2ZRSA

Crystal structure of ca2+-bound form of des3-23alg-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
165
structure length
165
Chain Sequence
b'DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 30
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zrsA00
1QV0A 2CBLA 3EVVA 3JVTC 1PSBA 3LLEA 5DKNA 4CIDA 1B7TY 2PRUA 4GFTA 1YUUA 4DIRA 4I5LB 2JC2A 2JZIA 3OX6A 1ZUZA 4YRUA 1TOPA 1S5GY 3JTDC 1DVIA 2BKIB 2BCXA 4P2YB 3PFVA 1WRKA 2JWWA 1SMGA 2JXLA 3DF0A 2LUXA 1MWNA 1DTLA 1EL4A 3TDIA 3OHMB 2HPSA 1LXFC 2I18A 1L2OB 1YUTA 2HETA 2WCBA 4R1EA 1C07A 4YGBB 4CFRA 1KFUL 1DMOA 3SIBA 1XFYO 1UURA 2Y1NA 5KSZA 4WQ3A 1KK7Z 4UPGA 3DVKA 4PE4A 1UP5A 1V1GA 4YGEB 1YR5A 1SCVA 1YX8A 2LE9B 4GBAA 1F4OA 2KI6D 3C1VA 5DKQA 1F71A 1L2OC 1DT7B 1MF8B 3BXKA 3CR2A 2L51A 3CTNA 4NQGA 1DF0A 1LA3A 2COLB 2KI4B 3HCMA 2Q4UA 3PATA 1KQVA 1B7TZ 1MXLC 2WCEA 1QIWA 1U5IA 2PALA 1EXRA 1CDPA 2JXCA 2KSPA 4U8DA 1DJYA 1F8HA 1JF2A 4ICBA 1S5GZ 3EK8A 2KGBC 4L9MA 1B1GA 4N1FA 1RJVA 1CTRA 2KI4C 2QPTA 2R2IA 1FI6A 1NX2A 1UHKA 4PE0A 5AEQA 2HF5A 3KF9A 1NX1A 3RM1A 1KSOA 1SL8A 1J7QA 4MZJA 5CSIA 1PRWA 2GGMA 2ZNDA 4QJ3B 4GGFA 1OMRA 1TCFA 5CSFA 5HLVA 2P6BB 4C0JA 1A75B 2OTGB 1BU3A 4OVNF 3SG6A 1K93D 1NPQA 4PDZA 3BUMB 1CLBA 1K94A 2MLFC 4OV2A 3IQQA 2FJUB 2JRFA 2RGIA 2JNXA 2NCOA 2SASA 3OX5A 2SCPA 4QJ5B 5K89A 3EK7A 2WC8A 4M2PA 1H4BA 1UHIA 2OTGC 1OMVA 3FIAA 4CLNA 2BCAA 5CSJA 1LVCD 1XFUO 4D1EA 3AKAA 5HKYA 2CXJA 2H61C 2KFGA 1S6JA 3FS7A 4NDCA 2LUCA 3LCPC 2BBMA 3KEVA 1JUOA 2KHNA 2LMVA 4GGNA 1CMFA 1KFXS 1NIWA 2K7DA 3VRQA 1TIZA 1F70A 2JT0A 2JT3A 1B9AA 1RTP1 1NSHA 1S6IA 2GV5A 2KFHA 4HREE 2NXQA 3SG5A 4ORCB 1XFZO 3VRRA 3PSRA 3NXAA 2I7AA 2FCEA 1Y1UA 2F3ZA 2KBIA 3CR4X 3NSOA 1YVLA 2BE6A 3I5FB 1KK8B 1UHNA 1SCMB 1W7IB 5I2OA 1CDLA 4YGCB 1MR8A 1K9PA 2KBMA 5I2LA 1RECA 4XJKB 3SG7A 3EVUA 1OZOA 4FQOA 4C0LA 2LVJA 3NSLA 5JJGA 3SG4A 1SKTA 1UUSA 2F33A 3VGOA 1ALWA 1KK8C 1SCMC 1IJ5A 4DRWA 1FF1A 1E8AA 1C7WA 1W7JB 2EGDA 2JTTA 3GK2A 2HQWA 4GNKB 1QX7A 2MBXA 2LCPA 2K7CA 1QIVA 3DVJA 1SY9A 3JTDB 4M2QA 4CPVA 5HLOA 5JOLA 1N2DA 1QLSA 1LA0A 1BF5A 3GK1A 2BKHB 2M0RA 1TCOB 1Y1XA 2BL0B 1B8LA 2K8MB 2Q91A 1JWDA 1BR4B 1CM1A 3E3RA 1IKUA 3PALA 1G33A 2LMUA 2M1KB 2BBNA 2ZKMX 3EK4A 1A75A 4XYNA 5B8IB 5ER5A 3O6BA 2AAOA 1KWOB 2BECA 2BL0C 1TNWA 4QJ4B 4FTGA 2H61A 2OPOA 4HSZA 2NLNA 2F8PA 1J55A 3CZTX 1CMGA 4DCKA 1DGUA 1QS7A 1S3PA 4MLWA 2FCDA 2OS8B 4JWQA 2VRGA 1K9UA 5AFPA 1KWOC 2K61A 1R2UA 1SK6D 3KHEA 4MN0A 1IQ5A 4C0KA 5TNCA 2L4HA 2JNFA 1Q80A 4WRIA 2LVIA 1QASA 1NP8A 1G4YR 2CTNA 3ICBA 2OS8C 3ZWHA 1S1EA 1GGWA 1L7ZA 2K0JA 1DJWA 1GGZA 1DJGA 1QV1A 1TN4A 3BUXB 3CR5X 3PLFB 1IQ3A 3VRPA 5KU1A 1JC2A 3LK0A 2JOJA 1RROA 1S6CA 1K96A 1CDMA 1KFXL 4PALA 1M39A 1M46A 2JPTA 3SG2A 1S36A 2NZ0A 1B8RA 1SYMA 2MA2A 5AERA 3IF7A 1HQVA 2LVKA 2ZN8A 1AP4A 1QLKA 2M7NA 1DJZA 1IRJA 2MAZA 5DKRA 1SL9A 1BT6A 2CCMA 3MSEB 3CGAA 1OOJA 2ISDA 2PASA 1YX7A 4OCIA 1OZSA 1SW8A 4XJKA 4A4BA 2ZFDA 1RFJA 5IBWA 5D69A 1MHOA 2M97A 1K8UA 1OE9B 1WDCC 2LP3A 1JBAA 2HQ8A 1M45A 1RWYA 1AJ5A 5AANA 4ETOA 3EVRA 1YVHA 1QVIY 1KSMA 5CSNA 2KAYA 1K2HA 1DJHA 1TNPA 5AXIA 1CLMA 2BE4A 2MLEC 2ZNEA 2Y4QA 1BR1B 5PALA 1QXPA 1MUXA 3IQOA 3PN7C 1TRFA 1GQMA 1TNQA 1LINA 1OQPA 1PALA 1Y0VH 1PULA 2M9GA 1X02A 5HKZA 1C7VA 2K7OA 1NX3A 1EG4A 1GJYA 1FPWA 1K9KA 1Y6WA 2V53A 2L2EA 2FOTA 1J7RA 1N65A 4PCWA 1F54A 1TTXA 4M2OA 2K2FA 2LP2A 3KPXA 4MSPA 4PHKA 2KFFA 5ER4X 2ZN9A 2KGRA 2EC6B 3BUWB 1YUSA 4NDBA 1UWOA 2MJWB 1M63B 2JTZA 1Y1AA 1QVIZ 2M1UA 2ZRSA 1MQ1A 2LC5A 3OB1B 1NYAA 4GAOA 1M31A 1MXEA 2L98A 1PSRA 1WLMA 4GUKA 1QATA 2LANA 1SR6B 3CS1A 3LK1A 1AJ4A 3F45A 4ORAB 3VROA 4AOMA 1EG3A 3DD4A 2JULA 1BJFA 3WHUB 3WNXB 1K95A 2EC6C 3H4SE 3M0WA 4CFQA 1CFFA 1XO5A 4A4CA 1SRAA 1FBVA 3DVMA 1CM4A 1KQMC 3I5HB 1XFWO 2MRDA 3O78A 4MBEA 3KO0A 4YBHB 1G8IA 1SR6C 1UHJA 1SPYA 4IL1A 1AHRA 1JFKA 2LLSA 1IJ6A 1S26D 4YI8A 4YGDB 1QX2A 2KNEA 2M29A 2G2BA 2L4IA 1J1DA 2KYCA 3I5HC 2KAXA 5BPJA 1BLQA 2KOTA 3WHTB 4USLA 1K90D 2KI6C 1CFDA 2LHLA 3BYAA 2A4JA 1AK8A 4WQ2A 3AAJA 1AVSA 3QRXA 3PM8A 2F3YA 3TDUA 4MZKA 2LLUA 3AKBA 3NSIA 5KTYA 1UHHA 3GK4X 1PVBA 4BY5A 3SJSA 1XYDA 1A03A 2K2AA 3BOWB 3DVEA 4YGAA 3WXAA 1A29A 1ZACA 4P5OE 2BCBA 1J7PA 4YI9A 4ZCUA 4MVFA 4Q04A 1ZMZA 3CLNA 1YRUB 1YTZC 3GOFA 2LM5A 1WLZA 5HYDA 2H2KA 5FYXA 2D8NA 1BG1A 3SIAA 4JQ0D 4OKHA 1QTXA 1EH2A 2Y5IA 3VRNA 2O60A 3D10A 5D7FA 1IGVA 1CDNA 1PK0D 2O5GA 1CLLA 3I5IB 3NSKA 2PVBA 1AUIB 5I8NA 1B8CA 1KCYA 1J7OA 3HX4A 1FW4A 2PSRA 3D0YB 1WDCB 4HRGA 1A4PA 5CPVA 2MHHA 2F2OA 3I5IC 1QJTA 1RK9A 1OMDA 3FWBA 4BY4A 1ODBA 5I2QA 2LLTA 4AQJA 1FI5A 2LNKA 1CFCA 1NWDA 4N5XA 1XVJA 1NCXA 2KYFA 1PVAA 1XK4C 1ZOTB 1DJIA 2TN4A 3PN7B 1LKJA 1NCZA 4PHJA 2JU0A 2K7BA 3A4UB 4ORBB 1CNPA 2PMYA 4MRYA 1SL7A 4PE7A 2G9BA 1WRLA 3O2PA 4JPZB 1F55A 3K21A 1BMOA 3BQ3A 3I5GB 5GQQC 1IH0A 1HT9A 5F6TA 4DS7A 4E68A 1CKKA 2I94A 2L50A 3AAKA 3ZNIA 3TDZA 1KFUS 1XA5A 2KQYA 3OP0A 1DGVA 2LVVA 2AUCA 3DF0B 1CB1A 1V1FA 4AQIA 2L5XB 4NDDA 4GPLB 3I5GC 2KQ6A 1SNLA 4OR9B 2WORA 2M7LA 2JQ6A 2M3WA 3O4YA 2B1UA 3LL8B 4PHNA 1VRKA 2M8UA 1B47A 2WNDA 2E6WA 5HKWA 1XFXO 1J1EA 3EKJA 3EKHA 2LV7A 2EHBA 2L0PA 2AMIA 3FWCA 1WRZA 4HRHA 2F2PA 2LMTA 1N0YA 4MRXA 4PE1A 4I5KA 1ALVA 2WOSA 2M49B 3BOWA 1KQMB 1CFPA 3SG3A 1IWQA 1DF0B 1NCYA 3A8RA 4MEWA 1U5IB 3RLZA 1F4QA 2CT9A 1NX0A 4TNCA 1BODA 1DJXA 3CWGA 1EJ3A 2JT8A 2GGZA 2KAVA 2Y1MA 1ZFSA 1JF0A 1A2XA 1SBJA 2DOQA 2NCPA 4I5JA 2LAPA 4F0ZB 3TS5B 3TZ1A 4I5NB 4N1GA 2IS9A 1H8BA 3BUNB 1IG5A 5G08A 1YURA 1B4CA 2I2RE 4PHMA 2QACA 1QX5B 3BUOB 1OSAA 2CNPA 1XK4A 3D0YA 4ZCVA 1TNXA 3TUYB 1YRTB 1JFJA 4DUQA 3OB2B 3TS5C 5J3XA 4MZLA 1JSAA 1WY9A 2WCFA 1XFVO 3JVTB 2ZRTA 3I5FC 1D1OA 1BOCA 4GGFC 1NUBA 2E30A 1KK7Y 2LHIA 1R6PA 2KDHA 3TUYC
