 4DIRA 1MHOA 2KBIA 3NSOA 5PALA 1K2HA 1WDCB 1XYDA 1B9AA 1YR5A 1B7TY 2ZN8A 1KSMA 2E30A 1DJXA 3IQOA 4TNCA 3LLEA 2Y1NA 1R2UA 2OTGC 2CTNA 2Y1MA 4OV2A 4MRXA 2F2OA 3CLNA 3NSLA 2BCXA 4I5KA 5AERA 4YGAA 5D69A 4PHKA 1B8RA 1QVIY 5JOLA 2K0JA 1CB1A 5HLVA 2MLFC 1J1EA 1UUSA 2KAXA 2M49B 3SG4A 3BUOB 2KI6D 3AAJA 1KK7Y 3WXAA 1WY9A 1DJIA 3GK2A 3K21A 4GBAA 4MEWA 2K2AA 1SRAA 1CTRA 4FTGA 1OOJA 3GOFA 2WCEA 2PALA 1LINA 1DJHA 1S1EA 1J7OA 1NYAA 2L51A 1NCYA 3BUMB 2KOTA 5DKNA 1YUSA 2ZNDA 3H4SE 2NXQA 1JC2A 1CNPA 1RTP1 2JT3A 2AUCA 1OQPA 4GNKB 1EXRA 1YVLA 5HLOA 2JRFA 2CXJA 1XFXO 1S3PA 1B8LA 1A29A 1ZUZA 1F70A 5DKQA 5AANA 1XO5A 5D7FA 1BOCA 1AJ4A 1S36A 5TNCA 4QJ5B 1RECA 2LAPA 2OS8C 1F71A 3IQQA 1CDMA 4ZCUA 3TZ1A 1B7TZ 4OR9B 2LVVA 1DMOA 1PSBA 4XJKA 3TUYC 4WQ2A 1C07A 1K8UA 1NX0A 1M63B 4P2YB 2LHLA 1BT6A 2GGZA 3EK4A 1WRKA 1IJ6A 2LCPA 3HX4A 1WRLA 1SCMC 2M9GA 3DD4A 1KSOA 5KU1A 1X02A 3SIBA 1OMVA 2JULA 2LMVA 3CWGA 4BY5A 1AHRA 1E8AA 1F55A 1XFUO 2JNFA 3PN7B 2ISDA 1KK7Z 2I7AA 5KTYA 2LUCA 1YUUA 2Q4UA 1PRWA 4M2OA 1QASA 1BODA 2JXLA 4PHNA 1TNPA 5CSNA 2LMUA 4YGDB 2LVJA 4D1EA 1RROA 2LM5A 1W7JB 2LLSA 1K96A 1WLZA 2K8MB 2L98A 1JWDA 1UHNA 1KK8C 2K7CA 4ORBB 1SR6C 4UPGA 1G4YR 1CM4A 3BOWB 3PSRA 4I5LB 3TS5C 1BU3A 2R2IA 2LLUA 2GGMA 2L4IA 1JFJA 2F3ZA 2BCBA 3SG2A 1KFUL 1FW4A 1GGWA 2LC5A 4MZKA 1KFXL 3KPXA 2JTZA 1G8IA 2KGRA 5ER4X 1FI5A 4YI9A 1J7PA 3JVTB 4CFQA 2K7BA 2JC2A 1DF0A 4GUKA 2Q91A 2B1UA 3VRQA 2MLEC 3PALA 2M3WA 2LANA 3OHMB 1FF1A 2EC6B 2BECA 2EHBA 3CR2A 4CLNA 5JJGA 3KHEA 1K90D 3RM1A 1Y1UA 2JOJA 2MRDA 4HRGA 4OVNF 1FI6A 2DOQA 1JF0A 1QX7A 2FCDA 2WOSA 1DTLA 2KFGA 3CGAA 1AUIB 3EVRA 1AVSA 1LKJA 1SY9A 2FOTA 5I2OA 5AEQA 1YRUB 2KAVA 2O5GA 4PE7A 2LLTA 3FWBA 4JWQA 3O2PA 2HPSA 2WNDA 2OTGB 1BF5A 3O6BA 3JTDC 4ICBA 5IBWA 5FYXA 3DF0A 3NSIA 1D1OA 2I94A 1F4QA 2WCBA 1NX3A 4R1EA 2JNXA 4E68A 4PALA 1MXLC 1J7QA 1XK4A 1IH0A 3PFVA 3BXKA 2F3YA 1A75B 2L2EA 1FBVA 1KWOC 5I2LA 1MXEA 2JZIA 3A4UB 1PALA 1CDLA 1EJ3A 1CFDA 1MQ1A 1DJYA 2M1UA 4PDZA 1NX2A 1SYMA 4GFTA 4YGEB 4NDDA 1JBAA 2LVIA 3D0YA 1AK8A 4YGCB 2M29A 3WHUB 2KFHA 1UURA 3IF7A 1NCZA 3PATA 1Y0VH 4MN0A 2FCEA 2MHHA 4AOMA 1ZFSA 2E6WA 1LVCD 1C7WA 2WCFA 1K9KA 2BCAA 5CSIA 2HQWA 3I5GC 3O78A 3KEVA 4HRHA 2ZKMX 4YI8A 4MSPA 3BUNB 1TIZA 2MA2A 3I5IC 2BKIB 1BR1B 1V1GA 3KF9A 1Y1XA 4CFRA 3CTNA 2F2PA 1JUOA 1PVBA 4JPZB 2CT9A 4PE4A 1TNXA 1Q80A 2G2BA 2JT8A 3FWCA 4AQIA 1H4BA 2L50A 1OE9B 1XFYO 4I5JA 5G08A 1U5IB 1CFFA 1B4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF5 A;  2KHN A;  1CDP A;  3NSK A;  1OZS A;  2BE4 A;  2JXC A;  3GK4 X;  2OS8 B;  5HKZ A;  1BG1 A;  4P5O E;  1ALV A;  3EVU A;  3OB2 B;  1KQM C;  2OPO A;  4NDC A;  2LMT A;  2BBM A;  2F8P A;  2I18 A;  3I5F C;  1CM1 A;  1J1D A;  1A2X A;  3TUY B;  3BUW B;  1H8B A;  2MJW B;  4PCW A;  2M7L A;  2H2K A;  1B8C A;  1QAT A;  2JQ6 A;  1EG3 A;  1BJF A;  2K61 A;  5CSJ A;  1B47 A;  4GGN A;  4ZCV A;  3ZNI A;  3OX5 A;  1DGV A;  3EKJ A;  3SJS A;  2LE9 B;  4ORA B;  2KYC A;  1IRJ A;  5I2Q A;  1QXP A;  2AMI A;  1YTZ C;  1RK9 A;  1NWD A;  1QLK A;  1UWO A;  2JPT A;  2KSP A;  3I5H C;  4PHJ A;  3ZWH A;  1IG5 A;  1S6J A;  2KDH A;  1GGZ A;  1UHH A;  4M2Q A;  1XK4 C;  2BBN A;  1L2O C;  2G9B A;  1CFP A;  2QAC A;  2BE6 A;  1JSA A;  3TDI A;  1K95 A;  4C0K A;  1KK8 B;  2H61 A;  1SR6 B;  1S6I A;  1NUB A;  2JU0 A;  1PSR A;  4MVF A;  1YX8 A;  3TS5 B;  1R6P A;  2K7O A;  1QX5 B;  1TRF A;  2MBX A;  3VRR A;  4HSZ A;  4C0L A;  2KFF A;  3RLZ A;  2KAY A;  1RFJ A;  1YX7 A;  4ETO A;  1K93 D;  4GAO A;  1GQM A;  