2ZRSA

Crystal structure of ca2+-bound form of des3-23alg-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
165
structure length
165
Chain Sequence
DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 30
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zrsA00
3I5FB 1ZOTB 3IF7A 2M8UA 1YVLA 4ORCB 2KI6D 1WLMA 5CSNA 3NXAA 4BY5A 1DJGA 1WDCB 1RTP1 2LMUA 3OX5A 1PVAA 3VRRA 1Y1UA 4ZCVA 2PSRA 1UURA 3D0YA 3NSOA 2JQ6A 4I5KA 1M39A 1F4OA 5DKRA 4MSPA 3SIAA 1FBVA 1XFWO 2P6BB 1S3PA 1BG1A 1CLLA 1BODA 3GOFA 3FS7A 4NDCA 2L2EA 3EK7A 1JFJA 2OS8C 5F6TA 1UHJA 1SW8A 4PE0A 1C7VA 1BR4B 2LP3A 2LLSA 1UHHA 1N0YA 2JPTA 3OX6A 2WCEA 2Y4QA 1CFFA 3JVTB 1WDCC 1QATA 3SJSA 1SCMB 1JF2A 1DT7B 1YR5A 2WCBA 1TRFA 4NDDA 2PALA 1K2HA 1L7ZA 1TIZA 1AK8A 1GGZA 1K95A 1QASA 4WQ2A 2MRDA 2M29A 2BKHB 1Q80A 4YRUA 1UHNA 5IBWA 1GQMA 4GGFC 2AUCA 5G08A 2JT8A 1TOPA 2Q4UA 1WRKA 1AUIB 5AXIA 2TN4A 4OCIA 1M63B 1QVIZ 3D0YB 3DVMA 4MZLA 5D7FA 1LA3A 1S26D 4HRGA 5CSFA 2BE6A 2K7CA 1PALA 3EKJA 1YTZC 5PALA 1BOCA 1EG3A 1SR6B 2LHIA 3JVTC 4YI9A 1AJ4A 4MRXA 1XFYO 1ALWA 5I2OA 1BR1B 2DOQA 2LAPA 1GJYA 1S1EA 4YGBB 3TS5C 1CMGA 4OKHA 2Y1NA 2Q91A 2IS9A 4GFTA 1KFUL 2BL0B 1G4YR 1LVCD 2K0JA 4P2YB 2FCEA 3IQQA 2CTNA 2GGMA 5AEQA 3LL8B 4DCKA 2BKIB 5KSZA 4MZJA 2L4IA 1OMVA 2LNKA 1K94A 3VROA 1F8HA 1XVJA 3EK4A 2L51A 1MR8A 1IQ3A 1SR6C 2NZ0A 2ZN8A 1KSMA 2RGIA 3PATA 1ZUZA 3MSEB 3OP0A 1KQMB 1QLKA 2K7DA 3BUNB 1RJVA 1IWQA 3WNXB 1QS7A 1Y1XA 1EG4A 2BL0C 1XFVO 2CXJA 2OTGB 2LLTA 2M1UA 1WRLA 2JTTA 1S6CA 3D10A 3PLFB 1CNPA 4XYNA 5B8IB 1IH0A 1SCVA 2KDHA 1RECA 3AAKA 4YI8A 2D8NA 1JWDA 3RLZA 4MN0A 3BUWB 1F55A 1BMOA 3PFVA 1N2DA 1N65A 1SL8A 4YGCB 4CIDA 3A8RA 1BF5A 2LVIA 4CLNA 2KGBC 5AFPA 1S6JA 4MBEA 1QLSA 2LE9B 1CTRA 5CSJA 3I5GC 1UHIA 1EH2A 1KQMC 1GGWA 2PRUA 4PHMA 3ZWHA 1QIVA 1EJ3A 2Y5IA 3CTNA 4GPLB 4GNKB 1XA5A 2F3ZA 1SK6D 3FIAA 5HKWA 3SG2A 2ZNEA 1PRWA 2OTGC 3I5IB 4OV2A 1K93D 3PN7C 1ZACA 2K2FA 2JTZA 1DGUA 1F4QA 3DVEA 1BU3A 1X02A 2WCFA 3KHEA 1DJIA 2OS8B 1DF0B 1OZOA 4XJKA 1B9AA 1NCYA 1ODBA 1XK4C 3CR2A 3CR4X 1UP5A 2M7LA 1R2UA 2QPTA 2KI6C 1KFUS 3CS1A 4NDBA 3C1VA 1A75B 3KPXA 5I2LA 2LHLA 2AAOA 2KNEA 2SASA 4PE1A 2V53A 2BECA 3I5IC 1H4BA 3ZNIA 1U5IA 3TUYC 1QX5B 4PDZA 1L2OB 4N1GA 3GK2A 4QJ4B 1IQ5A 4PE7A 3SG5A 1NUBA 1Y0VH 5HKYA 1F54A 1AVSA 3F45A 1R6PA 2G2BA 3AAJA 1WRZA 1XFXO 1OMRA 1MF8B 1EL4A 4ICBA 2K2AA 2MA2A 3CLNA 1SYMA 2NLNA 3PALA 3TDZA 1IRJA 3O2PA 1NCZA 1QX2A 2KHNA 3DVJA 5TNCA 3KF9A 2OPOA 2CT9A 1B4CA 1QJTA 2ZRSA 1W7IB 2BCBA 3NSIA 3TS5B 4DS7A 1RK9A 2HPSA 1F71A 1J55A 2FOTA 3TDUA 1L2OC 5AANA 2ZRTA 2JOJA 3EK8A 4MLWA 2HETA 3BYAA 4C0JA 4DUQA 2LVJA 4WQ3A 2HF5A 2ZNDA 2ISDA 1CDLA 1K96A 1AHRA 4ZCUA 1XFUO 1LINA 1S6IA 1CDPA 5KTYA 2ZN9A 1FF1A 1LKJA 3O6BA 2JULA 1NCXA 1JBAA 4GUKA 4CFRA 4F0ZB 3EKHA 4CPVA 3CGAA 1CFPA 1MHOA 2KQ6A 2SCPA 2L50A 2KBMA 4PE4A 2KI4B 2QACA 2I18A 2JNFA 1DJYA 4E68A 3VRQA 2HQWA 1KK8C 4C0KA 5HYDA 1JFKA 2F8PA 4M2PA 3VRNA 1BLQA 3EVUA 4I5JA 1CM1A 3VRPA 1B7TY 1RWYA 1K9KA 2KYCA 1J7RA 1K9UA 4DRWA 1A03A 3I5GB 1CDMA 1YX7A 1DMOA 2WORA 1B8RA 1JC2A 2MLFC 1S5GY 1PSBA 3SG7A 4YGAA 1QX7A 1QXPA 4M2OA 1IKUA 4R1EA 2KI4C 3EVVA 1SKTA 2BE4A 1DGVA 1QIWA 2LM5A 3PN7B 2LUCA 4N1FA 4YGDB 3M0WA 2NCOA 1J7PA 4D1EA 1G8IA 1LXFC 2FCDA 2L0PA 3SG4A 1FPWA 2K8MB 4QJ3B 1OE9B 2JXCA 1JF0A 2I94A 1PSRA 2M1KB 2LVVA 1PK0D 1KFXL 2HQ8A 4HRHA 1HT9A 2KGRA 1SBJA 1SL9A 1JSAA 2EGDA 2VRGA 1YVHA 1FI5A 1IJ6A 5KU1A 5DKQA 4DIRA 1NX0A 1C7WA 2H61A 2K7OA 1FW4A 1BT6A 3TUYB 1IJ5A 2CBLA 1CLBA 5JJGA 3NSLA 1KSOA 1JUOA 1DJZA 2CNPA 2KSPA 2PMYA 4QJ5B 1QV1A 5GQQC 1CLMA 1EXRA 1DVIA 1CKKA 1C07A 1UWOA 1RROA 1J1EA 1OQPA 2CCMA 1MQ1A 2ZFDA 5FYXA 2L98A 1OSAA 2JC2A 4GGFA 1MXLC 1YUSA 2BBNA 2LP2A 1SY9A 3CR5X 2GGZA 3CWGA 3LCPC 1UHKA 4P5OE 2JT3A 3A4UB 1CDNA 1WY9A 1XYDA 2I2RE 4IL1A 1PULA 4HREE 1NSHA 3ICBA 1K90D 1WLZA 3GK1A 1TNQA 2M7NA 1ZFSA 5I2QA 2G9BA 2KAXA 5K89A 4ORAB 1CB1A 4PHNA 5D69A 3SG3A 4MVFA 1RFJA 2K61A 3SIBA 2COLB 3BQ3A 2LC5A 1DJXA 1YUUA 1Y1AA 1J7QA 1IG5A 5DKNA 5CSIA 1D1OA 1K9PA 2M9GA 3WHTB 3E3RA 4C0LA 2AMIA 5BPJA 4GBAA 1YRTB 1B47A 1OZSA 3EVRA 4L9MA 4A4CA 4JWQA 5AERA 2ZKMX 4XJKB 5HLOA 2KQYA 2KYFA 1SMGA 2LVKA 1NX1A 2MLEC 3I5HC 4CFQA 1TNWA 1KQVA 2KOTA 1B1GA 3WHUB 3O78A 3DF0A 1S36A 2E6WA 2NCPA 3I5FC 1KK8B 4USLA 2MBXA 1KFXS 3IQOA 4WRIA 3OB2B 2LANA 2LMVA 2PASA 3LK1A 1B8LA 3RM1A 1MXEA 3LLEA 2H61C 4JQ0D 5HLVA 2KAVA 2F2PA 1U5IB 3BUOB 3PSRA 4AOMA 1F70A 1M46A 3QRXA 2WOSA 5JOLA 1ALVA 1A2XA 4TNCA 5J3XA 1TN4A 1FI6A 2WNDA 1A29A 1DJHA 1QV0A 2E30A 2A4JA 5CPVA 2M97A 1QVIY 2JXLA 3PM8A 2LCPA 2JWWA 2KFFA 3WXAA 1YRUB 3OHMB 4PALA 3OB1B 4GAOA 2MHHA 3O4YA 4ORBB 1AP4A 1NYAA 3KEVA 1CM4A 1OOJA 2F33A 1SRAA 1J7OA 1IGVA 1VRKA 4I5NB 3LK0A 4N5XA 1BJFA 1HQVA 1W7JB 2JRFA 2Y1MA 3DD4A 1K8UA 1SCMC 3GK4X 1NIWA 1MUXA 3BOWA 3HCMA 4PHJA 1AJ5A 2WC8A 2H2KA 3DF0B 2M3WA 1E8AA 3BUMB 1XK4A 1B8CA 1B7TZ 3FWBA 2I7AA 1A4PA 2KFHA 4PHKA 3JTDB 2EC6B 2M0RA 1ZMZA 2JNXA 2LUXA 2F2OA 2KFGA 1TNXA 1YURA 1UUSA 2BBMA 1QTXA 3TZ1A 1S5GZ 5I8NA 3BUXB 1SNLA 4MZKA 1DTLA 2R2IA 2EHBA 2LMTA 3CZTX 1TCFA 4NQGA 3KO0A 2KAYA 2BCAA 2BCXA 4OVNF 4I5LB 2O60A 1G33A 2B1UA 4FQOA 2O5GA 1NX2A 1MWNA 1PVBA 3BXKA 4OR9B 4UPGA 1DF0A 3SG6A 5HKZA 2L4HA 4A4BA 3HX4A 2FJUB 1V1GA 3JTDC 1M31A 2EC6C 2PVBA 2K7BA 5ER5A 1YUTA 1A75A 1J1DA 1TNPA 3H4SE 3TDIA 1Y6WA 4AQJA 1KWOB 1V1FA 1XFZO 3BOWB 4Q04A 1TCOB 4HSZA 3DVKA 4GGNA 4MRYA 4AQIA 1NPQA 4M2QA 1CFCA 3AKBA 4FTGA 2M49B 1DJWA 4ETOA 4YGEB 2GV5A 4JPZB 4U8DA 4MEWA 1NX3A 5ER4X 1KK7Y 1LA0A 1TTXA 2MAZA 1H8BA 2LV7A 2MJWB 1SL7A 2JT0A 1NWDA 3FWCA 1YX8A 2LLUA 1OMDA 2NXQA 4YBHB 3K21A 1KK7Z 1SPYA 2L5XB 1XO5A 3VGOA 2JZIA 1KWOC 1CFDA 3AKAA 4PCWA 1M45A 1NP8A 2F3YA 1KCYA 3I5HB 2JU0A 1CMFA 2KBIA 4BY4A 3NSKA