chains in the Genus database with same CATH superfamily
1QV0A 2CBLA 2BAPA 3EVVA 3JVTC 1PSBA 3LLEA 2YGUA 5DKNA 1B7TY 2PRUA 4GFTA 1YUUA 4CIDA 4DIRA 4I5LB 1Z4HA 2H8VA 2JC2A 2BNXA 2JZIA 3OX6A 1ZUZA 4YRUA 1TOPA 1S5GY 2WCJA 3JTDC 1DVIA 2BKIB 2BCXA 4P2YB 3PFVA 1WRKA 2JWWA 2QEBA 1SMGA 2JXLA 3DF0A 5DICA 2LUXA 1MWNA 1DTLA 1EL4A 3TDIA 3OHMB 2HPSA 1LXFC 2I18A 1L2OB 1YUTA 2HETA 2WCBA 4R1EA 1C07A 4YGBB 2WCLA 4CFRA 1KFUL 1DMOA 3SIBA 1XFYO 1UURA 2Y1NA 5KSZA 4WQ3A 1KK7Z 4UPGA 3DVKA 4PE4A 1UP5A 1V1GA 4YGEB 1YR5A 1SCVA 1YX8A 2LE9B 4GBAA 1F4OA 2KI6D 3C1VA 5DKQA 1F71A 1L2OC 1DT7B 1MF8B 3BXKA 3CR2A 2L51A 3CTNA 4NQGA 1DF0A 1LA3A 2COLB 2KI4B 3DY9A 3HCMA 2Q4UA 3PATA 1KQVA 1B7TZ 1MXLC 2WCEA 1QIWA 1U5IA 2PALA 1DEKA 1EXRA 1CDPA 2JXCA 2KSPA 4U8DA 1DJYA 1F8HA 1JF2A 3D78A 4ICBA 1S5GZ 2KLDA 3EK8A 2KGBC 4L9MA 1B1GA 4N1FA 1RJVA 1CTRA 2KI4C 2QPTA 2R2IA 1FI6A 1NX2A 1UHKA 4PE0A 5AEQA 2HF5A 3KF9A 1NX1A 3RM1A 1KSOA 1SL8A 1J7QA 4MZJA 2WC5A 5CSIA 1PRWA 2GGMA 2ZNDA 3D77A 4QJ3B 4GGFA 1TUZA 4OZDA 1DQEA 1OMRA 1TCFA 3D73A 5CSFA 2P6BB 5HLVA 3S0EA 4C0JA 1A75B 2OTGB 1BU3A 4OVNF 3SG6A 1K93D 1NPQA 2L2CA 3CDNA 4PDZA 3BUMB 3CZ0A 1CLBA 1K94A 2MLFC 2QEVA 3IQQA 4OV2A 2FJUB 2JRFA 2RGIA 2JNXA 2NCOA 2SASA 3OX5A 2SCPA 4QJ5B 5K89A 3EK7A 2WC8A 4M2PA 1H4BA 1UHIA 4FQTA 2OTGC 1OMVA 3FIAA 4CLNA 2BCAA 2L5YA 3BFBA 3RZSA 5CSJA 1LVCD 1XFUO 4D1EA 3AKAA 5HKYA 1DC1A 2CXJA 2ERBA 2H61C 3L4AA 2KFGA 1S6JA 3Q8IA 3FS7A 4NDCA 2LUCA 3QMEA 3LCPC 2BBMA 1TUJA 3KEVA 3S0FA 1JUOA 2KHNA 2LMVA 4GGNA 1CMFA 1KFXS 1NIWA 2JPOA 2K7DA 3VRQA 1TIZA 1F70A 2JT0A 2JT3A 1B9AA 1RTP1 1NSHA 1S6IA 2GV5A 2KFHA 4HREE 3O4XA 3SS5A 2NXQA 3SG5A 2P70A 2WCHA 4ORCB 1XFZO 3CABA 3VRRA 3PSRA 3NXAA 2I7AA 2FCEA 1Y1UA 2F3ZA 2KBIA 3CR4X 3NSOA 1YVLA 2BE6A 3I5FB 1KK8B 1UHNA 1SCMB 1W7IB 5I2OA 1CDLA 1IIOA 3PM2A 2WCMA 4YGCB 3CYZA 1MR8A 1K9PA 2KBMA 5I2LA 1RECA 1Z2CB 4XJKB 3SG7A 3EVUA 3B7AA 1OZOA 3R1OA 4FQOA 2LVJA 3NSLA 2QDIA 4C0LA 5JJGA 3SG4A 1SKTA 1UUSA 2F33A 3VGOA 1ALWA 1KK8C 1SCMC 1IJ5A 5FI7A 4DRWA 1FF1A 3K1EA 1E8AA 1C7WA 1W7JB 2EGDA 2JTTA 3EG5B 2HQWA 3GK2A 1QX7A 4GNKB 2MBXA 2LCPA 2K7CA 1QIVA 3DVJA 1SY9A 3JTDB 4M2QA 4CPVA 5HLOA 5JOLA 1N2DA 1QLSA 1LA0A 1BF5A 3D75A 3GK1A 2BKHB 2M0RA 1TCOB 1Y1XA 2BL0B 1B8LA 2K8MB 2Q91A 1JWDA 1BR4B 1CM1A 3E3RA 1IKUA 3PALA 1G33A 2LMUA 2M1KB 5I94A 1QWVA 2BBNA 2ZKMX 3BJHA 3EK4A 1A75A 4XYNA 5B8IB 1LS8A 2QEOA 3O6BA 2AAOA 5ER5A 1KWOB 2BECA 2BL0C 1TNWA 4QJ4B 4FTGA 4PT1A 2H61A 2OPOA 4HSZA 2NLNA 2F8PA 1J55A 3CZTX 1CMGA 4DCKA 1DGUA 1QS7A 1S3PA 4MLWA 1SSEB 2FCDA 2OS8B 4JWQA 3S0GA 2VRGA 1K9UA 3N7HA 1KWOC 5AFPA 2K61A 1R2UA 1SK6D 3KHEA 4MN0A 1IQ5A 4C0KA 5TNCA 2L4HA 2JNFA 1Q80A 4WRIA 2LVIA 1QASA 1NP8A 1G4YR 3FE6A 2CTNA 3ICBA 2PYQA 3NGVA 2OS8C 3ZWHA 1S1EA 1GGWA 1L7ZA 2K0JA 1DJWA 1GGZA 1DJGA 1QV1A 1TN4A 3BUXB 3CR5X 3PLFB 1IQ3A 3VRPA 5KU1A 1JC2A 3LK0A 2JOJA 1RROA 1S6CA 1K96A 1CDMA 1KFXL 4PALA 1M39A 1M46A 2JPTA 3SG2A 1S36A 2NZ0A 1B8RA 1SYMA 2MA2A 5D3OA 3IF7A 5AERA 1HQVA 2LVKA 2ZN8A 1AP4A 1QLKA 2M7NA 1DJZA 1IRJA 2MAZA 1OW4A 3B86A 1SL9A 1BT6A 5DKRA 3UNWA 2CCMA 3MSEB 3CGAA 1OOJA 2ISDA 2PASA 1YX7A 4OCIA 1OZSA 1SW8A 4XJKA 4A4BA 2ZFDA 1RFJA 5IBWA 5D69A 1MHOA 2M97A 1K8UA 1OE9B 1WDCC 2LP3A 1JBAA 2FJYA 2HQ8A 1M45A 1RWYA 1AJ5A 5AANA 4ETOA 3EVRA 1YVHA 1QVIY 1KSMA 3CZ1A 5CSNA 2KAYA 3V2LA 1K2HA 1DJHA 1TNPA 5AXIA 1CLMA 2BE4A 2MLEC 2ZNEA 2Y4QA 1BR1B 5PALA 1QXPA 1MUXA 3IQOA 3PN7C 1TRFA 1GQMA 3DYEA 1OOFA 3DXLA 1TNQA 1LINA 1OQPA 1PALA 1Y0VH 2PQLA 1PULA 3FE8A 2M9GA 4F7FA 3D74A 1X02A 5HKZA 1C7VA 2K7OA 1NX3A 1C3YA 1EG4A 1GJYA 1FPWA 1K9KA 1Y6WA 2V53A 3PJIA 2L2EA 2FOTA 1J7RA 1N65A 4PCWA 1F54A 1TTXA 3NHTA 4IJ7A 4M2OA 2K2FA 2LP2A 3KPXA 4MSPA 4PHKA 2KFFA 5ER4X 2ZN9A 2KGRA 2EC6B 3BUWB 1YUSA 4NDBA 1UWOA 2MJWB 1M63B 2JTZA 1Y1AA 1QVIZ 2M1UA 2ZRSA 1MQ1A 2LC5A 3D76A 3OB1B 1NYAA 4GAOA 1DELA 1M31A 1MXEA 2L98A 1PSRA 1WLMA 4GUKA 1QATA 2LANA 1SR6B 3CS1A 3LK1A 1AJ4A 2WCKA 3F45A 4ORAB 3VROA 4AOMA 1EG3A 3DD4A 2JULA 1BJFA 3R72A 3WHUB 3WNXB 1K95A 2EC6C 3H4SE 3M0WA 4CFQA 1CFFA 1XO5A 4A4CA 1SRAA 1FBVA 3DVMA 1CM4A 1KQMC 3L47A 4INXA 3I5HB 1XFWO 2MRDA 3O78A 4MBEA 3KO0A 4YBHB 3NHIA 1G8IA 1SR6C 1UHJA 1SPYA 4IL1A 1AHRA 1JFKA 2LLSA 1IJ6A 1S26D 4YI8A 4YGDB 1QX2A 2KNEA 2M29A 2G2BA 3B6XA 2L4IA 3R1PA 1J1DA 2KYCA 3I5HC 2KAXA 5BPJA 1BLQA 3CZ2A 2KOTA 3WHTB 4USLA 1K90D 2KI6C 1CFDA 2LHLA 3BYAA 2A4JA 1AK8A 4WQ2A 3VB1A 3AAJA 1AVSA 3QRXA 3PM8A 2F3YA 3TDUA 4MZKA 2LLUA 1W9ZA 3AKBA 3NSIA 5KTYA 1UHHA 3GK4X 1PVBA 2QEHA 4BY5A 3SJSA 1XYDA 1A03A 2K2AA 3BOWB 3DVEA 4YGAA 3WXAA 1A29A 1ZACA 4P5OE 2BCBA 1T14A 1J7PA 3IVTA 3R1VA 4YI9A 4ZCUA 4JD9A 4KYNA 4MVFA 4Q04A 1ZMZA 3B88A 3CLNA 1YRUB 1YTZC 3GOFA 2LM5A 1WLZA 5HYDA 2H2KA 5FYXA 2D8NA 3L4LA 1BG1A 3SIAA 4JQ0D 4OKHA 1QTXA 1EH2A 2Y5IA 3VRNA 2O60A 3D10A 5D7FA 1IGVA 3BFAA 1CDNA 1PK0D 2O5GA 1CLLA 3I5IB 3NSKA 2PVBA 1AUIB 5I8NA 1B8CA 1KCYA 1J7OA 3HX4A 1FW4A 2PSRA 3D0YB 3S0BA 1WDCB 4HRGA 1A4PA 2K60A 5CPVA 2MHHA 2F2OA 3I5IC 1QJTA 1RK9A 1OMDA 3FWBA 4BY4A 1ODBA 5I2QA 2LLTA 4AQJA 4INWA 2LNKA 1CFCA 1FI5A 1NWDA 4N5XA 5HL1A 1XVJA 1NCXA 2KYFA 1PVAA 1XK4C 1ZOTB 1DJIA 2TN4A 3PN7B 1LKJA 1NCZA 4PHJA 2JU0A 2K7BA 