2ZFD A;  3PLF B;  4WRI A;  1AP4 A;  1ZAC A;  2F33 A;  2K2F A;  2Y4Q A;  1SBJ A;  1F54 A;  1EH2 A;  3AAK A;  3DVK A;  1TN4 A;  3M0W A;  2K7D A;  2MAZ A;  3WHT B;  3OB1 B;  3OX6 A;  2AAO A;  4A4C A;  1XFW O;  2HQ8 A;  1IQ5 A;  2CNP A;  1A03 A;  1PVA A;  3EVV A;  2PSR A;  3A8R A;  5GQQ C;  4OCI A;  4CPV A;  4GGF A;  1KFU S;  1Y6W A;  1SKT A;  1HT9 A;  2M97 A;  1KFX S;  2SAS A;  1UHJ A;  3DVJ A;  4N1F A;  2KQY A;  1YUT A;  4HRE E;  5BPJ A;  1XFV O;  2V53 A;  2BL0 C;  1F8H A;  1SPY A;  4OKH A;  1MWN A;  1NX1 A;  3ICB A;  1DT7 B;  1K9P A;  1VRK A;  1CMG A;  1EG4 A;  2D8N A;  1IKU A;  2KI4 C;  4Q04 A;  3AKA A;  3JTD B;  4QJ3 B;  2KI6 C;  1SL7 A;  4DS7 A;  2M8U A;  1W7I B;  2KYF A;  5F6T A;  1S5G Y;  1TCO B;  2EGD A;  1NPQ A;  4NDB A;  4MBE A;  1KWO B;  1TTX A;  1OZO A;  5ER5 A;  1UHI A;  2LHI A;  1K9U A;  1MF8 B;  1DJG A;  2QPT A;  2CBL A;  4M2P A;  1LXF C;  1BLQ A;  3VGO A;  3WNX B;  5I8N A;  1TNW A;  5CSF A;  2KGB C;  2ZN9 A;  1KQV A;  2M7N A;  1DVI A;  1M45 A;  4U8D A;  1J55 A;  1S6C A;  2JWW A;  2H61 C;  4YRU A;  4NQG A;  3I5G B;  3VRN A;  1OSA A;  1GJY A;  3BQ3 A;  1J7R A;  4DCK A;  2JTT A;  1WDC C;  3I5I B;  2CCM A;  1SMG A;  1EL4 A;  1Y1A A;  1NSH A;  5KSZ A;  2LV7 A;  1JF2 A;  1DGU A;  1RWY A;  4MRY A;  1S26 D;  2L0P A;  3CZT X;  2PVB A;  4L9M A;  4DRW A;  1AJ5 A;  1YRT B;  1UHK A;  1C7V A;  5AFP A;  2M1K B;  2NCP A;  1DF0 B;  5HKW A;  5DKR A;  3EK7 A;  2M0R A;  3CS1 A;  1QS7 A;  1PUL A;  1XVJ A;  1F4O A;  1KQM B;  2NCO A;  2LUX A;  1CFC A;  3BOW A;  3LCP C;  3I5F B;  2KQ6 A;  2O60 A;  5B8I B;  4F0Z B;  1LA0 A;  3O4Y A;  3LL8 B;  4GGF C;  4XYN A;  1NCX A;  1TOP A;  1IJ5 A;  1CMF A;  1OMR A;  2P6B B;  3E3R A;  3BYA A;  3SIA A;  4YBH B;  2GV5 A;  1S5G Z;  3QRX A;  4YGB B;  1SCM B;  1TNQ A;  5J3X A;  1ZMZ A;  3DVE A;  3SG6 A;  1N2D A;  2PAS A;  3NXA A;  1DJW A;  3I5H B;  1IGV A;  3FIA A;  1TCF A;  3LK0 A;  1YVH A;  3DF0 B;  1WLM A;  4FQO A;  2ZRS A;  3CR4 X;  1B1G A;  3FS7 A;  4BY4 A;  2COL B;  3GK1 A;  1L2O B;  1NP8 A;  1ODB A;  1NIW A;  1CDN A;  1QIV A;  1G33 A;  2LP3 A;  2PMY A;  4PE1 A;  1N0Y A;  1FPW A;  1MR8 A;  4IL1 A;  1BMO A;  3D0Y B;  1V1F A;  1SCV A;  1N65 A;  1SL8 A;  5CPV A;  3TDU A;  2VRG A;  1CLB A;  1QVI Z;  2FJU B;  2ZNE A;  3F45 A;  3SG5 A;  4I5N B;  3MSE B;  1SL9 A;  2JT0 A;  2LP2 A;  4PE0 A;  4CID A;  1ALW A;  1QTX A;  2KNE A;  1IQ3 A;  3BUX B;  1PK0 D;  3DVM A;  1SW8 A;  1A75 A;  2ZRT A;  3EK8 A;  3C1V A;  1OMD A;  1SNL A;  4WQ3 A;  3OP0 A;  3PN7 C;  1WRZ A;  1JFK A;  1QLS A;  1XFZ O;  1BR4 B;  2KBM A;  2LNK A;  2TN4 A;  5HYD A;  3VRO A;  1CKK A;  3SG3 A;  1QIW A;  4DUQ A;  2Y5I A;  3PM8 A;  2I2R E;  4N5X A;  3AKB A;  1MUX A;  2A4J A;  1KCY A;  2BL0 B;  3LK1 A;  2PRU A;  4MLW A;  1DJZ A;  1CLL A;  3HCM A;  3SG7 A;  4A4B A;  2IS9 A;  2L4H A;  4USL A;  3CR5 X;  2WC8 A;  1QV0 A;  4N1G A;  2KI4 B;  1CLM A;  1UP5 A;  4PHM A;  4XJK B;  5HKY A;  2SCP A;  1IWQ A;  2BKH B;  1LA3 A;  2LVK A;  1RJV A;  3EKH A;  1M31 A;  1QJT A;  1QV1 A;  4ORC B;  5AXI A;  4AQJ A;  1YUR A;  4QJ4 B;  1U5I A;  4JQ0 D;  3JVT C;  1A4P A;  2HET A;  2RGI A;  3D10 A;  2L5X B;  4MZL A;  4MZJ A;  3VRP A;  3KO0 A;  1SK6 D;  3TDZ A;  1L7Z A;  2NLN A;  1M46 A;  2EC6 C;  2WOR A;  5K89 A;  1K94 A;  4C0J A;  4GPL B;  1M39 A;  1QX2 A;  1ZOT B;  1XA5 A;  2NZ0 A;  1HQV A;  4DIR A;  1MHO A;  2KBI A;  3NSO A;  5PAL A;  1K2H A;  1WDC B;  1XYD A;  1B9A A;  1YR5 A;  1B7T Y;  2ZN8 A;  1KSM A;  2E30 A;  1DJX