chains in the Genus database with same CATH superfamily
3I5FB 1ZOTB 3CABA 3IF7A 2M8UA 1YVLA 4ORCB 2KI6D 3NHTA 1WLMA 5CSNA 3NXAA 4BY5A 1DJGA 1WDCB 1RTP1 2LMUA 3OX5A 3BJHA 1PVAA 3VRRA 1Y1UA 4ZCVA 2PSRA 1UURA 3D0YA 3NSOA 2JQ6A 4I5KA 1M39A 1F4OA 5DKRA 4MSPA 3SIAA 1FBVA 1XFWO 2P6BB 1S3PA 1BG1A 1CLLA 2QEVA 1BODA 3GOFA 3FS7A 4NDCA 2L2EA 3EK7A 1JFJA 3BFHA 2OS8C 5F6TA 1UHJA 3BFAA 1SW8A 4PE0A 4PT1A 1C7VA 1BR4B 2LP3A 2LLSA 1UHHA 2H8VA 1N0YA 2JPTA 3OX6A 2WCEA 2QEOA 1QWVA 2Y4QA 3JVTB 1CFFA 1WDCC 1QATA 3SJSA 1SCMB 1JF2A 2WCJA 1DT7B 1YR5A 3V2LA 2WCBA 1TRFA 4NDDA 2PALA 1K2HA 1L7ZA 1TIZA 2L5YA 1AK8A 1GGZA 1K95A 1QASA 4WQ2A 2MRDA 2M29A 3B88A 2BKHB 1Q80A 4YRUA 1UHNA 5IBWA 1GQMA 5HL1A 4GGFC 2AUCA 5G08A 2JT8A 1TOPA 2Q4UA 1WRKA 5FI6A 1AUIB 5AXIA 2TN4A 4OCIA 1M63B 1QVIZ 3D0YB 3DVMA 4MZLA 5D7FA 1LA3A 1S26D 4HRGA 5CSFA 2BE6A 1TUZA 2K7CA 1PALA 3EKJA 1YTZC 5PALA 1BOCA 1EG3A 1SR6B 2LHIA 3JVTC 4YI9A 1AJ4A 4MRXA 1XFYO 1ALWA 5I2OA 1BR1B 2DOQA 2LAPA 1GJYA 1S1EA 4YGBB 3TS5C 1CMGA 4OKHA 2Y1NA 2Q91A 2IS9A 4GFTA 1KFUL 3QMEA 2BL0B 1G4YR 1LVCD 2K0JA 2WCMA 2FCEA 4P2YB 3IQQA 2CTNA 2GGMA 5AEQA 3LL8B 4DCKA 2BKIB 5KSZA 4MZJA 2L4IA 1OMVA 3S0FA 3NGVA 1C3ZA 3L47A 2LNKA 1K94A 3VROA 1F8HA 1XVJA 3B7AA 3EK4A 2L51A 1MR8A 1IQ3A 1SR6C 2NZ0A 2ZN8A 1KSMA 2RGIA 3PATA 1ZUZA 3MSEB 3OP0A 1KQMB 1QLKA 2K7DA 3BUNB 1RJVA 1IWQA 3WNXB 1TUJA 1DELA 1IIOA 1QS7A 1Y1XA 1EG4A 2BL0C 1XFVO 2CXJA 2OTGB 3B6XA 2LLTA 2M1UA 1WRLA 2JTTA 1S6CA 3D10A 3PLFB 5D3OA 1CNPA 4XYNA 3B86A 5FI2A 1SCVA 5B8IB 1IH0A 2KDHA 1RECA 3AAKA 4YI8A 2D8NA 1JWDA 3RLZA 4MN0A 3BUWB 1F55A 1BMOA 3N7HA 1N2DA 1N65A 1SL8A 3PFVA 4YGCB 4CIDA 3A8RA 3R72A 1BF5A 2LVIA 4CLNA 2KGBC 5AFPA 1S6JA 4MBEA 1QLSA 2LE9B 1CTRA 5CSJA 3I5GC 1UHIA 1EH2A 1KQMC 1GGWA 2PRUA 4PHMA 3ZWHA 1QIVA 1EJ3A 2Y5IA 3CTNA 3PM2A 4GPLB 1XA5A 2F3ZA 1SK6D 3FIAA 4GNKB 3SG2A 2ZNEA 1PRWA 2OTGC 3I5IB 4OV2A 4F7FA 3SS5A 1K93D 3PN7C 1ZACA 2K2FA 2JTZA 3BFBA 1DGUA 1F4QA 3DVEA 1BU3A 1X02A 2WCFA 3KHEA 1DJIA 1TWOA 2OS8B 1DF0B 1OZOA 4XJKA 1B9AA 1NCYA 1ODBA 1XK4C 3CR2A 3S0GA 3CR4X 1UP5A 2M7LA 1R2UA 2QPTA 2KI6C 1C3YA 1KFUS 2QEBA 3CS1A 4NDBA 2BNXA 3C1VA 1A75B 3KPXA 5I2LA 2LHLA 2AAOA 2KNEA 2SASA 4PE1A 2V53A 2BECA 3I5IC 1H4BA 3ZNIA 1U5IA 3TUYC 1QX5B 3R1OA 4PDZA 4IJ7A 3B87A 1L2OB 4N1GA 3GK2A 4QJ4B 3OGNA 1GM0A 1IQ5A 4PE7A 3SG5A 1NUBA 1Y0VH 5HKYA 1F54A 1AVSA 3F45A 1R6PA 2G2BA 3AAJA 1WRZA 1XFXO 1OMRA 2JPOA 1MF8B 1EL4A 1Z4HA 2BAPA 4ICBA 3S0DA 2K2AA 2MA2A 3CLNA 1SYMA 2NLNA 3PALA 3TDZA 1IRJA 3R1PA 3O2PA 1NCZA 3D74A 1QX2A 2KHNA 3DVJA 5TNCA 3KF9A 2OPOA 2CT9A 1B4CA 1QJTA 2ZRSA 1W7IB 2BCBA 3DZTA 3NSIA 3TS5B 4DS7A 1RK9A 2HPSA 1F71A 1J55A 2FOTA 3TDUA 1L2OC 2QDIA 5AANA 1OW4A 2ZRTA 2JOJA 3EK8A 4MLWA 2HETA 3BYAA 4C0JA 4DUQA 2LVJA 3D76A 4WQ3A 2HF5A 2ZNDA 2ISDA 1CDLA 1K96A 1AHRA 3D75A 4ZCUA 1XFUO 1P28A 1LINA 1S6IA 1CDPA 3UNWA 2ZN9A 5KTYA 5I94A 1FF1A 1LKJA 3O6BA 2JULA 1NCXA 3EG5B 1JBAA 4GUKA 1XFRA 4CFRA 4F0ZB 3EKHA 1T14A 4CPVA 3CGAA 1CFPA 1MHOA 2KQ6A 2SCPA 2L50A 2KBMA 4PE4A 2KI4B 2QACA 2I18A 2JNFA 1DJYA 4E68A 3VRQA 2HQWA 1KK8C 4C0KA 5HYDA 1JFKA 2F8PA 4M2PA 3VRNA 1BLQA 3EVUA 4I5JA 1CM1A 3VRPA 3OBVA 1B7TY 1RWYA 1K9KA 2KYCA 3SS3A 1J7RA 1K9UA 2P70A 4DRWA 1A03A 3I5GB 1CDMA 1YX7A 1DMOA 2WORA 2QEHA 3K1EA 1B8RA 1JC2A 2MLFC 1S5GY 1PSBA 3SG7A 4YGAA 1QX7A 1QXPA 4M2OA 1IKUA 3DYEA 4R1EA 2KI4C 3EVVA 1SKTA 2BE4A 1DGVA 1QIWA 1OOFA 2LM5A 3PN7B 2LUCA 4N1FA 4YGDB 3M0WA 2NCOA 2K60A 1J7PA 2GTEA 4D1EA 5HKWA 1ORGA 1G8IA 1LXFC 2FCDA 2L0PA 3SG4A 1FPWA 2K8MB 2YGUA 3FE8A 4QJ3B 1OE9B 2JXCA 1JF0A 2I94A 2WCKA 1PSRA 2M1KB 2PYQA 2LVVA 1PK0D 1KFXL 2HQ8A 3S0BA 4HRHA 1HT9A 2KGRA 1SBJA 1SL9A 1JSAA 2EGDA 2VRGA 1YVHA 1FI5A 3S0EA 1IJ6A 5KU1A 5DKQA 3RZSA 4DIRA 1NX0A 1C7WA 2H61A 3Q8IA 2K7OA 2KLDA 1FW4A 1BT6A 3TUYB 3FE9A 1IJ5A 1SSEB 2CBLA 1CLBA 5JJGA 3NSLA 1DC1A 1KSOA 1JUOA 1DJZA 2CNPA 2KSPA 2P71A 2PMYA 5FI7A 4QJ5B 1QV1A 5GQQC 1CLMA 1EXRA 1DVIA 1CKKA 1C07A 1UWOA 1RROA 1J1EA 1OQPA 2CCMA 1MQ1A 2ZFDA 3CZ0A 5FYXA 2L98A 1OSAA 2JC2A 4GGFA 1MXLC 1YUSA 2BBNA 2LP2A 1SY9A 3CR5X 4FQTA 2GGZA 3CWGA 3DXLA 1Z2CB 1UHKA 3LCPC 4P5OE 2JT3A 3A4UB 1CDNA 1WY9A 1XYDA 2I2RE 3FE6A 4IL1A 1PULA 4HREE 1NSHA 3ICBA 1K90D 1WLZA 3GK1A 1TNQA 2M7NA 1ZFSA 5I2QA 1OOGA 2G9BA 2KAXA 4INWA 5K89A 4ORAB 1CB1A 4PHNA 5D69A 3SG3A 3D78A 4MVFA 1RFJA 2K61A 3SIBA 2COLB 3BQ3A 2LC5A 1DJXA 1YUUA 4JD9A 1Y1AA 1J7QA 1IG5A 5DKNA 5CSIA 1D1OA 1K9PA 2M9GA 3WHTB 3E3RA 4C0LA 2AMIA 4OZDA 3SS4A 5BPJA 4GBAA 1YRTB 1B47A 1OZSA 3EVRA 4L9MA 4A4CA 4JWQA 5AERA 2ZKMX 2WCHA 4XJKB 5HLOA 2KQYA 2KYFA 1SMGA 1W9ZA 2LVKA 1NX1A 3PJIA 4JKTA 2MLEC 3I5HC 4CFQA 1TNWA 1KQVA 2KOTA 1B1GA 3WHUB 3O78A 3DF0A 1S36A 2E6WA 2NCPA 3I5FC 1KK8B 4USLA 4INXA 2MBXA 1KFXS 3IQOA 4WRIA 3L4LA 3OB2B 2LANA 2LMVA 2PASA 3LK1A 1B8LA 3RM1A 1MXEA 3LLEA 2H61C 4JQ0D 5HLVA 2KAVA 3VB1A 2F2PA 1U5IB 2KLEA 2WC6A 3BUOB 3PSRA 4AOMA 1M46A 1F70A 3QRXA 2WOSA 5JOLA 1ALVA 1A2XA 4TNCA 5J3XA 1TN4A 1FI6A 2WNDA 1A29A 2PQLA 1DJHA 2WC5A 3D73A 1QV0A 1LS8A 2E30A 2A4JA 5CPVA 2FJYA 2M97A 1QVIY 2JXLA 3PM8A 2LCPA 2JWWA 2KFFA 3WXAA 1YRUB 3OHMB 4PALA 3OB1B 4GAOA 2MHHA 3O4YA 4ORBB 1AP4A 1NYAA 3KEVA 3L4AA 3IVTA 1CM4A 1OOJA 