1F70A

Refined solution structure of calmodulin n-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transport protein
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f70A00
2K0JA 4AQIA 3NSLA 4PCWA 3GK4X 1AHRA 4P2YB 1N2DA 2H2KA 2Y1MA 2MRDA 3AKAA 1LVCD 4C0LA 4CFQA 1TTXA 2BE4A 4YGCB 3PN7B 1NCYA 2K2FA 3EK7A 5I2OA 5KTYA 1S1EA 4DS7A 1LA3A 2BL0C 4GFTA 1CFFA 3WHUB 1DJZA 1PSRA 1ZFSA 4UPGA 4YGEB 2M7LA 1GQMA 4MZJA 3TDUA 3LLEA 3D10A 2WCBA 4CIDA 4PALA 1IGVA 1DTLA 2JOJA 2L0PA 2H61C 1NIWA 3AKBA 2F8PA 3I5HB 3NSIA 1SR6B 1QJTA 1YUSA 1EG4A 3GK1A 1CDLA 3EVRA 1KFUS 1FI5A 1YVHA 1U5IB 1Y0VH 3CS1A 2LE9B 3DF0A 1PULA 1S3PA 2HETA 4DRWA 2JT3A 2O5GA 1JC2A 3VRNA 2LP3A 2MA2A 1RFJA 2KSPA 2LVVA 3SG3A 5HKZA 1XFXO 4YI9A 3TDZA 3KEVA 5CPVA 1N65A 1BODA 1NX1A 1SMGA 2HQWA 1M31A 3EVVA 4GBAA 4M2OA 2BKHB 2KQYA 2L4HA 5HLVA 3OB1B 2D8NA 1F4QA 2WC8A 3D0YA 1Y1UA 3BQ3A 3GK2A 4MBEA 2F3ZA 3IF7A 2M9GA 1BMOA 5G08A 1BU3A 1BF5A 1F8HA 2B1UA 1MWNA 4FTGA 4I5LB 4GUKA 1G4YR 4NDCA 2ZN9A 4M2QA 1SRAA 1IQ5A 2A4JA 3KF9A 3SG6A 1FF1A 2F2PA 2JULA 2BCBA 1CMGA 1X02A 1VRKA 2PMYA 3HCMA 3OP0A 1J7RA 1JFKA 2PALA 1CFDA 5J3XA 5HYDA 4U8DA 1B8CA 3GOFA 2LLUA 1IQ3A 1B7TZ 1D1OA 2GGMA 2JWWA 5BPJA 5ER5A 2IS9A 3DD4A 1K90D 4QJ5B 4GAOA 3LL8B 2OTGB 2F33A 4YRUA 1YX8A 1YRTB 4DIRA 1OMDA 2M1UA 4WQ2A 4PHNA 1SKTA 1H8BA 1NUBA 1DJGA 2K8MB 1XA5A 1AP4A 1A75A 2CXJA 2EC6B 1BT6A 1MUXA 3KHEA 1WRKA 2NLNA 1LKJA 4CLNA 1CFPA 1SK6D 1WDCC 2FCDA 4MRXA 2NXQA 3VRQA 2KFFA 1L2OC 1MXLC 1V1GA 3TUYB 1YVLA 3BXKA 1KK7Z 4XJKA 3SG7A 5CSFA 1BR1B 1YURA 1LXFC 2LLTA 2JT0A 1SYMA 2JXLA 2LANA 2PVBA 1J7PA 2CNPA 3BUWB 3JVTC 4JWQA 3I5FB 5D7FA 1XYDA 4PE1A 3K21A 1DF0B 1NX2A 1E8AA 4GGNA 1SCMB 2M0RA 4AOMA 3CR5X 1DGUA 3A8RA 5DKRA 2KYCA 4P5OE 1PK0D 1S5GY 1NX0A 1IKUA 2NZ0A 1CLMA 3BUMB 1NP8A 1EG3A 1QS7A 3VROA 2K7CA 1S26D 4ICBA 2SCPA 2G9BA 2ZRTA 1QATA 2WORA 4GGFA 1WRLA 4OVNF 1QV0A 1UURA 5AERA 1DJIA 2AAOA 2KDHA 1FPWA 1YTZC 2FOTA 1CDNA 4NDDA 1UHKA 1XK4A 2DOQA 3PALA 1XFYO 1MR8A 2KAYA 4C0KA 3KO0A 1M39A 2KI4C 2BBMA 2CT9A 3KPXA 3O2PA 1K8UA 1J1EA 2KI6D 2LLSA 5HKWA 1DVIA 1QTXA 1OSAA 2JNXA 4YGBB 2TN4A 1M45A 1V1FA 3FIAA 1IRJA 1R2UA 2ZRSA 4YGDB 1JF2A 2K2AA 1KCYA 2CTNA 2M7NA 4OCIA 2ZN8A 3CWGA 2M29A 1PALA 2BL0B 5I2LA 4BY5A 1RWYA 2KGBC 2AUCA 2I18A 3JTDC 1RK9A 1S6JA 3FS7A 1K96A 1W7IB 1LINA 3CR2A 4MZLA 1NCZA 2KBIA 1PVAA 2KOTA 1Y6WA 2LMUA 2BECA 2LMVA 4PE4A 2GV5A 1NX3A 2L2EA 1JFJA 3F45A 5K89A 3I5GC 3PSRA 5AANA 2L4IA 3I5GB 2M3WA 3SIAA 1YR5A 2LHIA 1W7JB 4PE0A 1Y1XA 3AAJA 4ORBB 2LVKA 1EH2A 4MEWA 3BOWB 3SG5A 4L9MA 1SBJA 1S6IA 1TNPA 3NXAA 1J7QA 1CLBA 3FWBA 3SG2A 2BCAA 2KI6C 4OKHA 2JPTA 4ORAB 4WQ3A 1BG1A 4QJ3B 2NCPA 1AJ5A 1ZMZA 1QVIZ 3I5IC 1A03A 1EL4A 1S6CA 1FW4A 3EVUA 1ZOTB 1QX5B 3E3RA 2ISDA 2KAVA 1FI6A 1HQVA 1OMVA 1KSOA 3SG4A 1G8IA 1TNWA 1U5IA 1CLLA 2LNKA 3C1VA 5I8NA 4MVFA 1GJYA 1TOPA 1J55A 3WHTB 2LV7A 2GGZA 2E6WA 4F0ZB 2JU0A 2L5XB 1B8RA 1QIWA 1UHIA 2JNFA 3BOWA 2HQ8A 1ALWA 1CDMA 2JXCA 3CLNA 1HT9A 2AMIA 1GGZA 3PATA 2M1KB 2LCPA 1B47A 3PLFB 1CTRA 2I7AA 1A2XA 2KGRA 2KHNA 2KYFA 2KAXA 3BYAA 3TS5C 2K7BA 1K94A 1DT7B 1GGWA 1FBVA 2JT8A 2F2OA 3BUOB 2KBMA 1CDPA 2JTTA 2PRUA 1WDCB 1TN4A 3DVEA 4MRYA 1BJFA 1NPQA 1C7WA 1QLKA 3HX4A 1L2OB 5JOLA 2CCMA 4ZCUA 2L50A 1KFXL 4CFRA 1F54A 5CSJA 3LCPC 1B1GA 3OX6A 4D1EA 4TNCA 1AK8A 1H4BA 1YX7A 3WNXB 1AJ4A 1ZACA 2SASA 1XFUO 1K9PA 4HRHA 4GNKB 1YRUB 1NSHA 2K7OA 2LC5A 3BUXB 1RECA 3JVTB 2JQ6A 2JC2A 1PRWA 2L51A 2JRFA 3MSEB 5D69A 1PVBA 2R2IA 1SNLA 1OOJA 2OS8C 2ZNDA 4GGFC 4MZKA 1SL9A 5KSZA 1CM1A 3CTNA 1JUOA 3OX5A 2LAPA 3LK0A 1KQMC 1RJVA 1XK4C 2LMTA 1NCXA 2WCFA 2BCXA 1AUIB 1TCFA 1XFVO 1KQVA 1IWQA 1B7TY 2I94A 3NSKA 3DVJA 4AQJA 4A4BA 1K2HA 4N1GA 1A29A 1KWOC 2WNDA 5F6TA 2NCOA 2KQ6A 3PM8A 1TRFA 1CFCA 4I5NB 2KI4B 1A4PA 2MJWB 1K9UA 1KK8C 1B8LA 2V53A 4I5KA 4PHKA 1DF0A 1UHNA 1YUTA 4WRIA 4M2PA 1UUSA 2LVJA 5GQQC 1MHOA 1OZSA 4QJ4B 5DKNA 4OV2A 1KK7Y 5AEQA 1IJ6A 1SL7A 3ZWHA 1DJYA 4PHJA 5IBWA 1M46A 3A4UB 1G33A 2PASA 1Q80A 1UP5A 1EXRA 5FYXA 3JTDB 1M63B 3DF0B 1BR4B 3TS5B 2FJUB 1F71A 3SJSA 3AAKA 2M97A 1OE9B 3PN7C 3OHMB 2BKIB 1ODBA 3BUNB 2LM5A 1F70A 1TIZA 2F3YA 3ZNIA 1MXEA 1QV1A 4OR9B 1DMOA 1KFXS 2BE6A 1WY9A 1K9KA 3DVKA 2L98A 3D0YB 4NDBA 2QACA 2EGDA 3O4YA 1JSAA 3I5HC 1CB1A 3IQOA 1SR6C 4NQGA 2CBLA 3O6BA 1SW8A 2E30A 2LUCA 1Y1AA 3CZTX 4FQOA 5KU1A 1DJWA 2BBNA 1C07A 1F4OA 4N1FA 3I5IB 1XFZO 2OPOA 1ALVA 1UHHA 2LP2A 1J7OA 3VGOA 1OZOA 2H61A 3SIBA 2MHHA 4DUQA 2WCEA 2QPTA 1IJ5A 1QASA 3LK1A 1BLQA 2ZKMX 3EKHA 3RM1A 1OQPA 4ZCVA 4CPVA 2Y1NA 5I2QA 4YGAA 2O60A 1F55A 1SL8A 1N0YA 4HREE 2Q91A 2WOSA 1ZUZA 1OMRA 5HKYA 3NSOA 1WLMA 1A75B 4N5XA 3PFVA 5CSNA 1PSBA 3OB2B 1UWOA 5HLOA 1B9AA 3QRXA 3RLZA 1B4CA 3H4SE 3TZ1A 2EHBA 2KNEA 3EKJA 1MF8B 2K7DA 4BY4A 2K61A 4MSPA 1K95A 1EJ3A 2HF5A 5ER4X 1SCVA 5PALA 2M49B 1RROA 1S5GZ 4XJKB 2P6BB 4PE7A 2JTZA 3EK8A 2VRGA 2ZNEA 2LUXA 4PHMA 5AXIA 4A4CA 2MAZA 4ETOA 1WRZA 2LVIA 1DJHA 3VRPA 2MLFC 4JPZB 3CGAA 4R1EA 1IG5A 2COLB 1MQ1A 1LA0A 3TDIA 1QVIY 2KFGA 2Y4QA 1SPYA 2JZIA 2OTGC 1TNQA 4USLA 1CKKA 2Q4UA 1YUUA 4C0JA 3FWCA 1BOCA 1JBAA 1L7ZA 4MN0A 2EC6C 1QIVA 3IQQA 1XFWO 5AFPA 5JJGA 3M0WA 4XYNA 1KFUL 1QXPA 2OS8B 3ICBA 3TUYC 3O78A 4ORCB 2ZFDA 1JF0A 1S36A 1NYAA 1DGVA 1KQMB 4I5JA 2MBXA 1CMFA 1R6PA 1IH0A 3WXAA 1J1DA 2LHLA 2G2BA 2KFHA 3CR4X 1AVSA 4Q04A 4MLWA 1CM4A 1TCOB 2M8UA 4HRGA 4PDZA 1TNXA 3I5FC 4HSZA 3EK4A 2FCEA 1C7VA 1UHJA 1DJXA 4JQ0D 1SCMC 1XVJA 1KWOB 1XO5A 1RTP1 1JWDA 1KK8B 2I2RE 2MLEC 1QLSA 5TNCA 1K93D 2Y5IA 5CSIA 4GPLB 4IL1A 3VRRA 4YBHB 2PSRA 4YI8A 1WLZA 4E68A 1NWDA 2HPSA 1CNPA 1KSMA 1SY9A 4DCKA 2RGIA 5B8IB 3DVMA 5DKQA 1QX2A 1QX7A