A;  3IQO A;  4TNC A;  3LLE A;  2Y1N A;  1R2U A;  2OTG C;  2CTN A;  2Y1M A;  4OV2 A;  4MRX A;  2F2O A;  3CLN A;  3NSL A;  2BCX A;  4I5K A;  5AER A;  4YGA A;  5D69 A;  4PHK A;  1B8R A;  1QVI Y;  5JOL A;  2K0J A;  1CB1 A;  5HLV A;  2MLF C;  1J1E A;  1UUS A;  2KAX A;  2M49 B;  3SG4 A;  3BUO B;  2KI6 D;  3AAJ A;  1KK7 Y;  3WXA A;  1WY9 A;  1DJI A;  3GK2 A;  3K21 A;  4GBA A;  4MEW A;  2K2A A;  1SRA A;  1CTR A;  4FTG A;  1OOJ A;  3GOF A;  2WCE A;  2PAL A;  1LIN A;  1DJH A;  1S1E A;  1J7O A;  1NYA A;  2L51 A;  1NCY A;  3BUM B;  2KOT A;  5DKN A;  1YUS A;  2ZND A;  3H4S E;  2NXQ A;  1JC2 A;  1CNP A;  1RTP 1;  2JT3 A;  2AUC A;  1OQP A;  4GNK B;  1EXR A;  1YVL A;  5HLO A;  2JRF A;  2CXJ A;  1XFX O;  1S3P A;  1B8L A;  1A29 A;  1ZUZ A;  1F70 A;  5DKQ A;  5AAN A;  1XO5 A;  5D7F A;  1BOC A;  1AJ4 A;  1S36 A;  5TNC A;  4QJ5 B;  1REC A;  2LAP A;  2OS8 C;  1F71 A;  3IQQ A;  1CDM A;  4ZCU A;  3TZ1 A;  1B7T Z;  4OR9 B;  2LVV A;  1DMO A;  1PSB A;  4XJK A;  3TUY C;  4WQ2 A;  1C07 A;  1K8U A;  1NX0 A;  1M63 B;  4P2Y B;  2LHL A;  1BT6 A;  2GGZ A;  3EK4 A;  1WRK A;  1IJ6 A;  2LCP A;  3HX4 A;  1WRL A;  1SCM C;  2M9G A;  3DD4 A;  1KSO A;  5KU1 A;  1X02 A;  3SIB A;  1OMV A;  2JUL A;  2LMV A;  3CWG A;  4BY5 A;  1AHR A;  1E8A A;  1F55 A;  1XFU O;  2JNF A;  3PN7 B;  2ISD A;  1KK7 Z;  2I7A A;  5KTY A;  2LUC A;  1YUU A;  2Q4U A;  1PRW A;  4M2O A;  1QAS A;  1BOD A;  2JXL A;  4PHN A;  1TNP A;  5CSN A;  2LMU A;  4YGD B;  2LVJ A;  4D1E A;  1RRO A;  2LM5 A;  1W7J B;  2LLS A;  1K96 A;  1WLZ A;  2K8M B;  2L98 A;  1JWD A;  1UHN A;  1KK8 C;  2K7C A;  4ORB B;  1SR6 C;  4UPG A;  1G4Y R;  1CM4 A;  3BOW B;  3PSR A;  4I5L B;  3TS5 C;  1BU3 A;  2R2I A;  2LLU A;  2GGM A;  2L4I A;  1JFJ A;  2F3Z A;  2BCB A;  3SG2 A;  1KFU L;  1FW4 A;  1GGW A;  2LC5 A;  4MZK A;  1KFX L;  3KPX A;  2JTZ A;  1G8I A;  2KGR A;  5ER4 X;  1FI5 A;  4YI9 A;  1J7P A;  3JVT B;  4CFQ A;  2K7B A;  2JC2 A;  1DF0 A;  4GUK A;  2Q91 A;  2B1U A;  3VRQ A;  2MLE C;  3PAL A;  2M3W A;  2LAN A;  3OHM B;  1FF1 A;  2EC6 B;  2BEC A;  2EHB A;  3CR2 A;  4CLN A;  5JJG A;  3KHE A;  1K90 D;  3RM1 A;  1Y1U A;  2JOJ A;  2MRD A;  4HRG A;  4OVN F;  1FI6 A;  2DOQ A;  1JF0 A;  1QX7 A;  2FCD A;  2WOS A;  1DTL A;  2KFG A;  3CGA A;  1AUI B;  3EVR A;  1AVS A;  1LKJ A;  1SY9 A;  2FOT A;  5I2O A;  5AEQ A;  1YRU B;  2KAV A;  2O5G A;  4PE7 A;  2LLT A;  3FWB A;  4JWQ A;  3O2P A;  2HPS A;  2WND A;  2OTG B;  1BF5 A;  3O6B A;  3JTD C;  4ICB A;  5IBW A;  5FYX A;  3DF0 A;  3NSI A;  1D1O A;  2I94 A;  1F4Q A;  2WCB A;  1NX3 A;  4R1E A;  2JNX A;  4E68 A;  4PAL A;  1MXL C;  1J7Q A;  1XK4 A;  1IH0 A;  3PFV A;  3BXK A;  2F3Y A;  1A75 B;  2L2E A;  1FBV A;  1KWO C;  5I2L A;  1MXE A;  2JZI A;  3A4U B;  1PAL A;  1CDL A;  1EJ3 A;  1CFD A;  1MQ1 A;  1DJY A;  2M1U A;  4PDZ A;  1NX2 A;  1SYM A;  4GFT A;  4YGE B;  4NDD A;  1JBA A;  2LVI A;  3D0Y A;  1AK8 A;  4YGC B;  2M29 A;  3WHU B;  2KFH A;  1UUR A;  3IF7 A;  1NCZ A;  3PAT A;  1Y0V H;  4MN0 A;  2FCE A;  2MHH A;  4AOM A;  1ZFS A;  2E6W A;  1LVC D;  1C7W A;  2WCF A;  1K9K A;  2BCA A;  5CSI A;  2HQW A;  3I5G C;  3O78 A;  3KEV A;  4HRH A;  2ZKM X;  4YI8 A;  4MSP A;  3BUN B;  1TIZ A;  2MA2 A;  3I5I C;  2BKI B;  1BR1 B;  1V1G A;  3KF9 A;  1Y1X A;  4CFR A;  3CTN A;  2F2P A;  1JUO A;  1PVB A;  4JPZ B;  2CT9 A;  4PE4 A;  1TNX A;  1Q80 A;  2G2B A;  2JT8 A;  3FWC A;  4AQI A;  1H4B A;  2L50 A;  1OE9 B;  1XFY O;  4I5J A;  5G08 A;  1U5I B;  1CFF A;  1B4C A; 