3A4UB 4ORBB 3FE9A 1CNPA 2PMYA 4MRYA 3BFHA 1SL7A 4PE7A 5FI2A 2G9BA 1WRLA 3O2PA 4JPZB 1F55A 1C3ZA 1BMOA 3BQ3A 3I5GB 3K21A 5GQQC 1IH0A 1HT9A 1ORGA 2GTEA 5F6TA 4DS7A 4E68A 1CKKA 2I94A 2L50A 3AAKA 3ZNIA 3TDZA 1KFUS 1XA5A 1GM0A 2KQYA 3OP0A 1DGVA 1TWOA 2AUCA 2LVVA 3DF0B 1V1FA 4JKTA 4AQIA 1CB1A 1P28A 2L5XB 4NDDA 4GPLB 3I5GC 2KQ6A 3S0DA 1SNLA 4OR9B 2WORA 3OBVA 2JQ6A 2M3WA 3O4YA 2M7LA 2B1UA 3LL8B 4PHNA 1VRKA 2M8UA 1B47A 2WNDA 2E6WA 5HKWA 1XFXO 1J1EA 1OOIX 3EKJA 2KLEA 2P71A 2LV7A 3EKHA 3S0AA 2EHBA 2L0PA 2AMIA 3FWCA 3B87A 1WRZA 4HRHA 2F2PA 2LMTA 1N0YA 4MRXA 4PE1A 4I5KA 1ALVA 2WOSA 2M49B 3BOWA 1KQMB 1CFPA 3SG3A 1IWQA 2WC6A 1DF0B 1NCYA 3DZTA 3A8RA 4MEWA 3SS4A 1U5IB 3RLZA 1F4QA 2CT9A 1NX0A 4TNCA 1BODA 1DJXA 3CWGA 1EJ3A 2JT8A 2GGZA 2KAVA 2Y1MA 1ZFSA 1JF0A 1A2XA 1SBJA 2DOQA 2NCPA 4I5JA 2LAPA 4F0ZB 3TS5B 3TZ1A 4I5NB 4N1GA 2IS9A 1OOHA 1H8BA 3BUNB 1IG5A 5G08A 1YURA 1B4CA 2I2RE 4PHMA 1OOGA 2QACA 1QX5B 3BUOB 1OSAA 2CNPA 1XK4A 3D0YA 4ZCVA 1TNXA 1XFRA 5EL2A 3TUYB 1YRTB 1JFJA 4DUQA 3OB2B 3TS5C 3OGNA 5J3XA 4MZLA 1JSAA 1WY9A 2WCFA 1XFVO 3JVTB 2ZRTA 3I5FC 1D1OA 3UO9A 1BOCA 4GGFC 5FI6A 1NUBA 2E30A 3SS3A 1KK7Y 2LHIA 1R6PA 2KDHA 2KPHA 3TUYC
chains in the Genus database with same CATH topology
1QV0A 2CBLA 3EVVA 3JVTC 1PSBA 3LLEA 5DKNA 4CIDA 1B7TY 2PRUA 4GFTA 1YUUA 4DIRA 4I5LB 2JC2A 2JZIA 3OX6A 1ZUZA 4YRUA 1TOPA 1S5GY 3JTDC 1DVIA 2BKIB 2BCXA 4P2YB 3PFVA 1WRKA 2JWWA 1SMGA 2JXLA 3DF0A 2LUXA 1MWNA 1DTLA 1EL4A 3TDIA 3OHMB 2HPSA 1LXFC 2I18A 1L2OB 1YUTA 2HETA 2WCBA 4R1EA 1C07A 4YGBB 4CFRA 1KFUL 1DMOA 3SIBA 1XFYO 1UURA 2Y1NA 5KSZA 4WQ3A 1KK7Z 4UPGA 3DVKA 4PE4A 1UP5A 1V1GA 4YGEB 1YR5A 1SCVA 1YX8A 2LE9B 4GBAA 1F4OA 2KI6D 3C1VA 5DKQA 1F71A 1L2OC 1DT7B 1MF8B 3BXKA 3CR2A 2L51A 3CTNA 4NQGA 1DF0A 1LA3A 2COLB 2KI4B 3HCMA 2Q4UA 3PATA 1KQVA 1B7TZ 1MXLC 2WCEA 1QIWA 1U5IA 2PALA 1EXRA 1CDPA 2JXCA 2KSPA 4U8DA 1DJYA 1F8HA 1JF2A 4ICBA 1S5GZ 3EK8A 2KGBC 4L9MA 1B1GA 4N1FA 1RJVA 1CTRA 2KI4C 2QPTA 2R2IA 1FI6A 1NX2A 1UHKA 4PE0A 5AEQA 2HF5A 3KF9A 1NX1A 3RM1A 1KSOA 1SL8A 1J7QA 4MZJA 5CSIA 1PRWA 2GGMA 2ZNDA 4QJ3B 4GGFA 1OMRA 1TCFA 5CSFA 5HLVA 2P6BB 4C0JA 1A75B 2OTGB 1BU3A 4OVNF 3SG6A 1K93D 1NPQA 4PDZA 3BUMB 1CLBA 1K94A 2MLFC 4OV2A 3IQQA 2FJUB 2JRFA 2RGIA 2JNXA 2NCOA 2SASA 3OX5A 2SCPA 4QJ5B 5K89A 3EK7A 2WC8A 4M2PA 1H4BA 1UHIA 2OTGC 1OMVA 3FIAA 4CLNA 2BCAA 5CSJA 1LVCD 1XFUO 4D1EA 3AKAA 5HKYA 2CXJA 2H61C 2KFGA 1S6JA 3FS7A 4NDCA 2LUCA 3LCPC 2BBMA 3KEVA 1JUOA 2KHNA 2LMVA 4GGNA 1CMFA 1KFXS 1NIWA 2K7DA 3VRQA 1TIZA 1F70A 2JT0A 2JT3A 1B9AA 1RTP1 1NSHA 1S6IA 2GV5A 2KFHA 4HREE 2NXQA 3SG5A 4ORCB 1XFZO 3VRRA 3PSRA 3NXAA 2I7AA 2FCEA 1Y1UA 2F3ZA 2KBIA 3CR4X 3NSOA 1YVLA 2BE6A 3I5FB 1KK8B 1UHNA 1SCMB 1W7IB 5I2OA 1CDLA 4YGCB 1MR8A 1K9PA 2KBMA 5I2LA 1RECA 4XJKB 3SG7A 3EVUA 1OZOA 4FQOA 4C0LA 2LVJA 3NSLA 5JJGA 3SG4A 1SKTA 1UUSA 2F33A 3VGOA 1ALWA 1KK8C 1SCMC 1IJ5A 4DRWA 1FF1A 1E8AA 1C7WA 1W7JB 2EGDA 2JTTA 3GK2A 2HQWA 4GNKB 1QX7A 2MBXA 2LCPA 2K7CA 1QIVA 3DVJA 1SY9A 3JTDB 4M2QA 4CPVA 5HLOA 5JOLA 1N2DA 1QLSA 1LA0A 1BF5A 3GK1A 2BKHB 2M0RA 1TCOB 1Y1XA 2BL0B 1B8LA 2K8MB 2Q91A 1JWDA 1BR4B 1CM1A 3E3RA 1IKUA 3PALA 1G33A 2LMUA 2M1KB 2BBNA 2ZKMX 3EK4A 1A75A 4XYNA 5B8IB 5ER5A 3O6BA 2AAOA 1KWOB 2BECA 2BL0C 1TNWA 4QJ4B 4FTGA 2H61A 2OPOA 4HSZA 2NLNA 2F8PA 1J55A 3CZTX 1CMGA 4DCKA 1DGUA 1QS7A 1S3PA 4MLWA 2FCDA 2OS8B 4JWQA 2VRGA 1K9UA 5AFPA 1KWOC 2K61A 1R2UA 1SK6D 3KHEA 4MN0A 1IQ5A 4C0KA 5TNCA 2L4HA 2JNFA 1Q80A 4WRIA 2LVIA 1QASA 1NP8A 1G4YR 2CTNA 3ICBA 2OS8C 3ZWHA 1S1EA 1GGWA 1L7ZA 2K0JA 1DJWA 1GGZA 1DJGA 1QV1A 1TN4A 3BUXB 3CR5X 3PLFB 1IQ3A 3VRPA 5KU1A 1JC2A 3LK0A 2JOJA 1RROA 1S6CA 1K96A 1CDMA 1KFXL 4PALA 1M39A 1M46A 2JPTA 3SG2A 1S36A 2NZ0A 1B8RA 1SYMA 2MA2A 5AERA 3IF7A 1HQVA 2LVKA 2ZN8A 1AP4A 1QLKA 2M7NA 1DJZA 1IRJA 2MAZA 5DKRA 1SL9A 1BT6A 2CCMA 3MSEB 3CGAA 1OOJA 2ISDA 2PASA 1YX7A 4OCIA 1OZSA 1SW8A 4XJKA 4A4BA 2ZFDA 1RFJA 5IBWA 5D69A 1MHOA 2M97A 1K8UA 1OE9B 1WDCC 2LP3A 1JBAA 2HQ8A 1M45A 1RWYA 1AJ5A 5AANA 4ETOA 3EVRA 1YVHA 1QVIY 1KSMA 5CSNA 2KAYA 1K2HA 1DJHA 1TNPA 5AXIA 1CLMA 2BE4A 2MLEC 2ZNEA 2Y4QA 1BR1B 5PALA 1QXPA 1MUXA 3IQOA 3PN7C 1TRFA 1GQMA 1TNQA 1LINA 1OQPA 1PALA 1Y0VH 1PULA 2M9GA 1X02A 5HKZA 1C7VA 2K7OA 1NX3A 1EG4A 1GJYA 1FPWA 1K9KA 1Y6WA 2V53A 2L2EA 2FOTA 1J7RA 1N65A 4PCWA 1F54A 1TTXA 4M2OA 2K2FA 2LP2A 3KPXA 4MSPA 4PHKA 2KFFA 5ER4X 2ZN9A 2KGRA 2EC6B 3BUWB 1YUSA 4NDBA 1UWOA 2MJWB 1M63B 2JTZA 1Y1AA 1QVIZ 2M1UA 2ZRSA 1MQ1A 2LC5A 3OB1B 1NYAA 4GAOA 1M31A 1MXEA 2L98A 1PSRA 1WLMA 4GUKA 1QATA 2LANA 1SR6B 3CS1A 3LK1A 1AJ4A 3F45A 4ORAB 3VROA 4AOMA 1EG3A 3DD4A 2JULA 1BJFA 3WHUB 3WNXB 1K95A 2EC6C 3H4SE 3M0WA 4CFQA 1CFFA 1XO5A 4A4CA 1SRAA 1FBVA 3DVMA 1CM4A 1KQMC 3I5HB 1XFWO 2MRDA 3O78A 4MBEA 3KO0A 4YBHB 1G8IA 1SR6C 1UHJA 1SPYA 4IL1A 1AHRA 1JFKA 2LLSA 1IJ6A 1S26D 4YI8A 4YGDB 1QX2A 2KNEA 2M29A 2G2BA 2L4IA 1J1DA 2KYCA 3I5HC 2KAXA 5BPJA 1BLQA 2KOTA 3WHTB 4USLA 1K90D 2KI6C 1CFDA 2LHLA 3BYAA 2A4JA 1AK8A 4WQ2A 3AAJA 1AVSA 3QRXA 3PM8A 2F3YA 3TDUA 4MZKA 2LLUA 3AKBA 3NSIA 5KTYA 1UHHA 3GK4X 1PVBA 4BY5A 3SJSA 1XYDA 1A03A 2K2AA 3BOWB 3DVEA 4YGAA 3WXAA 1A29A 1ZACA 4P5OE 2BCBA 1J7PA 4YI9A 4ZCUA 4MVFA 4Q04A 1ZMZA 3CLNA 1YRUB 1YTZC 3GOFA 2LM5A 1WLZA 5HYDA 2H2KA 5FYXA 2D8NA 1BG1A 3SIAA 4JQ0D 4OKHA 1QTXA 1EH2A 2Y5IA 3VRNA 2O60A 3D10A 5D7FA 1IGVA 1CDNA 1PK0D 2O5GA 1CLLA 3I5IB 3NSKA 2PVBA 1AUIB 5I8NA 1B8CA 1KCYA 1J7OA 3HX4A 1FW4A 2PSRA 3D0YB 