2ZRSA

Crystal structure of ca2+-bound form of des3-23alg-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
165
structure length
165
Chain Sequence
DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 6
publication title Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zrsA00
2KBIA 2H61C 3BUNB 1Y1UA 1J7RA 4GGNA 4NDDA 1CDLA 1NX3A 3RLZA 1GGWA 2WCBA 3RM1A 3D0YA 4GUKA 4C0LA 2CNPA 4MN0A 3GK2A 4P5OE 1MWNA 3CS1A 2LCPA 3TS5B 1Y1AA 4MZJA 2SASA 3D10A 1TRFA 3LL8B 5I8NA 1A2XA 1SBJA 4D1EA 2JNXA 3SJSA 1RWYA 2HF5A 2F33A 3CGAA 1ODBA 2LM5A 2FJUB 1MR8A 4C0JA 1SY9A 4HRGA 4YGDB 5AANA 2ZRTA 1LKJA 2NZ0A 5JJGA 5B8IB 5KU1A 1J1EA 1QASA 1OMVA 2I94A 5DKNA 1JFJA 1PVBA 2LV7A 2ZNEA 1B4CA 3EK7A 2B1UA 3ZWHA 1DJYA 4MBEA 1NYAA 1DJGA 3PN7C 2JTTA 1A75A 2VRGA 2WCEA 3DF0B 2NCOA 2PASA 3K21A 1CDMA 4C0KA 4JQ0D 2LP2A 1IRJA 1NCZA 2KFHA 3BUMB 1KK8B 3TDIA 1BJFA 5F6TA 5GQQC 3KPXA 2JOJA 1FF1A 1TIZA 1CFPA 1DF0A 1U5IB 2Y5IA 3OX6A 5HKZA 3IF7A 1DT7B 1OE9B 4CFRA 4PE0A 2KOTA 2R2IA 4N1GA 3EKJA 4U8DA 1DJWA 5CPVA 1YVLA 3SIAA 1XVJA 2CBLA 2MHHA 2MJWB 4M2OA 1CMGA 3BOWB 3EK8A 3NXAA 2M9GA 1MUXA 2LMTA 3JVTB 2KSPA 4ICBA 4BY4A 3MSEB 2JT8A 3OB2B 4YGEB 4WRIA 1A4PA 2GV5A 3KHEA 5HYDA 1XFYO 2JQ6A 1YRUB 2AAOA 4PHKA 1K95A 3IQQA 2BL0C 4I5NB 1IJ6A 1WRKA 1AK8A 2KI4C 1ZUZA 3VRPA 1KWOB 1K2HA 1AVSA 2LHIA 1Y0VH 2JNFA 4GGFA 2L4IA 1DJIA 4Q04A 3PLFB 4YBHB 1WDCC 2LUCA 3PATA 2HQ8A 4NDBA 1OOJA 1S6CA 1K96A 3SG7A 3PM8A 2OS8C 1SR6B 3WHUB 1KFXL 4GAOA 5IBWA 2ZN8A 5HKWA 1SL9A 2L50A 1IJ5A 2O60A 1FW4A 1AHRA 1PSBA 3BUOB 1OSAA 1YUTA 2CCMA 4M2PA 3LCPC 1NSHA 3I5IB 5AEQA 3SG5A 1IGVA 2L4HA 3DVKA 4MZKA 1K93D 1M31A 4F0ZB 2K8MB 1DGUA 2MA2A 1M45A 4CIDA 4PE4A 1V1FA 1JBAA 2JTZA 2H2KA 1ZMZA 1NUBA 3OX5A 3GK1A 1DMOA 3E3RA 1SK6D 1F4OA 4P2YB 1L2OC 1RTP1 2E30A 1FPWA 1YURA 1XK4A 2KGRA 4L9MA 1NCYA 4DIRA 2EC6C 4PCWA 3I5GB 2BE4A 4OR9B 1RECA 2K7DA 2F3YA 5AERA 1BMOA 4PDZA 2TN4A 3CLNA 1NX1A 1UHJA 1QATA 2M97A 4DS7A 1M39A 1B7TZ 2BCXA 2E6WA 2F3ZA 3I5FB 3HCMA 1LXFC 2NCPA 2M1UA 4M2QA 4AOMA 2HPSA 3ICBA 1PSRA 1QLSA 1SCMC 4YI8A 2PALA 1RFJA 3IQOA 3GOFA 1PVAA 5DKRA 4AQJA 4FQOA 2K0JA 1CDNA 3HX4A 4WQ2A 1YX7A 1PRWA 2KDHA 1JF2A 2M3WA 1CFDA 1UP5A 1HT9A 4ORCB 1ZOTB 4A4CA 1PK0D 1QX2A 4HSZA 1X02A 3PN7B 2ISDA 4GGFC 3JTDC 4MEWA 2JULA 4QJ4B 4MZLA 3WHTB 1M63B 2A4JA 1W7IB 1EG4A 1NX0A 3LK0A 1CFFA 1EH2A 1F8HA 1Y6WA 3VROA 3FIAA 1SKTA 1C7VA 4CPVA 3EK4A 1CMFA 3A8RA 1E8AA 2I7AA 4HREE 2KBMA 4WQ3A 1U5IA 1XFWO 2JT0A 1F71A 5AFPA 1KFUL 2KNEA 2G2BA 2ZN9A 1DGVA 2P6BB 3CR2A 4MVFA 1C07A 1JFKA 4E68A 1GQMA 2I2RE 4PE1A 4I5KA 4PHJA 1XFXO 3BOWA 1QTXA 2LMUA 5ER5A 2CXJA 1B7TY 3SG6A 1H4BA 1KSOA 1S1EA 5G08A 1DTLA 1A29A 5AXIA 1CLLA 2FOTA 2QACA 2BL0B 3CTNA 2JT3A 3OP0A 1NIWA 1MF8B 1KQMC 1JC2A 1S26D 1LA0A 2CT9A 5J3XA 1UUSA 1SCVA 1WDCB 1K90D 1XK4C 4QJ5B 1GGZA 4GNKB 5KSZA 1RROA 3D0YB 4JWQA 4GPLB 1NCXA 2LVKA 2SCPA 4ORAB 3TS5C 1J1DA 5CSJA 1F55A 1YRTB 2LVVA 1QX7A 5FYXA 4YGBB 4UPGA 1AJ5A 4R1EA 2L2EA 1NPQA 1BOCA 2BKHB 4CFQA 2BCAA 3EVUA 2BBMA 3AKBA 3CR4X 3EVRA 1DJHA 2LLUA 4YGAA 2FCEA 3CZTX 1SMGA 3TUYC 1XA5A 1ALVA 2L98A 2JU0A 1EJ3A 1KQVA 4YGCB 1QIWA 1W7JB 5DKQA 3NSIA 1CB1A 2M7NA 4TNCA 2LUXA 4XJKA 2QPTA 4PHMA 1CDPA 1CLMA 1CTRA 3OB1B 1TTXA 2HQWA 1ZACA 1NX2A 1S6JA 1V1GA 1A75B 4PHNA 3LK1A 2LAPA 2Y1MA 3EKHA 3FS7A 1B1GA 3C1VA 4DRWA 1QV1A 2OTGC 2K61A 