chains in the Genus database with same CATH superfamily
2K0JA 4AQIA 3NSLA 3V2LA 4PCWA 2YGUA 3GK4X 3B87A 1AHRA 2ERBA 4P2YB 3B88A 1N2DA 2JPOA 2H2KA 2Y1MA 2MRDA 1TUJA 1LVCD 3AKAA 4C0LA 4CFQA 1TTXA 2BE4A 4YGCB 3PN7B 1NCYA 2K2FA 3EK7A 2PYQA 5I2OA 5KTYA 1S1EA 4DS7A 1TWOA 1LA3A 2BL0C 4GFTA 1CFFA 3WHUB 1DJZA 1PSRA 1ZFSA 4UPGA 4YGEB 2M7LA 1GQMA 4MZJA 3TDUA 3LLEA 3D10A 2WCBA 4CIDA 4PALA 1IGVA 1DTLA 2JOJA 2L0PA 2H61C 1NIWA 3AKBA 2F8PA 3I5HB 3EG5B 1SR6B 3NSIA 1QJTA 3FE9A 1YUSA 3BFBA 1EG4A 3GK1A 1CDLA 3D77A 3EVRA 1KFUS 3S0AA 1FI5A 1YVHA 1U5IB 1Y0VH 3CS1A 2LE9B 3DF0A 1PULA 1S3PA 2HETA 4DRWA 2JT3A 1GM0A 2O5GA 1JC2A 3VRNA 2LP3A 2MA2A 3N7HA 1RFJA 2KSPA 2LVVA 3D74A 5HKZA 3SG3A 1XFXO 4YI9A 3TDZA 3KEVA 4OZDA 5CPVA 1N65A 1BODA 1NX1A 1SMGA 2HQWA 1M31A 3EVVA 4GBAA 4M2OA 2BKHB 2KQYA 2L4HA 5HLVA 3OB1B 2D8NA 1F4QA 2WC8A 3D0YA 1Y1UA 3BQ3A 3GK2A 4MBEA 2F3ZA 3IF7A 5HL1A 2M9GA 3L4AA 3DY9A 1BMOA 5G08A 1BU3A 3S0DA 1BF5A 1F8HA 2B1UA 3NHTA 1MWNA 4FTGA 4I5LB 4GUKA 1G4YR 4NDCA 2ZN9A 4M2QA 1SRAA 1IQ5A 2A4JA 3KF9A 3SG6A 1FF1A 2F2PA 2JULA 3DYEA 2BCBA 1CMGA 2KLDA 1X02A 1VRKA 2PMYA 3HCMA 3OP0A 1J7RA 1JFKA 2PALA 1CFDA 3OGNA 5J3XA 5HYDA 4U8DA 5FI6A 1B8CA 3GOFA 2LLUA 1IQ3A 1B7TZ 1D1OA 2GGMA 2JWWA 3R1VA 5BPJA 5ER5A 1OOFA 2IS9A 1OOHA 1K90D 3DD4A 4GAOA 3LL8B 2OTGB 2F33A 4QJ5B 4YRUA 1YX8A 1YRTB 4DIRA 1OMDA 2M1UA 4WQ2A 4PHNA 1SKTA 1H8BA 4JKTA 1NUBA 1DJGA 3D76A 2K8MB 1XA5A 1AP4A 1A75A 2CXJA 2EC6B 1BT6A 1MUXA 3KHEA 1WRKA 2NLNA 1LKJA 4CLNA 2QEOA 1CFPA 1SK6D 1WDCC 2FCDA 3IVTA 2NXQA 4MRXA 3VRQA 2KFFA 1L2OC 1MXLC 1V1GA 3S0BA 3TUYB 1YVLA 3BXKA 1KK7Z 4XJKA 3SG7A 5CSFA 1BR1B 1YURA 1LXFC 2LLTA 2JT0A 1SYMA 2JXLA 2LANA 2PVBA 3K1EA 1J7PA 2CNPA 4FQTA 3BUWB 3JVTC 3NHIA 4JWQA 3I5FB 5D7FA 1XYDA 4PE1A 3K21A 1W9ZA 1DF0B 1NX2A 1E8AA 4GGNA 1SCMB 2M0RA 4AOMA 3CR5X 1DGUA 3A8RA 5DKRA 2KYCA 3B7AA 4P5OE 1PK0D 1S5GY 3O4XA 1NX0A 1IKUA 2NZ0A 1CLMA 3BUMB 1NP8A 1LS8A 1EG3A 1QS7A 3VROA 2K7CA 1S26D 4ICBA 2SCPA 2G9BA 2WCKA 1QATA 1Z4HA 2WORA 1WRLA 2ZRTA 4GGFA 4OVNF 1QV0A 1UURA 5AERA 1DJIA 2AAOA 3CZ1A 1TUZA 2KDHA 1FPWA 1YTZC 2FOTA 2WCMA 4NDDA 1CDNA 1UHKA 1XK4A 2DOQA 3PALA 1XFYO 1MR8A 2KAYA 4C0KA 3KO0A 1M39A 2KI4C 2BBMA 2CT9A 3KPXA 2QEHA 3O2PA 1K8UA 1J1EA 1Z2CB 2KI6D 2LLSA 5HKWA 1DVIA 1QTXA 1OSAA 2JNXA 4YGBB 2TN4A 2BNXA 1M45A 1V1FA 3FIAA 1IRJA 1R2UA 2ZRSA 4YGDB 1JF2A 3UO9A 2K2AA 5FI2A 2CTNA 2M7NA 4OCIA 1KCYA 2ZN8A 3CWGA 1ORGA 2M29A 1PALA 2BL0B 5I2LA 4BY5A 1RWYA 2P70A 2KGBC 2AUCA 2I18A 3JTDC 1RK9A 1S6JA 3FS7A 1K96A 1W7IB 1LINA 3CR2A 4MZLA 1NCZA 2KBIA 1PVAA 2KOTA 1Y6WA 2LMUA 2BECA 2LMVA 4PE4A 2GV5A 1NX3A 2L2EA 1JFJA 3F45A 5K89A 3I5GC 3PSRA 5AANA 1C3YA 2L4IA 3I5GB 2M3WA 3SIAA 1YR5A 2LHIA 1W7JB 2GTEA 1Y1XA 3AAJA 4ORBB 2LVKA 4PE0A 1EH2A 4MEWA 3BOWB 3SG5A 4L9MA 1SBJA 1S6IA 1TNPA 3NXAA 1J7QA 1CLBA 3FWBA 3SG2A 2BCAA 2KI6C 4OKHA 2JPTA 4ORAB 4WQ3A 1BG1A 4QJ3B 2NCPA 1OOGA 1AJ5A 1ZMZA 1QVIZ 3I5IC 1A03A 1P28A 1EL4A 1S6CA 1FW4A 3EVUA 1ZOTB 1QX5B 3E3RA 2ISDA 2KAVA 2L2CA 1HQVA 2K60A 1FI6A 1OMVA 1KSOA 3SG4A 1G8IA 1TNWA 1U5IA 1CLLA 2LNKA 3C1VA 5I8NA 4MVFA 1GJYA 1TOPA 1J55A 3WHTB 2LV7A 2GGZA 2E6WA 3SS4A 4F0ZB 2JU0A 2L5XB 1B8RA 1QIWA 1UHIA 2JNFA 3BOWA 2HQ8A 1ALWA 1CDMA 2JXCA 3CLNA 1HT9A 2AMIA 1GGZA 3PATA 2M1KB 2LCPA 1B47A 3PLFB 1CTRA 2I7AA 3BFHA 4F7FA 3B86A 1A2XA 2KGRA 2KHNA 2KYFA 2KAXA 3BYAA 3TS5C 2K7BA 1K94A 1DT7B 2H8VA 1GGWA 1FBVA 3PM2A 2JT8A 2F2OA 3BUOB 2KBMA 1CDPA 2JTTA 2PRUA 1WDCB 1TN4A 3DVEA 4MRYA 1BJFA 1NPQA 4INXA 5I94A 1C7WA 1QLKA 3HX4A 1L2OB 5JOLA 2CCMA 4ZCUA 2L50A 1KFXL 4CFRA 1F54A 5CSJA 3LCPC 1B1GA 3OX6A 4D1EA 4TNCA 1AK8A 1H4BA 1YX7A 3WNXB 1AJ4A 1ZACA 2SASA 3RZSA 1XFUO 1K9PA 4HRHA 4GNKB 1YRUB 1NSHA 4PT1A 2K7OA 2LC5A 3BUXB 1RECA 3JVTB 3FE6A 2JQ6A 2JC2A 1PRWA 2L51A 2JRFA 3MSEB 5D69A 1PVBA 2R2IA 1DELA 1SNLA 1OOJA 2OS8C 2ZNDA 4GGFC 4MZKA 1SL9A 5KSZA 1CM1A 3CTNA 1JUOA 3OX5A 2LAPA 3D73A 3LK0A 1KQMC 1RJVA 1XK4C 2LMTA 1DC1A 2QEVA 3DZTA 1NCXA 2WCFA 3SS3A 2BCXA 1AUIB 1TCFA 1XFVO 3D78A 1KQVA 1IWQA 1B7TY 2I94A 3NSKA 3B6XA 3DVJA 4AQJA 4A4BA 5D3OA 1K2HA 3UNWA 4N1GA 1A29A 1KWOC 2BAPA 2WNDA 5F6TA 2NCOA 2KQ6A 3PM8A 1TRFA 3S0EA 1CFCA 4I5NB 2KI4B 1A4PA 2MJWB 1K9UA 1KK8C 1B8LA 2V53A 4I5KA 3CDNA 4PHKA 1T14A 3RLZA 1DF0A 1UHNA 1YUTA 4WRIA 3OBVA 4M2PA 1UUSA 2LVJA 5GQQC 4INWA 1MHOA 1OZSA 4QJ4B 5DKNA 4OV2A 1KK7Y 5AEQA 1IJ6A 1SL7A 2WCLA 3ZWHA 1DJYA 4PHJA 5IBWA 1M46A 3A4UB 1G33A 2PASA 1Q80A 1UP5A 1EXRA 5FYXA 1DQEA 3CZ2A 3JTDB 1M63B 3DF0B 1BR4B 3TS5B 2FJUB 1F71A 3SJSA 3AAKA 2M97A 1OE9B 3PN7C 3OHMB 2BKIB 1ODBA 3BUNB 2LM5A 1F70A 1TIZA 2F3YA 3ZNIA 1MXEA 1QV1A 4OR9B 1DMOA 1KFXS 2BE6A 1WY9A 1K9KA 3SS5A 3DVKA 3BFAA 2L98A 3D0YB 3PJIA 4NDBA 1SSEB 2QACA 2EGDA 4KYNA 3O4YA 1JSAA 3I5HC 1CB1A 3QMEA 3IQOA 1SR6C 3NGVA 2CBLA 4NQGA 3O6BA 1SW8A 2E30A 2LUCA 1Y1AA 3CZTX 4FQOA 5KU1A 1DJWA 2BBNA 1C07A 1F4OA 4N1FA 3I5IB 5DICA 1XFZO 2OPOA 1ALVA 1UHHA 2LP2A 3D75A 1J7OA 3VGOA 1OZOA 3CZ0A 2H61A 3SIBA 2MHHA 4DUQA 3S0FA 2WCEA 2QPTA 1IJ5A 1QASA 3LK1A 2WCJA 1BLQA 2ZKMX 3EKHA 3RM1A 1OQPA 4ZCVA 4CPVA 2Y1NA 5I2QA 4YGAA 2O60A 1F55A 1SL8A 2P71A 1N0YA 4HREE 2Q91A 2WOSA 1ZUZA 1OMRA 5HKYA 3NSOA 1WLMA 3L4LA 1A75B 4N5XA 2KPHA 2WC6A 1PSBA 3OB2B 1UWOA 3PFVA 1B9AA 3QRXA 5CSNA 5HLOA 4JD9A 