3D77A 2F33A 1SRAA 1J7OA 3CDNA 1OOIX 1IGVA 1VRKA 3CZ2A 4I5NB 3LK0A 4N5XA 1BJFA 1HQVA 1W7JB 2JRFA 2Y1MA 3DD4A 1K8UA 1SCMC 3GK4X 1NIWA 1MUXA 3BOWA 3HCMA 4PHJA 1AJ5A 2WC8A 2H2KA 3DF0B 2L2CA 1E8AA 2M3WA 3BUMB 1XK4A 1B8CA 1B7TZ 3CZ1A 3FWBA 3O4XA 2I7AA 1A4PA 2KFHA 4PHKA 3JTDB 2EC6B 2M0RA 1ZMZA 2JNXA 1DQEA 2LUXA 3S0AA 2F2OA 2KFGA 1TNXA 1YURA 1UUSA 2BBMA 1QTXA 3TZ1A 1S5GZ 5I8NA 3BUXB 4KYNA 1SNLA 4MZKA 1DTLA 2R2IA 2EHBA 2LMTA 3R1VA 3CZTX 1TCFA 4NQGA 3KO0A 2KAYA 2BCAA 2BCXA 4OVNF 4I5LB 2O60A 1G33A 2B1UA 4FQOA 2O5GA 1NX2A 1MWNA 1PVBA 2ERBA 3BXKA 4OR9B 4UPGA 1DF0A 2KPHA 3SG6A 5HKZA 2L4HA 4A4BA 3HX4A 2FJUB 1V1GA 3JTDC 1M31A 2EC6C 2PVBA 2K7BA 5ER5A 1YUTA 1A75A 1J1DA 1TNPA 3H4SE 3TDIA 1Y6WA 4AQJA 1KWOB 1V1FA 1XFZO 3BOWB 3CYZA 4Q04A 1TCOB 4HSZA 3DVKA 4GGNA 4MRYA 1DEKA 1OOHA 4AQIA 1NPQA 4M2QA 1CFCA 3AKBA 4FTGA 2WCLA 2M49B 1DJWA 4ETOA 4YGEB 2GV5A 3NHIA 4JPZB 4U8DA 4MEWA 1NX3A 5ER4X 1KK7Y 1LA0A 1TTXA 2MAZA 1H8BA 2LV7A 2MJWB 1SL7A 2JT0A 1NWDA 3FWCA 1YX8A 2LLUA 1OMDA 5EL2A 5DICA 2NXQA 4YBHB 3K21A 1KK7Z 1SPYA 2L5XB 1XO5A 3VGOA 2JZIA 1KWOC 1CFDA 3AKAA 4PCWA 1M45A 1NP8A 2F3YA 1KCYA 3I5HB 2JU0A 3UO9A 1CMFA 2KBIA 4BY4A 3DY9A 3NSKA
chains in the Genus database with same CATH topology
3I5FB 1ZOTB 3IF7A 2M8UA 1YVLA 4ORCB 2KI6D 1WLMA 5CSNA 3NXAA 4BY5A 1DJGA 1WDCB 1RTP1 2LMUA 3OX5A 1PVAA 3VRRA 1Y1UA 4ZCVA 2PSRA 1UURA 3D0YA 3NSOA 2JQ6A 4I5KA 1M39A 1F4OA 5DKRA 4MSPA 3SIAA 1FBVA 1XFWO 2P6BB 1S3PA 1BG1A 1CLLA 1BODA 3GOFA 3FS7A 4NDCA 2L2EA 3EK7A 1JFJA 2OS8C 5F6TA 1UHJA 1SW8A 4PE0A 1C7VA 1BR4B 2LP3A 2LLSA 1UHHA 1N0YA 2JPTA 3OX6A 2WCEA 2Y4QA 1CFFA 3JVTB 1WDCC 1QATA 3SJSA 1SCMB 1JF2A 1DT7B 1YR5A 2WCBA 1TRFA 4NDDA 2PALA 1K2HA 1L7ZA 1TIZA 1AK8A 1GGZA 1K95A 1QASA 4WQ2A 2MRDA 2M29A 2BKHB 1Q80A 4YRUA 1UHNA 5IBWA 1GQMA 4GGFC 2AUCA 5G08A 2JT8A 1TOPA 2Q4UA 1WRKA 1AUIB 5AXIA 2TN4A 4OCIA 1M63B 1QVIZ 3D0YB 3DVMA 4MZLA 5D7FA 1LA3A 1S26D 4HRGA 5CSFA 2BE6A 2K7CA 1PALA 3EKJA 1YTZC 5PALA 1BOCA 1EG3A 1SR6B 2LHIA 3JVTC 4YI9A 1AJ4A 4MRXA 1XFYO 1ALWA 5I2OA 1BR1B 2DOQA 2LAPA 1GJYA 1S1EA 4YGBB 3TS5C 1CMGA 4OKHA 2Y1NA 2Q91A 2IS9A 4GFTA 1KFUL 2BL0B 1G4YR 1LVCD 2K0JA 4P2YB 2FCEA 3IQQA 2CTNA 2GGMA 5AEQA 3LL8B 4DCKA 2BKIB 5KSZA 4MZJA 2L4IA 1OMVA 2LNKA 1K94A 3VROA 1F8HA 1XVJA 3EK4A 2L51A 1MR8A 1IQ3A 1SR6C 2NZ0A 2ZN8A 1KSMA 2RGIA 3PATA 1ZUZA 3MSEB 3OP0A 1KQMB 1QLKA 2K7DA 3BUNB 1RJVA 1IWQA 3WNXB 1QS7A 1Y1XA 1EG4A 2BL0C 1XFVO 2CXJA 2OTGB 2LLTA 2M1UA 1WRLA 2JTTA 1S6CA 3D10A 3PLFB 1CNPA 4XYNA 5B8IB 1IH0A 1SCVA 2KDHA 1RECA 3AAKA 4YI8A 2D8NA 1JWDA 3RLZA 4MN0A 3BUWB 1F55A 1BMOA 3PFVA 1N2DA 1N65A 1SL8A 4YGCB 4CIDA 3A8RA 1BF5A 2LVIA 4CLNA 2KGBC 5AFPA 1S6JA 4MBEA 1QLSA 2LE9B 1CTRA 5CSJA 3I5GC 1UHIA 1EH2A 1KQMC 1GGWA 2PRUA 4PHMA 3ZWHA 1QIVA 1EJ3A 2Y5IA 3CTNA 4GPLB 4GNKB 1XA5A 2F3ZA 1SK6D 3FIAA 5HKWA 3SG2A 2ZNEA 1PRWA 2OTGC 3I5IB 4OV2A 1K93D 3PN7C 1ZACA 2K2FA 2JTZA 1DGUA 1F4QA 3DVEA 1BU3A 1X02A 2WCFA 3KHEA 1DJIA 2OS8B 1DF0B 1OZOA 4XJKA 1B9AA 1NCYA 1ODBA 1XK4C 3CR2A 3CR4X 1UP5A 2M7LA 1R2UA 2QPTA 2KI6C 1KFUS 3CS1A 4NDBA 3C1VA 1A75B 3KPXA 5I2LA 2LHLA 2AAOA 2KNEA 2SASA 4PE1A 2V53A 2BECA 3I5IC 1H4BA 3ZNIA 1U5IA 3TUYC 1QX5B 4PDZA 1L2OB 4N1GA 3GK2A 4QJ4B 1IQ5A 4PE7A 3SG5A 1NUBA 1Y0VH 5HKYA 1F54A 1AVSA 3F45A 1R6PA 2G2BA 3AAJA 1WRZA 1XFXO 1OMRA 1MF8B 1EL4A 4ICBA 2K2AA 2MA2A 3CLNA 1SYMA 2NLNA 3PALA 3TDZA 1IRJA 3O2PA 1NCZA 1QX2A 2KHNA 3DVJA 5TNCA 3KF9A 2OPOA 2CT9A 1B4CA 1QJTA 2ZRSA 1W7IB 2BCBA 3NSIA 3TS5B 4DS7A 1RK9A 2HPSA 1F71A 1J55A 2FOTA 3TDUA 1L2OC 5AANA 2ZRTA 2JOJA 3EK8A 4MLWA 2HETA 3BYAA 4C0JA 4DUQA 2LVJA 4WQ3A 2HF5A 2ZNDA 2ISDA 1CDLA 1K96A 1AHRA 4ZCUA 1XFUO 1LINA 1S6IA 1CDPA 5KTYA 2ZN9A 1FF1A 1LKJA 3O6BA 2JULA 1NCXA 1JBAA 4GUKA 4CFRA 4F0ZB 3EKHA 4CPVA 3CGAA 1CFPA 1MHOA 2KQ6A 2SCPA 2L50A 2KBMA 4PE4A 2KI4B 2QACA 2I18A 2JNFA 1DJYA 4E68A 3VRQA 2HQWA 1KK8C 4C0KA 5HYDA 1JFKA 2F8PA 4M2PA 3VRNA 1BLQA 3EVUA 4I5JA 1CM1A 3VRPA 1B7TY 1RWYA 1K9KA 2KYCA 1J7RA 1K9UA 4DRWA 1A03A 3I5GB 1CDMA 1YX7A 1DMOA 2WORA 1B8RA 1JC2A 2MLFC 1S5GY 1PSBA 3SG7A 4YGAA 1QX7A 1QXPA 4M2OA 1IKUA 4R1EA 2KI4C 3EVVA 1SKTA 2BE4A 1DGVA 1QIWA 2LM5A 3PN7B 2LUCA 4N1FA 4YGDB 3M0WA 2NCOA 1J7PA 4D1EA 1G8IA 1LXFC 2FCDA 2L0PA 3SG4A 1FPWA 2K8MB 4QJ3B 1OE9B 2JXCA 1JF0A 2I94A 1PSRA 2M1KB 2LVVA 1PK0D 1KFXL 2HQ8A 4HRHA 1HT9A 2KGRA 1SBJA 1SL9A 1JSAA 2EGDA 2VRGA 1YVHA 1FI5A 1IJ6A 5KU1A 5DKQA 4DIRA 1NX0A 1C7WA 2H61A 2K7OA 1FW4A 1BT6A 3TUYB 1IJ5A 2CBLA 1CLBA 5JJGA 3NSLA 1KSOA 1JUOA 1DJZA 2CNPA 2KSPA 2PMYA 4QJ5B 1QV1A 5GQQC 1CLMA 1EXRA 1DVIA 1CKKA 1C07A 1UWOA 1RROA 1J1EA 1OQPA 2CCMA 1MQ1A 2ZFDA 5FYXA 2L98A 1OSAA 2JC2A 4GGFA 1MXLC 1YUSA 2BBNA 2LP2A 1SY9A 3CR5X 2GGZA 3CWGA 3LCPC 1UHKA 4P5OE 2JT3A 3A4UB 1CDNA 1WY9A 1XYDA 2I2RE 4IL1A 1PULA 4HREE 1NSHA 3ICBA 1K90D 1WLZA 3GK1A 1TNQA 2M7NA 1ZFSA 5I2QA 2G9BA 2KAXA 5K89A 4ORAB 1CB1A 4PHNA 5D69A 3SG3A 4MVFA 1RFJA 2K61A 3SIBA 2COLB 3BQ3A 2LC5A 1DJXA 1YUUA 1Y1AA 1J7QA 1IG5A 5DKNA 5CSIA 1D1OA 1K9PA 2M9GA 3WHTB 3E3RA 4C0LA 2AMIA 5BPJA 4GBAA 1YRTB 1B47A 1OZSA 3EVRA 4L9MA 4A4CA 4JWQA 5AERA 2ZKMX 4XJKB 5HLOA 2KQYA 2KYFA 1SMGA 2LVKA 1NX1A 2MLEC 3I5HC 4CFQA 1TNWA 1KQVA 2KOTA 1B1GA 3WHUB 3O78A 3DF0A 1S36A 2E6WA 2NCPA 3I5FC 1KK8B 4USLA 2MBXA 1KFXS 3IQOA 4WRIA 3OB2B 2LANA 2LMVA 2PASA 3LK1A 1B8LA 3RM1A 1MXEA 3LLEA 2H61C 4JQ0D 5HLVA 2KAVA 2F2PA 1U5IB 3BUOB 3PSRA 4AOMA 1F70A 1M46A 3QRXA 2WOSA 5JOLA 1ALVA 1A2XA 4TNCA 5J3XA 1TN4A 