1N65A 1WLZA 3KEVA 5HKYA 1IWQA 1TNWA 3GK4X 5HLOA 1A03A 1CNPA 1J7OA 1TNQA 2WOSA 1TNPA 1DF0B 1MXLC 1BT6A 3LLEA 2MLFC 2PSRA 1AJ4A 1XFVO 2JXCA 1K8UA 3BXKA 1TN4A 1XO5A 4DCKA 1DJXA 2ZNDA 1BLQA 3O4YA 3TDZA 1IG5A 1YVHA 5CSFA 4ZCUA 1QIVA 1WY9A 1SW8A 1B8RA 5HLVA 2M7LA 1D1OA 1CKKA 3SIBA 3VRQA 2Q91A 1YX8A 1EXRA 2HETA 1KSMA 2JWWA 1SPYA 1LA3A 3JTDB 3PALA 2F2OA 4A4BA 2MRDA 2M49B 2LANA 3WNXB 1G33A 2BECA 1BR4B 2D8NA 2O5GA 1QS7A 1ALWA 1OMRA 5JOLA 3I5HC 3DVJA 1Q80A 1UHHA 3OHMB 1B47A 2K2FA 1JUOA 1Y1XA 4HRHA 2BKIB 1IQ3A 1NP8A 5TNCA 1L7ZA 3AAJA 1KCYA 1OMDA 2LNKA 2K2AA 2LMVA 5CSIA 1G8IA 3FWCA 3VGOA 1KFXS 3DF0A 4DUQA 2DOQA 2RGIA 3TZ1A 1CLBA 1R2UA 4OCIA 4QJ3B 5CSNA 3PFVA 1AP4A 5I2LA 1PALA 1IQ5A 1XFZO 1YR5A 2KQYA 3O6BA 2K7OA 1OQPA 2L0PA 3I5GC 1AUIB 1B8CA 1OZSA 2G9BA 1K94A 1IKUA 1XYDA 1WRZA 2PVBA 1J55A 1QXPA 1PULA 3H4SE 4YI9A 2M1KB 3AAKA 2COLB 2LLTA 5KTYA 2CTNA 1MHOA 3KO0A 1XFUO 2M0RA 3I5FC 1VRKA 2KQ6A 1FI5A 1QX5B 4I5LB 4PALA 1IH0A 1TOPA 3SG3A 2L51A 2M8UA 3SG4A 3DD4A 2KI4B 1RK9A 3BUXB 1N2DA 1F54A 3TUYB 2V53A 1SL7A 2JZIA 1K9UA 3KF9A 2JRFA 1MQ1A 1EL4A 1QVIY 2BE6A 3BUWB 4I5JA 5ER4X 2BBNA 1S3PA 2LC5A 2OPOA 1EG3A 1JF0A 2PRUA 2OS8B 1B9AA 2MBXA 4N1FA 1DVIA 2JXLA 1R6PA 1HQVA 3VRRA 1F4QA 2LE9B 1YUSA 3TDUA 1YUUA 2KHNA 1MXEA 2MLEC 1NWDA 3SG2A 2OTGB 2K7BA 4ETOA 2WC8A 1TCFA 1QLKA 2F8PA 2Y4QA 4NQGA 4YRUA 1UHNA 1FI6A 1BG1A 2LVIA 2WORA 2GGMA 3BYAA 1F70A 1KK7Z 1CFCA 1B8LA 1LVCD 1RJVA 5PALA 2KI6D 1YTZC 4USLA 2NLNA 4BY5A 2KAYA 1L2OB 1J7QA 3FWBA 2H61A 5I2OA 2Q4UA 2F2PA 4FTGA 1H8BA 4IL1A 2LP3A 3CWGA 2GGZA 1K9PA 1C7WA 2ZKMX 2EC6B 2EGDA 1QV0A 4MLWA 4N5XA 4AQIA 1CM4A 2KGBC 2M29A 1KFUS 1KK8C 4PE7A 1WRLA 1SYMA 2ZFDA 2PMYA 4OV2A 3O2PA 2EHBA 1LINA 1CM1A 1S5GZ 5D69A 4MRXA 1SCMB 1UHKA 2Y1NA 1BODA 1K9KA 5I2QA 2LVJA 1BU3A 1WLMA 3I5HB 2LHLA 4ORBB 2ZRSA 3JVTC 2WCFA 4MRYA 3VRNA 3DVMA 1G4YR 1SNLA 1J7PA 1UHIA 1ZFSA 1GJYA 2JPTA 3O78A 1N0YA 4GBAA 5BPJA 1TNXA 1QJTA 2AUCA 1KWOC 1KK7Y 3NSLA 1S36A 2KFFA 1TCOB 4JPZB 4OVNF 4CLNA 3A4UB 1JSAA 4XJKB 3QRXA 1S6IA 3AKAA 2KAVA 1SR6C 3F45A 2FCDA 4NDCA 1BR1B 1SL8A 1UWOA 2KYFA 3DVEA 3EVVA 2K7CA 2KAXA 2KYCA 3BQ3A 1M46A 1QVIZ 2AMIA 4OKHA 2I18A 1FBVA 3I5IC 1UURA 4ZCVA 3ZNIA 3NSKA 1JWDA 4MSPA 3NSOA 2KFGA 4XYNA 2KI6C 2MAZA 3PSRA 1S5GY 2L5XB 2JC2A 2LLSA 2NXQA 3WXAA 1DJZA 2BCBA 2WNDA 3M0WA 1BF5A 1OZOA 5D7FA 3CR5X 1SRAA 5K89A 4GFTA 2IS9A 1KQMB
chains in the Genus database with same CATH superfamily
2KBIA 2H61C 3BUNB 1Y1UA 1J7RA 4GGNA 4NDDA 1CDLA 1NX3A 3BJHA 3RLZA 1GGWA 2WCBA 3RM1A 3D0YA 4GUKA 4C0LA 3D76A 2CNPA 4MN0A 3GK2A 4P5OE 2WC5A 1MWNA 3CS1A 2LCPA 3TS5B 1Y1AA 4MZJA 2SASA 3D10A 1TRFA 3CDNA 3LL8B 5I8NA 1A2XA 5HL1A 1SBJA 3R72A 4D1EA 2JNXA 3SJSA 1RWYA 2HF5A 2F33A 2WCJA 3CGAA 1ODBA 2LM5A 2FJUB 1MR8A 4C0JA 1SY9A 4HRGA 4YGDB 5AANA 3OGNA 2ZRTA 1LKJA 2NZ0A 5JJGA 5B8IB 5KU1A 1J1EA 1QASA 1OMVA 2I94A 4FQTA 5DKNA 1PVBA 2LV7A 2ZNEA 1B4CA 1JFJA 3EK7A 1OOGA 2B1UA 3ZWHA 4KYNA 1DJYA 4MBEA 1NYAA 5FI7A 3UNWA 3BFAA 1DJGA 3PN7C 2JTTA 1XFRA 1A75A 2VRGA 3B86A 3R1OA 1DELA 2WCEA 3DF0B 2NCOA 2PASA 3K21A 5EL2A 1CDMA 4C0KA 4JQ0D 2LP2A 1IRJA 1NCZA 2KFHA 2YGUA 3CABA 3S0DA 3BUMB 1KK8B 3TDIA 1BJFA 5F6TA 5GQQC 2KLDA 3KPXA 2JOJA 2KPHA 1TIZA 1CFPA 1DF0A 1U5IB 2Y5IA 3OX6A 5HKZA 1FF1A 3IF7A 1DT7B 1OE9B 4CFRA 4PE0A 2KOTA 2R2IA 3B87A 4N1GA 3EKJA 4U8DA 1DJWA 