2WC5A 3H4SE 3L47A 1B4CA 3TZ1A 2EHBA 2KNEA 2PQLA 3EKJA 1MF8B 2K7DA 4BY4A 2K61A 4MSPA 1K95A 1EJ3A 2HF5A 5ER4X 1SCVA 5PALA 2M49B 1RROA 2QDIA 1S5GZ 3R1OA 4XJKB 2P6BB 4PE7A 2JTZA 3EK8A 2VRGA 2ZNEA 2LUXA 4PHMA 5AXIA 4A4CA 2MAZA 4ETOA 1WRZA 2LVIA 1DJHA 3VRPA 2MLFC 1OW4A 1XFRA 3BJHA 4JPZB 2WCHA 3CGAA 4R1EA 1IG5A 2COLB 1MQ1A 5FI7A 1LA0A 3TDIA 1QVIY 2KFGA 2Y4QA 1SPYA 2JZIA 2OTGC 1TNQA 4USLA 1CKKA 2Q4UA 4IJ7A 1YUUA 4C0JA 3FWCA 1BOCA 3Q8IA 1JBAA 3R72A 3S0GA 1L7ZA 4MN0A 2QEBA 2EC6C 1QIVA 3IQQA 1QWVA 1XFWO 5AFPA 5JJGA 3M0WA 4XYNA 1KFUL 1QXPA 2OS8B 3ICBA 3TUYC 3O78A 4ORCB 1IIOA 2ZFDA 1JF0A 1S36A 1NYAA 1DGVA 1KQMB 4I5JA 3FE8A 2MBXA 1R6PA 1CMFA 1IH0A 3WXAA 1J1DA 5EL2A 2LHLA 2G2BA 2FJYA 2KFHA 3CR4X 1AVSA 4Q04A 4MLWA 3R1PA 1CM4A 1TCOB 2M8UA 4HRGA 4PDZA 1TNXA 3I5FC 4HSZA 3EK4A 1C3ZA 2FCEA 1C7VA 2KLEA 1UHJA 1DJXA 4JQ0D 1SCMC 1XVJA 1KWOB 1XO5A 3CABA 2L5YA 1RTP1 1JWDA 1KK8B 2I2RE 2MLEC 1QLSA 5TNCA 3DXLA 1K93D 2Y5IA 5CSIA 3CYZA 4GPLB 4IL1A 3VB1A 3VRRA 4YBHB 2PSRA 4YI8A 1DEKA 1WLZA 4E68A 1NWDA 2HPSA 1CNPA 1KSMA 1OOIX 1SY9A 4DCKA 2RGIA 5B8IB 3DVMA 5DKQA 1QX2A 1QX7A
chains in the Genus database with same CATH topology
2K0JA 4AQIA 3NSLA 4PCWA 3GK4X 1AHRA 4P2YB 1N2DA 2H2KA 2Y1MA 2MRDA 3AKAA 1LVCD 4C0LA 4CFQA 1TTXA 2BE4A 4YGCB 3PN7B 1NCYA 2K2FA 3EK7A 5I2OA 5KTYA 1S1EA 4DS7A 1LA3A 2BL0C 4GFTA 1CFFA 3WHUB 1DJZA 1PSRA 1ZFSA 4UPGA 4YGEB 2M7LA 1GQMA 4MZJA 3TDUA 3LLEA 3D10A 2WCBA 4CIDA 4PALA 1IGVA 1DTLA 2JOJA 2L0PA 2H61C 1NIWA 3AKBA 2F8PA 3I5HB 3NSIA 1SR6B 1QJTA 1YUSA 1EG4A 3GK1A 1CDLA 3EVRA 1KFUS 1FI5A 1YVHA 1U5IB 1Y0VH 3CS1A 2LE9B 3DF0A 1PULA 1S3PA 2HETA 4DRWA 2JT3A 2O5GA 1JC2A 3VRNA 2LP3A 2MA2A 1RFJA 2KSPA 2LVVA 3SG3A 5HKZA 1XFXO 4YI9A 3TDZA 3KEVA 5CPVA 1N65A 1BODA 1NX1A 1SMGA 2HQWA 1M31A 3EVVA 4GBAA 4M2OA 2BKHB 2KQYA 2L4HA 5HLVA 3OB1B 2D8NA 1F4QA 2WC8A 3D0YA 1Y1UA 3BQ3A 3GK2A 4MBEA 2F3ZA 3IF7A 2M9GA 1BMOA 5G08A 1BU3A 1BF5A 1F8HA 2B1UA 1MWNA 4FTGA 4I5LB 4GUKA 1G4YR 4NDCA 2ZN9A 4M2QA 1SRAA 1IQ5A 2A4JA 3KF9A 3SG6A 1FF1A 2F2PA 2JULA 2BCBA 1CMGA 1X02A 1VRKA 2PMYA 3HCMA 3OP0A 1J7RA 1JFKA 2PALA 1CFDA 5J3XA 5HYDA 4U8DA 1B8CA 3GOFA 2LLUA 1IQ3A 1B7TZ 1D1OA 2GGMA 2JWWA 5BPJA 5ER5A 2IS9A 3DD4A 1K90D 4QJ5B 4GAOA 3LL8B 2OTGB 2F33A 4YRUA 1YX8A 1YRTB 4DIRA 1OMDA 2M1UA 4WQ2A 4PHNA 1SKTA 1H8BA 1NUBA 1DJGA 2K8MB 1XA5A 1AP4A 1A75A 2CXJA 2EC6B 1BT6A 1MUXA 3KHEA 1WRKA 2NLNA 1LKJA 4CLNA 1CFPA 1SK6D 1WDCC 2FCDA 4MRXA 2NXQA 3VRQA 2KFFA 1L2OC 1MXLC 1V1GA 3TUYB 1YVLA 3BXKA 1KK7Z 4XJKA 3SG7A 5CSFA 1BR1B 1YURA 1LXFC 2LLTA 2JT0A 1SYMA 2JXLA 2LANA 2PVBA 1J7PA 2CNPA 3BUWB 3JVTC 4JWQA 3I5FB 5D7FA 1XYDA 4PE1A 3K21A 1DF0B 1NX2A 1E8AA 4GGNA 1SCMB 2M0RA 4AOMA 3CR5X 1DGUA 3A8RA 5DKRA 2KYCA 4P5OE 1PK0D 1S5GY 1NX0A 1IKUA 2NZ0A 1CLMA 3BUMB 1NP8A 1EG3A 1QS7A 3VROA 2K7CA 1S26D 4ICBA 2SCPA 2G9BA 2ZRTA 1QATA 2WORA 4GGFA 1WRLA 4OVNF 1QV0A 1UURA 5AERA 1DJIA 2AAOA 2KDHA 1FPWA 1YTZC 2FOTA 1CDNA 4NDDA 1UHKA 1XK4A 2DOQA 3PALA 1XFYO 1MR8A 2KAYA 4C0KA 3KO0A 1M39A 2KI4C 2BBMA 2CT9A 3KPXA 3O2PA 1K8UA 1J1EA 2KI6D 2LLSA 5HKWA 1DVIA 1QTXA 1OSAA 2JNXA 4YGBB 2TN4A 1M45A 1V1FA 3FIAA 1IRJA 1R2UA 2ZRSA 4YGDB 1JF2A 2K2AA 1KCYA 2CTNA 2M7NA 4OCIA 2ZN8A 3CWGA 2M29A 1PALA 2BL0B 5I2LA 4BY5A 1RWYA 2KGBC 2AUCA 2I18A 3JTDC 1RK9A 1S6JA 3FS7A 1K96A 1W7IB 1LINA 3CR2A 4MZLA 1NCZA 2KBIA 1PVAA 2KOTA 1Y6WA 2LMUA 2BECA 2LMVA 4PE4A 2GV5A 1NX3A 2L2EA 1JFJA 3F45A 5K89A 3I5GC 3PSRA 5AANA 2L4IA 3I5GB 2M3WA 3SIAA 1YR5A 2LHIA 1W7JB 4PE0A 1Y1XA 3AAJA 4ORBB 2LVKA 1EH2A 4MEWA 3BOWB 3SG5A 4L9MA 1SBJA 1S6IA 1TNPA 3NXAA 1J7QA 1CLBA 3FWBA 3SG2A 2BCAA 2KI6C 4OKHA 2JPTA 4ORAB 4WQ3A 1BG1A 4QJ3B 2NCPA 1AJ5A 1ZMZA 1QVIZ 3I5IC 1A03A 1EL4A 1S6CA 1FW4A 3EVUA 1ZOTB 1QX5B 3E3RA 2ISDA 2KAVA 1FI6A 1HQVA 1OMVA 1KSOA 3SG4A 1G8IA 1TNWA 1U5IA 1CLLA 2LNKA 3C1VA 5I8NA 4MVFA 1GJYA 1TOPA 1J55A 3WHTB 2LV7A 2GGZA 2E6WA 4F0ZB 2JU0A 2L5XB 1B8RA 1QIWA 1UHIA 2JNFA 3BOWA 2HQ8A 1ALWA 1CDMA 2JXCA 3CLNA 1HT9A 2AMIA 1GGZA 3PATA 2M1KB 2LCPA 1B47A 3PLFB 1CTRA 2I7AA 1A2XA 2KGRA 2KHNA 2KYFA 2KAXA 3BYAA 3TS5C 2K7BA 1K94A 1DT7B 1GGWA 1FBVA 2JT8A 2F2OA 3BUOB 2KBMA 1CDPA 2JTTA 2PRUA 1WDCB 1TN4A 3DVEA 4MRYA 1BJFA 1NPQA 1C7WA 1QLKA 3HX4A 1L2OB 5JOLA 2CCMA 4ZCUA 2L50A 1KFXL 4CFRA 1F54A 5CSJA 3LCPC 1B1GA 3OX6A 4D1EA 4TNCA 1AK8A 1H4BA 1YX7A 3WNXB 1AJ4A 1ZACA 2SASA 1XFUO 1K9PA 4HRHA 4GNKB 1YRUB 1NSHA 2K7OA 2LC5A 3BUXB 1RECA 3JVTB 2JQ6A 2JC2A 1PRWA 2L51A 2JRFA 3MSEB 5D69A 1PVBA 2R2IA 1SNLA 1OOJA 2OS8C 2ZNDA 4GGFC 4MZKA 1SL9A 5KSZA 1CM1A 3CTNA 1JUOA 3OX5A 2LAPA 3LK0A 1KQMC 1RJVA 1XK4C 2LMTA 1NCXA 2WCFA 2BCXA 1AUIB 1TCFA 1XFVO 1KQVA 1IWQA 1B7TY 2I94A 3NSKA 3DVJA 4AQJA 4A4BA 1K2HA 4N1GA 1A29A 1KWOC 2WNDA 5F6TA 2NCOA 2KQ6A 3PM8A 1TRFA 1CFCA 4I5NB 2KI4B 1A4PA 2MJWB 1K9UA 1KK8C 1B8LA 2V53A 4I5KA 4PHKA 1DF0A 1UHNA 1YUTA 4WRIA 4M2PA 1UUSA 2LVJA 5GQQC 1MHOA 1OZSA 4QJ4B 5DKNA 4OV2A 1KK7Y 5AEQA 1IJ6A 1SL7A 3ZWHA 1DJYA 4PHJA 5IBWA 1M46A 3A4UB 1G33A 2PASA 1Q80A 1UP5A 1EXRA 5FYXA 3JTDB 1M63B 3DF0B 1BR4B 3TS5B 2FJUB 1F71A 3SJSA 3AAKA 2M97A 1OE9B 3PN7C 3OHMB 2BKIB 1ODBA 3BUNB 2LM5A 1F70A 1TIZA 2F3YA 3ZNIA 1MXEA 1QV1A 4OR9B 1DMOA 1KFXS 2BE6A 1WY9A 1K9KA 3DVKA 2L98A 3D0YB 4NDBA 2QACA 2EGDA 3O4YA 1JSAA 3I5HC 1CB1A 3IQOA 1SR6C 4NQGA 2CBLA 3O6BA 1SW8A 2E30A 2LUCA 1Y1AA 3CZTX 4FQOA 5KU1A 1DJWA 2BBNA 1C07A 1F4OA 4N1FA 3I5IB 1XFZO 2OPOA 1ALVA 1UHHA 2LP2A 1J7OA 3VGOA 1OZOA 2H61A 3SIBA 2MHHA 