1FI6A 2WNDA 1A29A 1DJHA 1QV0A 2E30A 2A4JA 5CPVA 2M97A 1QVIY 2JXLA 3PM8A 2LCPA 2JWWA 2KFFA 3WXAA 1YRUB 3OHMB 4PALA 3OB1B 4GAOA 2MHHA 3O4YA 4ORBB 1AP4A 1NYAA 3KEVA 1CM4A 1OOJA 2F33A 1SRAA 1J7OA 1IGVA 1VRKA 4I5NB 3LK0A 4N5XA 1BJFA 1HQVA 1W7JB 2JRFA 2Y1MA 3DD4A 1K8UA 1SCMC 3GK4X 1NIWA 1MUXA 3BOWA 3HCMA 4PHJA 1AJ5A 2WC8A 2H2KA 3DF0B 2M3WA 1E8AA 3BUMB 1XK4A 1B8CA 1B7TZ 3FWBA 2I7AA 1A4PA 2KFHA 4PHKA 3JTDB 2EC6B 2M0RA 1ZMZA 2JNXA 2LUXA 2F2OA 2KFGA 1TNXA 1YURA 1UUSA 2BBMA 1QTXA 3TZ1A 1S5GZ 5I8NA 3BUXB 1SNLA 4MZKA 1DTLA 2R2IA 2EHBA 2LMTA 3CZTX 1TCFA 4NQGA 3KO0A 2KAYA 2BCAA 2BCXA 4OVNF 4I5LB 2O60A 1G33A 2B1UA 4FQOA 2O5GA 1NX2A 1MWNA 1PVBA 3BXKA 4OR9B 4UPGA 1DF0A 3SG6A 5HKZA 2L4HA 4A4BA 3HX4A 2FJUB 1V1GA 3JTDC 1M31A 2EC6C 2PVBA 2K7BA 5ER5A 1YUTA 1A75A 1J1DA 1TNPA 3H4SE 3TDIA 1Y6WA 4AQJA 1KWOB 1V1FA 1XFZO 3BOWB 4Q04A 1TCOB 4HSZA 3DVKA 4GGNA 4MRYA 4AQIA 1NPQA 4M2QA 1CFCA 3AKBA 4FTGA 2M49B 1DJWA 4ETOA 4YGEB 2GV5A 4JPZB 4U8DA 4MEWA 1NX3A 5ER4X 1KK7Y 1LA0A 1TTXA 2MAZA 1H8BA 2LV7A 2MJWB 1SL7A 2JT0A 1NWDA 3FWCA 1YX8A 2LLUA 1OMDA 2NXQA 4YBHB 3K21A 1KK7Z 1SPYA 2L5XB 1XO5A 3VGOA 2JZIA 1KWOC 1CFDA 3AKAA 4PCWA 1M45A 1NP8A 2F3YA 1KCYA 3I5HB 2JU0A 1CMFA 2KBIA 4BY4A 3NSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5F B;  1ZOT B;  3IF7 A;  2M8U A;  1YVL A;  4ORC B;  2KI6 D;  1WLM A;  5CSN A;  3NXA A;  4BY5 A;  1DJG A;  1WDC B;  1RTP 1;  2LMU A;  3OX5 A;  1PVA A;  3VRR A;  1Y1U A;  4ZCV A;  2PSR A;  1UUR A;  3D0Y A;  3NSO A;  2JQ6 A;  4I5K A;  1M39 A;  1F4O A;  5DKR A;  4MSP A;  3SIA A;  1FBV A;  1XFW O;  2P6B B;  1S3P A;  1BG1 A;  1CLL A;  1BOD A;  3GOF A;  3FS7 A;  4NDC A;  2L2E A;  3EK7 A;  1JFJ A;  2OS8 C;  5F6T A;  1UHJ A;  1SW8 A;  4PE0 A;  1C7V A;  1BR4 B;  2LP3 A;  2LLS A;  1UHH A;  1N0Y A;  2JPT A;  3OX6 A;  2WCE A;  2Y4Q A;  1CFF A;  3JVT B;  1WDC C;  1QAT A;  3SJS A;  1SCM B;  1JF2 A;  1DT7 B;  1YR5 A;  2WCB A;  1TRF A;  4NDD A;  2PAL A;  1K2H A;  1L7Z A;  1TIZ A;  1AK8 A;  1GGZ A;  1K95 A;  1QAS A;  4WQ2 A;  2MRD A;  2M29 A;  2BKH B;  1Q80 A;  4YRU A;  1UHN A;  5IBW A;  1GQM A;  4GGF C;  2AUC A;  5G08 A;  2JT8 A;  1TOP A;  2Q4U A;  1WRK A;  1AUI B;  5AXI A;  2TN4 A;  4OCI A;  1M63 B;  1QVI Z;  3D0Y B;  3DVM A;  4MZL A;  5D7F A;  1LA3 A;  1S26 D;  4HRG A;  5CSF A;  2BE6 A;  2K7C A;  1PAL A;  3EKJ A;  1YTZ C;  5PAL A;  1BOC A;  1EG3 A;  1SR6 B;  2LHI A;  3JVT C;  4YI9 A;  1AJ4 A;  4MRX A;  1XFY O;  1ALW A;  5I2O A;  1BR1 B;  2DOQ A;  2LAP A;  1GJY A;  1S1E A;  4YGB B;  3TS5 C;  1CMG A;  4OKH A;  2Y1N A;  2Q91 A;  2IS9 A;  4GFT A;  1KFU L;  2BL0 B;  1G4Y R;  1LVC D;  2K0J A;  4P2Y B;  2FCE A;  3IQQ A;  2CTN A;  2GGM A;  5AEQ A;  3LL8 B;  4DCK A;  2BKI B;  5KSZ A;  4MZJ A;  2L4I A;  1OMV A;  2LNK A;  1K94 A;  3VRO A;  1F8H A;  1XVJ A;  3EK4 A;  2L51 A;  1MR8 A;  1IQ3 A;  1SR6 C;  2NZ0 A;  2ZN8 A;  1KSM A;  2RGI A;  3PAT A;  1ZUZ A;  3MSE B;  3OP0 A;  1KQM B;  1QLK A;  2K7D A;  3BUN B;  1RJV A;  1IWQ A;  3WNX B;  1QS7 A;  1Y1X A;  1EG4 A;  2BL0 C;  1XFV O;  2CXJ A;  2OTG B;  2LLT A;  2M1U A;  1WRL A;  2JTT A;  1S6C A;  3D10 A;  3PLF B;  1CNP A;  4XYN A;  5B8I B;  1IH0 A;  1SCV A;  2KDH A;  1REC A;  3AAK A;  4YI8 A;  2D8N A;  1JWD A;  3RLZ A;  4MN0 A;  3BUW B;  1F55 A;  1BMO A;  3PFV A;  1N2D A;  1N65 A;  1SL8 A;  4YGC B;  4CID A;  3A8R A;  1BF5 A;  2LVI A;  4CLN A;  2KGB C;  5AFP A;  1S6J A;  4MBE A;  1QLS A;  2LE9 B;  1CTR A;  5CSJ A;  3I5G C;  1UHI A;  1EH2 A;  1KQM C;  1GGW A;  2PRU A;  4PHM A;  3ZWH A;  1QIV A;  1EJ3 A;  2Y5I A;  3CTN A;  4GPL B;  4GNK B;  1XA5 A;  2F3Z A;  1SK6 D;  3FIA A;  5HKW A;  3SG2 A;  2ZNE A;  1PRW A;  2OTG C;  3I5I B;  4OV2 A;  1K93 D;  3PN7 C;  1ZAC A;  2K2F A;  2JTZ A;  1DGU A;  1F4Q A;  3DVE A;  1BU3 A;  1X02 A;  2WCF A;  3KHE A;  1DJI A;  2OS8 B;  1DF0 B;  1OZO A;  4XJK A;  1B9A A;  1NCY A;  1ODB A;  1XK4 C;  3CR2 A;  3CR4 X;  1UP5 A;  2M7L A;  1R2U A;  2QPT A;  2KI6 C;  1KFU S;  3CS1 A;  4NDB A;  3C1V A;  1A75 B;  3KPX A;  5I2L A;  2LHL A;  2AAO A;  2KNE A;  2SAS A;  4PE1 A;  2V53 A;  2BEC A;  3I5I C;  1H4B A;  3ZNI A;  1U5I A;  3TUY C;  1QX5 B;  4PDZ A;  1L2O B;  4N1G A;  3GK2 A;  4QJ4 B;  1IQ5 A;  4PE7 A;  3SG5 A;  1NUB A;  1Y0V H;  5HKY A;  1F54 A;  1AVS A;  3F45 A;  1R6P A;  2G2B A;  3AAJ A;  1WRZ A;  1XFX O;  1OMR A;  1MF8 B;  1EL4 A;  4ICB A;  2K2A A;  2MA2 A;  3CLN A;  1SYM A;  2NLN A;  3PAL A;  3TDZ A;  1IRJ A;  3O2P A;  1NCZ A;  1QX2 A;  2KHN A;  3DVJ A;  5TNC A;  3KF9 A;  2OPO A;  2CT9 A;  1B4C A;  1QJT A;  2ZRS A;  1W7I B;  2BCB A;  3NSI A;  3TS5 B;  4DS7 A;  1RK9 A;  2HPS A;  1F71 A;  1J55 A;  2FOT A;  3TDU A;  1L2O C;  5AAN A;  2ZRT A;  2JOJ A;  3EK8 A;  4MLW A;  2HET A;  3BYA A;  4C0J A;  4DUQ A;  2LVJ A;  4WQ3 A;  2HF5 A;  2ZND A;  2ISD A;  1CDL A;  1K96 A;  1AHR A;  4ZCU A;  1XFU O;  1LIN A;  1S6I A;  1CDP A;  5KTY A;  2ZN9 A;  1FF1 A;  1LKJ A;  3O6B A;  2JUL A;  1NCX A;  1JBA A;  4GUK A;  4CFR A;  4F0Z B;  3EKH A;  4CPV A;  3CGA A;  1CFP A;  1MHO A;  2KQ6 A;  2SCP A;  2L50 A;  2KBM A;  4PE4 A;  2KI4 B;  2QAC A;  2I18 A;  2JNF A;  1DJY A;  4E68 A;  3VRQ A;  2HQW A;  1KK8 C;  4C0K A;  5HYD A;  1JFK A;  2F8P A;  4M2P A;  3VRN A;  1BLQ A;  3EVU A;  4I5J A;  1CM1 A;  3VRP A;  1B7T Y;  1RWY A;  1K9K A;  2KYC A;  1J7R A;  1K9U A;  4DRW A;  1A03 A;  3I5G B;  1CDM A;  1YX7 A;  1DMO