#chains in the Genus database with same CATH topology
 3L4L A;  2HF5 A;  2KHN A;  1CDP A;  3NSK A;  1OZS A;  4PT1 A;  2BE4 A;  2JXC A;  3BFA A;  3GK4 X;  5FI2 A;  2OS8 B;  5HKZ A;  1BG1 A;  3NHT A;  1TUZ A;  4P5O E;  1ALV A;  3EVU A;  3OB2 B;  1KQM C;  2OPO A;  4NDC A;  2LMT A;  2BBM A;  2F8P A;  2I18 A;  3I5F C;  1CM1 A;  1J1D A;  1A2X A;  3TUY B;  3BUW B;  1H8B A;  2MJW B;  4PCW A;  2M7L A;  1DEK A;  1B8C A;  2H2K A;  1QAT A;  2JQ6 A;  1EG3 A;  1BJF A;  2K61 A;  3CYZ A;  1B47 A;  4GGN A;  5CSJ A;  4ZCV A;  3OX5 A;  3ZNI A;  1DGV A;  3EKJ A;  2ERB A;  1W9Z A;  3SJS A;  2LE9 B;  4ORA B;  2KYC A;  1IRJ A;  5I2Q A;  3CZ2 A;  1QXP A;  2AMI A;  1YTZ C;  1RK9 A;  1NWD A;  1QLK A;  1UWO A;  2JPT A;  2KSP A;  3I5H C;  4PHJ A;  1XFR A;  3ZWH A;  1IG5 A;  1S6J A;  2KDH A;  1GGZ A;  1UHH A;  4M2Q A;  1XK4 C;  2BBN A;  1L2O C;  2G9B A;  1CFP A;  2QAC A;  2QEO A;  1DQE A;  2BE6 A;  1JSA A;  3TDI A;  3SS4 A;  1K95 A;  4C0K A;  1KK8 B;  2H61 A;  1SR6 B;  2WC6 A;  1S6I A;  3B87 A;  1NUB A;  2JU0 A;  1PSR A;  4MVF A;  1YX8 A;  3TS5 B;  1R6P A;  2K7O A;  3D78 A;  1QX5 B;  1TRF A;  2MBX A;  3VRR A;  2QEB A;  4HSZ A;  4C0L A;  2KFF A;  3RLZ A;  2KAY A;  1RFJ A;  1YX7 A;  4ETO A;  1K93 D;  4GAO A;  1GQM A;  2ZFD A;  3PLF B;  4WRI A;  1AP4 A;  1ZAC A;  2F33 A;  2K2F A;  2Y4Q A;  1SBJ A;  1F54 A;  1EH2 A;  3AAK A;  3DVK A;  1TN4 A;  3M0W A;  2K7D A;  2MAZ A;  3WHT B;  3OB1 B;  3OX6 A;  2AAO A;  4A4C A;  1XFW O;  2HQ8 A;  1IQ5 A;  2CNP A;  1A03 A;  1PVA A;  3EVV A;  2PSR A;  1OOG A;  3A8R A;  5GQQ C;  4OZD A;  4OCI A;  4CPV A;  4GGF A;  1KFU S;  1Y6W A;  1SKT A;  1HT9 A;  3FE8 A;  2M97 A;  1KFX S;  2SAS A;  1UHJ A;  3DVJ A;  4N1F A;  2KQY A;  1YUT A;  4HRE E;  5BPJ A;  1XFV O;  3DZT A;  2V53 A;  2BL0 C;  1F8H A;  1SPY A;  4OKH A;  1MWN A;  1NX1 A;  3O4X A;  3ICB A;  1DT7 B;  1K9P A;  1VRK A;  1CMG A;  1EG4 A;  2D8N A;  1IKU A;  2KI4 C;  4Q04 A;  3AKA A;  3JTD B;  4QJ3 B;  2KI6 C;  1SL7 A;  4DS7 A;  2M8U A;  3B88 A;  1W7I B;  2KYF A;  5F6T A;  1S5G Y;  1TCO B;  2EGD A;  1NPQ A;  4NDB A;  4MBE A;  1KWO B;  1TTX A;  1OZO A;  4INW A;  1UHI A;  5ER5 A;  2LHI A;  1K9U A;  1MF8 B;  1DJG A;  2QPT A;  2CBL A;  4M2P A;  1LXF C;  3CAB A;  3VGO A;  3WNX B;  5I8N A;  1TNW A;  1BLQ A;  5CSF A;  2KGB C;  2ZN9 A;  1KQV A;  2M7N A;  1DVI A;  1M45 A;  4U8D A;  1J55 A;  1S6C A;  2JWW A;  2H61 C;  4YRU A;  4NQG A;  3I5G B;  5FI7 A;  3VRN A;  1OSA A;  1GJY A;  4INX A;  3BQ3 A;  1J7R A;  4DCK A;  2JTT A;  1WDC C;  3I5I B;  2CCM A;  1SMG A;  1EL4 A;  1Y1A A;  1NSH A;  3Q8I A;  5KSZ A;  2LV7 A;  1JF2 A;  1DGU A;  1RWY A;  4MRY A;  5D3O A;  1S26 D;  2L0P A;  3CZT X;  2PVB A;  3N7H A;  4L9M A;  4DRW A;  1AJ5 A;  4IJ7 A;  1YRT B;  1UHK A;  1C7V A;  5AFP A;  1QWV A;  2M1K B;  2NCP A;  3NGV A;  1DF0 B;  5HKW A;  5DKR A;  3EK7 A;  2M0R A;  3DYE A;  3CS1 A;  3CDN A;  1QS7 A;  1PUL A;  1XVJ A;  1F4O A;  1KQM B;  2NCO A;  2LUX A;  1CFC A;  3BOW A;  3LCP C;  3I5F B;  2KQ6 A;  2O60 A;  5B8I B;  3CZ1 A;  4F0Z B;  1LA0 A;  3O4Y A;  3LL8 B;  3DXL A;  4GGF C;  4XYN A;  1NCX A;  1SSE B;  1TOP A;  1IJ5 A;  1CMF A;  1OMR A;  2P6B B;  3E3R A;  3BYA A;  3SIA A;  3R1P A;  4YBH B;  2GV5 A;  2WCJ A;  1S5G Z;  3OGN A;  3QRX A;  4YGB B;  1SCM B;  1TNQ A;  3VB1 A;  5J3X A;  1ZMZ A;  3DVE A;  3SG6 A;  1N2D A;  2PAS A;  3NXA A;  1DJW A;  3I5H B;  1IGV A;  3FIA A;  1TCF A;  3UO9 A;  1GM0 A;  1T14 A;  3LK0 A;  1YVH A;  3DF0 B;  1WLM A;  4FQO A;  2ZRS A;  