4DUQA 2WCEA 2QPTA 1IJ5A 1QASA 3LK1A 1BLQA 2ZKMX 3EKHA 3RM1A 1OQPA 4ZCVA 4CPVA 2Y1NA 5I2QA 4YGAA 2O60A 1F55A 1SL8A 1N0YA 4HREE 2Q91A 2WOSA 1ZUZA 1OMRA 5HKYA 3NSOA 1WLMA 1A75B 4N5XA 3PFVA 5CSNA 1PSBA 3OB2B 1UWOA 5HLOA 1B9AA 3QRXA 3RLZA 1B4CA 3H4SE 3TZ1A 2EHBA 2KNEA 3EKJA 1MF8B 2K7DA 4BY4A 2K61A 4MSPA 1K95A 1EJ3A 2HF5A 5ER4X 1SCVA 5PALA 2M49B 1RROA 1S5GZ 4XJKB 2P6BB 4PE7A 2JTZA 3EK8A 2VRGA 2ZNEA 2LUXA 4PHMA 5AXIA 4A4CA 2MAZA 4ETOA 1WRZA 2LVIA 1DJHA 3VRPA 2MLFC 4JPZB 3CGAA 4R1EA 1IG5A 2COLB 1MQ1A 1LA0A 3TDIA 1QVIY 2KFGA 2Y4QA 1SPYA 2JZIA 2OTGC 1TNQA 4USLA 1CKKA 2Q4UA 1YUUA 4C0JA 3FWCA 1BOCA 1JBAA 1L7ZA 4MN0A 2EC6C 1QIVA 3IQQA 1XFWO 5AFPA 5JJGA 3M0WA 4XYNA 1KFUL 1QXPA 2OS8B 3ICBA 3TUYC 3O78A 4ORCB 2ZFDA 1JF0A 1S36A 1NYAA 1DGVA 1KQMB 4I5JA 2MBXA 1CMFA 1R6PA 1IH0A 3WXAA 1J1DA 2LHLA 2G2BA 2KFHA 3CR4X 1AVSA 4Q04A 4MLWA 1CM4A 1TCOB 2M8UA 4HRGA 4PDZA 1TNXA 3I5FC 4HSZA 3EK4A 2FCEA 1C7VA 1UHJA 1DJXA 4JQ0D 1SCMC 1XVJA 1KWOB 1XO5A 1RTP1 1JWDA 1KK8B 2I2RE 2MLEC 1QLSA 5TNCA 1K93D 2Y5IA 5CSIA 4GPLB 4IL1A 3VRRA 4YBHB 2PSRA 4YI8A 1WLZA 4E68A 1NWDA 2HPSA 1CNPA 1KSMA 1SY9A 4DCKA 2RGIA 5B8IB 3DVMA 5DKQA 1QX2A 1QX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0J A;  4AQI A;  3NSL A;  4PCW A;  3GK4 X;  1AHR A;  4P2Y B;  1N2D A;  2H2K A;  2Y1M A;  2MRD A;  3AKA A;  1LVC D;  4C0L A;  4CFQ A;  1TTX A;  2BE4 A;  4YGC B;  3PN7 B;  1NCY A;  2K2F A;  3EK7 A;  5I2O A;  5KTY A;  1S1E A;  4DS7 A;  1LA3 A;  2BL0 C;  4GFT A;  1CFF A;  3WHU B;  1DJZ A;  1PSR A;  1ZFS A;  4UPG A;  4YGE B;  2M7L A;  1GQM A;  4MZJ A;  3TDU A;  3LLE A;  3D10 A;  2WCB A;  4CID A;  4PAL A;  1IGV A;  1DTL A;  2JOJ A;  2L0P A;  2H61 C;  1NIW A;  3AKB A;  2F8P A;  3I5H B;  3NSI A;  1SR6 B;  1QJT A;  1YUS A;  1EG4 A;  3GK1 A;  1CDL A;  3EVR A;  1KFU S;  1FI5 A;  1YVH A;  1U5I B;  1Y0V H;  3CS1 A;  2LE9 B;  3DF0 A;  1PUL A;  1S3P A;  2HET A;  4DRW A;  2JT3 A;  2O5G A;  1JC2 A;  3VRN A;  2LP3 A;  2MA2 A;  1RFJ A;  2KSP A;  2LVV A;  3SG3 A;  5HKZ A;  1XFX O;  4YI9 A;  3TDZ A;  3KEV A;  5CPV A;  1N65 A;  1BOD A;  1NX1 A;  1SMG A;  2HQW A;  1M31 A;  3EVV A;  4GBA A;  4M2O A;  2BKH B;  2KQY A;  2L4H A;  5HLV A;  3OB1 B;  2D8N A;  1F4Q A;  2WC8 A;  3D0Y A;  1Y1U A;  3BQ3 A;  3GK2 A;  4MBE A;  2F3Z A;  3IF7 A;  2M9G A;  1BMO A;  5G08 A;  1BU3 A;  1BF5 A;  1F8H A;  2B1U A;  1MWN A;  4FTG A;  4I5L B;  4GUK A;  1G4Y R;  4NDC A;  2ZN9 A;  4M2Q A;  1SRA A;  1IQ5 A;  2A4J A;  3KF9 A;  3SG6 A;  1FF1 A;  2F2P A;  2JUL A;  2BCB A;  1CMG A;  1X02 A;  1VRK A;  2PMY A;  3HCM A;  3OP0 A;  1J7R A;  1JFK A;  2PAL A;  1CFD A;  5J3X A;  5HYD A;  4U8D A;  1B8C A;  3GOF A;  2LLU A;  1IQ3 A;  1B7T Z;  1D1O A;  2GGM A;  2JWW A;  5BPJ A;  5ER5 A;  2IS9 A;  3DD4 A;  1K90 D;  4QJ5 B;  4GAO A;  3LL8 B;  2OTG B;  2F33 A;  4YRU A;  1YX8 A;  1YRT B;  4DIR A;  1OMD A;  2M1U A;  4WQ2 A;  4PHN A;  1SKT A;  1H8B A;  1NUB A;  1DJG A;  2K8M B;  1XA5 A;  1AP4 A;  1A75 A;  2CXJ A;  2EC6 B;  1BT6 A;  1MUX A;  3KHE A;  1WRK A;  2NLN A;  1LKJ A;  4CLN A;  1CFP A;  1SK6 D;  1WDC C;  2FCD A;  4MRX A;  2NXQ A;  3VRQ A;  2KFF A;  1L2O C;  1MXL C;  1V1G A;  3TUY B;  1YVL A;  3BXK A;  1KK7 Z;  4XJK A;  3SG7 A;  5CSF A;  1BR1 B;  1YUR A;  1LXF C;  2LLT A;  2JT0 A;  1SYM A;  2JXL A;  2LAN A;  2PVB A;  1J7P A;  2CNP A;  3BUW B;  3JVT C;  4JWQ A;  3I5F B;  5D7F A;  1XYD A;  4PE1 A;  3K21 A;  1DF0 B;  1NX2 A;  1E8A A;  4GGN A;  1SCM B;  2M0R A;  4AOM A;  3CR5 X;  1DGU A;  3A8R A;  5DKR A;  2KYC A;  4P5O E;  1PK0 D;  1S5G Y;  1NX0 A;  1IKU A;  2NZ0 A;  1CLM A;  3BUM B;  1NP8 A;  1EG3 A;  1QS7 A;  3VRO A;  2K7C A;  1S26 D;  4ICB A;  2SCP A;  2G9B A;  2ZRT A;  1QAT A;  2WOR A;  4GGF A;  1WRL A;  4OVN F;  1QV0 A;  1UUR A;  5AER A;  1DJI A;  2AAO A;  2KDH A;  1FPW A;  1YTZ C;  2FOT A;  1CDN A;  4NDD A;  1UHK A;  1XK4 A;  2DOQ A;  3PAL A;  1XFY O;  1MR8 A;  2KAY A;  4C0K A;  3KO0 A;  1M39 A;  2KI4 C;  2BBM A;  2CT9 A;  3KPX A;  3O2P A;  1K8U A;  1J1E A;  2KI6 D;  2LLS A;  5HKW A;  1DVI A;  1QTX A;  1OSA A;  2JNX A;  4YGB B;  2TN4 A;  1M45 A;  1V1F A;  3FIA A;  1IRJ A;  1R2U A;  2ZRS A;  4YGD B;  1JF2 A;  2K2A A;  1KCY A;  2CTN A;  2M7N A;  4OCI A;  2ZN8 A;  3CWG A;  2M29 A;  1PAL A;  2BL0 B;  5I2L A;  4BY5 A;  1RWY A;  2KGB C;  2AUC A;  2I18 A;  3JTD C;  1RK9 A;  1S6J A;  3FS7 A;  1K96 A;  1W7I B;  1LIN A;  3CR2 A;  4MZL A;  1NCZ A;  2KBI A;  1PVA A;  2KOT A;  1Y6W A;  2LMU A;  2BEC A;  2LMV A;  4PE4 A;  2GV5 A;  1NX3 A;  2L2E A;  1JFJ A;  3F45 A;  5K89 A;  3I5G C;  3PSR A;  5AAN A;  2L4I A;  3I5G B;  2M3W A;  3SIA A;  1YR5 A;  2LHI A;  1W7J B;  4PE0 A;  1Y1X A;  3AAJ A;  4ORB B;  2LVK A;  1EH2 A;  4MEW A;  3BOW B;  3SG5 A;  4L9M A;  1SBJ A;  1S6I A;  1TNP A;  3NXA A;  1J7Q A;  1CLB A;  3FWB A;  3SG2 A;  2BCA A;  2KI6 C;  4OKH A;  2JPT A;  4ORA B;  4WQ3 A;  1BG1 A;  4QJ3 B;  2NCP A;  1AJ5 A;  1ZMZ A;  1QVI Z;  3I5I C;  1A03 A;  1EL4 A;  1S6C A;  1FW4 A;  3EVU A;  1ZOT B;  1QX5 B;  3E3R A;  2ISD A;  2KAV A;  1FI6 A;  1HQV A;  1OMV A;  1KSO A;  3SG4 A;  1G8I A;  1TNW A;  1U5I A;  1CLL A;  2LNK A;  3C1V A;  5I8N A;  4MVF A;  1GJY A;  1TOP A;  1J55 A;  3WHT B;  2LV7 A;  2GGZ A;  2E6W A;  4F0Z B;  2JU0 A;  2L5X B;  1B8R A;  1QIW A;  1UHI A;  2JNF A;  3BOW A;  2HQ8 A;  1ALW A;  1CDM A;  2JXC A;  3CLN A;  1HT9 A;  2AMI A;  1GGZ A;  3PAT A;  2M1K B;  2LCP A;  1B47 A;  3PLF B;  1CTR A;  2I7A A;  1A2X A;  2KGR A;  2KHN A;  2KYF A;  2KAX A;  3BYA A;  3TS5 C;  2K7B A;  1K94 A;  1DT7 B;  1GGW A;  1FBV A;  2JT8 A;  2F2O A;  3BUO B;  2KBM A;  1CDP A;  2JTT A;  2PRU A;  1WDC B;  1TN4 A;  3DVE A;  4MRY A;  1BJF A;  1NPQ A;  1C7W A;  1QLK A;  3HX4 A;  1L2O B;  5JOL A;  2CCM A;  4ZCU A;  2L50 A;  1KFX L;  4CFR A;  1F54 A;  5CSJ A;  3LCP C;  1B1G A;  3OX6 A;  4D1E A;  4TNC A;  1AK8 A;  1H4B A;  1YX7 A;  3WNX B;  1AJ4 A;  1ZAC A;  2SAS A;  1XFU O;  1K9P A;  4HRH A;  4GNK B;  1YRU B;  1NSH A;  2K7O A;  2LC5 A;  3BUX B;  1REC A;  3JVT B;  2JQ6 A;  2JC2 A;  1PRW A;  2L51 A;  2JRF A;  3MSE B;  5D69 A;  1PVB A;  2R2I A;  1SNL A;  1OOJ A;  2OS8 C;  2ZND A;  4GGF C;  4MZK A;  1SL9 A;  5KSZ A;  1CM1 A;  3CTN A;  1JUO A;  3OX5 A;  2LAP A;  3LK0 A;  1KQM C;  1RJV A;  1XK4 C;  2LMT A;  1NCX A;  2WCF A;  2BCX A;  1AUI B;  1TCF A;  1XFV O;  1KQV A;  1IWQ A;  1B7T Y;  2I94 A;  3NSK A;  3DVJ A;  4AQJ A;  4A4B A;  1K2H A;  4N1G A;  1A29 A;  1KWO C;  2WND A;  5F6T A;  2NCO A;  2KQ6 A;  3PM8 A;  1TRF A;  1CFC A;  4I5N B;  2KI4 B;  1A4P A;  2MJW B;  1K9U A;  1KK8 C;  1B8L A;  2V53 A;  4I5K A;  4PHK A;  1DF0 A;  1UHN A;  1YUT A;  4WRI A;  4M2P A;  1UUS A;  2LVJ A;  5GQQ C;  1MHO A;  1OZS A;  4QJ4 B;  5DKN A;  4OV2 A;  1KK7 Y;  5AEQ A;  1IJ6 A;  1SL7 A;  3ZWH A;  1DJY A;  4PHJ A;  5IBW A;  1M46 A;  3A4U B;  1G33 A;  2PAS A;  1Q80 A;  1UP5 A;  1EXR A;  5FYX A;  3JTD B;  1M63 B;  3DF0 B;  1BR4 B;  3TS5 B;  2FJU B;  1F71 A;  3SJS A;  3AAK A;  2M97 A;  1OE9 B;  3PN7 C;  3OHM B;  2BKI B;  1ODB A;  3BUN B;  2LM5 A;  1F70 A;  1TIZ A;  2F3Y A;  3ZNI A;  1MXE A;  1QV1 A;  4OR9 B;  1DMO A;  1KFX S;  2BE6 A;  1WY9 A;  1K9K A;  3DVK A;  2L98 A;  3D0Y B;  4NDB A;  2QAC A;  2EGD A;  3O4Y A;  1JSA A;  3I5H C;  1CB1 A;  3IQO A;  1SR6 C;  4NQG A;  2CBL A;  3O6B A;  1SW8 A;  2E30 A;  2LUC A;  1Y1A A;  3CZT X;  4FQO A;  5KU1 A;  1DJW A;  2BBN A;  1C07 A;  1F4O A;  4N1F A;  3I5I B;  1XFZ O;  2OPO A;  1ALV A;  1UHH A;  2LP2 A;  1J7O A;  3VGO A;  1OZO A;  2H61 A;  3SIB A;  2MHH A;  4DUQ A;  2WCE A;  2QPT A;  1IJ5 A;  1QAS A;  3LK1 A;  1BLQ A;  2ZKM X;  3EKH A;  3RM1 A;  1OQP A;  4ZCV A;  4CPV A;  2Y1N A;  5I2Q A;  4YGA A;  2O60 A;  1F55 A;  1SL8 A;  1N0Y A;  4HRE E;  2Q91 A;  2WOS A;  1ZUZ A;  1OMR A;  5HKY A;  3NSO A;  1WLM A;  1A75 B;  4N5X A;  3PFV A;  5CSN A;  1PSB A;  3OB2 B;  1UWO A;  5HLO A;  1B9A A;  3QRX A;  3RLZ A;  1B4C A;  3H4S E;  3TZ1 A;  2EHB A;  2KNE A;  3EKJ A;  1MF8 B;  2K7D A;  4BY4 A;  2K61 A;  4MSP A;  1K95 A;  1EJ3 A;  2HF5 A;  5ER4 X;  1SCV A;  5PAL A;  2M49 B;  1RRO A;  1S5G Z;  4XJK B;  2P6B B;  4PE7 A;  2JTZ A;  3EK8 A;  2VRG A;  2ZNE A;  2LUX A;  4PHM A;  5AXI A;  4A4C A;  2MAZ A;  4ETO A;  1WRZ A;  2LVI A;  1DJH A;  3VRP A;  2MLF C;  4JPZ B;  3CGA A;  4R1E A;  1IG5 A;  2COL B;  1MQ1 A;  1LA0 A;  3TDI A;  1QVI Y;  2KFG A;  2Y4Q A;  1SPY A;  2JZI A;  2OTG C;  1TNQ A;  4USL A;  1CKK A;  2Q4U A;  1YUU A;  4C0J A;  3FWC A;  1BOC A;  1JBA A;  1L7Z A;  4MN0 A;  2EC6 C;  1QIV A;  3IQQ A;  1XFW O;  5AFP A;  5JJG A;  3M0W A;  4XYN A;  1KFU L;  1QXP A;  2OS8 B;  3ICB A;  3TUY C;  3O78 A;  4ORC B;  2ZFD A;  1JF0 A;  1S36 A;  1NYA A;  1DGV A;  1KQM B;  4I5J A;  2MBX A;  1CMF A;  1R6P A;  1IH0 A;  3WXA A;  1J1D A;  2LHL A;  2G2B A;  2KFH A;  3CR4 X;  1AVS A;  4Q04 A;  4MLW A;  1CM4 A;  1TCO B;  2M8U A;  4HRG A;  4PDZ A;  1TNX A;  3I5F C;  4HSZ A;  3EK4 A;  2FCE A;  1C7V A;  1UHJ A;  1DJX A;  4JQ0 D;  1SCM C;  1XVJ A;  1KWO B;  1XO5 A;  1RTP 1;  1JWD A;  1KK8 B;  2I2R E;  2MLE C;  1QLS A;  5TNC A;  1K93 D;  2Y5I A;  5CSI A;  4GPL B;  4IL1 A;  3VRR A;  4YBH B;  2PSR A;  4YI8 A;  1WLZ A;  4E68 A;  1NWD A;  2HPS A;  1CNP A;  1KSM A;  1SY9 A;  4DCK A;  2RGI A;  5B8I B;  3DVM A;  5DKQ A;  1QX2 A;  1QX7 A; 
#chains in the Genus database with same CATH topology
 2K0J A;  4AQI A;  3NSL A;  3V2L A;  4PCW A;  2YGU A;  3GK4 X;  3B87 A;  1AHR A;  2ERB A;  4P2Y B;  3B88 A;  1N2D A;  2JPO A;  2H2K A;  2Y1M A;  2MRD A;  1TUJ A;  1LVC D;  3AKA A;  4C0L A;  4CFQ A;  1TTX A;  2BE4 A;  4YGC B;  3PN7 B;  1NCY A;  2K2F A;  3EK7 A;  2PYQ A;  5I2O A;  5KTY A;  1S1E A;  4DS7 A;  1TWO A;  1LA3 A;  2BL0 C;  4GFT A;  1CFF A;  3WHU B;  1DJZ A;  1PSR A;  1ZFS A;  4UPG A;  4YGE B;  2M7L A;  1GQM A;  4MZJ A;  3TDU A;  3LLE A;  3D10 A;  2WCB A;  4CID A;  4PAL A;  1IGV A;  1DTL A;  2JOJ A;  2L0P A;  2H61 C;  1NIW A;  3AKB A;  2F8P A;  3I5H B;  3EG5 B;  1SR6 B;  3NSI A;  1QJT A;  3FE9 A;  1YUS A;  3BFB A;  1EG4 A;  3GK1 A;  1CDL A;  3D77 A;  3EVR A;  1KFU S;  3S0A A;  1FI5 A;  1YVH A;  1U5I B;  1Y0V H;  3CS1 A;  2LE9 B;  3DF0 A;  1PUL A;  1S3P A;  2HET A;  4DRW A;  2JT3 A;  1GM0 A;  2O5G A;  1JC2 A;  3VRN A;  2LP3 A;  2MA2 A;  3N7H A;  1RFJ A;  2KSP A;  2LVV A;  3D74 A;  5HKZ A;  3SG3 A;  1XFX O;  4YI9 A;  3TDZ A;  3KEV A;  4OZD A;  5CPV A;  1N65 A;  1BOD A;  1NX1 A;  1SMG A;  2HQW A;  1M31 A;  3EVV A;  4GBA A;  4M2O A;  2BKH B;  2KQY A;  2L4H A;  5HLV A;  3OB1 B;  2D8N A;  1F4Q A;  2WC8 A;  3D0Y A;  1Y1U A;  3BQ3 A;  3GK2 A;  4MBE A;  2F3Z A;  3IF7 A;  5HL1 A;  2M9G A;  3L4A A;  3DY9 A;  1BMO A;  5G08 A;  1BU3 A;  3S0D A;  1BF5 A;  1F8H A;  2B1U A;  3NHT A;  1MWN A;  4FTG A;  4I5L B;  4GUK A;  1G4Y