A;  2WOR A;  1B8R A;  1JC2 A;  2MLF C;  1S5G Y;  1PSB A;  3SG7 A;  4YGA A;  1QX7 A;  1QXP A;  4M2O A;  1IKU A;  4R1E A;  2KI4 C;  3EVV A;  1SKT A;  2BE4 A;  1DGV A;  1QIW A;  2LM5 A;  3PN7 B;  2LUC A;  4N1F A;  4YGD B;  3M0W A;  2NCO A;  1J7P A;  4D1E A;  1G8I A;  1LXF C;  2FCD A;  2L0P A;  3SG4 A;  1FPW A;  2K8M B;  4QJ3 B;  1OE9 B;  2JXC A;  1JF0 A;  2I94 A;  1PSR A;  2M1K B;  2LVV A;  1PK0 D;  1KFX L;  2HQ8 A;  4HRH A;  1HT9 A;  2KGR A;  1SBJ A;  1SL9 A;  1JSA A;  2EGD A;  2VRG A;  1YVH A;  1FI5 A;  1IJ6 A;  5KU1 A;  5DKQ A;  4DIR A;  1NX0 A;  1C7W A;  2H61 A;  2K7O A;  1FW4 A;  1BT6 A;  3TUY B;  1IJ5 A;  2CBL A;  1CLB A;  5JJG A;  3NSL A;  1KSO A;  1JUO A;  1DJZ A;  2CNP A;  2KSP A;  2PMY A;  4QJ5 B;  1QV1 A;  5GQQ C;  1CLM A;  1EXR A;  1DVI A;  1CKK A;  1C07 A;  1UWO A;  1RRO A;  1J1E A;  1OQP A;  2CCM A;  1MQ1 A;  2ZFD A;  5FYX A;  2L98 A;  1OSA A;  2JC2 A;  4GGF A;  1MXL C;  1YUS A;  2BBN A;  2LP2 A;  1SY9 A;  3CR5 X;  2GGZ A;  3CWG A;  3LCP C;  1UHK A;  4P5O E;  2JT3 A;  3A4U B;  1CDN A;  1WY9 A;  1XYD A;  2I2R E;  4IL1 A;  1PUL A;  4HRE E;  1NSH A;  3ICB A;  1K90 D;  1WLZ A;  3GK1 A;  1TNQ A;  2M7N A;  1ZFS A;  5I2Q A;  2G9B A;  2KAX A;  5K89 A;  4ORA B;  1CB1 A;  4PHN A;  5D69 A;  3SG3 A;  4MVF A;  1RFJ A;  2K61 A;  3SIB A;  2COL B;  3BQ3 A;  2LC5 A;  1DJX A;  1YUU A;  1Y1A A;  1J7Q A;  1IG5 A;  5DKN A;  5CSI A;  1D1O A;  1K9P A;  2M9G A;  3WHT B;  3E3R A;  4C0L A;  2AMI A;  5BPJ A;  4GBA A;  1YRT B;  1B47 A;  1OZS A;  3EVR A;  4L9M A;  4A4C A;  4JWQ A;  5AER A;  2ZKM X;  4XJK B;  5HLO A;  2KQY A;  2KYF A;  1SMG A;  2LVK A;  1NX1 A;  2MLE C;  3I5H C;  4CFQ A;  1TNW A;  1KQV A;  2KOT A;  1B1G A;  3WHU B;  3O78 A;  3DF0 A;  1S36 A;  2E6W A;  2NCP A;  3I5F C;  1KK8 B;  4USL A;  2MBX A;  1KFX S;  3IQO A;  4WRI A;  3OB2 B;  2LAN A;  2LMV A;  2PAS A;  3LK1 A;  1B8L A;  3RM1 A;  1MXE A;  3LLE A;  2H61 C;  4JQ0 D;  5HLV A;  2KAV A;  2F2P A;  1U5I B;  3BUO B;  3PSR A;  4AOM A;  1F70 A;  1M46 A;  3QRX A;  2WOS A;  5JOL A;  1ALV A;  1A2X A;  4TNC A;  5J3X A;  1TN4 A;  1FI6 A;  2WND A;  1A29 A;  1DJH A;  1QV0 A;  2E30 A;  2A4J A;  5CPV A;  2M97 A;  1QVI Y;  2JXL A;  3PM8 A;  2LCP A;  2JWW A;  2KFF A;  3WXA A;  1YRU B;  3OHM B;  4PAL A;  3OB1 B;  4GAO A;  2MHH A;  3O4Y A;  4ORB B;  1AP4 A;  1NYA A;  3KEV A;  1CM4 A;  1OOJ A;  2F33 A;  1SRA A;  1J7O A;  1IGV A;  1VRK A;  4I5N B;  3LK0 A;  4N5X A;  1BJF A;  1HQV A;  1W7J B;  2JRF A;  2Y1M A;  3DD4 A;  1K8U A;  1SCM C;  3GK4 X;  1NIW A;  1MUX A;  3BOW A;  3HCM A;  4PHJ A;  1AJ5 A;  2WC8 A;  2H2K A;  3DF0 B;  2M3W A;  1E8A A;  3BUM B;  1XK4 A;  1B8C A;  1B7T Z;  3FWB A;  2I7A A;  1A4P A;  2KFH A;  4PHK A;  3JTD B;  2EC6 B;  2M0R A;  1ZMZ A;  2JNX A;  2LUX A;  2F2O A;  2KFG A;  1TNX A;  1YUR A;  1UUS A;  2BBM A;  1QTX A;  3TZ1 A;  1S5G Z;  5I8N A;  3BUX B;  1SNL A;  4MZK A;  1DTL A;  2R2I A;  2EHB A;  2LMT A;  3CZT X;  1TCF A;  4NQG A;  3KO0 A;  2KAY A;  2BCA A;  2BCX A;  4OVN F;  4I5L B;  2O60 A;  1G33 A;  2B1U A;  4FQO A;  2O5G A;  1NX2 A;  1MWN A;  1PVB A;  3BXK A;  4OR9 B;  4UPG A;  1DF0 A;  3SG6 A;  5HKZ A;  2L4H A;  4A4B A;  3HX4 A;  2FJU B;  1V1G A;  3JTD C;  1M31 A;  2EC6 C;  2PVB A;  2K7B A;  5ER5 A;  1YUT A;  1A75 A;  1J1D A;  1TNP A;  3H4S E;  3TDI A;  1Y6W A;  4AQJ A;  1KWO B;  1V1F A;  1XFZ O;  3BOW B;  4Q04 A;  1TCO B;  4HSZ A;  3DVK A;  4GGN A;  4MRY A;  4AQI A;  1NPQ A;  4M2Q A;  1CFC A;  3AKB A;  4FTG A;  2M49 B;  1DJW A;  4ETO A;  4YGE B;  2GV5 A;  4JPZ B;  4U8D A;  4MEW A;  1NX3 A;  5ER4 X;  1KK7 Y;  1LA0 A;  1TTX A;  2MAZ A;  1H8B A;  2LV7 A;  2MJW B;  1SL7 A;  2JT0 A;  1NWD A;  3FWC A;  1YX8 A;  2LLU A;  1OMD A;  2NXQ A;  4YBH B;  3K21 A;  1KK7 Z;  1SPY A;  2L5X B;  1XO5 A;  3VGO A;  2JZI A;  1KWO C;  1CFD A;  3AKA A;  4PCW A;  1M45 A;  1NP8 A;  2F3Y A;  1KCY A;  3I5H B;  2JU0 A;  1CMF A;  2KBI A;  4BY4 A;  3NSK A; 
#chains in the Genus database with same CATH topology
 3I5F B;  1ZOT B;  3CAB A;  3IF7 A;  2M8U A;  1YVL A;  4ORC B;  2KI6 D;  3NHT A;  1WLM A;  5CSN A;  3NXA A;  4BY5 A;  1DJG A;  1WDC B;  1RTP 1;  2LMU A;  3OX5 A;  3BJH A;  1PVA A;  3VRR A;  1Y1U A;  4ZCV A;  2PSR A;  1UUR A;  3D0Y A;  3NSO A;  2JQ6 A;  4I5K A;  1M39 A;  1F4O A;  5DKR A;  4MSP A;  3SIA A;  1FBV A;  1XFW O;  2P6B B;  1S3P A;  1BG1 A;  1CLL A;  2QEV A;  1BOD A;  3GOF A;  3FS7 A;  4NDC A;  2L2E A;  3EK7 A;  1JFJ A;  3BFH A;  2OS8 C;  5F6T A;  1UHJ A;  3BFA A;  1SW8 A;  4PE0 A;  4PT1 A;  1C7V A;  1BR4 B;  2LP3 A;  2LLS A;  1UHH A;  2H8V A;  1N0Y A;  2JPT A;  3OX6 A;  2WCE A;  2QEO A;  1QWV A;  2Y4Q A;  3JVT B;  1CFF A;  1WDC C;  1QAT A;  3SJS A;  1SCM B;  1JF2 A;  2WCJ A;  1DT7 B;  1YR5 A;  3V2L A;  2WCB A;  1TRF A;  4NDD A;  2PAL A;  1K2H A;  1L7Z A;  1TIZ A;  2L5Y A;  1AK8 A;  1GGZ A;  1K95 A;  1QAS A;  4WQ2 A;  2MRD A;  2M29 A;  3B88 A;  2BKH B;  1Q80 A;  4YRU A;  1UHN A;  5IBW A;  1GQM A;  5HL1 A;  4GGF C;  2AUC A;  5G08 A;  2JT8 A;  1TOP A;  2Q4U A;  1WRK A;  5FI6 A;  1AUI B;  5AXI A;  2TN4 A;  4OCI A;  1M63 B;  1QVI Z;  3D0Y B;  3DVM A;  4MZL A;  5D7F A;  1LA3 A;  1S26 D;  4HRG A;  5CSF A;  2BE6 A;  1TUZ A;  2K7C A;  1PAL A;  3EKJ A;  1YTZ C;  5PAL A;  1BOC A;  1EG3 A;  1SR6 B;  2LHI A;  3JVT C;  4YI9 A;  1AJ4 A;  4MRX A;  1XFY O;  1ALW A;  5I2O A;  1BR1 B;  2DOQ A;  2LAP A;  1GJY A;  1S1E A;  4YGB B;  3TS5 C;  1CMG A;  4OKH A;  2Y1N A;  2Q91 A;  2IS9 A;  4GFT A;  1KFU L;  3QME A;  2BL0 B;  1G4Y R;  1LVC D;  2K0J A;  2WCM A;  2FCE A;  4P2Y B;  3IQQ A;  2CTN A;  2GGM A;  5AEQ A;  3LL8 B;  4DCK A;  2BKI B;  5KSZ A;  4MZJ A;  2L4I A;  1OMV A;  3S0F A;  3NGV A;  1C3Z A;  3L47 A;  2LNK A;  1K94 A;  3VRO A;  1F8H A;  1XVJ A;  3B7A A;  3EK4 A;  2L51 A;  1MR8 A;  1IQ3 A;  1SR6 C;  2NZ0 A;  2ZN8 A;  1KSM A;  2RGI A;  3PAT A;  1ZUZ A;  3MSE B;  3OP0 A;  1KQM B;  1QLK A;  2K7D A;  3BUN B;  1RJV A;  1IWQ A;  3WNX B;  1TUJ A;  1DEL A;  1IIO A;  1QS7 A;  1Y1X A;  1EG4 A;  2BL0 C;  1XFV O;  2CXJ A;  2OTG B;  3B6X A;  2LLT A;  2M1U A;  1WRL A;  2JTT A;  1S6C A;  3D10 A;  3PLF B;  5D3O A;  1CNP A;  4XYN A;  3B86 A;  5FI2 A;  1SCV A;  5B8I B;  1IH0 A;  2KDH A;  1REC A;  3AAK A;  4YI8 A;  2D8N A;  1JWD A;  3RLZ A;  4MN0 A;  3BUW B;  1F55 A;  1BMO A;  3N7H A;  1N2D A;  1N65 A;  1SL8 A;  3PFV A;  4YGC B;  4CID A;  3A8R A;  3R72 A;  1BF5 A;  2LVI A;  4CLN A;  2KGB C;  5AFP A;  1S6J A;  4MBE A;  1QLS A;  2LE9 B;  1CTR A;  5CSJ A;  3I5G C;  1UHI A;  1EH2 A;  1KQM C;  1GGW A;  2PRU A;  4PHM A;  3ZWH A;  1QIV A;  1EJ3 A;  2Y5I A;  3CTN A;  3PM2 A;  4GPL B;  1XA5 A;  2F3Z A;  1SK6 D;  3FIA A;  4GNK B;  3SG2 A;  2ZNE A;  1PRW A;  2OTG C;  3I5I B;  4OV2 A;  4F7F A;  3SS5 A;  1K93 D;  3PN7 C;  1ZAC A;  2K2F A;  2JTZ A;  3BFB A;  1DGU A;  1F4Q A;  3DVE A;  1BU3 A;  1X02 A;  2WCF A;  3KHE A;  1DJI A;  1TWO A;  2OS8 B;  1DF0 B;  1OZO A;  4XJK A;  1B9A A;  1NCY A;  1ODB A;  1XK4 C;  3CR2 A;  3S0G A;  3CR4 X;  1UP5 A;  2M7L A;  1R2U A;  2QPT A;  2KI6 C;  1C3Y A;  1KFU S;  2QEB A;  3CS1 A;  4NDB A;  2BNX A;  3C1V A;  1A75 B;  3KPX A;  5I2L A;  2LHL A;  2AAO A;  2KNE A;  2SAS A;  4PE1 A;  2V53 A;  2BEC A;  3I5I C;  1H4B A;  3ZNI A;  1U5I A;  3TUY C;  1QX5 B;  3R1O A;  4PDZ A;  4IJ7 A;  3B87 A;  1L2O B;  4N1G A;  3GK2 A;  4QJ4 B;  3OGN A;  1GM0 A;  1IQ5 A;  4PE7 A;  3SG5 A;  1NUB A;  1Y0V H;  5HKY A;  1F54 A;  1AVS A;  3F45 A;  1R6P A;  2G2B A;  3AAJ A;  1WRZ A;  1XFX O;  1OMR A;  2JPO A;  1MF8 B;  1EL4 A;  1Z4H A;  2BAP A;  4ICB A;  3S0D A;  2K2A A;  2MA2 A;  3CLN A;  1SYM A;  2NLN A;  3PAL A;  3TDZ A;  1IRJ A;  3R1P A;  3O2P A;  1NCZ A;  3D74 A;  1QX2 A;  2KHN A;  3DVJ A;  5TNC A;  3KF9 A;  2OPO A;  2CT9 A;  1B4C A;  1QJT A;  2ZRS A;  1W7I B;  2BCB A;  3DZT A;  3NSI A;  3TS5 B;  4DS7 A;  1RK9 A;  2HPS A;  1F71 A;  1J55 A;  2FOT A;  3TDU A;  1L2O C;  2QDI A;  5AAN A;  1OW4 A;  2ZRT A;  2JOJ A;  3EK8 A;  4MLW A;  2HET A;  3BYA A;  4C0J A;  4DUQ A;  2LVJ A;  3D76 A;  4WQ3 A;  2HF5 A;  2ZND A;  2ISD A;  1CDL A;  1K96 A;  1AHR A;  3D75 A;  4ZCU A;  1XFU O;  1P28 A;  1LIN A;  1S6I A;  1CDP A;  3UNW A;  2ZN9 A;  5KTY A;  5I94 A;  1FF1 A;  1LKJ A;  3O6B A;  2JUL A;  1NCX A;  3EG5 B;  1JBA A;  4GUK A;  1XFR A;  4CFR A;  4F0Z B;  3EKH A;  1T14 A;  4CPV A;  3CGA A;  1CFP A;  1MHO A;  2KQ6 A;  2SCP A;  2L50 A;  2KBM A;  4PE4 A;  2KI4 B;  2QAC A;  2I18 A;  2JNF A;  1DJY A;  4E68 A;  3VRQ A;  2HQW A;  1KK8 C;  4C0K A;  5HYD A;  1JFK A;  2F8P A;  4M2P A;  3VRN A;  1BLQ A;  3EVU A;  4I5J A;  1CM1 A;  3VRP A;  3OBV A;  1B7T Y;  1RWY A;  1K9K A;  2KYC A;  3SS3 A;  1J7R A;  1K9U A;  2P70 A;  4DRW A;  1A03 A;  3I5G B;  1CDM A;  1YX7 A;  1DMO A;  2WOR A;  2QEH A;  3K1E A;  1B8R A;  1JC2 A;  2MLF C;  1S5G Y;  1PSB A;  3SG7 A;  4YGA A;  1QX7 A;  1QXP A;  4M2O A;  1IKU A;  3DYE A;  4R1E A;  2KI4 C;  3EVV A;  1SKT A;  2BE4 A;  1DGV A;  1QIW A;  1OOF A;  2LM5 A;  3PN7 B;  2LUC A;  4N1F A;  4YGD B;  3M0W A;  2NCO A;  2K60 A;  1J7P A;  2GTE A;  4D1E A;  5HKW A;  1ORG A;  1G8I A;  1LXF C;  2FCD A;  2L0P A;  3SG4 A;  1FPW A;  2K8M B;  2YGU A;  3FE8 A;  4QJ3 B;  1OE9 B;  2JXC A;  1JF0 A;  2I94 A;  2WCK A;  1PSR A;  2M1K B;  2PYQ A;  2LVV A;  1PK0 D;  1KFX L;  2HQ8 A;  3S0B A;  4HRH A;  1HT9 A;  2KGR A;  1SBJ A;  1SL9 A;  1JSA A;  2EGD A;  2VRG A;  1YVH A;  1FI5 A;  3S0E A;  1IJ6 A;  5KU1 A;  5DKQ A;  3RZS A;  4DIR A;  1NX0 A;  1C7W A;  2H61 A;  3Q8I A;  2K7O A;  2KLD A;  1FW4 A;  1BT6 A;  3TUY B;  3FE9 A;  1IJ5 A;  1SSE B;  2CBL A;  1CLB A;  5JJG A;  3NSL A;  1DC1 A;  1KSO A;  1JUO A;  1DJZ A;  2CNP A;  2KSP A;  2P71 A;  2PMY A;  5FI7 A;  4QJ5 B;  1QV1 A;  5GQQ C;  1CLM A;  1EXR A;  1DVI A;  1CKK A;  1C07 A;  1UWO A;  1RRO A;  1J1E A;  1OQP A;  2CCM A;  1MQ1 A;  2ZFD A;  3CZ0 A;  5FYX A;  2L98 A;  1OSA A;  2JC2 A;  4GGF A;  1MXL C;  1YUS A;  2BBN A;  2LP2 A;  1SY9 A;  3CR5 X;  4FQT A;  2GGZ A;  3CWG A;  3DXL A;  1Z2C B;  1UHK A;  3LCP C;  4P5O E;  2JT3 A;  3A4U B;  1CDN A;  1WY9 A;  1XYD A;  2I2R E;  3FE6 A;  4IL1 A;  1PUL A;  4HRE E;  1NSH A;  3ICB A;  1K90 D;  1WLZ A;  3GK1 A;  1TNQ A;  2M7N A;  1ZFS A;  5I2Q A;  1OOG A;  2G9B A;  2KAX A;  4INW A;  5K89 A;  4ORA B;  1CB1 A;  4PHN A;  5D69 A;  3SG3 A;  3D78 A;  4MVF A;  1RFJ A;  2K61 A;  3SIB A;  2COL B;  3BQ3 A;  2LC5 A;  1DJX A;  1YUU A;  4JD9 A;  1Y1A A;  1J7Q A;  1IG5 A;  5DKN A;  5CSI A;  1D1O A;  1K9P A;  2M9G A;  3WHT B;  3E3R A;  4C0L A;  2AMI A;  4OZD A;  3SS4 A;  5BPJ A;  4GBA A;  1YRT B;  1B47 A;  1OZS A;  3EVR A;  4L9M A;  4A4C A;  4JWQ A;  5AER A;  2ZKM X;  2WCH A;  4XJK B;  5HLO A;  2KQY A;  2KYF A;  1SMG A;  1W9Z A;  2LVK A;  1NX1 A;  3PJI A;  4JKT A;  2MLE C;  3I5H C;  