5CPVA 1YVLA 3SIAA 1XVJA 2CBLA 2MHHA 2MJWB 4M2OA 1TUZA 1CMGA 3BOWB 3EK8A 3NXAA 2M9GA 1MUXA 2LMTA 3JVTB 2KSPA 4ICBA 4BY4A 3MSEB 2JT8A 3OB2B 4YGEB 3D77A 4WRIA 1A4PA 2GV5A 3KHEA 5HYDA 1XFYO 2JQ6A 1YRUB 2AAOA 4PHKA 1K95A 3IQQA 2BL0C 4I5NB 1IJ6A 1WRKA 3UO9A 1AK8A 2KI4C 1ZUZA 3VRPA 1KWOB 1K2HA 1AVSA 2LHIA 1Y0VH 2JNFA 4GGFA 2L4IA 3OBVA 1DJIA 1OW4A 4Q04A 3PLFB 4YBHB 1WDCC 2LUCA 3PATA 2HQ8A 4NDBA 1OOJA 1S6CA 1K96A 3SG7A 3PM8A 1DQEA 2OS8C 1SR6B 3PJIA 3WHUB 1KFXL 4GAOA 5IBWA 2ZN8A 3O4XA 5HKWA 1SL9A 2L50A 1IJ5A 2O60A 1FW4A 1AHRA 1PSBA 3BUOB 1OSAA 1YUTA 2CCMA 4M2PA 3LCPC 1NSHA 3I5IB 5AEQA 3SG5A 1IGVA 2L4HA 3DVKA 4MZKA 1K93D 1M31A 4F0ZB 2K8MB 1DGUA 2MA2A 2FJYA 1M45A 3DY9A 4CIDA 4PE4A 1V1FA 1JBAA 2JTZA 2H2KA 3B7AA 1ZMZA 1NUBA 3OX5A 3GK1A 1DMOA 3E3RA 1SK6D 1F4OA 4P2YB 1L2OC 1RTP1 2E30A 1FPWA 1YURA 1W9ZA 1XK4A 2KGRA 4L9MA 2QEBA 1NCYA 4DIRA 3DZTA 2EC6C 4PCWA 2QEOA 2GTEA 3I5GB 2BE4A 4OR9B 1RECA 2K7DA 3SS3A 2F3YA 3FE9A 5AERA 1BMOA 4PDZA 2TN4A 3CLNA 1NX1A 1UHJA 1QATA 2WCHA 2M97A 2QEVA 4DS7A 1M39A 3NGVA 1B7TZ 2BCXA 2E6WA 2F3ZA 3I5FB 3HCMA 1LXFC 2NCPA 2M1UA 4M2QA 4AOMA 2HPSA 3ICBA 1PSRA 1QLSA 1SCMC 4YI8A 2PALA 1RFJA 3IQOA 3GOFA 1PVAA 5DKRA 2P71A 4AQJA 4FQOA 2K0JA 1CDNA 3HX4A 4WQ2A 3S0BA 1YX7A 1PRWA 2KDHA 3S0FA 1JF2A 1QWVA 2M3WA 2K60A 1CFDA 1UP5A 1HT9A 4ORCB 1ZOTB 4A4CA 1PK0D 1QX2A 4HSZA 1X02A 1IIOA 3PN7B 2ISDA 1OOFA 1SSEB 4GGFC 3S0GA 3JTDC 4MEWA 2JULA 4QJ4B 4MZLA 3WHTB 1M63B 2A4JA 1W7IB 1EG4A 1NX0A 3L4LA 3LK0A 1CFFA 1EH2A 1Y6WA 1F8HA 3VROA 1P28A 3FIAA 1SKTA 1C7VA 4CPVA 3EK4A 1CMFA 3A8RA 1E8AA 2I7AA 4HREE 2KBMA 4WQ3A 1U5IA 2PQLA 1XFWO 2JT0A 1F71A 4INXA 5AFPA 1KFUL 2KNEA 2G2BA 2ZN9A 1DGVA 2WC6A 2P6BB 3CR2A 4MVFA 1C07A 1JFKA 4E68A 1GQMA 2I2RE 4PE1A 4I5KA 4PHJA 1XFXO 3BOWA 3B6XA 3N7HA 1QTXA 2LMUA 5ER5A 2CXJA 1B7TY 3SG6A 1H4BA 1KSOA 1S1EA 5G08A 1DTLA 1A29A 5AXIA 1CLLA 2FOTA 2QACA 2BL0B 3CTNA 2JT3A 3OP0A 1NIWA 1MF8B 1KQMC 1JC2A 1GM0A 1S26D 1LA0A 2CT9A 5J3XA 1UUSA 1XK4C 1SCVA 1K90D 1WDCB 4QJ5B 1GGZA 4GNKB 5KSZA 1RROA 1Z2CB 3D0YB 4JWQA 4GPLB 1NCXA 1ORGA 2LVKA 3BFBA 2SCPA 4ORAB 3TS5C 1J1DA 5CSJA 1F55A 2H8VA 1YRTB 2LVVA 1QX7A 5FYXA 4YGBB 4UPGA 1AJ5A 4R1EA 3D74A 2L2EA 1NPQA 1BOCA 2BKHB 4CFQA 2BCAA 3EVUA 2BBMA 4INWA 2WCLA 3AKBA 3CR4X 1DJHA 2LLUA 3EVRA 4YGAA 2FCEA 3CZTX 1SMGA 3TUYC 1XA5A 1ALVA 2L98A 2JU0A 2BNXA 1EJ3A 1KQVA 4YGCB 1QIWA 1W7JB 5DKQA 3NSIA 2L5YA 1CB1A 3QMEA 2M7NA 4TNCA 2LUXA 3CZ2A 4XJKA 2QPTA 4PHMA 1CDPA 1CLMA 1CTRA 3OB1B 1TTXA 2HQWA 1ZACA 1NX2A 1S6JA 1V1GA 1A75B 4PHNA 3B88A 3LK1A 3L4AA 2LAPA 2Y1MA 3EKHA 3FS7A 1B1GA 3K1EA 3C1VA 4DRWA 1QV1A 2OTGC 2K61A 2QEHA 1N65A 1WLZA 3KEVA 5HKYA 1IWQA 3L47A 1TNWA 4F7FA 3GK4X 5HLOA 1A03A 1CNPA 1J7OA 1T14A 1TNQA 2WOSA 1TNPA 1DF0B 1MXLC 1BT6A 3LLEA 2MLFC 2PSRA 3BFHA 2ERBA 1AJ4A 1XFVO 2JXCA 3D78A 1K8UA 3BXKA 1TN4A 1XO5A 4DCKA 1DJXA 2ZNDA 1OOIX 1BLQA 3O4YA 3TDZA 1IG5A 1YVHA 5CSFA 3EG5B 4ZCUA 1QIVA 2WCKA 1WY9A 1SW8A 1B8RA 5HLVA 2M7LA 3SS4A 1D1OA 1CKKA 3SIBA 3VRQA 2Q91A 1YX8A 1EXRA 2HETA 1KSMA 2JWWA 1SPYA 1LA3A 3JTDB 3PALA 2F2OA 4A4BA 2MRDA 2M49B 2LANA 3WNXB 3NHIA 1G33A 2QDIA 2BECA 1BR4B 2D8NA 2O5GA 1QS7A 1ALWA 1OMRA 5JOLA 3I5HC 3DVJA 1Q80A 4IJ7A 1UHHA 3SS5A 3OHMB 1B47A 2K2FA 1JUOA 1Y1XA 4HRHA 4PT1A 2BKIB 3FE6A 1NP8A 5TNCA 1L7ZA 1IQ3A 3AAJA 1DEKA 1OMDA 1KCYA 2LNKA 2K2AA 2LMVA 