R;  4NDC A;  2ZN9 A;  4M2Q A;  1SRA A;  1IQ5 A;  2A4J A;  3KF9 A;  3SG6 A;  1FF1 A;  2F2P A;  2JUL A;  3DYE A;  2BCB A;  1CMG A;  2KLD A;  1X02 A;  1VRK A;  2PMY A;  3HCM A;  3OP0 A;  1J7R A;  1JFK A;  2PAL A;  1CFD A;  3OGN A;  5J3X A;  5HYD A;  4U8D A;  5FI6 A;  1B8C A;  3GOF A;  2LLU A;  1IQ3 A;  1B7T Z;  1D1O A;  2GGM A;  2JWW A;  3R1V A;  5BPJ A;  5ER5 A;  1OOF A;  2IS9 A;  1OOH A;  1K90 D;  3DD4 A;  4GAO A;  3LL8 B;  2OTG B;  2F33 A;  4QJ5 B;  4YRU A;  1YX8 A;  1YRT B;  4DIR A;  1OMD A;  2M1U A;  4WQ2 A;  4PHN A;  1SKT A;  1H8B A;  4JKT A;  1NUB A;  1DJG A;  3D76 A;  2K8M B;  1XA5 A;  1AP4 A;  1A75 A;  2CXJ A;  2EC6 B;  1BT6 A;  1MUX A;  3KHE A;  1WRK A;  2NLN A;  1LKJ A;  4CLN A;  2QEO A;  1CFP A;  1SK6 D;  1WDC C;  2FCD A;  3IVT A;  2NXQ A;  4MRX A;  3VRQ A;  2KFF A;  1L2O C;  1MXL C;  1V1G A;  3S0B A;  3TUY B;  1YVL A;  3BXK A;  1KK7 Z;  4XJK A;  3SG7 A;  5CSF A;  1BR1 B;  1YUR A;  1LXF C;  2LLT A;  2JT0 A;  1SYM A;  2JXL A;  2LAN A;  2PVB A;  3K1E A;  1J7P A;  2CNP A;  4FQT A;  3BUW B;  3JVT C;  3NHI A;  4JWQ A;  3I5F B;  5D7F A;  1XYD A;  4PE1 A;  3K21 A;  1W9Z A;  1DF0 B;  1NX2 A;  1E8A A;  4GGN A;  1SCM B;  2M0R A;  4AOM A;  3CR5 X;  1DGU A;  3A8R A;  5DKR A;  2KYC A;  3B7A A;  4P5O E;  1PK0 D;  1S5G Y;  3O4X A;  1NX0 A;  1IKU A;  2NZ0 A;  1CLM A;  3BUM B;  1NP8 A;  1LS8 A;  1EG3 A;  1QS7 A;  3VRO A;  2K7C A;  1S26 D;  4ICB A;  2SCP A;  2G9B A;  2WCK A;  1QAT A;  1Z4H A;  2WOR A;  1WRL A;  2ZRT A;  4GGF A;  4OVN F;  1QV0 A;  1UUR A;  5AER A;  1DJI A;  2AAO A;  3CZ1 A;  1TUZ A;  2KDH A;  1FPW A;  1YTZ C;  2FOT A;  2WCM A;  4NDD A;  1CDN A;  1UHK A;  1XK4 A;  2DOQ A;  3PAL A;  1XFY O;  1MR8 A;  2KAY A;  4C0K A;  3KO0 A;  1M39 A;  2KI4 C;  2BBM A;  2CT9 A;  3KPX A;  2QEH A;  3O2P A;  1K8U A;  1J1E A;  1Z2C B;  2KI6 D;  2LLS A;  5HKW A;  1DVI A;  1QTX A;  1OSA A;  2JNX A;  4YGB B;  2TN4 A;  2BNX A;  1M45 A;  1V1F A;  3FIA A;  1IRJ A;  1R2U A;  2ZRS A;  4YGD B;  1JF2 A;  3UO9 A;  2K2A A;  5FI2 A;  2CTN A;  2M7N A;  4OCI A;  1KCY A;  2ZN8 A;  3CWG A;  1ORG A;  2M29 A;  1PAL A;  2BL0 B;  5I2L A;  4BY5 A;  1RWY A;  2P70 A;  2KGB C;  2AUC A;  2I18 A;  3JTD C;  1RK9 A;  1S6J A;  3FS7 A;  1K96 A;  1W7I B;  1LIN A;  3CR2 A;  4MZL A;  1NCZ A;  2KBI A;  1PVA A;  2KOT A;  1Y6W A;  2LMU A;  2BEC A;  2LMV A;  4PE4 A;  2GV5 A;  1NX3 A;  2L2E A;  1JFJ A;  3F45 A;  5K89 A;  3I5G C;  3PSR A;  5AAN A;  1C3Y A;  2L4I A;  3I5G B;  2M3W A;  3SIA A;  1YR5 A;  2LHI A;  1W7J B;  2GTE A;  1Y1X A;  3AAJ A;  4ORB B;  2LVK A;  4PE0 A;  1EH2 A;  4MEW A;  3BOW B;  3SG5 A;  4L9M A;  1SBJ A;  1S6I A;  1TNP A;  3NXA A;  1J7Q A;  1CLB A;  3FWB A;  3SG2 A;  2BCA A;  2KI6 C;  4OKH A;  2JPT A;  4ORA B;  4WQ3 A;  1BG1 A;  4QJ3 B;  2NCP A;  1OOG A;  1AJ5 A;  1ZMZ A;  1QVI Z;  3I5I C;  1A03 A;  1P28 A;  1EL4 A;  1S6C A;  1FW4 A;  3EVU A;  1ZOT B;  1QX5 B;  3E3R A;  2ISD A;  2KAV A;  2L2C A;  1HQV A;  2K60 A;  1FI6 A;  1OMV A;  1KSO A;  3SG4 A;  1G8I A;  1TNW A;  1U5I A;  1CLL A;  2LNK A;  3C1V A;  5I8N A;  4MVF A;  1GJY A;  1TOP A;  1J55 A;  3WHT B;  2LV7 A;  2GGZ A;  2E6W A;  3SS4 A;  4F0Z B;  2JU0 A;  2L5X B;  1B8R A;  1QIW A;  1UHI A;  2JNF A;  3BOW A;  2HQ8 A;  1ALW A;  1CDM A;  2JXC A;  3CLN A;  1HT9 A;  2AMI A;  1GGZ A;  3PAT A;  2M1K B;  2LCP A;  1B47 A;  3PLF B;  1CTR A;  2I7A A;  3BFH A;  4F7F A;  3B86 A;  1A2X A;  2KGR A;  2KHN A;  2KYF A;  2KAX A;  3BYA A;  3TS5 C;  2K7B A;  1K94 A;  1DT7 B;  2H8V A;  1GGW A;  1FBV A;  3PM2 A;  2JT8 A;  2F2O A;  3BUO B;  2KBM A;  1CDP A;  2JTT A;  2PRU A;  1WDC B;  1TN4 A;  3DVE A;  4MRY A;  1BJF A;  1NPQ A;  4INX A;  5I94 A;  1C7W A;  1QLK A;  3HX4 A;  1L2O B;  5JOL A;  2CCM A;  4ZCU A;  2L50 A;  1KFX L;  4CFR A;  1F54 A;  5CSJ A;  3LCP C;  1B1G A;  3OX6 A;  4D1E A;  4TNC A;  1AK8 A;  1H4B A;  1YX7 A;  3WNX B;  1AJ4 A;  1ZAC A;  2SAS A;  3RZS A;  1XFU O;  1K9P A;  4HRH A;  4GNK B;  1YRU B;  1NSH A;  4PT1 A;  2K7O A;  2LC5 A;  3BUX B;  1REC A;  3JVT B;  3FE6 A;  2JQ6 A;  2JC2 A;  1PRW A;  2L51 A;  2JRF A;  3MSE B;  5D69 A;  1PVB A;  2R2I A;  1DEL A;  1SNL A;  1OOJ A;  2OS8 C;  2ZND A;  4GGF C;  4MZK A;  1SL9 A;  5KSZ A;  1CM1 A;  3CTN A;  1JUO A;  3OX5 A;  2LAP A;  3D73 A;  3LK0 A;  1KQM C;  1RJV A;  1XK4 C;  2LMT A;  1DC1 A;  2QEV A;  3DZT A;  1NCX A;  2WCF A;  3SS3 A;  2BCX A;  1AUI B;  1TCF A;  1XFV O;  3D78 A;  1KQV A;  1IWQ A;  1B7T Y;  2I94 A;  3NSK A;  3B6X A;  3DVJ A;  4AQJ A;  4A4B A;  5D3O A;  1K2H A;  3UNW A;  4N1G A;  1A29 A;  1KWO C;  2BAP A;  2WND A;  5F6T A;  2NCO A;  2KQ6 A;  3PM8 A;  1TRF A;  3S0E A;  1CFC A;  4I5N B;  2KI4 B;  1A4P A;  2MJW B;  1K9U A;  1KK8 C;  1B8L A;  2V53 A;  4I5K A;  3CDN A;  4PHK A;  1T14 A;  3RLZ A;  1DF0 A;  1UHN A;  1YUT A;  4WRI A;  3OBV A;  4M2P A;  1UUS A;  2LVJ A;  5GQQ C;  4INW A;  1MHO A;  1OZS A;  4QJ4 B;  5DKN A;  4OV2 A;  1KK7 Y;  5AEQ A;  1IJ6 A;  1SL7 A;  2WCL A;  3ZWH A;  1DJY A;  4PHJ A;  5IBW A;  1M46 A;  3A4U B;  1G33 A;  2PAS A;  1Q80 A;  1UP5 A;  1EXR A;  5FYX A;  1DQE A;  3CZ2 A;  3JTD B;  1M63 B;  3DF0 B;  1BR4 B;  3TS5 B;  2FJU B;  1F71 A;  3SJS A;  3AAK A;  2M97 A;  1OE9 B;  3PN7 C;  3OHM B;  2BKI B;  1ODB A;  3BUN B;  2LM5 A;  1F70 A;  1TIZ A;  2F3Y A;  3ZNI A;  1MXE A;  1QV1 A;  4OR9 B;  1DMO A;  1KFX S;  2BE6 A;  1WY9 