2KLD A;  3CR4 X;  1B1G A;  3FS7 A;  4BY4 A;  2COL B;  3GK1 A;  1L2O B;  1NP8 A;  1ODB A;  1NIW A;  1CDN A;  1QIV A;  1G33 A;  2LP3 A;  2PMY A;  4PE1 A;  3S0F A;  1N0Y A;  3NHI A;  1FPW A;  3D75 A;  1MR8 A;  4IL1 A;  1BMO A;  1P28 A;  2JPO A;  3D0Y B;  1V1F A;  3QME A;  1SCV A;  1N65 A;  1SL8 A;  5CPV A;  3TDU A;  2VRG A;  1C3Z A;  1CLB A;  1QVI Z;  2FJU B;  2ZNE A;  2KPH A;  3F45 A;  3SG5 A;  4I5N B;  3MSE B;  1SL9 A;  2JT0 A;  2LP2 A;  3PM2 A;  4PE0 A;  4CID A;  1ALW A;  1QTX A;  2KNE A;  1IQ3 A;  1C3Y A;  3B86 A;  3BUX B;  1PK0 D;  3DVM A;  1SW8 A;  1A75 A;  2ZRT A;  3V2L A;  4JD9 A;  3EK8 A;  3C1V A;  1OMD A;  1SNL A;  4WQ3 A;  3OP0 A;  3PN7 C;  1WRZ A;  1JFK A;  1QLS A;  1XFZ O;  1BR4 B;  2KBM A;  2LNK A;  2TN4 A;  3S0B A;  5HYD A;  3VRO A;  1CKK A;  3SG3 A;  1QIW A;  4DUQ A;  2Y5I A;  4AOM A;  2PQL A;  3PM8 A;  2QEV A;  2I2R E;  3S0D A;  4N5X A;  3AKB A;  1MUX A;  2A4J A;  1KCY A;  2BL0 B;  3LK1 A;  2PRU A;  4MLW A;  1DJZ A;  1CLL A;  3HCM A;  3SG7 A;  4A4B A;  2IS9 A;  2L4H A;  2WCM A;  3CR5 X;  2WC8 A;  1QV0 A;  4USL A;  4N1G A;  2GTE A;  2KI4 B;  1CLM A;  1UP5 A;  4PHM A;  3D76 A;  4XJK B;  5HKY A;  2SCP A;  1IWQ A;  2BKH B;  2WC5 A;  1LA3 A;  2LVK A;  1RJV A;  3EKH A;  1M31 A;  1ORG A;  1QJT A;  1QV1 A;  4ORC B;  5AXI A;  3SS5 A;  4AQJ A;  1YUR A;  4QJ4 B;  1U5I A;  4JQ0 D;  3JVT C;  1A4P A;  2KLE A;  2HET A;  2RGI A;  3D10 A;  2L5X B;  2P71 A;  3R72 A;  2WCK A;  3KO0 A;  1SK6 D;  4MZJ A;  4MZL A;  3VRP A;  3RZS A;  3TDZ A;  1L7Z A;  2NLN A;  1M46 A;  2EC6 C;  2WOR A;  3BFB A;  5K89 A;  1K94 A;  3S0A A;  4C0J A;  3S0E A;  4GPL B;  3CZ0 A;  1M39 A;  3D74 A;  1QX2 A;  1ZOT B;  3S0G A;  1XA5 A;  2NZ0 A;  1HQV A;  4DIR A;  1MHO A;  2KBI A;  3NSO A;  5PAL A;  1K2H A;  1WDC B;  1XYD A;  1B9A A;  1YR5 A;  1B7T Y;  2ZN8 A;  1KSM A;  2E30 A;  1DJX A;  3SS3 A;  3IQO A;  3R1V A;  3DY9 A;  1IIO A;  4TNC A;  2YGU A;  1OOI X;  5FI6 A;  3LLE A;  2Y1N A;  1R2U A;  2OTG C;  2CTN A;  2Y1M A;  4OV2 A;  4MRX A;  2F2O A;  3CLN A;  3NSL A;  2BCX A;  4I5K A;  5AER A;  4YGA A;  1LS8 A;  5D69 A;  4PHK A;  1B8R A;  1QVI Y;  5JOL A;  2K0J A;  1CB1 A;  5HLV A;  2MLF C;  1J1E A;  1UUS A;  2KAX A;  2M49 B;  3BFH A;  3SG4 A;  1DC1 A;  3BUO B;  2KI6 D;  3AAJ A;  1KK7 Y;  3WXA A;  4F7F A;  1WY9 A;  1DJI A;  3GK2 A;  3K21 A;  4GBA A;  4MEW A;  2K2A A;  1SRA A;  1CTR A;  1OW4 A;  4FTG A;  1OOJ A;  3B6X A;  3GOF A;  2WCE A;  2PAL A;  1LIN A;  1DJH A;  3K1E A;  1S1E A;  1J7O A;  1NYA A;  2L51 A;  1NCY A;  3BUM B;  2KOT A;  5DKN A;  1YUS A;  2ZND A;  3H4S E;  2NXQ A;  1JC2 A;  1CNP A;  3D73 A;  1RTP 1;  2JT3 A;  2AUC A;  1OQP A;  4GNK B;  1EXR A;  1YVL A;  5HLO A;  2JRF A;  2CXJ A;  1XFX O;  1S3P A;  1B8L A;  1FF1 A;  1A29 A;  1ZUZ A;  1F70 A;  5DKQ A;  5AAN A;  1XO5 A;  5D7F A;  2BAP A;  1BOC A;  1AJ4 A;  3FE6 A;  1S36 A;  5TNC A;  4QJ5 B;  1REC A;  2LAP A;  2OS8 C;  1F71 A;  3IQQ A;  1CDM A;  4ZCU A;  3TZ1 A;  1B7T Z;  4OR9 B;  2LVV A;  1J7Q A;  1PSB A;  1DMO A;  4XJK A;  3TUY C;  4WQ2 A;  1C07 A;  1K8U A;  1NX0 A;  1M63 B;  4P2Y B;  2LHL A;  3D77 A;  1BT6 A;  2GGZ A;  3EK4 A;  1WRK A;  1IJ6 A;  2LCP A;  3HX4 A;  1WRL A;  1SCM C;  2M9G A;  3DD4 A;  1KSO A;  5KU1 A;  1X02 A;  3SIB A;  1OMV A;  2JUL A;  4KYN A;  2LMV A;  3CWG A;  4BY5 A;  1AHR A;  1E8A A;  1F55 A;  1XFU O;  2JNF A;  3PN7 B;  2ISD A;  1KK7 Z;  2I7A A;  5KTY A;  2LUC A;  1YUU A;  2PYQ A;  1OOH A;  2Q4U A;  1PRW A;  4M2O A;  1QAS A;  1BOD A;  2JXL A;  4PHN A;  1TNP A;  5CSN A;  2LMU A;  4YGD B;  2LVJ A;  4D1E A;  1RRO A;  2LM5 A;  1W7J B;  2LLS A;  1K96 A;  1WLZ A;  2K8M B;  2L98 A;  1JWD A;  1UHN A;  1KK8 C;  2K7C A;  4ORB B;  1SR6 C;  4UPG A;  1G4Y R;  1CM4 A;  2QDI A;  2P70 A;  3BOW B;  3PSR A;  4I5L B;  3TS5 C;  1BU3 A;  2R2I A;  2LLU A;  2GGM A;  2L4I A;  3OBV A;  1JFJ A;  2F3Z A;  2BCB A;  3SG2 A;  1KFU L;  1FW4 A;  3IVT A;  1GGW A;  2LC5 A;  4MZK A;  1KFX L;  1TUJ A;  3KPX A;  5DIC A;  2JTZ A;  1G8I A;  2KGR A;  5ER4 X;  1FI5 A;  1DEL A;  4YI9 A;  1J7P A;  3JVT B;  4CFQ A;  2K7B A;  2JC2 A;  1DF0 A;  4GUK A;  2Q91 A;  2B1U A;  3VRQ A;  2MLE C;  3PAL A;  2M3W A;  2LAN A;  5I94 A;  3OHM B;  2FJY A;  5HL1 A;  2EC6 B;  2BEC A;  2EHB A;  3CR2 A;  4FQT A;  4CLN A;  5JJG A;  3KHE A;  1K90 D;  3RM1 A;  1Y1U A;  2JOJ A;  2MRD A;  4HRG A;  4OVN F;  1FI6 A;  2DOQ A;  1JF0 A;  1QX7 A;  2FCD A;  2WOS A;  1DTL A;  2KFG A;  3CGA A;  1AUI B;  3EVR A;  1AVS A;  1LKJ A;  1SY9 A;  2FOT A;  5I2O A;  5AEQ A;  1YRU B;  2KAV A;  2O5G A;  2BNX A;  4PE7 A;  2LLT A;  3FWB A;  4JWQ A;  3O2P A;  2HPS A;  2WND A;  2OTG B;  1BF5 A;  3O6B A;  3JTD C;  3R1O A;  4ICB A;  5IBW A;  5FYX A;  3DF0 A;  2L2C A;  3NSI A;  1D1O A;  2I94 A;  1F4Q A;  2WCB A;  1NX3 A;  4R1E A;  2JNX A;  3UNW A;  4PAL A;  1MXL C;  4E68 A;  1XK4 A;  1IH0 A;  3PFV A;  3BXK A;  2F3Y A;  1A75 B;  2L2E A;  1FBV A;  1KWO C;  4JKT A;  5I2L A;  1MXE A;  2JZI A;  3A4U B;  1PAL A;  1CDL A;  1EJ3 A;  2L5Y A;  1CFD A;  1MQ1 A;  1DJY A;  2M1U A;  4PDZ A;  1NX2 A;  1SYM A;  4GFT A;  4YGE B;  1Z2C B;  4NDD A;  1JBA A;  2LVI A;  3D0Y A;  2QEH A;  1AK8 A;  4YGC B;  2M29 A;  3WHU B;  2KFH A;  1UUR A;  3IF7 A;  1NCZ A;  3PAT A;  1Y0V H;  3L4A A;  2FCE A;  2MHH A;  2WCL A;  3BJH A;  1ZFS A;  3EG5 B;  2E6W A;  4MN0 A;  1LVC D;  1C7W A;  2WCF A;  1K9K A;  2BCA A;  3B7A A;  5CSI A;  2HQW A;  3I5G C;  3O78 A;  3KEV A;  3PJI A;  4HRH A;  1OOF A;  2ZKM X;  4YI8 A;  4MSP A;  3BUN B;  1TIZ A;  2MA2 A;  3I5I C;  2BKI B;  1BR1 B;  1V1G A;  3KF9 A;  1Y1X A;  4CFR A;  3CTN A;  2F2P A;  1JUO A;  1PVB A;  4JPZ B;  2K60 A;  2CT9 A;  5EL2 A;  4PE4 A;  1Z4H A;  1TNX A;  1Q80 A;  2G2B A;  2JT8 A;  3FWC A;  4AQI A;  1H4B A;  2L50 A;  1OE9 B;  1TWO A;  2WCH A;  3L47 A;  1XFY O;  2H8V A;  4I5J A;  5G08 A;  3FE9 A;  1U5I B;  1CFF A;  1B4C A; 
#chains in the Genus database with same CATH homology
 2HF5 A;  2KHN A;  1CDP A;  3NSK A;  1OZS A;  2BE4 A;  2JXC A;  3GK4 X;  2OS8 B;  5HKZ A;  1BG1 A;  4P5O E;  1ALV A;  3EVU A;  3OB2 B;  1KQM C;  2OPO A;  4NDC A;  2LMT A;  2BBM A;  2F8P A;  2I18 A;  3I5F C;  1CM1 A;  1J1D A;  1A2X A;  3TUY B;  3BUW B;  1H8B A;  2MJW B;  4PCW A;  2M7L A;  2H2K A;  1B8C A;  1QAT A;  2JQ6 A;  1EG3 A;  1BJF A;  2K61 A;  5CSJ A;  1B47 A;  4GGN A;  4ZCV A;  3ZNI A;  3OX5 A;  1DGV A;  3EKJ A;  3SJS A;  2LE9 B;  4ORA B;  2KYC A;  1IRJ A;  5I2Q A;  1QXP A;  2AMI A;  1YTZ C;  1RK9 A;  1NWD A;  1QLK A;  1UWO A;  2JPT A;  2KSP A;  3I5H C;  4PHJ A;  3ZWH A;  1IG5 A;  1S6J A;  2KDH A;  1GGZ A;  1UHH A;  4M2Q A;  1XK4 C;  2BBN A;  1L2O C;  2G9B A;  1CFP A;  2QAC A;  2BE6 A;  1JSA A;  3TDI A;  1K95 A;  4C0K A;  1KK8 B;  2H61 A;  1SR6 B;  1S6I A;  1NUB A;  2JU0 A;  1PSR A;  4MVF A;  1YX8 A;  3TS5 B;  1R6P A;  2K7O A;  1QX5 B;  1TRF A;  2MBX A;  3VRR A;  4HSZ A;  4C0L A;  2KFF A;  3RLZ A;  2KAY A;  1RFJ A;  1YX7 A;  4ETO A;  1K93 D;  4GAO A;  1GQM A;  2ZFD A;  3PLF B;  4WRI A;  1AP4 A;  1ZAC