4CFQ A;  1TNW A;  1KQV A;  2KOT A;  1B1G A;  3WHU B;  3O78 A;  3DF0 A;  1S36 A;  2E6W A;  2NCP A;  3I5F C;  1KK8 B;  4USL A;  4INX A;  2MBX A;  1KFX S;  3IQO A;  4WRI A;  3L4L A;  3OB2 B;  2LAN A;  2LMV A;  2PAS A;  3LK1 A;  1B8L A;  3RM1 A;  1MXE A;  3LLE A;  2H61 C;  4JQ0 D;  5HLV A;  2KAV A;  3VB1 A;  2F2P A;  1U5I B;  2KLE A;  2WC6 A;  3BUO B;  3PSR A;  4AOM A;  1M46 A;  1F70 A;  3QRX A;  2WOS A;  5JOL A;  1ALV A;  1A2X A;  4TNC A;  5J3X A;  1TN4 A;  1FI6 A;  2WND A;  1A29 A;  2PQL A;  1DJH A;  2WC5 A;  3D73 A;  1QV0 A;  1LS8 A;  2E30 A;  2A4J A;  5CPV A;  2FJY A;  2M97 A;  1QVI Y;  2JXL A;  3PM8 A;  2LCP A;  2JWW A;  2KFF A;  3WXA A;  1YRU B;  3OHM B;  4PAL A;  3OB1 B;  4GAO A;  2MHH A;  3O4Y A;  4ORB B;  1AP4 A;  1NYA A;  3KEV A;  3L4A A;  3IVT A;  1CM4 A;  1OOJ A;  3D77 A;  2F33 A;  1SRA A;  1J7O A;  3CDN A;  1OOI X;  1IGV A;  1VRK A;  3CZ2 A;  4I5N B;  3LK0 A;  4N5X A;  1BJF A;  1HQV A;  1W7J B;  2JRF A;  2Y1M A;  3DD4 A;  1K8U A;  1SCM C;  3GK4 X;  1NIW A;  1MUX A;  3BOW A;  3HCM A;  4PHJ A;  1AJ5 A;  2WC8 A;  2H2K A;  3DF0 B;  2L2C A;  1E8A A;  2M3W A;  3BUM B;  1XK4 A;  1B8C A;  1B7T Z;  3CZ1 A;  3FWB A;  3O4X A;  2I7A A;  1A4P A;  2KFH A;  4PHK A;  3JTD B;  2EC6 B;  2M0R A;  1ZMZ A;  2JNX A;  1DQE A;  2LUX A;  3S0A A;  2F2O A;  2KFG A;  1TNX A;  1YUR A;  1UUS A;  2BBM A;  1QTX A;  3TZ1 A;  1S5G Z;  5I8N A;  3BUX B;  4KYN A;  1SNL A;  4MZK A;  1DTL A;  2R2I A;  2EHB A;  2LMT A;  3R1V A;  3CZT X;  1TCF A;  4NQG A;  3KO0 A;  2KAY A;  2BCA A;  2BCX A;  4OVN F;  4I5L B;  2O60 A;  1G33 A;  2B1U A;  4FQO A;  2O5G A;  1NX2 A;  1MWN A;  1PVB A;  2ERB A;  3BXK A;  4OR9 B;  4UPG A;  1DF0 A;  2KPH A;  3SG6 A;  5HKZ A;  2L4H A;  4A4B A;  3HX4 A;  2FJU B;  1V1G A;  3JTD C;  1M31 A;  2EC6 C;  2PVB A;  2K7B A;  5ER5 A;  1YUT A;  1A75 A;  1J1D A;  1TNP A;  3H4S E;  3TDI A;  1Y6W A;  4AQJ A;  1KWO B;  1V1F A;  1XFZ O;  3BOW B;  3CYZ A;  4Q04 A;  1TCO B;  4HSZ A;  3DVK A;  4GGN A;  4MRY A;  1DEK A;  1OOH A;  4AQI A;  1NPQ A;  4M2Q A;  1CFC A;  3AKB A;  4FTG A;  2WCL A;  2M49 B;  1DJW A;  4ETO A;  4YGE B;  2GV5 A;  3NHI A;  4JPZ B;  4U8D A;  4MEW A;  1NX3 A;  5ER4 X;  1KK7 Y;  1LA0 A;  1TTX A;  2MAZ A;  1H8B A;  2LV7 A;  2MJW B;  1SL7 A;  2JT0 A;  1NWD A;  3FWC A;  1YX8 A;  2LLU A;  1OMD A;  5EL2 A;  5DIC A;  2NXQ A;  4YBH B;  3K21 A;  1KK7 Z;  1SPY A;  2L5X B;  1XO5 A;  3VGO A;  2JZI A;  1KWO C;  1CFD A;  3AKA A;  4PCW A;  1M45 A;  1NP8 A;  2F3Y A;  1KCY A;  3I5H B;  2JU0 A;  3UO9 A;  1CMF A;  2KBI A;  4BY4 A;  3DY9 A;  3NSK A; 
#chains in the Genus database with same CATH homology
 3I5F B;  1ZOT B;  3IF7 A;  2M8U A;  1YVL A;  4ORC B;  2KI6 D;  1WLM A;  5CSN A;  3NXA A;  4BY5 A;  1DJG A;  1WDC B;  1RTP 1;  2LMU A;  3OX5 A;  1PVA A;  3VRR A;  1Y1U A;  4ZCV A;  2PSR A;  1UUR A;  3D0Y A;  3NSO A;  2JQ6 A;  4I5K A;  1M39 A;  1F4O A;  5DKR A;  4MSP A;  3SIA A;  1FBV A;  1XFW O;  2P6B B;  1S3P A;  1BG1 A;  1CLL A;  1BOD A;  3GOF A;  3FS7 A;  4NDC A;  2L2E A;  3EK7 A;  1JFJ A;  2OS8 C;  5F6T A;  1UHJ A;  1SW8 A;  4PE0 A;  1C7V A;  1BR4 B;  2LP3 A;  2LLS A;  1UHH A;  1N0Y A;  2JPT A;  3OX6 A;  2WCE A;  2Y4Q A;  1CFF A;  3JVT B;  1WDC C;  1QAT A;  3SJS A;  1SCM B;  1JF2 A;  1DT7 B;  1YR5 A;  2WCB A;  1TRF A;  4NDD A;  2PAL A;  1K2H A;  1L7Z A;  1TIZ A;  1AK8 A;  1GGZ A;  1K95 A;  1QAS A;  4WQ2 A;  2MRD A;  2M29 A;  2BKH B;  1Q80 A;  4YRU A;  1UHN A;  5IBW A;  1GQM A;  4GGF C;  2AUC A;  5G08 A;  2JT8 A;  1TOP A;  2Q4U A;  1WRK A;  1AUI B;  5AXI A;  2TN4 A;  4OCI A;  1M63 B;  1QVI Z;  3D0Y B;  3DVM A;  4MZL A;  5D7F A;  1LA3 A;  1S26 D;  4HRG A;  5CSF A;  2BE6 A;  2K7C A;  1PAL A;  3EKJ A;  1YTZ C;  5PAL A;  1BOC A;  1EG3 A;  1SR6 B;  2LHI A;  3JVT C;  4YI9 A;  1AJ4 A;  4MRX A;  1XFY O;  1ALW A;  5I2O A;  1BR1 B;  2DOQ A;  2LAP A;  1GJY A;  1S1E A;  4YGB B;  3TS5 C;  1CMG A;  4OKH A;  2Y1N A;  2Q91 A;  2IS9 A;  4GFT A;  1KFU L;  2BL0 B;  1G4Y R;  1LVC D;  2K0J A;  4P2Y B;  2FCE A;  3IQQ A;  2CTN A;  2GGM A;  5AEQ A;  3LL8 B;  4DCK A;  2BKI B;  5KSZ A;  4MZJ A;  2L4I A;  1OMV A;  2LNK A;  1K94 A;  3VRO A;  1F8H A;  1XVJ A;  3EK4 A;  2L51 A;  1MR8 A;  1IQ3 A;  1SR6 C;  2NZ0 A;  2ZN8 A;  1KSM A;  2RGI A;  3PAT A;  1ZUZ A;  3MSE B;  3OP0 A;  1KQM B;  1QLK A;  2K7D A;  3BUN B;  1RJV A;  1IWQ A;  3WNX B;  1QS7 A;  1Y1X A;  1EG4 A;  2BL0 C;  1XFV O;  2CXJ A;  2OTG B;  2LLT A;  2M1U A;  1WRL A;  2JTT A;  1S6C A;  3D10 A;  3PLF B;  1CNP A;  4XYN A;  5B8I B;  1IH0 A;  1SCV A;  2KDH A;  1REC A;  3AAK A;  4YI8 A;  2D8N A;  1JWD A;  3RLZ A;  4MN0 A;  3BUW B;  1F55 A;  1BMO A;  3PFV A;  1N2D A;  1N65 A;  1SL8 A;  4YGC B;  4CID A;  3A8R A;  1BF5 A;  2LVI A;  4CLN A;  2KGB C;  5AFP A;  1S6J A;  4MBE A;  1QLS A;  2LE9 B;  1CTR A;  5CSJ A;  3I5G C;  1UHI A;  1EH2 A;  1KQM C;  1GGW A;  2PRU A;  4PHM A;  3ZWH A;  1QIV A;  1EJ3 A;  2Y5I A;  3CTN A;  4GPL B;  4GNK B;  1XA5 A;  2F3Z A;  1SK6 D;  3FIA A;  5HKW A;  3SG2 A;  2ZNE A;  1PRW A;  2OTG C;  3I5I B;  4OV2 A;  1K93 D;  3PN7 C;  1ZAC A;  2K2F A;  2JTZ A;  1DGU A;  1F4Q A;  3DVE A;  1BU3 A;  1X02 A;  2WCF A;  3KHE A;  1DJI A;  2OS8 B;  1DF0 B;  1OZO A;  4XJK A;  1B9A A;  1NCY A;  1ODB A;  1XK4 C;  3CR2 A;  3CR4 X;  1UP5 A;  2M7L A;  1R2U A;  2QPT A;  2KI6 C;  1KFU S;  3CS1 A;  4NDB A;  3C1V A;  1A75 B;  3KPX A;  5I2L A;  2LHL A;  2AAO A;  2KNE A;  2SAS A;  4PE1 A;  2V53 A;  2BEC A;  3I5I C;  1H4B A;  3ZNI A;  1U5I A;  3TUY C;  1QX5 B;  4PDZ A;  1L2O B;  4N1G A;  3GK2 A;  4QJ4 B;  1IQ5 A;  4PE7 A;  3SG5 A;  1NUB A;  1Y0V H;  5HKY A;  1F54 A;  1AVS A;  3F45 A;  1R6P A;  2G2B A;  3AAJ A;  1WRZ A;  1XFX O;  1OMR A;  1MF8 B;  1EL4 A;  4ICB A;  2K2A A;  2MA2 A;  3CLN A;  1SYM A;  2NLN A;  3PAL A;  3TDZ A;  1IRJ A;  3O2P A;  1NCZ A;  1QX2 A;  2KHN A;  3DVJ A;  5TNC A;  3KF9 A;  2OPO A;  2CT9 A;  1B4C A;  1QJT A;  2ZRS A;  1W7I B;  2BCB A;  3NSI A;  3TS5 B;  4DS7 A;  1RK9 A;  2HPS A;  1F71 A;  1J55 A;  2FOT A;  3TDU A;  1L2O C;  5AAN A;  2ZRT A;  2JOJ A;  3EK8 A;  4MLW A;  2HET A;  3BYA A;  4C0J A;  4DUQ A;  2LVJ A;  4WQ3 A;  2HF5 A;  2ZND A;  2ISD A;  1CDL A;  1K96 A;  1AHR A;  4ZCU A;  1XFU O;  1LIN A;  1S6I A;  1CDP A;  5KTY A;  2ZN9 A;  1FF1 A;  1LKJ A;  3O6B A;  2JUL A;  1NCX A;  1JBA A;  4GUK A;  4CFR A;  4F0Z B;  3EKH A;  4CPV A;  3CGA A;  1CFP A;  1MHO A;  2KQ6 A;  2SCP A;  2L50 A;  2KBM A;  4PE4 A;  2KI4 B;  2QAC A;  2I18 A;  2JNF A;  1DJY A;  4E68 A;  3VRQ A;  2HQW A;  1KK8 C;  4C0K A;  5HYD A;  1JFK A;  2F8P A;  4M2P A;  3VRN A;  1BLQ A;  3EVU A;  4I5J A;  1CM1 A;  3VRP A;  1B7T Y;  1RWY A;  1K9K A;  2KYC A;  1J7R A;  1K9U A;  4DRW A;  1A03 A;  3I5G B;  1CDM A;  1YX7 A;  1DMO A;  2WOR A;  1B8R A;  1JC2 A;  2MLF C;  1S5G Y;  1PSB A;  3SG7 A;  4YGA A;  1QX7 A;  1QXP A;  4M2O A;  1IKU A;  4R1E A;  2KI4 C;  3EVV A;  1SKT A;  2BE4 A;  1DGV A;  1QIW A;  2LM5 A;  3PN7 B;  2LUC A;  4N1F A;  4YGD B;  3M0W A;  2NCO A;  1J7P A;  4D1E A;  1G8I A;  1LXF C;  2FCD A;  2L0P A;  3SG4 A;  1FPW A;  2K8M B;  4QJ3 B;  1OE9 B;  2JXC A;  1JF0 A;  2I94 A;  1PSR A;  2M1K B;  2LVV A;  1PK0 D;  1KFX L;  2HQ8 A;  4HRH A;  1HT9 A;  2KGR A;  1SBJ A;  1SL9 A;  1JSA A;  2EGD A;  2VRG A;  1YVH A;  1FI5 A;  1IJ6 A;  5KU1 A;  5DKQ A;  4DIR A;  1NX0 A;  1C7W A;  2H61 A;  2K7O A;  1FW4 A;  1BT6 A;  3TUY B;  1IJ5 A;  2CBL A;  1CLB A;  5JJG A;  3NSL A;  1KSO A;  1JUO A;  1DJZ A;  2CNP A;  2KSP A;  2PMY A;  4QJ5 B;  1QV1 A;  5GQQ C;  1CLM A;  1EXR A;  1DVI A;  1CKK A;  1C07 A;  1UWO A;  1RRO A;  1J1E A;  1OQP A;  2CCM A;  1MQ1 A;  2ZFD A;  5FYX A;  2L98 A;  1OSA A;  2JC2 A;  4GGF A;  1MXL C;  1YUS A;  2BBN A;  2LP2 A;  1SY9 A;  3CR5 X;  2GGZ A;  3CWG A;  3LCP C;  1UHK A;  4P5O E;  2JT3 A;  3A4U B;  1CDN A;  1WY9 A;  1XYD A;  2I2R E;  4IL1 A;  1PUL A;  4HRE E;  1NSH A;  3ICB A;  1K90 D;  1WLZ A;  3GK1 A;  1TNQ A;  2M7N A;  1ZFS A;  5I2Q A;  2G9B A;  2KAX A;  5K89 A;  4ORA B;  1CB1 A;  4PHN A;  5D69 A;  3SG3 A;  4MVF A;  1RFJ A;  2K61 A;  3SIB A;  2COL B;  3BQ3 A;  2LC5 A;  1DJX A;  1YUU A;  1Y1A A;  1J7Q A;  1IG5 A;  5DKN A;  5CSI A;  1D1O A;  1K9P A;  2M9G A;  3WHT B;  3E3R A;  4C0L A;  2AMI A;  5BPJ A;  4GBA A;  1YRT B;  1B47 A;  1OZS A;  3EVR A;  4L9M A;  4A4C A;  4JWQ A;  5AER A;  2ZKM X;  4XJK B;  5HLO A;  2KQY A;  2KYF A;  1SMG A;  2LVK A;  1NX1 A;  2MLE C;  3I5H C;  4CFQ A;  1TNW A;  1KQV A;  2KOT A;  1B1G A;  3WHU B;  3O78 A;  3DF0 A;  1S36 A;  2E6W A;  2NCP A;  3I5F C;  1KK8 B;  4USL A;  2MBX A;  1KFX S;  3IQO A;  4WRI A;  3OB2 B;  2LAN A;  2LMV A;  2PAS A;  3LK1 A;  1B8L A;  3RM1 A;  1MXE A;  3LLE A;  2H61 C;  4JQ0 D;  5HLV A;  2KAV A;  2F2P A;  1U5I B;  3BUO B;  3PSR A;  4AOM A;  1F70 A;  1M46 A;  3QRX A;  2WOS A;  5JOL A;  1ALV A;  1A2X A;  4TNC A;  5J3X A;  1TN4 A;  1FI6 A;  2WND A;  1A29 A;  1DJH A;  1QV0 A;  2E30 A;  2A4J A;  5CPV A;  2M97 A;  1QVI Y;  2JXL A;  3PM8 A;  2LCP A;  2JWW A;  2KFF A;  3WXA A;  1YRU B;  3OHM B;  4PAL A;  3OB1 B;  4GAO A;  2MHH A;  3O4Y A;  4ORB B;  1AP4 A;  1NYA A;  3KEV A;  1CM4 A;  1OOJ A;  2F33 A;  1SRA A;  1J7O A;  1IGV A;  1VRK A;  4I5N B;  3LK0 A;  4N5X A;  1BJF A;  1HQV A;  1W7J B;  2JRF A;  2Y1M A;  3DD4 A;  1K8U A;  1SCM C;  3GK4 X;  1NIW A;  1MUX A;  3BOW A;  3HCM A;  4PHJ A;  1AJ5 A;  2WC8 A;  2H2K A;  3DF0 B;  2M3W A;  1E8A A;  3BUM B;  1XK4 A;  1B8C A;  1B7T Z;  3FWB A;  2I7A A;  1A4P A;  2KFH A;  4PHK A;  3JTD B;  2EC6 B;  2M0R A;  1ZMZ A;  2JNX A;  2LUX A;  2F2O A;  2KFG A;  1TNX A;  1YUR A;  1UUS A;  2BBM A;  1QTX A;  3TZ1 A;  1S5G Z;  5I8N A;  3BUX B;  1SNL A;  4MZK A;  1DTL A;  2R2I A;  2EHB A;  2LMT A;  3CZT X;  1TCF A;  4NQG A;  3KO0 A;  2KAY A;  2BCA A;  2BCX A;  4OVN F;  4I5L B;  2O60 A;  1G33 A;  2B1U A;  4FQO A;  2O5G A;  1NX2 A;  1MWN A;  1PVB A;  3BXK A;  4OR9 B;  4UPG A;  1DF0 A;  3SG6 A;  5HKZ A;  2L4H A;  4A4B A;  3HX4 A;  2FJU B;  1V1G A;  3JTD C;  1M31 A;  2EC6 C;  2PVB A;  2K7B A;  5ER5 A;  1YUT A;  1A75 A;  1J1D A;  1TNP A;  3H4S E;  3TDI A;  1Y6W A;  4AQJ A;  1KWO B;  1V1F A;  1XFZ O;  3BOW B;  4Q04 A;  1TCO B;  4HSZ A;  3DVK A;  4GGN A;  4MRY A;  4AQI A;  1NPQ A;  4M2Q A;  1CFC A;  3AKB A;  4FTG A;  2M49 B;  1DJW A;  4ETO A;  4YGE B;  2GV5 A;  4JPZ B;  4U8D A;  4MEW A;  1NX3 A;  5ER4 X;  1KK7 Y;  1LA0 A;  1TTX A;  2MAZ A;  1H8B A;  2LV7 A;  2MJW B;  1SL7 A;  2JT0 A;  1NWD A;  3FWC A;  1YX8 A;  2LLU A;  1OMD A;  2NXQ A;  4YBH B;  3K21 A;  1KK7 Z;  1SPY A;  2L5X B;  1XO5 A;  3VGO A;  2JZI A;  1KWO C;  1CFD A;  3AKA A;  4PCW A;  1M45 A;  1NP8 A;  2F3Y A;  1KCY A;  3I5H B;  2JU0 A;  1CMF A;  2KBI A;  4BY4 A;  3NSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...