1WDCB 4HRGA 1A4PA 5CPVA 2MHHA 2F2OA 3I5IC 1QJTA 1RK9A 1OMDA 3FWBA 4BY4A 1ODBA 5I2QA 2LLTA 4AQJA 1FI5A 2LNKA 1CFCA 1NWDA 4N5XA 1XVJA 1NCXA 2KYFA 1PVAA 1XK4C 1ZOTB 1DJIA 2TN4A 3PN7B 1LKJA 1NCZA 4PHJA 2JU0A 2K7BA 3A4UB 4ORBB 1CNPA 2PMYA 4MRYA 1SL7A 4PE7A 2G9BA 1WRLA 3O2PA 4JPZB 1F55A 3K21A 1BMOA 3BQ3A 3I5GB 5GQQC 1IH0A 1HT9A 5F6TA 4DS7A 4E68A 1CKKA 2I94A 2L50A 3AAKA 3ZNIA 3TDZA 1KFUS 1XA5A 2KQYA 3OP0A 1DGVA 2LVVA 2AUCA 3DF0B 1CB1A 1V1FA 4AQIA 2L5XB 4NDDA 4GPLB 3I5GC 2KQ6A 1SNLA 4OR9B 2WORA 2M7LA 2JQ6A 2M3WA 3O4YA 2B1UA 3LL8B 4PHNA 1VRKA 2M8UA 1B47A 2WNDA 2E6WA 5HKWA 1XFXO 1J1EA 3EKJA 3EKHA 2LV7A 2EHBA 2L0PA 2AMIA 3FWCA 1WRZA 4HRHA 2F2PA 2LMTA 1N0YA 4MRXA 4PE1A 4I5KA 1ALVA 2WOSA 2M49B 3BOWA 1KQMB 1CFPA 3SG3A 1IWQA 1DF0B 1NCYA 3A8RA 4MEWA 1U5IB 3RLZA 1F4QA 2CT9A 1NX0A 4TNCA 1BODA 1DJXA 3CWGA 1EJ3A 2JT8A 2GGZA 2KAVA 2Y1MA 1ZFSA 1JF0A 1A2XA 1SBJA 2DOQA 2NCPA 4I5JA 2LAPA 4F0ZB 3TS5B 3TZ1A 4I5NB 4N1GA 2IS9A 1H8BA 3BUNB 1IG5A 5G08A 1YURA 1B4CA 2I2RE 4PHMA 2QACA 1QX5B 3BUOB 1OSAA 2CNPA 1XK4A 3D0YA 4ZCVA 1TNXA 3TUYB 1YRTB 1JFJA 4DUQA 3OB2B 3TS5C 5J3XA 4MZLA 1JSAA 1WY9A 2WCFA 1XFVO 3JVTB 2ZRTA 3I5FC 1D1OA 1BOCA 4GGFC 1NUBA 2E30A 1KK7Y 2LHIA 1R6PA 2KDHA 3TUYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QV0 A;  2CBL A;  3EVV A;  3JVT C;  1PSB A;  3LLE A;  5DKN A;  4CID A;  1B7T Y;  2PRU A;  4GFT A;  1YUU A;  4DIR A;  4I5L B;  2JC2 A;  2JZI A;  3OX6 A;  1ZUZ A;  4YRU A;  1TOP A;  1S5G Y;  3JTD C;  1DVI A;  2BKI B;  2BCX A;  4P2Y B;  3PFV A;  1WRK A;  2JWW A;  1SMG A;  2JXL A;  3DF0 A;  2LUX A;  1MWN A;  1DTL A;  1EL4 A;  3TDI A;  3OHM B;  2HPS A;  1LXF C;  2I18 A;  1L2O B;  1YUT A;  2HET A;  2WCB A;  4R1E A;  1C07 A;  4YGB B;  4CFR A;  1KFU L;  1DMO A;  3SIB A;  1XFY O;  1UUR A;  2Y1N A;  5KSZ A;  4WQ3 A;  1KK7 Z;  4UPG A;  3DVK A;  4PE4 A;  1UP5 A;  1V1G A;  4YGE B;  1YR5 A;  1SCV A;  1YX8 A;  2LE9 B;  4GBA A;  1F4O A;  2KI6 D;  3C1V A;  5DKQ A;  1F71 A;  1L2O C;  1DT7 B;  1MF8 B;  3BXK A;  3CR2 A;  2L51 A;  3CTN A;  4NQG A;  1DF0 A;  1LA3 A;  2COL B;  2KI4 B;  3HCM A;  2Q4U A;  3PAT A;  1KQV A;  1B7T Z;  1MXL C;  2WCE A;  1QIW A;  1U5I A;  2PAL A;  1EXR A;  1CDP A;  2JXC A;  2KSP A;  4U8D A;  1DJY A;  1F8H A;  1JF2 A;  4ICB A;  1S5G Z;  3EK8 A;  2KGB C;  4L9M A;  1B1G A;  4N1F A;  1RJV A;  1CTR A;  2KI4 C;  2QPT A;  2R2I A;  1FI6 A;  1NX2 A;  1UHK A;  4PE0 A;  5AEQ A;  2HF5 A;  3KF9 A;  1NX1 A;  3RM1 A;  1KSO A;  1SL8 A;  1J7Q A;  4MZJ A;  5CSI A;  1PRW A;  2GGM A;  2ZND A;  4QJ3 B;  4GGF A;  1OMR A;  1TCF A;  5CSF A;  5HLV A;  2P6B B;  4C0J A;  1A75 B;  2OTG B;  1BU3 A;  4OVN F;  3SG6 A;  1K93 D;  1NPQ A;  4PDZ A;  3BUM B;  1CLB A;  1K94 A;  2MLF C;  4OV2 A;  3IQQ A;  2FJU B;  2JRF A;  2RGI A;  2JNX A;  2NCO A;  2SAS A;  3OX5 A;  2SCP A;  4QJ5 B;  5K89 A;  3EK7 A;  2WC8 A;  4M2P A;  1H4B A;  1UHI A;  2OTG C;  1OMV A;  3FIA A;  4CLN A;  2BCA A;  5CSJ A;  1LVC D;  1XFU O;  4D1E A;  3AKA A;  5HKY A;  2CXJ A;  2H61 C;  2KFG A;  1S6J A;  3FS7 A;  4NDC A;  2LUC A;  3LCP C;  2BBM A;  3KEV A;  1JUO A;  2KHN A;  2LMV A;  4GGN A;  1CMF A;  1KFX S;  1NIW A;  2K7D A;  3VRQ A;  1TIZ A;  1F70 A;  2JT0 A;  2JT3 A;  1B9A A;  1RTP 1;  1NSH A;  1S6I A;  2GV5 A;  2KFH A;  4HRE E;  2NXQ A;  3SG5 A;  4ORC B;  1XFZ O;  3VRR A;  3PSR A;  3NXA A;  2I7A A;  2FCE A;  1Y1U A;  2F3Z A;  2KBI A;  3CR4 X;  3NSO A;  1YVL A;  2BE6 A;  3I5F B;  1KK8 B;  1UHN A;  1SCM B;  1W7I B;  5I2O A;  1CDL A;  4YGC B;  1MR8 A;  1K9P A;  2KBM A;  5I2L A;  1REC A;  4XJK B;  3SG7 A;  3EVU A;  1OZO A;  4FQO A;  4C0L A;  2LVJ A;  3NSL A;  5JJG A;  3SG4 A;  1SKT A;  1UUS A;  2F33 A;  3VGO A;  1ALW A;  1KK8 C;  1SCM C;  1IJ5 A;  4DRW A;  1FF1 A;  1E8A A;  1C7W A;  1W7J B;  2EGD A;  2JTT A;  3GK2 A;  2HQW A;  4GNK B;  1QX7 A;  2MBX A;  2LCP A;  2K7C A;  1QIV A;  3DVJ A;  1SY9 A;  3JTD B;  4M2Q A;  4CPV A;  5HLO A;  5JOL A;  1N2D A;  1QLS A;  1LA0 A;  1BF5 A;  3GK1 A;  2BKH B;  2M0R A;  1TCO B;  1Y1X A;  2BL0 B;  1B8L A;  2K8M B;  2Q91 A;  1JWD A;  1BR4 B;  1CM1 A;  3E3R A;  1IKU A;  3PAL A;  1G33 A;  2LMU A;  2M1K B;  2BBN A;  2ZKM X;  3EK4 A;  1A75 A;  4XYN A;  5B8I B;  5ER5 A;  3O6B A;  2AAO A;  1KWO B;  2BEC A;  2BL0 C;  1TNW A;  4QJ4 B;  4FTG A;  2H61 A;  2OPO A;  4HSZ A;  2NLN A;  2F8P A;  1J55 A;  3CZT X;  1CMG A;  4DCK A;  1DGU A;  1QS7 A;  1S3P A;  4MLW A;  2FCD A;  2OS8 B;  4JWQ A;  2VRG A;  1K9U A;  5AFP A;  1KWO C;  2K61 A;  1R2U A;  1SK6 D;  3KHE A;  4MN0 A;  1IQ5 A;  4C0K A;  5TNC A;  2L4H A;  2JNF A;  1Q80 A;  4WRI A;  2LVI A;  1QAS A;  1NP8 A;  1G4Y R;  2CTN A;  3ICB A;  2OS8 C;  3ZWH A;  1S1E A;  1GGW A;  1L7Z A;  2K0J A;  1DJW A;  1GGZ A;  1DJG A;  1QV1 A;  1TN4 A;  3BUX B;  3CR5 X;  3PLF B;  1IQ3 A;  3VRP A;  5KU1 A;  1JC2 A;  3LK0 A;  2JOJ A;  1RRO A;  1S6C A;  1K96 A;  1CDM A;  1KFX L;  4PAL A;  1M39 A;  1M46 A;  2JPT A;  3SG2 A;  1S36 A;  2NZ0 A;  1B8R A;  1SYM A;  2MA2 A;  5AER A;  3IF7 A;  1HQV A;  2LVK A;  2ZN8 A;  1AP4 A;  1QLK A;  2M7N A;  1DJZ A;  1IRJ A;  2MAZ A;  5DKR A;  1SL9 A;  1BT6 A;  2CCM A;  3MSE B;  3CGA A;  1OOJ A;  2ISD A;  2PAS A;  1YX7 A;  4OCI A;  1OZS A;  1SW8 A;  4XJK A;  4A4B A;  2ZFD A;  1RFJ A;  5IBW A;  5D69 A;  1MHO A;  2M97 A;  1K8U A;  1OE9 B;  1WDC C;  2LP3 A;  1JBA A;  2HQ8 A;  1M45 A;  1RWY A;  1AJ5 A;  5AAN A;  4ETO