A;  1K9K A;  3SS5 A;  3DVK A;  3BFA A;  2L98 A;  3D0Y B;  3PJI A;  4NDB A;  1SSE B;  2QAC A;  2EGD A;  4KYN A;  3O4Y A;  1JSA A;  3I5H C;  1CB1 A;  3QME A;  3IQO A;  1SR6 C;  3NGV A;  2CBL A;  4NQG A;  3O6B A;  1SW8 A;  2E30 A;  2LUC A;  1Y1A A;  3CZT X;  4FQO A;  5KU1 A;  1DJW A;  2BBN A;  1C07 A;  1F4O A;  4N1F A;  3I5I B;  5DIC A;  1XFZ O;  2OPO A;  1ALV A;  1UHH A;  2LP2 A;  3D75 A;  1J7O A;  3VGO A;  1OZO A;  3CZ0 A;  2H61 A;  3SIB A;  2MHH A;  4DUQ A;  3S0F A;  2WCE A;  2QPT A;  1IJ5 A;  1QAS A;  3LK1 A;  2WCJ A;  1BLQ A;  2ZKM X;  3EKH A;  3RM1 A;  1OQP A;  4ZCV A;  4CPV A;  2Y1N A;  5I2Q A;  4YGA A;  2O60 A;  1F55 A;  1SL8 A;  2P71 A;  1N0Y A;  4HRE E;  2Q91 A;  2WOS A;  1ZUZ A;  1OMR A;  5HKY A;  3NSO A;  1WLM A;  3L4L A;  1A75 B;  4N5X A;  2KPH A;  2WC6 A;  1PSB A;  3OB2 B;  1UWO A;  3PFV A;  1B9A A;  3QRX A;  5CSN A;  5HLO A;  4JD9 A;  2WC5 A;  3H4S E;  3L47 A;  1B4C A;  3TZ1 A;  2EHB A;  2KNE A;  2PQL A;  3EKJ A;  1MF8 B;  2K7D A;  4BY4 A;  2K61 A;  4MSP A;  1K95 A;  1EJ3 A;  2HF5 A;  5ER4 X;  1SCV A;  5PAL A;  2M49 B;  1RRO A;  2QDI A;  1S5G Z;  3R1O A;  4XJK B;  2P6B B;  4PE7 A;  2JTZ A;  3EK8 A;  2VRG A;  2ZNE A;  2LUX A;  4PHM A;  5AXI A;  4A4C A;  2MAZ A;  4ETO A;  1WRZ A;  2LVI A;  1DJH A;  3VRP A;  2MLF C;  1OW4 A;  1XFR A;  3BJH A;  4JPZ B;  2WCH A;  3CGA A;  4R1E A;  1IG5 A;  2COL B;  1MQ1 A;  5FI7 A;  1LA0 A;  3TDI A;  1QVI Y;  2KFG A;  2Y4Q A;  1SPY A;  2JZI A;  2OTG C;  1TNQ A;  4USL A;  1CKK A;  2Q4U A;  4IJ7 A;  1YUU A;  4C0J A;  3FWC A;  1BOC A;  3Q8I A;  1JBA A;  3R72 A;  3S0G A;  1L7Z A;  4MN0 A;  2QEB A;  2EC6 C;  1QIV A;  3IQQ A;  1QWV A;  1XFW O;  5AFP A;  5JJG A;  3M0W A;  4XYN A;  1KFU L;  1QXP A;  2OS8 B;  3ICB A;  3TUY C;  3O78 A;  4ORC B;  1IIO A;  2ZFD A;  1JF0 A;  1S36 A;  1NYA A;  1DGV A;  1KQM B;  4I5J A;  3FE8 A;  2MBX A;  1R6P A;  1CMF A;  1IH0 A;  3WXA A;  1J1D A;  5EL2 A;  2LHL A;  2G2B A;  2FJY A;  2KFH A;  3CR4 X;  1AVS A;  4Q04 A;  4MLW A;  3R1P A;  1CM4 A;  1TCO B;  2M8U A;  4HRG A;  4PDZ A;  1TNX A;  3I5F C;  4HSZ A;  3EK4 A;  1C3Z A;  2FCE A;  1C7V A;  2KLE A;  1UHJ A;  1DJX A;  4JQ0 D;  1SCM C;  1XVJ A;  1KWO B;  1XO5 A;  3CAB A;  2L5Y A;  1RTP 1;  1JWD A;  1KK8 B;  2I2R E;  2MLE C;  1QLS A;  5TNC A;  3DXL A;  1K93 D;  2Y5I A;  5CSI A;  3CYZ A;  4GPL B;  4IL1 A;  3VB1 A;  3VRR A;  4YBH B;  2PSR A;  4YI8 A;  1DEK A;  1WLZ A;  4E68 A;  1NWD A;  2HPS A;  1CNP A;  1KSM A;  1OOI X;  1SY9 A;  4DCK A;  2RGI A;  5B8I B;  3DVM A;  5DKQ A;  1QX2 A;  1QX7 A; 
#chains in the Genus database with same CATH homology
 2K0J A;  4AQI A;  3NSL A;  4PCW A;  3GK4 X;  1AHR A;  4P2Y B;  1N2D A;  2H2K A;  2Y1M A;  2MRD A;  3AKA A;  1LVC D;  4C0L A;  4CFQ A;  1TTX A;  2BE4 A;  4YGC B;  3PN7 B;  1NCY A;  2K2F A;  3EK7 A;  5I2O A;  5KTY A;  1S1E A;  4DS7 A;  1LA3 A;  2BL0 C;  4GFT A;  1CFF A;  3WHU B;  1DJZ A;  1PSR A;  1ZFS A;  4UPG A;  4YGE B;  2M7L A;  1GQM A;  4MZJ A;  3TDU A;  3LLE A;  3D10 A;  2WCB A;  4CID A;  4PAL A;  1IGV A;  1DTL A;  2JOJ A;  2L0P A;  2H61 C;  1NIW A;  3AKB A;  2F8P A;  3I5H B;  3NSI A;  1SR6 B;  1QJT A;  1YUS A;  1EG4 A;  3GK1 A;  1CDL A;  3EVR A;  1KFU S;  1FI5 A;  1YVH A;  1U5I B;  1Y0V H;  3CS1 A;  2LE9 B;  3DF0 A;  1PUL A;  1S3P A;  2HET A;  4DRW A;  2JT3 A;  2O5G A;  1JC2 A;  3VRN A;  2LP3 A;  2MA2 A;  1RFJ A;  2KSP A;  2LVV A;  3SG3 A;  5HKZ A;  1XFX O;  4YI9 A;  3TDZ A;  3KEV A;  5CPV A;  1N65 A;  1BOD A;  1NX1 A;  1SMG A;  2HQW A;  1M31 A;  3EVV A;  4GBA A;  4M2O A;  2BKH B;  2KQY A;  2L4H A;  5HLV A;  3OB1 B;  2D8N A;  1F4Q A;  2WC8 A;  3D0Y A;  1Y1U A;  3BQ3 A;  3GK2 A;  4MBE A;  2F3Z A;  3IF7 A;  2M9G A;  1BMO A;  5G08 A;  1BU3 A;  1BF5 A;  1F8H A;  2B1U A;  1MWN A;  4FTG A;  4I5L B;  4GUK A;  1G4Y R;  4NDC A;  2ZN9 A;  4M2Q A;  1SRA A;  1IQ5 A;  2A4J A;  3KF9 A;  3SG6 A;  1FF1 A;  2F2P A;  2JUL A;  2BCB A;  1CMG A;  1X02 A;  1VRK A;  2PMY A;  3HCM A;  3OP0 A;  1J7R A;  1JFK A;  2PAL A;  1CFD A;  5J3X A;  5HYD A;  4U8D A;  1B8C A;  3GOF A;  2LLU A;  1IQ3 A;  1B7T Z;  1D1O A;  2GGM A;  2JWW A;  5BPJ A;  5ER5 A;  2IS9 A;  3DD4 A;  1K90 D;  4QJ5 B;  4GAO A;  3LL8 B;  2OTG B;  2F33 A;  4YRU A;  1YX8 A;  1YRT B;  4DIR A;  1OMD A;  2M1U A;  4WQ2 A;  4PHN A;  1SKT A;  1H8B A;  1NUB A;  1DJG A;  2K8M B;  1XA5 A;  1AP4 A;  1A75 A;  2CXJ A;  2EC6 B;  1BT6 A;  1MUX A;  3KHE A;  1WRK A;  2NLN A;  1LKJ A;  4CLN A;  1CFP A;  1SK6 D;  1WDC C;  2FCD A;  4MRX A;  2NXQ A;  3VRQ A;  2KFF A;  1L2O C;  1MXL C;  1V1G A;  3TUY B;  1YVL A;  3BXK A;  1KK7 Z;  4XJK A;  3SG7 A;  5CSF A;  1BR1 B;  1YUR A;  1LXF C;  2LLT A;  2JT0 A;  1SYM A;  2JXL A;  2LAN A;  2PVB A;  1J7P A;  2CNP A;  3BUW B;  3JVT C;  4JWQ A;  3I5F B;  5D7F A;  1XYD A;  4PE1 A;  3K21 A;  1DF0 B;  1NX2 A;  1E8A A;  4GGN A;  1SCM B;  2M0R A;  4AOM A;  3CR5 X;  1DGU A;  3A8R A;  5DKR A;  2KYC A;  4P5O E;  1PK0 D;  1S5G Y;  1NX0 A;  1IKU A;  2NZ0 A;  1CLM A;  3BUM B;  1NP8 A;  1EG3 A;  1QS7 A;  3VRO A;  2K7C A;  1S26 D;  4ICB A;  2SCP A;  2G9B A;  2ZRT A;  1QAT A;  2WOR A;  4GGF A;  1WRL A;  4OVN F;  1QV0 A;  1UUR A;  5AER A;  1DJI A;  2AAO A;  2KDH A;  1FPW A;  1YTZ C;  2FOT A;  1CDN A;  4NDD A;  1UHK A;  1XK4 A;  2DOQ A;  3PAL A;  1XFY O;  1MR8 A;  2KAY A;  4C0K A;  3KO0 A;  1M39 A;  2KI4 C;  2BBM