5CSIA 1G8IA 3FWCA 3VGOA 1KFXS 3DF0A 3VB1A 4DUQA 2DOQA 2RGIA 3TZ1A 1CLBA 1R2UA 4OCIA 4QJ3B 5CSNA 3PFVA 1AP4A 3D75A 5I2LA 1PALA 1IQ5A 1XFZO 2PYQA 3Q8IA 1YR5A 2KQYA 3O6BA 4OZDA 2K7OA 1OQPA 3V2LA 3CZ1A 2L0PA 3I5GC 1AUIB 1TUJA 1B8CA 1OZSA 2G9BA 1K94A 1IKUA 1XYDA 1WRZA 2PVBA 3DYEA 1J55A 1QXPA 1PULA 3H4SE 4YI9A 2M1KB 3AAKA 2COLB 2LLTA 5KTYA 2CTNA 1MHOA 3KO0A 1Z4HA 1XFUO 2M0RA 3I5FC 1VRKA 2KQ6A 1FI5A 1QX5B 4I5LB 4PALA 1IH0A 1TOPA 3SG3A 2L51A 2M8UA 3SG4A 3DD4A 2KI4B 1RK9A 3BUXB 1N2DA 1F54A 3TUYB 2V53A 4JD9A 1SL7A 2JZIA 1K9UA 3KF9A 2JRFA 1MQ1A 1EL4A 1QVIY 2BE6A 3BUWB 4I5JA 3NHTA 5ER4X 4JKTA 2BBNA 1S3PA 2LC5A 2OPOA 1EG3A 1JF0A 2PRUA 2OS8B 1B9AA 2MBXA 4N1FA 1TWOA 1DVIA 2JXLA 1R6PA 1HQVA 3VRRA 1F4QA 2LE9B 1YUSA 3TDUA 1YUUA 2KHNA 1MXEA 5D3OA 3R1VA 2MLEC 1NWDA 3SG2A 2OTGB 2K7BA 4ETOA 2WC8A 1TCFA 1QLKA 2F8PA 2Y4QA 4NQGA 1DC1A 4YRUA 1UHNA 1FI6A 1BG1A 2LVIA 2WORA 2GGMA 3BYAA 1F70A 1KK7Z 1CFCA 2L2CA 1B8LA 1LVCD 1RJVA 5PALA 2KI6D 3PM2A 1YTZC 4USLA 2NLNA 4BY5A 2KAYA 1L2OB 1J7QA 3FWBA 2H61A 5I2OA 2Q4UA 2F2PA 4FTGA 1H8BA 3FE8A 4IL1A 5FI2A 2LP3A 3CWGA 2GGZA 1K9PA 1C7WA 2ZKMX 2EC6B 2EGDA 1QV0A 4MLWA 4N5XA 4AQIA 3IVTA 1CM4A 3S0AA 2KGBC 2M29A 1KFUS 1C3YA 1KK8C 4PE7A 3RZSA 2P70A 1WRLA 1SYMA 2ZFDA 2PMYA 3R1PA 4OV2A 3O2PA 2EHBA 1LINA 3DXLA 1CM1A 1S5GZ 5D69A 4MRXA 1SCMB 1UHKA 2Y1NA 1BODA 1K9KA 5I2QA 2LVJA 1BU3A 3S0EA 1WLMA 3I5HB 2LHLA 4ORBB 2ZRSA 3JVTC 2WCFA 4MRYA 3VRNA 3DVMA 3CZ0A 1G4YR 1SNLA 1J7PA 1UHIA 1ZFSA 1GJYA 2JPTA 3O78A 1N0YA 4GBAA 5BPJA 1TNXA 1QJTA 2AUCA 1KWOC 1KK7Y 3NSLA 5DICA 1S36A 2KFFA 1TCOB 4JPZB 4OVNF 4CLNA 3A4UB 1JSAA 4XJKB 3QRXA 1S6IA 3D73A 3AKAA 2KAVA 1SR6C 2KLEA 3F45A 2FCDA 2WCMA 4NDCA 1BR1B 1SL8A 1UWOA 2KYFA 5FI6A 3DVEA 3EVVA 5I94A 2K7CA 2KAXA 2KYCA 3BQ3A 1M46A 1QVIZ 2AMIA 4OKHA 1LS8A 2I18A 1FBVA 3I5IC 1UURA 2BAPA 4ZCVA 3ZNIA 3NSKA 1OOHA 1JWDA 4MSPA 3NSOA 2KFGA 4XYNA 2KI6C 2MAZA 3PSRA 1S5GY 2L5XB 2JC2A 2LLSA 2NXQA 3WXAA 1DJZA 2BCBA 2WNDA 3M0WA 3CYZA 1BF5A 1C3ZA 1OZOA 2JPOA 3CR5X 5D7FA 1SRAA 5K89A 4GFTA 2IS9A 1KQMB
chains in the Genus database with same CATH topology
2KBIA 2H61C 3BUNB 1Y1UA 1J7RA 4GGNA 4NDDA 1CDLA 1NX3A 3RLZA 1GGWA 2WCBA 3RM1A 3D0YA 4GUKA 4C0LA 2CNPA 4MN0A 3GK2A 4P5OE 1MWNA 3CS1A 2LCPA 3TS5B 1Y1AA 4MZJA 2SASA 3D10A 1TRFA 3LL8B 5I8NA 1A2XA 1SBJA 4D1EA 2JNXA 3SJSA 1RWYA 2HF5A 2F33A 3CGAA 1ODBA 2LM5A 2FJUB 1MR8A 4C0JA 1SY9A 4HRGA 4YGDB 5AANA 2ZRTA 1LKJA 2NZ0A 5JJGA 5B8IB 5KU1A 1J1EA 1QASA 1OMVA 2I94A 5DKNA 1JFJA 1PVBA 2LV7A 2ZNEA 1B4CA 3EK7A 2B1UA 3ZWHA 1DJYA 4MBEA 1NYAA 1DJGA 3PN7C 2JTTA 1A75A 2VRGA 2WCEA 3DF0B 2NCOA 2PASA 3K21A 1CDMA 4C0KA 4JQ0D 2LP2A 1IRJA 1NCZA 2KFHA 3BUMB 1KK8B 3TDIA 1BJFA 5F6TA 5GQQC 3KPXA 2JOJA 1FF1A 1TIZA 1CFPA 1DF0A 1U5IB 2Y5IA 3OX6A 5HKZA 3IF7A 1DT7B 1OE9B 4CFRA 4PE0A 2KOTA 2R2IA 4N1GA 3EKJA 4U8DA 1DJWA 5CPVA 1YVLA 3SIAA 1XVJA 2CBLA 2MHHA 2MJWB 4M2OA 1CMGA 3BOWB 3EK8A 3NXAA 2M9GA 1MUXA 2LMTA 3JVTB 2KSPA 4ICBA 4BY4A 3MSEB 2JT8A 3OB2B 4YGEB 4WRIA 1A4PA 2GV5A 3KHEA 5HYDA 1XFYO 2JQ6A 1YRUB 2AAOA 4PHKA 1K95A 3IQQA 2BL0C 4I5NB 1IJ6A 1WRKA 1AK8A 2KI4C 1ZUZA 3VRPA 1KWOB 1K2HA 1AVSA 2LHIA 1Y0VH 2JNFA 4GGFA 2L4IA 1DJIA 4Q04A 3PLFB 4YBHB 1WDCC 2LUCA 3PATA 2HQ8A 4NDBA 1OOJA 1S6CA 1K96A 3SG7A 3PM8A 2OS8C 1SR6B 3WHUB 1KFXL 4GAOA 5IBWA 2ZN8A 5HKWA 1SL9A 2L50A 1IJ5A 