A;  3EVR A;  1YVH A;  1QVI Y;  1KSM A;  5CSN A;  2KAY A;  1K2H A;  1DJH A;  1TNP A;  5AXI A;  1CLM A;  2BE4 A;  2MLE C;  2ZNE A;  2Y4Q A;  1BR1 B;  5PAL A;  1QXP A;  1MUX A;  3IQO A;  3PN7 C;  1TRF A;  1GQM A;  1TNQ A;  1LIN A;  1OQP A;  1PAL A;  1Y0V H;  1PUL A;  2M9G A;  1X02 A;  5HKZ A;  1C7V A;  2K7O A;  1NX3 A;  1EG4 A;  1GJY A;  1FPW A;  1K9K A;  1Y6W A;  2V53 A;  2L2E A;  2FOT A;  1J7R A;  1N65 A;  4PCW A;  1F54 A;  1TTX A;  4M2O A;  2K2F A;  2LP2 A;  3KPX A;  4MSP A;  4PHK A;  2KFF A;  5ER4 X;  2ZN9 A;  2KGR A;  2EC6 B;  3BUW B;  1YUS A;  4NDB A;  1UWO A;  2MJW B;  1M63 B;  2JTZ A;  1Y1A A;  1QVI Z;  2M1U A;  2ZRS A;  1MQ1 A;  2LC5 A;  3OB1 B;  1NYA A;  4GAO A;  1M31 A;  1MXE A;  2L98 A;  1PSR A;  1WLM A;  4GUK A;  1QAT A;  2LAN A;  1SR6 B;  3CS1 A;  3LK1 A;  1AJ4 A;  3F45 A;  4ORA B;  3VRO A;  4AOM A;  1EG3 A;  3DD4 A;  2JUL A;  1BJF A;  3WHU B;  3WNX B;  1K95 A;  2EC6 C;  3H4S E;  3M0W A;  4CFQ A;  1CFF A;  1XO5 A;  4A4C A;  1SRA A;  1FBV A;  3DVM A;  1CM4 A;  1KQM C;  3I5H B;  1XFW O;  2MRD A;  3O78 A;  4MBE A;  3KO0 A;  4YBH B;  1G8I A;  1SR6 C;  1UHJ A;  1SPY A;  4IL1 A;  1AHR A;  1JFK A;  2LLS A;  1IJ6 A;  1S26 D;  4YI8 A;  4YGD B;  1QX2 A;  2KNE A;  2M29 A;  2G2B A;  2L4I A;  1J1D A;  2KYC A;  3I5H C;  2KAX A;  5BPJ A;  1BLQ A;  2KOT A;  3WHT B;  4USL A;  1K90 D;  2KI6 C;  1CFD A;  2LHL A;  3BYA A;  2A4J A;  1AK8 A;  4WQ2 A;  3AAJ A;  1AVS A;  3QRX A;  3PM8 A;  2F3Y A;  3TDU A;  4MZK A;  2LLU A;  3AKB A;  3NSI A;  5KTY A;  1UHH A;  3GK4 X;  1PVB A;  4BY5 A;  3SJS A;  1XYD A;  1A03 A;  2K2A A;  3BOW B;  3DVE A;  4YGA A;  3WXA A;  1A29 A;  1ZAC A;  4P5O E;  2BCB A;  1J7P A;  4YI9 A;  4ZCU A;  4MVF A;  4Q04 A;  1ZMZ A;  3CLN A;  1YRU B;  1YTZ C;  3GOF A;  2LM5 A;  1WLZ A;  5HYD A;  2H2K A;  5FYX A;  2D8N A;  1BG1 A;  3SIA A;  4JQ0 D;  4OKH A;  1QTX A;  1EH2 A;  2Y5I A;  3VRN A;  2O60 A;  3D10 A;  5D7F A;  1IGV A;  1CDN A;  1PK0 D;  2O5G A;  1CLL A;  3I5I B;  3NSK A;  2PVB A;  1AUI B;  5I8N A;  1B8C A;  1KCY A;  1J7O A;  3HX4 A;  1FW4 A;  2PSR A;  3D0Y B;  1WDC B;  4HRG A;  1A4P A;  5CPV A;  2MHH A;  2F2O A;  3I5I C;  1QJT A;  1RK9 A;  1OMD A;  3FWB A;  4BY4 A;  1ODB A;  5I2Q A;  2LLT A;  4AQJ A;  1FI5 A;  2LNK A;  1CFC A;  1NWD A;  4N5X A;  1XVJ A;  1NCX A;  2KYF A;  1PVA A;  1XK4 C;  1ZOT B;  1DJI A;  2TN4 A;  3PN7 B;  1LKJ A;  1NCZ A;  4PHJ A;  2JU0 A;  2K7B A;  3A4U B;  4ORB B;  1CNP A;  2PMY A;  4MRY A;  1SL7 A;  4PE7 A;  2G9B A;  1WRL A;  3O2P A;  4JPZ B;  1F55 A;  3K21 A;  1BMO A;  3BQ3 A;  3I5G B;  5GQQ C;  1IH0 A;  1HT9 A;  5F6T A;  4DS7 A;  4E68 A;  1CKK A;  2I94 A;  2L50 A;  3AAK A;  3ZNI A;  3TDZ A;  1KFU S;  1XA5 A;  2KQY A;  3OP0 A;  1DGV A;  2LVV A;  2AUC A;  3DF0 B;  1CB1 A;  1V1F A;  4AQI A;  2L5X B;  4NDD A;  4GPL B;  3I5G C;  2KQ6 A;  1SNL A;  4OR9 B;  2WOR A;  2M7L A;  2JQ6 A;  2M3W A;  3O4Y A;  2B1U A;  3LL8 B;  4PHN A;  1VRK A;  2M8U A;  1B47 A;  2WND A;  2E6W A;  5HKW A;  1XFX O;  1J1E A;  3EKJ A;  3EKH A;  2LV7 A;  2EHB A;  2L0P A;  2AMI A;  3FWC A;  1WRZ A;  4HRH A;  2F2P A;  2LMT A;  1N0Y A;  4MRX A;  4PE1 A;  4I5K A;  1ALV A;  2WOS A;  2M49 B;  3BOW A;  1KQM B;  1CFP A;  3SG3 A;  1IWQ A;  1DF0 B;  1NCY A;  3A8R A;  4MEW A;  1U5I B;  3RLZ A;  1F4Q A;  2CT9 A;  1NX0 A;  4TNC A;  1BOD A;  1DJX A;  3CWG A;  1EJ3 A;  2JT8 A;  2GGZ A;  2KAV A;  2Y1M A;  1ZFS A;  1JF0 A;  1A2X A;  1SBJ A;  2DOQ A;  2NCP A;  4I5J A;  2LAP A;  4F0Z B;  3TS5 B;  3TZ1 A;  4I5N B;  4N1G A;  2IS9 A;  1H8B A;  3BUN B;  1IG5 A;  5G08 A;  1YUR A;  1B4C A;  2I2R E;  4PHM A;  2QAC A;  1QX5 B;  3BUO B;  1OSA A;  2CNP A;  1XK4 A;  3D0Y A;  4ZCV A;  1TNX A;  3TUY B;  1YRT B;  1JFJ A;  4DUQ A;  3OB2 B;  3TS5 C;  5J3X A;  4MZL A;  1JSA A;  1WY9 A;  2WCF A;  1XFV O;  3JVT B;  2ZRT A;  3I5F C;  1D1O A;  1BOC A;  4GGF C;  1NUB A;  2E30 A;  1KK7 Y;  2LHI A;  1R6P A;  2KDH A;  3TUY C; 
#chains in the Genus database with same CATH topology
 1QV0 A;  2CBL A;  2BAP A;  3EVV A;  3JVT C;  1PSB A;  3LLE A;  2YGU A;  5DKN A;  1B7T Y;  2PRU A;  4GFT A;  1YUU A;  4CID A;  4DIR A;  4I5L B;  1Z4H A;  2H8V A;  2JC2 A;  2BNX A;  2JZI A;  3OX6 A;  1ZUZ A;  4YRU A;  1TOP A;  1S5G Y;  2WCJ A;  3JTD C;  1DVI A;  2BKI B;  2BCX A;  4P2Y B;  3PFV A;  1WRK A;  2JWW A;  2QEB A;  1SMG A;  2JXL A;  3DF0 A;  5DIC A;  2LUX A;  1MWN A;  1DTL A;  1EL4 A;  3TDI A;  3OHM B;  2HPS A;  1LXF C;  2I18 A;  1L2O B;  1YUT A;  2HET A;  2WCB A;  4R1E A;  1C07 A;  4YGB B;  2WCL A;  4CFR A;  1KFU L;  1DMO A;  3SIB A;  1XFY O;  1UUR A;  2Y1N A;  5KSZ A;  4WQ3 A;  1KK7 Z;  4UPG A;  3DVK A;  4PE4 A;  1UP5 A;  1V1G A;  4YGE B;  1YR5 A;  1SCV A;  1YX8 A;  2LE9 B;  4GBA A;  1F4O A;  2KI6 D;  3C1V A;  5DKQ A;  1F71 A;  1L2O C;  1DT7 B;  1MF8 B;  3BXK A;  3CR2 A;  2L51 A;  3CTN A;  4NQG A;  1DF0 A;  1LA3 A;  2COL B;  2KI4 B;  3DY9 A;  3HCM A;  2Q4U A;  3PAT A;  1KQV A;  1B7T Z;  1MXL C;  2WCE A;  1QIW A;  1U5I A;  2PAL A;  1DEK A;  1EXR A;  1CDP A;  2JXC A;  2KSP A;  4U8D A;  1DJY A;  1F8H A;  1JF2 A;  3D78 A;  4ICB A;  1S5G Z;  2KLD A;  3EK8 A;  2KGB C;  4L9M A;  1B1G A;  4N1F A;  1RJV A;  1CTR A;  2KI4 C;  2QPT A;  2R2I A;  1FI6 A;  1NX2 A;  1UHK A;  4PE0 A;  5AEQ A;  2HF5 A;  3KF9 A;  1NX1 A;  3RM1 A;  1KSO A;  1SL8 A;  1J7Q A;  4MZJ A;  2WC5 A;  5CSI A;  1PRW