A;  2CT9 A;  3KPX A;  3O2P A;  1K8U A;  1J1E A;  2KI6 D;  2LLS A;  5HKW A;  1DVI A;  1QTX A;  1OSA A;  2JNX A;  4YGB B;  2TN4 A;  1M45 A;  1V1F A;  3FIA A;  1IRJ A;  1R2U A;  2ZRS A;  4YGD B;  1JF2 A;  2K2A A;  1KCY A;  2CTN A;  2M7N A;  4OCI A;  2ZN8 A;  3CWG A;  2M29 A;  1PAL A;  2BL0 B;  5I2L A;  4BY5 A;  1RWY A;  2KGB C;  2AUC A;  2I18 A;  3JTD C;  1RK9 A;  1S6J A;  3FS7 A;  1K96 A;  1W7I B;  1LIN A;  3CR2 A;  4MZL A;  1NCZ A;  2KBI A;  1PVA A;  2KOT A;  1Y6W A;  2LMU A;  2BEC A;  2LMV A;  4PE4 A;  2GV5 A;  1NX3 A;  2L2E A;  1JFJ A;  3F45 A;  5K89 A;  3I5G C;  3PSR A;  5AAN A;  2L4I A;  3I5G B;  2M3W A;  3SIA A;  1YR5 A;  2LHI A;  1W7J B;  4PE0 A;  1Y1X A;  3AAJ A;  4ORB B;  2LVK A;  1EH2 A;  4MEW A;  3BOW B;  3SG5 A;  4L9M A;  1SBJ A;  1S6I A;  1TNP A;  3NXA A;  1J7Q A;  1CLB A;  3FWB A;  3SG2 A;  2BCA A;  2KI6 C;  4OKH A;  2JPT A;  4ORA B;  4WQ3 A;  1BG1 A;  4QJ3 B;  2NCP A;  1AJ5 A;  1ZMZ A;  1QVI Z;  3I5I C;  1A03 A;  1EL4 A;  1S6C A;  1FW4 A;  3EVU A;  1ZOT B;  1QX5 B;  3E3R A;  2ISD A;  2KAV A;  1FI6 A;  1HQV A;  1OMV A;  1KSO A;  3SG4 A;  1G8I A;  1TNW A;  1U5I A;  1CLL A;  2LNK A;  3C1V A;  5I8N A;  4MVF A;  1GJY A;  1TOP A;  1J55 A;  3WHT B;  2LV7 A;  2GGZ A;  2E6W A;  4F0Z B;  2JU0 A;  2L5X B;  1B8R A;  1QIW A;  1UHI A;  2JNF A;  3BOW A;  2HQ8 A;  1ALW A;  1CDM A;  2JXC A;  3CLN A;  1HT9 A;  2AMI A;  1GGZ A;  3PAT A;  2M1K B;  2LCP A;  1B47 A;  3PLF B;  1CTR A;  2I7A A;  1A2X A;  2KGR A;  2KHN A;  2KYF A;  2KAX A;  3BYA A;  3TS5 C;  2K7B A;  1K94 A;  1DT7 B;  1GGW A;  1FBV A;  2JT8 A;  2F2O A;  3BUO B;  2KBM A;  1CDP A;  2JTT A;  2PRU A;  1WDC B;  1TN4 A;  3DVE A;  4MRY A;  1BJF A;  1NPQ A;  1C7W A;  1QLK A;  3HX4 A;  1L2O B;  5JOL A;  2CCM A;  4ZCU A;  2L50 A;  1KFX L;  4CFR A;  1F54 A;  5CSJ A;  3LCP C;  1B1G A;  3OX6 A;  4D1E A;  4TNC A;  1AK8 A;  1H4B A;  1YX7 A;  3WNX B;  1AJ4 A;  1ZAC A;  2SAS A;  1XFU O;  1K9P A;  4HRH A;  4GNK B;  1YRU B;  1NSH A;  2K7O A;  2LC5 A;  3BUX B;  1REC A;  3JVT B;  2JQ6 A;  2JC2 A;  1PRW A;  2L51 A;  2JRF A;  3MSE B;  5D69 A;  1PVB A;  2R2I A;  1SNL A;  1OOJ A;  2OS8 C;  2ZND A;  4GGF C;  4MZK A;  1SL9 A;  5KSZ A;  1CM1 A;  3CTN A;  1JUO A;  3OX5 A;  2LAP A;  3LK0 A;  1KQM C;  1RJV A;  1XK4 C;  2LMT A;  1NCX A;  2WCF A;  2BCX A;  1AUI B;  1TCF A;  1XFV O;  1KQV A;  1IWQ A;  1B7T Y;  2I94 A;  3NSK A;  3DVJ A;  4AQJ A;  4A4B A;  1K2H A;  4N1G A;  1A29 A;  1KWO C;  2WND A;  5F6T A;  2NCO A;  2KQ6 A;  3PM8 A;  1TRF A;  1CFC A;  4I5N B;  2KI4 B;  1A4P A;  2MJW B;  1K9U A;  1KK8 C;  1B8L A;  2V53 A;  4I5K A;  4PHK A;  1DF0 A;  1UHN A;  1YUT A;  4WRI A;  4M2P A;  1UUS A;  2LVJ A;  5GQQ C;  1MHO A;  1OZS A;  4QJ4 B;  5DKN A;  4OV2 A;  1KK7 Y;  5AEQ A;  1IJ6 A;  1SL7 A;  3ZWH A;  1DJY A;  4PHJ A;  5IBW A;  1M46 A;  3A4U B;  1G33 A;  2PAS A;  1Q80 A;  1UP5 A;  1EXR A;  5FYX A;  3JTD B;  1M63 B;  3DF0 B;  1BR4 B;  3TS5 B;  2FJU B;  1F71 A;  3SJS A;  3AAK A;  2M97 A;  1OE9 B;  3PN7 C;  3OHM B;  2BKI B;  1ODB A;  3BUN B;  2LM5 A;  1F70 A;  1TIZ A;  2F3Y A;  3ZNI A;  1MXE A;  1QV1 A;  4OR9 B;  1DMO A;  1KFX S;  2BE6 A;  1WY9 A;  1K9K A;  3DVK A;  2L98 A;  3D0Y B;  4NDB A;  2QAC A;  2EGD A;  3O4Y A;  1JSA A;  3I5H C;  1CB1 A;  3IQO A;  1SR6 C;  4NQG A;  2CBL A;  3O6B A;  1SW8 A;  2E30 A;  2LUC A;  1Y1A A;  3CZT X;  4FQO A;  5KU1 A;  1DJW A;  2BBN A;  1C07 A;  1F4O A;  4N1F A;  3I5I B;  1XFZ O;  2OPO A;  1ALV A;  1UHH A;  2LP2 A;  1J7O A;  3VGO A;  1OZO A;  2H61 A;  3SIB A;  2MHH A;  4DUQ A;  2WCE A;  2QPT A;  1IJ5 A;  1QAS A;  3LK1 A;  1BLQ A;  2ZKM X;  3EKH A;  3RM1 A;  1OQP A;  4ZCV A;  4CPV A;  2Y1N A;  5I2Q A;  4YGA A;  2O60 A;  1F55 A;  1SL8 A;  1N0Y A;  4HRE E;  2Q91 A;  2WOS A;  1ZUZ A;  1OMR A;  5HKY A;  3NSO A;  1WLM A;  1A75 B;  4N5X A;  3PFV A;  5CSN A;  1PSB A;  3OB2 B;  1UWO A;  5HLO A;  1B9A A;  3QRX A;  3RLZ A;  1B4C A;  3H4S E;  3TZ1 A;  2EHB A;  2KNE A;  3EKJ A;  1MF8 B;  2K7D A;  4BY4 A;  2K61 A;  4MSP A;  1K95 A;  1EJ3 A;  2HF5 A;  5ER4 X;  1SCV A;  5PAL A;  2M49 B;  1RRO A;  1S5G Z;  4XJK B;  2P6B B;  4PE7 A;  2JTZ A;  3EK8 A;  2VRG A;  2ZNE A;  2LUX A;  4PHM A;  5AXI A;  4A4C A;  2MAZ A;  4ETO A;  1WRZ A;  2LVI A;  1DJH A;  3VRP A;  2MLF C;  4JPZ B;  3CGA A;  4R1E A;  1IG5 A;  2COL B;  1MQ1 A;  1LA0 A;  3TDI A;  1QVI Y;  2KFG A;  2Y4Q A;  1SPY A;  2JZI A;  2OTG C;  1TNQ A;  4USL A;  1CKK A;  2Q4U A;  1YUU A;  4C0J A;  3FWC A;  1BOC A;  1JBA A;  1L7Z A;  4MN0 A;  2EC6 C;  1QIV A;  3IQQ A;  1XFW O;  5AFP A;  5JJG A;  3M0W A;  4XYN A;  1KFU L;  1QXP A;  2OS8 B;  3ICB A;  3TUY C;  3O78 A;  4ORC B;  2ZFD A;  1JF0 A;  1S36 A;  1NYA A;  1DGV A;  1KQM B;  4I5J A;  2MBX A;  1CMF A;  1R6P A;  1IH0 A;  3WXA A;  1J1D A;  2LHL A;  2G2B A;  2KFH A;  3CR4 X;  1AVS A;  4Q04 A;  4MLW A;  1CM4 A;  1TCO B;  2M8U A;  4HRG A;  4PDZ A;  1TNX A;  3I5F C;  4HSZ A;  3EK4 A;  2FCE A;  1C7V A;  1UHJ A;  1DJX A;  4JQ0 D;  1SCM C;  1XVJ A;  1KWO B;  1XO5 A;  1RTP 1;  1JWD A;  1KK8 B;  2I2R E;  2MLE C;  1QLS A;  5TNC A;  1K93 D;  2Y5I A;  5CSI A;  4GPL B;  4IL1 A;  3VRR A;  4YBH B;  2PSR A;  4YI8 A;  1WLZ A;  4E68 A;  1NWD A;  2HPS A;  1CNP A;  1KSM A;  1SY9 A;  4DCK A;  2RGI A;  5B8I B;  3DVM A;  5DKQ A;  1QX2 A;  1QX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...