2O60A 1FW4A 1AHRA 1PSBA 3BUOB 1OSAA 1YUTA 2CCMA 4M2PA 3LCPC 1NSHA 3I5IB 5AEQA 3SG5A 1IGVA 2L4HA 3DVKA 4MZKA 1K93D 1M31A 4F0ZB 2K8MB 1DGUA 2MA2A 1M45A 4CIDA 4PE4A 1V1FA 1JBAA 2JTZA 2H2KA 1ZMZA 1NUBA 3OX5A 3GK1A 1DMOA 3E3RA 1SK6D 1F4OA 4P2YB 1L2OC 1RTP1 2E30A 1FPWA 1YURA 1XK4A 2KGRA 4L9MA 1NCYA 4DIRA 2EC6C 4PCWA 3I5GB 2BE4A 4OR9B 1RECA 2K7DA 2F3YA 5AERA 1BMOA 4PDZA 2TN4A 3CLNA 1NX1A 1UHJA 1QATA 2M97A 4DS7A 1M39A 1B7TZ 2BCXA 2E6WA 2F3ZA 3I5FB 3HCMA 1LXFC 2NCPA 2M1UA 4M2QA 4AOMA 2HPSA 3ICBA 1PSRA 1QLSA 1SCMC 4YI8A 2PALA 1RFJA 3IQOA 3GOFA 1PVAA 5DKRA 4AQJA 4FQOA 2K0JA 1CDNA 3HX4A 4WQ2A 1YX7A 1PRWA 2KDHA 1JF2A 2M3WA 1CFDA 1UP5A 1HT9A 4ORCB 1ZOTB 4A4CA 1PK0D 1QX2A 4HSZA 1X02A 3PN7B 2ISDA 4GGFC 3JTDC 4MEWA 2JULA 4QJ4B 4MZLA 3WHTB 1M63B 2A4JA 1W7IB 1EG4A 1NX0A 3LK0A 1CFFA 1EH2A 1F8HA 1Y6WA 3VROA 3FIAA 1SKTA 1C7VA 4CPVA 3EK4A 1CMFA 3A8RA 1E8AA 2I7AA 4HREE 2KBMA 4WQ3A 1U5IA 1XFWO 2JT0A 1F71A 5AFPA 1KFUL 2KNEA 2G2BA 2ZN9A 1DGVA 2P6BB 3CR2A 4MVFA 1C07A 1JFKA 4E68A 1GQMA 2I2RE 4PE1A 4I5KA 4PHJA 1XFXO 3BOWA 1QTXA 2LMUA 5ER5A 2CXJA 1B7TY 3SG6A 1H4BA 1KSOA 1S1EA 5G08A 1DTLA 1A29A 5AXIA 1CLLA 2FOTA 2QACA 2BL0B 3CTNA 2JT3A 3OP0A 1NIWA 1MF8B 1KQMC 1JC2A 1S26D 1LA0A 2CT9A 5J3XA 1UUSA 1SCVA 1WDCB 1K90D 1XK4C 4QJ5B 1GGZA 4GNKB 5KSZA 1RROA 3D0YB 4JWQA 4GPLB 1NCXA 2LVKA 2SCPA 4ORAB 3TS5C 1J1DA 5CSJA 1F55A 1YRTB 2LVVA 1QX7A 5FYXA 4YGBB 4UPGA 1AJ5A 4R1EA 2L2EA 1NPQA 1BOCA 2BKHB 4CFQA 2BCAA 3EVUA 2BBMA 3AKBA 3CR4X 3EVRA 1DJHA 2LLUA 4YGAA 2FCEA 3CZTX 1SMGA 3TUYC 1XA5A 1ALVA 2L98A 2JU0A 1EJ3A 1KQVA 4YGCB 1QIWA 1W7JB 5DKQA 3NSIA 1CB1A 2M7NA 4TNCA 2LUXA 4XJKA 2QPTA 4PHMA 1CDPA 1CLMA 1CTRA 3OB1B 1TTXA 2HQWA 1ZACA 1NX2A 1S6JA 1V1GA 1A75B 4PHNA 3LK1A 2LAPA 2Y1MA 3EKHA 3FS7A 1B1GA 3C1VA 4DRWA 1QV1A 2OTGC 2K61A 1N65A 1WLZA 3KEVA 5HKYA 1IWQA 1TNWA 3GK4X 5HLOA 1A03A 1CNPA 1J7OA 1TNQA 2WOSA 1TNPA 1DF0B 1MXLC 1BT6A 3LLEA 2MLFC 2PSRA 1AJ4A 1XFVO 2JXCA 1K8UA 3BXKA 1TN4A 1XO5A 4DCKA 1DJXA 2ZNDA 1BLQA 3O4YA 3TDZA 1IG5A 1YVHA 5CSFA 4ZCUA 1QIVA 1WY9A 1SW8A 1B8RA 5HLVA 2M7LA 1D1OA 1CKKA 3SIBA 3VRQA 2Q91A 1YX8A 1EXRA 2HETA 1KSMA 2JWWA 1SPYA 1LA3A 3JTDB 3PALA 2F2OA 4A4BA 2MRDA 2M49B 2LANA 3WNXB 1G33A 2BECA 1BR4B 2D8NA 2O5GA 1QS7A 1ALWA 1OMRA 5JOLA 3I5HC 3DVJA 1Q80A 1UHHA 3OHMB 1B47A 2K2FA 1JUOA 1Y1XA 4HRHA 2BKIB 1IQ3A 1NP8A 5TNCA 1L7ZA 3AAJA 1KCYA 1OMDA 2LNKA 2K2AA 2LMVA 5CSIA 1G8IA 3FWCA 3VGOA 1KFXS 3DF0A 4DUQA 2DOQA 2RGIA 3TZ1A 1CLBA 1R2UA 4OCIA 4QJ3B 5CSNA 3PFVA 1AP4A 5I2LA 1PALA 1IQ5A 1XFZO 1YR5A 2KQYA 3O6BA 2K7OA 1OQPA 2L0PA 3I5GC 1AUIB 1B8CA 1OZSA 2G9BA 1K94A 1IKUA 1XYDA 1WRZA 2PVBA 1J55A 1QXPA 1PULA 3H4SE 4YI9A 2M1KB 3AAKA 2COLB 2LLTA 5KTYA 2CTNA 1MHOA 3KO0A 1XFUO 2M0RA 3I5FC 1VRKA 2KQ6A 1FI5A 1QX5B 4I5LB 4PALA 1IH0A 1TOPA 3SG3A 2L51A 2M8UA 3SG4A 3DD4A 2KI4B 1RK9A 3BUXB 1N2DA 1F54A 3TUYB 2V53A 1SL7A 2JZIA 1K9UA 3KF9A 2JRFA 1MQ1A 1EL4A 1QVIY 2BE6A 3BUWB 4I5JA 5ER4X 2BBNA 1S3PA 2LC5A 2OPOA 1EG3A 1JF0A 2PRUA 2OS8B 1B9AA 2MBXA 4N1FA 1DVIA 2JXLA 1R6PA 1HQVA 3VRRA 1F4QA 2LE9B 1YUSA 3TDUA 1YUUA 2KHNA 1MXEA 2MLEC 1NWDA 3SG2A 2OTGB 2K7BA 4ETOA 2WC8A 1TCFA 1QLKA 2F8PA 2Y4QA 4NQGA 4YRUA 1UHNA 1FI6A 1BG1A 2LVIA 2WORA 2GGMA 3BYAA 1F70A 1KK7Z 1CFCA 1B8LA 1LVCD 1RJVA 5PALA 2KI6D 1YTZC 4USLA 2NLNA 4BY5A 2KAYA 1L2OB 1J7QA 3FWBA 2H61A 5I2OA 