A;  2GGM A;  2ZND A;  3D77 A;  4QJ3 B;  4GGF A;  1TUZ A;  4OZD A;  1DQE A;  1OMR A;  1TCF A;  3D73 A;  5CSF A;  2P6B B;  5HLV A;  3S0E A;  4C0J A;  1A75 B;  2OTG B;  1BU3 A;  4OVN F;  3SG6 A;  1K93 D;  1NPQ A;  2L2C A;  3CDN A;  4PDZ A;  3BUM B;  3CZ0 A;  1CLB A;  1K94 A;  2MLF C;  2QEV A;  3IQQ A;  4OV2 A;  2FJU B;  2JRF A;  2RGI A;  2JNX A;  2NCO A;  2SAS A;  3OX5 A;  2SCP A;  4QJ5 B;  5K89 A;  3EK7 A;  2WC8 A;  4M2P A;  1H4B A;  1UHI A;  4FQT A;  2OTG C;  1OMV A;  3FIA A;  4CLN A;  2BCA A;  2L5Y A;  3BFB A;  3RZS A;  5CSJ A;  1LVC D;  1XFU O;  4D1E A;  3AKA A;  5HKY A;  1DC1 A;  2CXJ A;  2ERB A;  2H61 C;  3L4A A;  2KFG A;  1S6J A;  3Q8I A;  3FS7 A;  4NDC A;  2LUC A;  3QME A;  3LCP C;  2BBM A;  1TUJ A;  3KEV A;  3S0F A;  1JUO A;  2KHN A;  2LMV A;  4GGN A;  1CMF A;  1KFX S;  1NIW A;  2JPO A;  2K7D A;  3VRQ A;  1TIZ A;  1F70 A;  2JT0 A;  2JT3 A;  1B9A A;  1RTP 1;  1NSH A;  1S6I A;  2GV5 A;  2KFH A;  4HRE E;  3O4X A;  3SS5 A;  2NXQ A;  3SG5 A;  2P70 A;  2WCH A;  4ORC B;  1XFZ O;  3CAB A;  3VRR A;  3PSR A;  3NXA A;  2I7A A;  2FCE A;  1Y1U A;  2F3Z A;  2KBI A;  3CR4 X;  3NSO A;  1YVL A;  2BE6 A;  3I5F B;  1KK8 B;  1UHN A;  1SCM B;  1W7I B;  5I2O A;  1CDL A;  1IIO A;  3PM2 A;  2WCM A;  4YGC B;  3CYZ A;  1MR8 A;  1K9P A;  2KBM A;  5I2L A;  1REC A;  1Z2C B;  4XJK B;  3SG7 A;  3EVU A;  3B7A A;  1OZO A;  3R1O A;  4FQO A;  2LVJ A;  3NSL A;  2QDI A;  4C0L A;  5JJG A;  3SG4 A;  1SKT A;  1UUS A;  2F33 A;  3VGO A;  1ALW A;  1KK8 C;  1SCM C;  1IJ5 A;  5FI7 A;  4DRW A;  1FF1 A;  3K1E A;  1E8A A;  1C7W A;  1W7J B;  2EGD A;  2JTT A;  3EG5 B;  2HQW A;  3GK2 A;  1QX7 A;  4GNK B;  2MBX A;  2LCP A;  2K7C A;  1QIV A;  3DVJ A;  1SY9 A;  3JTD B;  4M2Q A;  4CPV A;  5HLO A;  5JOL A;  1N2D A;  1QLS A;  1LA0 A;  1BF5 A;  3D75 A;  3GK1 A;  2BKH B;  2M0R A;  1TCO B;  1Y1X A;  2BL0 B;  1B8L A;  2K8M B;  2Q91 A;  1JWD A;  1BR4 B;  1CM1 A;  3E3R A;  1IKU A;  3PAL A;  1G33 A;  2LMU A;  2M1K B;  5I94 A;  1QWV A;  2BBN A;  2ZKM X;  3BJH A;  3EK4 A;  1A75 A;  4XYN A;  5B8I B;  1LS8 A;  2QEO A;  3O6B A;  2AAO A;  5ER5 A;  1KWO B;  2BEC A;  2BL0 C;  1TNW A;  4QJ4 B;  4FTG A;  4PT1 A;  2H61 A;  2OPO A;  4HSZ A;  2NLN A;  2F8P A;  1J55 A;  3CZT X;  1CMG A;  4DCK A;  1DGU A;  1QS7 A;  1S3P A;  4MLW A;  1SSE B;  2FCD A;  2OS8 B;  4JWQ A;  3S0G A;  2VRG A;  1K9U A;  3N7H A;  1KWO C;  5AFP A;  2K61 A;  1R2U A;  1SK6 D;  3KHE A;  4MN0 A;  1IQ5 A;  4C0K A;  5TNC A;  2L4H A;  2JNF A;  1Q80 A;  4WRI A;  2LVI A;  1QAS A;  1NP8 A;  1G4Y R;  3FE6 A;  2CTN A;  3ICB A;  2PYQ A;  3NGV A;  2OS8 C;  3ZWH A;  1S1E A;  1GGW A;  1L7Z A;  2K0J A;  1DJW A;  1GGZ A;  1DJG A;  1QV1 A;  1TN4 A;  3BUX B;  3CR5 X;  3PLF B;  1IQ3 A;  3VRP A;  5KU1 A;  1JC2 A;  3LK0 A;  2JOJ A;  1RRO A;  1S6C A;  1K96 A;  1CDM A;  1KFX L;  4PAL A;  1M39 A;  1M46 A;  2JPT A;  3SG2 A;  1S36 A;  2NZ0 A;  1B8R A;  1SYM A;  2MA2 A;  5D3O A;  3IF7 A;  5AER A;  1HQV A;  2LVK A;  2ZN8 A;  1AP4 A;  1QLK A;  2M7N A;  1DJZ A;  1IRJ A;  2MAZ A;  1OW4 A;  3B86 A;  1SL9 A;  1BT6 A;  5DKR A;  3UNW A;  2CCM A;  3MSE B;  3CGA A;  1OOJ A;  2ISD A;  2PAS A;  1YX7 A;  4OCI A;  1OZS A;  1SW8 A;  4XJK A;  4A4B A;  2ZFD A;  1RFJ A;  5IBW A;  5D69 A;  1MHO A;  2M97 A;  1K8U A;  1OE9 B;  1WDC C;  2LP3 A;  1JBA A;  2FJY A;  2HQ8 A;  1M45 A;  1RWY A;  1AJ5 A;  5AAN A;  4ETO A;  3EVR A;  1YVH A;  1QVI Y;  1KSM A;  3CZ1 A;  5CSN A;  2KAY A;  3V2L A;  1K2H A;  1DJH A;  1TNP A;  5AXI A;  1CLM A;  2BE4 A;  2MLE C;  2ZNE A;  2Y4Q A;  1BR1 B;  5PAL A;  1QXP A;  1MUX A;  3IQO A;  3PN7 C;  1TRF A;  1GQM A;  3DYE A;  1OOF A;  3DXL A;  1TNQ A;  1LIN A;  1OQP A;  1PAL A;  1Y0V H;  2PQL A;  1PUL A;  3FE8 A;  2M9G A;  4F7F A;  3D74 A;  1X02 A;  5HKZ A;  1C7V A;  2K7O A;  1NX3 A;  1C3Y A;  1EG4 A;  1GJY A;  1FPW A;  1K9K A;  1Y6W A;  2V53 A;  3PJI A;  2L2E A;  2FOT A;  1J7R A;  1N65 A;  4PCW A;  1F54 A;  1TTX A;  3NHT A;  4IJ7 A;  4M2O A;  2K2F A;  2LP2 A;  3KPX A;  4MSP A;  4PHK A;  2KFF A;  5ER4 X;  2ZN9 A;  2KGR A;  2EC6 B;  3BUW B;  1YUS A;  4NDB A;  1UWO A;  2MJW B;  1M63 B;  2JTZ A;  1Y1A A;  1QVI Z;  2M1U A;  2ZRS A;  1MQ1 A;  2LC5 A;  3D76 A;  3OB1 B;  1NYA A;  4GAO A;  1DEL A;  1M31 A;  1MXE A;  2L98 A;  1PSR A;  1WLM A;  4GUK A;  1QAT A;  2LAN A;  1SR6 B;  3CS1 A;  3LK1 A;  1AJ4 A;  2WCK A;  3F45 A;  4ORA B;  3VRO A;  4AOM A;  1EG3 A;  3DD4 A;  2JUL A;  1BJF A;  3R72 A;  3WHU B;  3WNX B;  1K95 A;  2EC6 C;  3H4S E;  3M0W A;  4CFQ A;  1CFF A;  1XO5 A;  4A4C A;  1SRA A;  1FBV A;  3DVM A;  1CM4 A;  1KQM C;  3L47 A;  4INX A;  3I5H B;  1XFW O;  2MRD A;  3O78 A;  4MBE A;  3KO0 A;  4YBH B;  3NHI A;  1G8I A;  1SR6 C;  1UHJ A;  1SPY A;  4IL1 A;  1AHR A;  1JFK A;  2LLS A;  1IJ6 A;  1S26 D;  4YI8 A;  4YGD B;  1QX2 A;  2KNE A;  2M29 A;  2G2B A;  3B6X A;  2L4I A;  3R1P A;  1J1D A;  2KYC A;  3I5H C;  2KAX A;  5BPJ A;  1BLQ A;  3CZ2 A;  2KOT A;  3WHT B;  4USL A;  1K90 D;  2KI6 C;  1CFD A;  2LHL A;  3BYA A;  2A4J A;  1AK8 A;  4WQ2 A;  3VB1 A;  3AAJ A;  1AVS A;  3QRX A;  3PM8 A;  2F3Y A;  3TDU A;  4MZK A;  2LLU A;  1W9Z A;  3AKB A;  3NSI A;  5KTY A;  1UHH A;  3GK4 X;  1PVB A;  2QEH A;  4BY5 A;  3SJS A;  1XYD A;  1A03 A;  2K2A A;  3BOW B;  3DVE A;  4YGA A;  3WXA A;  1A29 A;  1ZAC A;  4P5O E;  2BCB A;  1T14 A;  1J7P A;  3IVT A;  3R1V A;  4YI9 A;  