A;  2F33 A;  2K2F A;  2Y4Q A;  1SBJ A;  1F54 A;  1EH2 A;  3AAK A;  3DVK A;  1TN4 A;  3M0W A;  2K7D A;  2MAZ A;  3WHT B;  3OB1 B;  3OX6 A;  2AAO A;  4A4C A;  1XFW O;  2HQ8 A;  1IQ5 A;  2CNP A;  1A03 A;  1PVA A;  3EVV A;  2PSR A;  3A8R A;  5GQQ C;  4OCI A;  4CPV A;  4GGF A;  1KFU S;  1Y6W A;  1SKT A;  1HT9 A;  2M97 A;  1KFX S;  2SAS A;  1UHJ A;  3DVJ A;  4N1F A;  2KQY A;  1YUT A;  4HRE E;  5BPJ A;  1XFV O;  2V53 A;  2BL0 C;  1F8H A;  1SPY A;  4OKH A;  1MWN A;  1NX1 A;  3ICB A;  1DT7 B;  1K9P A;  1VRK A;  1CMG A;  1EG4 A;  2D8N A;  1IKU A;  2KI4 C;  4Q04 A;  3AKA A;  3JTD B;  4QJ3 B;  2KI6 C;  1SL7 A;  4DS7 A;  2M8U A;  1W7I B;  2KYF A;  5F6T A;  1S5G Y;  1TCO B;  2EGD A;  1NPQ A;  4NDB A;  4MBE A;  1KWO B;  1TTX A;  1OZO A;  5ER5 A;  1UHI A;  2LHI A;  1K9U A;  1MF8 B;  1DJG A;  2QPT A;  2CBL A;  4M2P A;  1LXF C;  1BLQ A;  3VGO A;  3WNX B;  5I8N A;  1TNW A;  5CSF A;  2KGB C;  2ZN9 A;  1KQV A;  2M7N A;  1DVI A;  1M45 A;  4U8D A;  1J55 A;  1S6C A;  2JWW A;  2H61 C;  4YRU A;  4NQG A;  3I5G B;  3VRN A;  1OSA A;  1GJY A;  3BQ3 A;  1J7R A;  4DCK A;  2JTT A;  1WDC C;  3I5I B;  2CCM A;  1SMG A;  1EL4 A;  1Y1A A;  1NSH A;  5KSZ A;  2LV7 A;  1JF2 A;  1DGU A;  1RWY A;  4MRY A;  1S26 D;  2L0P A;  3CZT X;  2PVB A;  4L9M A;  4DRW A;  1AJ5 A;  1YRT B;  1UHK A;  1C7V A;  5AFP A;  2M1K B;  2NCP A;  1DF0 B;  5HKW A;  5DKR A;  3EK7 A;  2M0R A;  3CS1 A;  1QS7 A;  1PUL A;  1XVJ A;  1F4O A;  1KQM B;  2NCO A;  2LUX A;  1CFC A;  3BOW A;  3LCP C;  3I5F B;  2KQ6 A;  2O60 A;  5B8I B;  4F0Z B;  1LA0 A;  3O4Y A;  3LL8 B;  4GGF C;  4XYN A;  1NCX A;  1TOP A;  1IJ5 A;  1CMF A;  1OMR A;  2P6B B;  3E3R A;  3BYA A;  3SIA A;  4YBH B;  2GV5 A;  1S5G Z;  3QRX A;  4YGB B;  1SCM B;  1TNQ A;  5J3X A;  1ZMZ A;  3DVE A;  3SG6 A;  1N2D A;  2PAS A;  3NXA A;  1DJW A;  3I5H B;  1IGV A;  3FIA A;  1TCF A;  3LK0 A;  1YVH A;  3DF0 B;  1WLM A;  4FQO A;  2ZRS A;  3CR4 X;  1B1G A;  3FS7 A;  4BY4 A;  2COL B;  3GK1 A;  1L2O B;  1NP8 A;  1ODB A;  1NIW A;  1CDN A;  1QIV A;  1G33 A;  2LP3 A;  2PMY A;  4PE1 A;  1N0Y A;  1FPW A;  1MR8 A;  4IL1 A;  1BMO A;  3D0Y B;  1V1F A;  1SCV A;  1N65 A;  1SL8 A;  5CPV A;  3TDU A;  2VRG A;  1CLB A;  1QVI Z;  2FJU B;  2ZNE A;  3F45 A;  3SG5 A;  4I5N B;  3MSE B;  1SL9 A;  2JT0 A;  2LP2 A;  4PE0 A;  4CID A;  1ALW A;  1QTX A;  2KNE A;  1IQ3 A;  3BUX B;  1PK0 D;  3DVM A;  1SW8 A;  1A75 A;  2ZRT A;  3EK8 A;  3C1V A;  1OMD A;  1SNL A;  4WQ3 A;  3OP0 A;  3PN7 C;  1WRZ A;  1JFK A;  1QLS A;  1XFZ O;  1BR4 B;  2KBM A;  2LNK A;  2TN4 A;  5HYD A;  3VRO A;  1CKK A;  3SG3 A;  1QIW A;  4DUQ A;  2Y5I A;  3PM8 A;  2I2R E;  4N5X A;  3AKB A;  1MUX A;  2A4J A;  1KCY A;  2BL0 B;  3LK1 A;  2PRU A;  4MLW A;  1DJZ A;  1CLL A;  3HCM A;  3SG7 A;  4A4B A;  2IS9 A;  2L4H A;  4USL A;  3CR5 X;  2WC8 A;  1QV0 A;  4N1G A;  2KI4 B;  1CLM A;  1UP5 A;  4PHM A;  4XJK B;  5HKY A;  2SCP A;  1IWQ A;  2BKH B;  1LA3 A;  2LVK A;  1RJV A;  3EKH A;  1M31 A;  1QJT A;  1QV1 A;  4ORC B;  5AXI A;  4AQJ A;  1YUR A;  4QJ4 B;  1U5I A;  4JQ0 D;  3JVT C;  1A4P A;  2HET A;  2RGI A;  3D10 A;  2L5X B;  4MZL A;  4MZJ A;  3VRP A;  3KO0 A;  1SK6 D;  3TDZ A;  1L7Z A;  2NLN A;  1M46 A;  2EC6 C;  2WOR A;  5K89 A;  1K94 A;  4C0J A;  4GPL B;  1M39 A;  1QX2 A;  1ZOT B;  1XA5 A;  2NZ0 A;  1HQV A;  4DIR A;  1MHO A;  2KBI A;  3NSO A;  5PAL A;  1K2H A;  1WDC B;  1XYD A;  1B9A A;  1YR5 A;  1B7T Y;  2ZN8 A;  1KSM A;  2E30 A;  1DJX A;  3IQO A;  4TNC A;  3LLE A;  2Y1N A;  