2Q4UA 2F2PA 4FTGA 1H8BA 4IL1A 2LP3A 3CWGA 2GGZA 1K9PA 1C7WA 2ZKMX 2EC6B 2EGDA 1QV0A 4MLWA 4N5XA 4AQIA 1CM4A 2KGBC 2M29A 1KFUS 1KK8C 4PE7A 1WRLA 1SYMA 2ZFDA 2PMYA 4OV2A 3O2PA 2EHBA 1LINA 1CM1A 1S5GZ 5D69A 4MRXA 1SCMB 1UHKA 2Y1NA 1BODA 1K9KA 5I2QA 2LVJA 1BU3A 1WLMA 3I5HB 2LHLA 4ORBB 2ZRSA 3JVTC 2WCFA 4MRYA 3VRNA 3DVMA 1G4YR 1SNLA 1J7PA 1UHIA 1ZFSA 1GJYA 2JPTA 3O78A 1N0YA 4GBAA 5BPJA 1TNXA 1QJTA 2AUCA 1KWOC 1KK7Y 3NSLA 1S36A 2KFFA 1TCOB 4JPZB 4OVNF 4CLNA 3A4UB 1JSAA 4XJKB 3QRXA 1S6IA 3AKAA 2KAVA 1SR6C 3F45A 2FCDA 4NDCA 1BR1B 1SL8A 1UWOA 2KYFA 3DVEA 3EVVA 2K7CA 2KAXA 2KYCA 3BQ3A 1M46A 1QVIZ 2AMIA 4OKHA 2I18A 1FBVA 3I5IC 1UURA 4ZCVA 3ZNIA 3NSKA 1JWDA 4MSPA 3NSOA 2KFGA 4XYNA 2KI6C 2MAZA 3PSRA 1S5GY 2L5XB 2JC2A 2LLSA 2NXQA 3WXAA 1DJZA 2BCBA 2WNDA 3M0WA 1BF5A 1OZOA 5D7FA 3CR5X 1SRAA 5K89A 4GFTA 2IS9A 1KQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBI A;  2H61 C;  3BUN B;  1Y1U A;  1J7R A;  4GGN A;  4NDD A;  1CDL A;  1NX3 A;  3RLZ A;  1GGW A;  2WCB A;  3RM1 A;  3D0Y A;  4GUK A;  4C0L A;  2CNP A;  4MN0 A;  3GK2 A;  4P5O E;  1MWN A;  3CS1 A;  2LCP A;  3TS5 B;  1Y1A A;  4MZJ A;  2SAS A;  3D10 A;  1TRF A;  3LL8 B;  5I8N A;  1A2X A;  1SBJ A;  4D1E A;  2JNX A;  3SJS A;  1RWY A;  2HF5 A;  2F33 A;  3CGA A;  1ODB A;  2LM5 A;  2FJU B;  1MR8 A;  4C0J A;  1SY9 A;  4HRG A;  4YGD B;  5AAN A;  2ZRT A;  1LKJ A;  2NZ0 A;  5JJG A;  5B8I B;  5KU1 A;  1J1E A;  1QAS A;  1OMV A;  2I94 A;  5DKN A;  1JFJ A;  1PVB A;  2LV7 A;  2ZNE A;  1B4C A;  3EK7 A;  2B1U A;  3ZWH A;  1DJY A;  4MBE A;  1NYA A;  1DJG A;  3PN7 C;  2JTT A;  1A75 A;  2VRG A;  2WCE A;  3DF0 B;  2NCO A;  2PAS A;  3K21 A;  1CDM A;  4C0K A;  4JQ0 D;  2LP2 A;  1IRJ A;  1NCZ A;  2KFH A;  3BUM B;  1KK8 B;  3TDI A;  1BJF A;  5F6T A;  5GQQ C;  3KPX A;  2JOJ A;  1FF1 A;  1TIZ A;  1CFP A;  1DF0 A;  1U5I B;  2Y5I A;  3OX6 A;  5HKZ A;  3IF7 A;  1DT7 B;  1OE9 B;  4CFR A;  4PE0 A;  2KOT A;  2R2I A;  4N1G A;  3EKJ A;  4U8D A;  1DJW A;  5CPV A;  1YVL A;  3SIA A;  1XVJ A;  2CBL A;  2MHH A;  2MJW B;  4M2O A;  1CMG A;  3BOW B;  3EK8 A;  3NXA A;  2M9G A;  1MUX A;  2LMT A;  3JVT B;  2KSP A;  4ICB A;  4BY4 A;  3MSE B;  2JT8 A;  3OB2 B;  4YGE B;  4WRI A;  1A4P A;  2GV5 A;  3KHE A;  5HYD A;  1XFY O;  2JQ6 A;  1YRU B;  2AAO A;  4PHK A;  1K95 A;  3IQQ A;  2BL0 C;  4I5N B;  1IJ6 A;  1WRK A;  1AK8 A;  2KI4 C;  1ZUZ A;  3VRP A;  1KWO B;  1K2H A;  1AVS A;  2LHI A;  1Y0V H;  2JNF A;  4GGF A;  2L4I A;  1DJI A;  4Q04 A;  3PLF B;  4YBH B;  1WDC C;  2LUC A;  3PAT A;  2HQ8 A;  4NDB A;  1OOJ A;  1S6C A;  1K96 A;  3SG7 A;  3PM8 A;  2OS8 C;  1SR6 B;  3WHU B;  1KFX L;  4GAO A;  5IBW A;  2ZN8 A;  5HKW A;  1SL9 A;  2L50 A;  1IJ5 A;  2O60 A;  1FW4 A;  1AHR A;  1PSB A;  3BUO B;  1OSA A;  1YUT A;  2CCM A;  4M2P A;  3LCP C;  1NSH A;  3I5I B;  5AEQ A;  3SG5 A;  1IGV A;  2L4H A;  3DVK A;  4MZK A;  1K93 D;  1M31 A;  4F0Z B;  2K8M B;  1DGU A;  2MA2 A;  1M45 A;  4CID A;  4PE4 A;  1V1F A;  1JBA A;  2JTZ A;  2H2K A;  1ZMZ A;  1NUB A;  3OX5 A;  3GK1 A;  1DMO A;  3E3R A;  1SK6 D;  1F4O A;  4P2Y B;  1L2O C;  1RTP 1;  2E30 A;  1FPW A;  1YUR A;  1XK4 A;  2KGR A;  4L9M A;  1NCY A;  4DIR A;  2EC6 C;  4PCW A;  3I5G B;  2BE4 A;  4OR9 B;  1REC A;  2K7D A;  2F3Y A;  5AER A;  1BMO A;  4PDZ A;  2TN4 A;  3CLN