4ZCU A;  4JD9 A;  4KYN A;  4MVF A;  4Q04 A;  1ZMZ A;  3B88 A;  3CLN A;  1YRU B;  1YTZ C;  3GOF A;  2LM5 A;  1WLZ A;  5HYD A;  2H2K A;  5FYX A;  2D8N A;  3L4L A;  1BG1 A;  3SIA A;  4JQ0 D;  4OKH A;  1QTX A;  1EH2 A;  2Y5I A;  3VRN A;  2O60 A;  3D10 A;  5D7F A;  1IGV A;  3BFA A;  1CDN A;  1PK0 D;  2O5G A;  1CLL A;  3I5I B;  3NSK A;  2PVB A;  1AUI B;  5I8N A;  1B8C A;  1KCY A;  1J7O A;  3HX4 A;  1FW4 A;  2PSR A;  3D0Y B;  3S0B A;  1WDC B;  4HRG A;  1A4P A;  2K60 A;  5CPV A;  2MHH A;  2F2O A;  3I5I C;  1QJT A;  1RK9 A;  1OMD A;  3FWB A;  4BY4 A;  1ODB A;  5I2Q A;  2LLT A;  4AQJ A;  4INW A;  2LNK A;  1CFC A;  1FI5 A;  1NWD A;  4N5X A;  5HL1 A;  1XVJ A;  1NCX A;  2KYF A;  1PVA A;  1XK4 C;  1ZOT B;  1DJI A;  2TN4 A;  3PN7 B;  1LKJ A;  1NCZ A;  4PHJ A;  2JU0 A;  2K7B A;  3A4U B;  4ORB B;  3FE9 A;  1CNP A;  2PMY A;  4MRY A;  3BFH A;  1SL7 A;  4PE7 A;  5FI2 A;  2G9B A;  1WRL A;  3O2P A;  4JPZ B;  1F55 A;  1C3Z A;  1BMO A;  3BQ3 A;  3I5G B;  3K21 A;  5GQQ C;  1IH0 A;  1HT9 A;  1ORG A;  2GTE A;  5F6T A;  4DS7 A;  4E68 A;  1CKK A;  2I94 A;  2L50 A;  3AAK A;  3ZNI A;  3TDZ A;  1KFU S;  1XA5 A;  1GM0 A;  2KQY A;  3OP0 A;  1DGV A;  1TWO A;  2AUC A;  2LVV A;  3DF0 B;  1V1F A;  4JKT A;  4AQI A;  1CB1 A;  1P28 A;  2L5X B;  4NDD A;  4GPL B;  3I5G C;  2KQ6 A;  3S0D A;  1SNL A;  4OR9 B;  2WOR A;  3OBV A;  2JQ6 A;  2M3W A;  3O4Y A;  2M7L A;  2B1U A;  3LL8 B;  4PHN A;  1VRK A;  2M8U A;  1B47 A;  2WND A;  2E6W A;  5HKW A;  1XFX O;  1J1E A;  1OOI X;  3EKJ A;  2KLE A;  2P71 A;  2LV7 A;  3EKH A;  3S0A A;  2EHB A;  2L0P A;  2AMI A;  3FWC A;  3B87 A;  1WRZ A;  4HRH A;  2F2P A;  2LMT A;  1N0Y A;  4MRX A;  4PE1 A;  4I5K A;  1ALV A;  2WOS A;  2M49 B;  3BOW A;  1KQM B;  1CFP A;  3SG3 A;  1IWQ A;  2WC6 A;  1DF0 B;  1NCY A;  3DZT A;  3A8R A;  4MEW A;  3SS4 A;  1U5I B;  3RLZ A;  1F4Q A;  2CT9 A;  1NX0 A;  4TNC A;  1BOD A;  1DJX A;  3CWG A;  1EJ3 A;  2JT8 A;  2GGZ A;  2KAV A;  2Y1M A;  1ZFS A;  1JF0 A;  1A2X A;  1SBJ A;  2DOQ A;  2NCP A;  4I5J A;  2LAP A;  4F0Z B;  3TS5 B;  3TZ1 A;  4I5N B;  4N1G A;  2IS9 A;  1OOH A;  1H8B A;  3BUN B;  1IG5 A;  5G08 A;  1YUR A;  1B4C A;  2I2R E;  4PHM A;  1OOG A;  2QAC A;  1QX5 B;  3BUO B;  1OSA A;  2CNP A;  1XK4 A;  3D0Y A;  4ZCV A;  1TNX A;  1XFR A;  5EL2 A;  3TUY B;  1YRT B;  1JFJ A;  4DUQ A;  3OB2 B;  3TS5 C;  3OGN A;  5J3X A;  4MZL A;  1JSA A;  1WY9 A;  2WCF A;  1XFV O;  3JVT B;  2ZRT A;  3I5F C;  1D1O A;  3UO9 A;  1BOC A;  4GGF C;  5FI6 A;  1NUB A;  2E30 A;  3SS3 A;  1KK7 Y;  2LHI A;  1R6P A;  2KDH A;  2KPH A;  3TUY C; 
#chains in the Genus database with same CATH homology
 1QV0 A;  2CBL A;  3EVV A;  3JVT C;  1PSB A;  3LLE A;  5DKN A;  4CID A;  1B7T Y;  2PRU A;  4GFT A;  1YUU A;  4DIR A;  4I5L B;  2JC2 A;  2JZI A;  3OX6 A;  1ZUZ A;  4YRU A;  1TOP A;  1S5G Y;  3JTD C;  1DVI A;  2BKI B;  2BCX A;  4P2Y B;  3PFV A;  1WRK A;  2JWW A;  1SMG A;  2JXL A;  3DF0 A;  2LUX A;  1MWN A;  1DTL A;  1EL4 A;  3TDI A;  3OHM B;  2HPS A;  1LXF C;  2I18 A;  1L2O B;  1YUT A;  2HET A;  2WCB A;  4R1E A;  1C07 A;  4YGB B;  4CFR A;  1KFU L;  1DMO A;  3SIB A;  1XFY O;  1UUR A;  2Y1N A;  5KSZ A;  4WQ3 A;  1KK7 Z;  4UPG A;  3DVK A;  4PE4 A;  1UP5 A;  1V1G A;  4YGE B;  1YR5 A;  1SCV A;  1YX8 A;  2LE9 B;  4GBA A;  1F4O A;  2KI6 D;  3C1V A;  5DKQ A;  1F71 A;  1L2O C;  1DT7 B;  1MF8 B;  3BXK A;  3CR2 A;  2L51 A;  3CTN A;  4NQG A;  1DF0 A;  1LA3 A;  2COL B;  2KI4 B;  3HCM A;  2Q4U A;  3PAT A;  1KQV A;  1B7T Z;  1MXL C;  2WCE A;  1QIW A;  1U5I A;  2PAL A;  1EXR A;  1CDP A;  2JXC A;  2KSP A;  4U8D A;  1DJY A;  1F8H A;  1JF2 A;  4ICB A;  1S5G Z;  3EK8 A;  2KGB C;  4L9M A;  1B1G A;  4N1F A;  1RJV A;  1CTR A;  2KI4 C;  2QPT A;  2R2I A;  1FI6 A;  1NX2 A;  1UHK A;  4PE0 A;  5AEQ A;  2HF5 A;  3KF9 A;  1NX1 A;  3RM1 A;  1KSO A;  1SL8 A;  1J7Q A;  4MZJ A;  5CSI A;  1PRW A;  2GGM A;  2ZND A;  4QJ3 B;  4GGF A;  1OMR A;  1TCF A;  5CSF A;  5HLV A;  2P6B B;  4C0J A;  1A75 B;  2OTG B;  1BU3 A;  4OVN F;  3SG6 A;  1K93 D;  1NPQ A;  4PDZ A;  3BUM B;  1CLB A;  1K94 A;  2MLF C;  4OV2 A;  3IQQ A;  2FJU B;  2JRF A;  2RGI A;  2JNX A;  2NCO A;  2SAS A;  3OX5 A;  2SCP A;  4QJ5 B;  5K89 A;  3EK7 A;  2WC8 A;  4M2P A;  1H4B A;  1UHI A;  2OTG C;  1OMV A;  3FIA A;  4CLN A;  2BCA A;  5CSJ A;  1LVC D;  1XFU O;  4D1E A;  3AKA A;  5HKY A;  2CXJ A;  2H61 C;  2KFG A;  1S6J A;  3FS7 A;  4NDC A;  2LUC A;  3LCP C;  2BBM A;  3KEV A;  1JUO A;  2KHN A;  2LMV A;  4GGN A;  1CMF A;  1KFX S;  1NIW A;  2K7D A;  3VRQ A;  1TIZ A;  1F70 A;  2JT0 A;  2JT3 A;  1B9A A;  1RTP 1;  1NSH A;  1S6I A;  2GV5 A;  2KFH A;  4HRE E;  2NXQ A;  3SG5 A;  4ORC B;  1XFZ O;  3VRR A;  3PSR A;  3NXA A;  2I7A A;  2FCE A;  1Y1U A;  2F3Z A;  2KBI A;  3CR4 X;  3NSO A;  1YVL A;  2BE6 A;  3I5F B;  1KK8 B;  1UHN A;  1SCM B;  1W7I B;  5I2O A;  1CDL A;  4YGC B;  1MR8 A;  1K9P A;  2KBM A;  5I2L A;  1REC A;  4XJK B;  3SG7 A;  3EVU A;  1OZO A;  4FQO A;  4C0L A;  2LVJ A;  3NSL A;  5JJG A;  3SG4 A;  1SKT A;  1UUS A;  2F33 A;  3VGO A;  1ALW A;  1KK8 C;  1SCM C;  1IJ5 A;  4DRW A;  1FF1 A;  1E8A A;  1C7W A;  1W7J B;  2EGD A;  2JTT A;  3GK2 A;  2HQW A;  4GNK B;  1QX7 A;  2MBX A;  2LCP A;  2K7C A;  1QIV A;  3DVJ A;  1SY9 A;  3JTD B;  4M2Q A;  4CPV A;  5HLO A;  5JOL A;  1N2D A;  1QLS A;  1LA0 A;  1BF5 A;  3GK1 A;  2BKH B;  2M0R A;  