1R2U A;  2OTG C;  2CTN A;  2Y1M A;  4OV2 A;  4MRX A;  2F2O A;  3CLN A;  3NSL A;  2BCX A;  4I5K A;  5AER A;  4YGA A;  5D69 A;  4PHK A;  1B8R A;  1QVI Y;  5JOL A;  2K0J A;  1CB1 A;  5HLV A;  2MLF C;  1J1E A;  1UUS A;  2KAX A;  2M49 B;  3SG4 A;  3BUO B;  2KI6 D;  3AAJ A;  1KK7 Y;  3WXA A;  1WY9 A;  1DJI A;  3GK2 A;  3K21 A;  4GBA A;  4MEW A;  2K2A A;  1SRA A;  1CTR A;  4FTG A;  1OOJ A;  3GOF A;  2WCE A;  2PAL A;  1LIN A;  1DJH A;  1S1E A;  1J7O A;  1NYA A;  2L51 A;  1NCY A;  3BUM B;  2KOT A;  5DKN A;  1YUS A;  2ZND A;  3H4S E;  2NXQ A;  1JC2 A;  1CNP A;  1RTP 1;  2JT3 A;  2AUC A;  1OQP A;  4GNK B;  1EXR A;  1YVL A;  5HLO A;  2JRF A;  2CXJ A;  1XFX O;  1S3P A;  1B8L A;  1A29 A;  1ZUZ A;  1F70 A;  5DKQ A;  5AAN A;  1XO5 A;  5D7F A;  1BOC A;  1AJ4 A;  1S36 A;  5TNC A;  4QJ5 B;  1REC A;  2LAP A;  2OS8 C;  1F71 A;  3IQQ A;  1CDM A;  4ZCU A;  3TZ1 A;  1B7T Z;  4OR9 B;  2LVV A;  1DMO A;  1PSB A;  4XJK A;  3TUY C;  4WQ2 A;  1C07 A;  1K8U A;  1NX0 A;  1M63 B;  4P2Y B;  2LHL A;  1BT6 A;  2GGZ A;  3EK4 A;  1WRK A;  1IJ6 A;  2LCP A;  3HX4 A;  1WRL A;  1SCM C;  2M9G A;  3DD4 A;  1KSO A;  5KU1 A;  1X02 A;  3SIB A;  1OMV A;  2JUL A;  2LMV A;  3CWG A;  4BY5 A;  1AHR A;  1E8A A;  1F55 A;  1XFU O;  2JNF A;  3PN7 B;  2ISD A;  1KK7 Z;  2I7A A;  5KTY A;  2LUC A;  1YUU A;  2Q4U A;  1PRW A;  4M2O A;  1QAS A;  1BOD A;  2JXL A;  4PHN A;  1TNP A;  5CSN A;  2LMU A;  4YGD B;  2LVJ A;  4D1E A;  1RRO A;  2LM5 A;  1W7J B;  2LLS A;  1K96 A;  1WLZ A;  2K8M B;  2L98 A;  1JWD A;  1UHN A;  1KK8 C;  2K7C A;  4ORB B;  1SR6 C;  4UPG A;  1G4Y R;  1CM4 A;  3BOW B;  3PSR A;  4I5L B;  3TS5 C;  1BU3 A;  2R2I A;  2LLU A;  2GGM A;  2L4I A;  1JFJ A;  2F3Z A;  2BCB A;  3SG2 A;  1KFU L;  1FW4 A;  1GGW A;  2LC5 A;  4MZK A;  1KFX L;  3KPX A;  2JTZ A;  1G8I A;  2KGR A;  5ER4 X;  1FI5 A;  4YI9 A;  1J7P A;  3JVT B;  4CFQ A;  2K7B A;  2JC2 A;  1DF0 A;  4GUK A;  2Q91 A;  2B1U A;  3VRQ A;  2MLE C;  3PAL A;  2M3W A;  2LAN A;  3OHM B;  1FF1 A;  2EC6 B;  2BEC A;  2EHB A;  3CR2 A;  4CLN A;  5JJG A;  3KHE A;  1K90 D;  3RM1 A;  1Y1U A;  2JOJ A;  2MRD A;  4HRG A;  4OVN F;  1FI6 A;  2DOQ A;  1JF0 A;  1QX7 A;  2FCD A;  2WOS A;  1DTL A;  2KFG A;  3CGA A;  1AUI B;  3EVR A;  1AVS A;  1LKJ A;  1SY9 A;  2FOT A;  5I2O A;  5AEQ A;  1YRU B;  2KAV A;  2O5G A;  4PE7 A;  2LLT A;  3FWB A;  4JWQ A;  3O2P A;  2HPS A;  2WND A;  2OTG B;  1BF5 A;  3O6B A;  3JTD C;  4ICB A;  5IBW A;  5FYX A;  3DF0 A;  3NSI A;  1D1O A;  2I94 A;  1F4Q A;  2WCB A;  1NX3 A;  4R1E A;  2JNX A;  4E68 A;  4PAL A;  1MXL C;  1J7Q A;  1XK4 A;  1IH0 A;  3PFV A;  3BXK A;  2F3Y A;  1A75 B;  2L2E A;  1FBV A;  1KWO C;  5I2L A;  1MXE A;  2JZI A;  3A4U B;  1PAL A;  1CDL A;  1EJ3 A;  1CFD A;  1MQ1 A;  1DJY A;  2M1U A;  4PDZ A;  1NX2 A;  1SYM A;  4GFT A;  4YGE B;  4NDD A;  1JBA A;  2LVI A;  3D0Y A;  1AK8 A;  4YGC B;  2M29 A;  3WHU B;  2KFH A;  1UUR A;  3IF7 A;  1NCZ A;  3PAT A;  1Y0V H;  4MN0 A;  2FCE A;  2MHH A;  4AOM A;  1ZFS A;  2E6W A;  1LVC D;  1C7W A;  2WCF A;  1K9K A;  2BCA A;  5CSI A;  2HQW A;  3I5G C;  3O78 A;  3KEV A;  4HRH A;  2ZKM X;  4YI8 A;  4MSP A;  3BUN B;  1TIZ A;  2MA2 A;  3I5I C;  2BKI B;  1BR1 B;  1V1G A;  3KF9 A;  1Y1X A;  4CFR A;  3CTN A;  2F2P A;  1JUO A;  1PVB A;  4JPZ B;  2CT9 A;  4PE4 A;  1TNX A;  1Q80 A;  2G2B A;  2JT8 A;  3FWC A;  4AQI A;  1H4B A;  2L50 A;  1OE9 B;  1XFY O;  4I5J A;  5G08 A;  1U5I B;  1CFF A;  1B4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...