A;  1NX1 A;  1UHJ A;  1QAT A;  2M97 A;  4DS7 A;  1M39 A;  1B7T Z;  2BCX A;  2E6W A;  2F3Z A;  3I5F B;  3HCM A;  1LXF C;  2NCP A;  2M1U A;  4M2Q A;  4AOM A;  2HPS A;  3ICB A;  1PSR A;  1QLS A;  1SCM C;  4YI8 A;  2PAL A;  1RFJ A;  3IQO A;  3GOF A;  1PVA A;  5DKR A;  4AQJ A;  4FQO A;  2K0J A;  1CDN A;  3HX4 A;  4WQ2 A;  1YX7 A;  1PRW A;  2KDH A;  1JF2 A;  2M3W A;  1CFD A;  1UP5 A;  1HT9 A;  4ORC B;  1ZOT B;  4A4C A;  1PK0 D;  1QX2 A;  4HSZ A;  1X02 A;  3PN7 B;  2ISD A;  4GGF C;  3JTD C;  4MEW A;  2JUL A;  4QJ4 B;  4MZL A;  3WHT B;  1M63 B;  2A4J A;  1W7I B;  1EG4 A;  1NX0 A;  3LK0 A;  1CFF A;  1EH2 A;  1F8H A;  1Y6W A;  3VRO A;  3FIA A;  1SKT A;  1C7V A;  4CPV A;  3EK4 A;  1CMF A;  3A8R A;  1E8A A;  2I7A A;  4HRE E;  2KBM A;  4WQ3 A;  1U5I A;  1XFW O;  2JT0 A;  1F71 A;  5AFP A;  1KFU L;  2KNE A;  2G2B A;  2ZN9 A;  1DGV A;  2P6B B;  3CR2 A;  4MVF A;  1C07 A;  1JFK A;  4E68 A;  1GQM A;  2I2R E;  4PE1 A;  4I5K A;  4PHJ A;  1XFX O;  3BOW A;  1QTX A;  2LMU A;  5ER5 A;  2CXJ A;  1B7T Y;  3SG6 A;  1H4B A;  1KSO A;  1S1E A;  5G08 A;  1DTL A;  1A29 A;  5AXI A;  1CLL A;  2FOT A;  2QAC A;  2BL0 B;  3CTN A;  2JT3 A;  3OP0 A;  1NIW A;  1MF8 B;  1KQM C;  1JC2 A;  1S26 D;  1LA0 A;  2CT9 A;  5J3X A;  1UUS A;  1SCV A;  1WDC B;  1K90 D;  1XK4 C;  4QJ5 B;  1GGZ A;  4GNK B;  5KSZ A;  1RRO A;  3D0Y B;  4JWQ A;  4GPL B;  1NCX A;  2LVK A;  2SCP A;  4ORA B;  3TS5 C;  1J1D A;  5CSJ A;  1F55 A;  1YRT B;  2LVV A;  1QX7 A;  5FYX A;  4YGB B;  4UPG A;  1AJ5 A;  4R1E A;  2L2E A;  1NPQ A;  1BOC A;  2BKH B;  4CFQ A;  2BCA A;  3EVU A;  2BBM A;  3AKB A;  3CR4 X;  3EVR A;  1DJH A;  2LLU A;  4YGA A;  2FCE A;  3CZT X;  1SMG A;  3TUY C;  1XA5 A;  1ALV A;  2L98 A;  2JU0 A;  1EJ3 A;  1KQV A;  4YGC B;  1QIW A;  1W7J B;  5DKQ A;  3NSI A;  1CB1 A;  2M7N A;  4TNC A;  2LUX A;  4XJK A;  2QPT A;  4PHM A;  1CDP A;  1CLM A;  1CTR A;  3OB1 B;  1TTX A;  2HQW A;  1ZAC A;  1NX2 A;  1S6J A;  1V1G A;  1A75 B;  4PHN A;  3LK1 A;  2LAP A;  2Y1M A;  3EKH A;  3FS7 A;  1B1G A;  3C1V A;  4DRW A;  1QV1 A;  2OTG C;  2K61 A;  1N65 A;  1WLZ A;  3KEV A;  5HKY A;  1IWQ A;  1TNW A;  3GK4 X;  5HLO A;  1A03 A;  1CNP A;  1J7O A;  1TNQ A;  2WOS A;  1TNP A;  1DF0 B;  1MXL C;  1BT6 A;  3LLE A;  2MLF C;  2PSR A;  1AJ4 A;  1XFV O;  2JXC A;  1K8U A;  3BXK A;  1TN4 A;  1XO5 A;  4DCK A;  1DJX A;  2ZND A;  1BLQ A;  3O4Y A;  3TDZ A;  1IG5 A;  1YVH A;  5CSF A;  4ZCU A;  1QIV A;  1WY9 A;  1SW8 A;  1B8R A;  5HLV A;  2M7L A;  1D1O A;  1CKK A;  3SIB A;  3VRQ A;  2Q91 A;  1YX8 A;  1EXR A;  2HET A;  1KSM A;  2JWW A;  1SPY A;  1LA3 A;  3JTD B;  3PAL A;  2F2O A;  4A4B A;  2MRD A;  2M49 B;  2LAN A;  3WNX B;  1G33 A;  2BEC A;  1BR4 B;  2D8N A;  2O5G A;  1QS7 A;  1ALW A;  1OMR A;  5JOL A;  3I5H C;  3DVJ A;  1Q80 A;  1UHH A;  3OHM B;  1B47 A;  2K2F A;  1JUO A;  1Y1X A;  4HRH A;  2BKI B;  1IQ3 A;  1NP8 A;  5TNC A;  1L7Z A;  3AAJ A;  1KCY A;  1OMD A;  2LNK A;  2K2A A;  2LMV A;  5CSI A;  1G8I A;  3FWC A;  3VGO A;  1KFX S;  3DF0 A;  4DUQ A;  2DOQ A;  2RGI A;  3TZ1 A;  1CLB A;  1R2U A;  4OCI A;  4QJ3 B;  5CSN A;  3PFV A;  1AP4 A;  5I2L A;  1PAL A;  1IQ5 A;  1XFZ O;  1YR5 A;  2KQY A;  3O6B A;  2K7O A;  1OQP A;  2L0P A;  3I5G C;  1AUI B;  1B8C A;  1OZS A;  2G9B A;  1K94 A;  1IKU A;  