1TCO B;  1Y1X A;  2BL0 B;  1B8L A;  2K8M B;  2Q91 A;  1JWD A;  1BR4 B;  1CM1 A;  3E3R A;  1IKU A;  3PAL A;  1G33 A;  2LMU A;  2M1K B;  2BBN A;  2ZKM X;  3EK4 A;  1A75 A;  4XYN A;  5B8I B;  5ER5 A;  3O6B A;  2AAO A;  1KWO B;  2BEC A;  2BL0 C;  1TNW A;  4QJ4 B;  4FTG A;  2H61 A;  2OPO A;  4HSZ A;  2NLN A;  2F8P A;  1J55 A;  3CZT X;  1CMG A;  4DCK A;  1DGU A;  1QS7 A;  1S3P A;  4MLW A;  2FCD A;  2OS8 B;  4JWQ A;  2VRG A;  1K9U A;  5AFP A;  1KWO C;  2K61 A;  1R2U A;  1SK6 D;  3KHE A;  4MN0 A;  1IQ5 A;  4C0K A;  5TNC A;  2L4H A;  2JNF A;  1Q80 A;  4WRI A;  2LVI A;  1QAS A;  1NP8 A;  1G4Y R;  2CTN A;  3ICB A;  2OS8 C;  3ZWH A;  1S1E A;  1GGW A;  1L7Z A;  2K0J A;  1DJW A;  1GGZ A;  1DJG A;  1QV1 A;  1TN4 A;  3BUX B;  3CR5 X;  3PLF B;  1IQ3 A;  3VRP A;  5KU1 A;  1JC2 A;  3LK0 A;  2JOJ A;  1RRO A;  1S6C A;  1K96 A;  1CDM A;  1KFX L;  4PAL A;  1M39 A;  1M46 A;  2JPT A;  3SG2 A;  1S36 A;  2NZ0 A;  1B8R A;  1SYM A;  2MA2 A;  5AER A;  3IF7 A;  1HQV A;  2LVK A;  2ZN8 A;  1AP4 A;  1QLK A;  2M7N A;  1DJZ A;  1IRJ A;  2MAZ A;  5DKR A;  1SL9 A;  1BT6 A;  2CCM A;  3MSE B;  3CGA A;  1OOJ A;  2ISD A;  2PAS A;  1YX7 A;  4OCI A;  1OZS A;  1SW8 A;  4XJK A;  4A4B A;  2ZFD A;  1RFJ A;  5IBW A;  5D69 A;  1MHO A;  2M97 A;  1K8U A;  1OE9 B;  1WDC C;  2LP3 A;  1JBA A;  2HQ8 A;  1M45 A;  1RWY A;  1AJ5 A;  5AAN A;  4ETO A;  3EVR A;  1YVH A;  1QVI Y;  1KSM A;  5CSN A;  2KAY A;  1K2H A;  1DJH A;  1TNP A;  5AXI A;  1CLM A;  2BE4 A;  2MLE C;  2ZNE A;  2Y4Q A;  1BR1 B;  5PAL A;  1QXP A;  1MUX A;  3IQO A;  3PN7 C;  1TRF A;  1GQM A;  1TNQ A;  1LIN A;  1OQP A;  1PAL A;  1Y0V H;  1PUL A;  2M9G A;  1X02 A;  5HKZ A;  1C7V A;  2K7O A;  1NX3 A;  1EG4 A;  1GJY A;  1FPW A;  1K9K A;  1Y6W A;  2V53 A;  2L2E A;  2FOT A;  1J7R A;  1N65 A;  4PCW A;  1F54 A;  1TTX A;  4M2O A;  2K2F A;  2LP2 A;  3KPX A;  4MSP A;  4PHK A;  2KFF A;  5ER4 X;  2ZN9 A;  2KGR A;  2EC6 B;  3BUW B;  1YUS A;  4NDB A;  1UWO A;  2MJW B;  1M63 B;  2JTZ A;  1Y1A A;  1QVI Z;  2M1U A;  2ZRS A;  1MQ1 A;  2LC5 A;  3OB1 B;  1NYA A;  4GAO A;  1M31 A;  1MXE A;  2L98 A;  1PSR A;  1WLM A;  4GUK A;  1QAT A;  2LAN A;  1SR6 B;  3CS1 A;  3LK1 A;  1AJ4 A;  3F45 A;  4ORA B;  3VRO A;  4AOM A;  1EG3 A;  3DD4 A;  2JUL A;  1BJF A;  3WHU B;  3WNX B;  1K95 A;  2EC6 C;  3H4S E;  3M0W A;  4CFQ A;  1CFF A;  1XO5 A;  4A4C A;  1SRA A;  1FBV A;  3DVM A;  1CM4 A;  1KQM C;  3I5H B;  1XFW O;  2MRD A;  3O78 A;  4MBE A;  3KO0 A;  4YBH B;  1G8I A;  1SR6 C;  1UHJ A;  1SPY A;  4IL1 A;  1AHR A;  1JFK A;  2LLS A;  1IJ6 A;  1S26 D;  4YI8 A;  4YGD B;  1QX2 A;  2KNE A;  2M29 A;  2G2B A;  2L4I A;  1J1D A;  2KYC A;  3I5H C;  2KAX A;  5BPJ A;  1BLQ A;  2KOT A;  3WHT B;  4USL A;  1K90 D;  2KI6 C;  1CFD A;  2LHL A;  3BYA A;  2A4J A;  1AK8 A;  4WQ2 A;  3AAJ A;  1AVS A;  3QRX A;  3PM8 A;  2F3Y A;  3TDU A;  4MZK A;  2LLU A;  3AKB A;  3NSI A;  5KTY A;  1UHH A;  3GK4 X;  1PVB A;  4BY5 A;  3SJS A;  1XYD A;  1A03 A;  2K2A A;  3BOW B;  3DVE A;  4YGA A;  3WXA A;  1A29 A;  1ZAC A;  4P5O E;  2BCB A;  1J7P A;  4YI9 A;  4ZCU A;  4MVF A;  4Q04 A;  1ZMZ A;  3CLN A;  1YRU B;  1YTZ C;  3GOF A;  2LM5 A;  1WLZ A;  5HYD A;  2H2K A;  5FYX A;  2D8N A;  1BG1 A;  3SIA A;  4JQ0 D;  4OKH A;  1QTX A;  1EH2 A;  2Y5I A;  3VRN A;  2O60 A;  3D10 A;  5D7F A;  1IGV A;  1CDN A;  1PK0 D;  2O5G A;  1CLL A;  3I5I B;  3NSK A;  2PVB A;  1AUI B;  5I8N A;  1B8C A;  1KCY A;  1J7O A;  3HX4 A;  1FW4 A;  2PSR A;  3D0Y B;  1WDC B;  4HRG A;  1A4P A;  5CPV A;  2MHH A;  2F2O A;  3I5I C;  1QJT A;  1RK9 A;  1OMD A;  3FWB A;  4BY4 A;  1ODB A;  5I2Q A;  2LLT A;  4AQJ A;  1FI5 A;  2LNK A;  1CFC A;  1NWD A;  4N5X A;  1XVJ A;  1NCX A;  2KYF A;  1PVA A;  1XK4 C;  1ZOT B;  1DJI A;  2TN4 A;  3PN7 B;  1LKJ A;  1NCZ A;  4PHJ A;  2JU0 A;  2K7B A;  3A4U B;  4ORB B;  1CNP A;  2PMY A;  4MRY A;  1SL7 A;  4PE7 A;  2G9B A;  1WRL A;  3O2P A;  4JPZ B;  1F55 A;  3K21 A;  1BMO A;  3BQ3 A;  3I5G B;  5GQQ C;  1IH0 A;  1HT9 A;  5F6T A;  4DS7 A;  4E68 A;  1CKK A;  2I94 A;  2L50 A;  3AAK A;  3ZNI A;  3TDZ A;  1KFU S;  1XA5 A;  2KQY A;  3OP0 A;  1DGV A;  2LVV A;  2AUC A;  3DF0 B;  1CB1 A;  1V1F A;  4AQI A;  2L5X B;  4NDD A;  4GPL B;  3I5G C;  2KQ6 A;  1SNL A;  4OR9 B;  2WOR A;  2M7L A;  2JQ6 A;  2M3W A;  3O4Y A;  2B1U A;  3LL8 B;  4PHN A;  1VRK A;  2M8U A;  1B47 A;  2WND A;  2E6W A;  5HKW A;  1XFX O;  1J1E A;  3EKJ A;  3EKH A;  2LV7 A;  2EHB A;  2L0P A;  2AMI A;  3FWC A;  1WRZ A;  4HRH A;  2F2P A;  2LMT A;  1N0Y A;  4MRX A;  4PE1 A;  4I5K A;  1ALV A;  2WOS A;  2M49 B;  3BOW A;  1KQM B;  1CFP A;  3SG3 A;  1IWQ A;  1DF0 B;  1NCY A;  3A8R A;  4MEW A;  1U5I B;  3RLZ A;  1F4Q A;  2CT9 A;  1NX0 A;  4TNC A;  1BOD A;  1DJX A;  3CWG A;  1EJ3 A;  2JT8 A;  2GGZ A;  2KAV A;  2Y1M A;  1ZFS A;  1JF0 A;  1A2X A;  1SBJ A;  2DOQ A;  2NCP A;  4I5J A;  2LAP A;  4F0Z B;  3TS5 B;  3TZ1 A;  4I5N B;  4N1G A;  2IS9 A;  1H8B A;  3BUN B;  1IG5 A;  5G08 A;  1YUR A;  1B4C A;  2I2R E;  4PHM A;  2QAC A;  1QX5 B;  3BUO B;  1OSA A;  2CNP A;  1XK4 A;  3D0Y A;  4ZCV A;  1TNX A;  3TUY B;  1YRT B;  1JFJ A;  4DUQ A;  3OB2 B;  3TS5 C;  5J3X A;  4MZL A;  1JSA A;  1WY9 A;  2WCF A;  1XFV O;  3JVT B;  2ZRT A;  3I5F C;  1D1O A;  1BOC A;  4GGF C;  1NUB A;  2E30 A;  1KK7 Y;  2LHI A;  1R6P A;  2KDH A;  3TUY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...