1XYD A;  1WRZ A;  2PVB A;  1J55 A;  1QXP A;  1PUL A;  3H4S E;  4YI9 A;  2M1K B;  3AAK A;  2COL B;  2LLT A;  5KTY A;  2CTN A;  1MHO A;  3KO0 A;  1XFU O;  2M0R A;  3I5F C;  1VRK A;  2KQ6 A;  1FI5 A;  1QX5 B;  4I5L B;  4PAL A;  1IH0 A;  1TOP A;  3SG3 A;  2L51 A;  2M8U A;  3SG4 A;  3DD4 A;  2KI4 B;  1RK9 A;  3BUX B;  1N2D A;  1F54 A;  3TUY B;  2V53 A;  1SL7 A;  2JZI A;  1K9U A;  3KF9 A;  2JRF A;  1MQ1 A;  1EL4 A;  1QVI Y;  2BE6 A;  3BUW B;  4I5J A;  5ER4 X;  2BBN A;  1S3P A;  2LC5 A;  2OPO A;  1EG3 A;  1JF0 A;  2PRU A;  2OS8 B;  1B9A A;  2MBX A;  4N1F A;  1DVI A;  2JXL A;  1R6P A;  1HQV A;  3VRR A;  1F4Q A;  2LE9 B;  1YUS A;  3TDU A;  1YUU A;  2KHN A;  1MXE A;  2MLE C;  1NWD A;  3SG2 A;  2OTG B;  2K7B A;  4ETO A;  2WC8 A;  1TCF A;  1QLK A;  2F8P A;  2Y4Q A;  4NQG A;  4YRU A;  1UHN A;  1FI6 A;  1BG1 A;  2LVI A;  2WOR A;  2GGM A;  3BYA A;  1F70 A;  1KK7 Z;  1CFC A;  1B8L A;  1LVC D;  1RJV A;  5PAL A;  2KI6 D;  1YTZ C;  4USL A;  2NLN A;  4BY5 A;  2KAY A;  1L2O B;  1J7Q A;  3FWB A;  2H61 A;  5I2O A;  2Q4U A;  2F2P A;  4FTG A;  1H8B A;  4IL1 A;  2LP3 A;  3CWG A;  2GGZ A;  1K9P A;  1C7W A;  2ZKM X;  2EC6 B;  2EGD A;  1QV0 A;  4MLW A;  4N5X A;  4AQI A;  1CM4 A;  2KGB C;  2M29 A;  1KFU S;  1KK8 C;  4PE7 A;  1WRL A;  1SYM A;  2ZFD A;  2PMY A;  4OV2 A;  3O2P A;  2EHB A;  1LIN A;  1CM1 A;  1S5G Z;  5D69 A;  4MRX A;  1SCM B;  1UHK A;  2Y1N A;  1BOD A;  1K9K A;  5I2Q A;  2LVJ A;  1BU3 A;  1WLM A;  3I5H B;  2LHL A;  4ORB B;  2ZRS A;  3JVT C;  2WCF A;  4MRY A;  3VRN A;  3DVM A;  1G4Y R;  1SNL A;  1J7P A;  1UHI A;  1ZFS A;  1GJY A;  2JPT A;  3O78 A;  1N0Y A;  4GBA A;  5BPJ A;  1TNX A;  1QJT A;  2AUC A;  1KWO C;  1KK7 Y;  3NSL A;  1S36 A;  2KFF A;  1TCO B;  4JPZ B;  4OVN F;  4CLN A;  3A4U B;  1JSA A;  4XJK B;  3QRX A;  1S6I A;  3AKA A;  2KAV A;  1SR6 C;  3F45 A;  2FCD A;  4NDC A;  1BR1 B;  1SL8 A;  1UWO A;  2KYF A;  3DVE A;  3EVV A;  2K7C A;  2KAX A;  2KYC A;  3BQ3 A;  1M46 A;  1QVI Z;  2AMI A;  4OKH A;  2I18 A;  1FBV A;  3I5I C;  1UUR A;  4ZCV A;  3ZNI A;  3NSK A;  1JWD A;  4MSP A;  3NSO A;  2KFG A;  4XYN A;  2KI6 C;  2MAZ A;  3PSR A;  1S5G Y;  2L5X B;  2JC2 A;  2LLS A;  2NXQ A;  3WXA A;  1DJZ A;  2BCB A;  2WND A;  3M0W A;  1BF5 A;  1OZO A;  5D7F A;  3CR5 X;  1SRA A;  5K89 A;  4GFT A;  2IS9 A;  1KQM B; 
#chains in the Genus database with same CATH topology
 2KBI A;  2H61 C;  3BUN B;  1Y1U A;  1J7R A;  4GGN A;  4NDD A;  1CDL A;  1NX3 A;  3BJH A;  3RLZ A;  1GGW A;  2WCB A;  3RM1 A;  3D0Y A;  4GUK A;  4C0L A;  3D76 A;  2CNP A;  4MN0 A;  3GK2 A;  4P5O E;  2WC5 A;  1MWN A;  3CS1 A;  2LCP A;  3TS5 B;  1Y1A A;  4MZJ A;  2SAS A;  3D10 A;  1TRF A;  3CDN A;  3LL8 B;  5I8N A;  1A2X A;  5HL1 A;  1SBJ A;  3R72 A;  4D1E A;  2JNX A;  3SJS A;  1RWY A;  2HF5 A;  2F33 A;  2WCJ A;  3CGA A;  1ODB A;  2LM5 A;  2FJU B;  1MR8 A;  4C0J A;  1SY9 A;  4HRG A;  4YGD B;  5AAN A;  3OGN A;  2ZRT A;  1LKJ A;  2NZ0 A;  5JJG A;  5B8I B;  5KU1 A;  1J1E A;  1QAS A;  1OMV A;  2I94 A;  4FQT A;  5DKN A;  1PVB A;  2LV7 A;  2ZNE A;  1B4C A;  1JFJ A;  3EK7 A;  1OOG A;  2B1U A;  3ZWH A;  4KYN A;  1DJY A;  4MBE A;  1NYA A;  5FI7 A;  3UNW A;  3BFA A;  1DJG A;  3PN7 C;  2JTT A;  1XFR A;  1A75 A;  2VRG A;  3B86 A;  3R1O A;  1DEL A;  2WCE A;  3DF0 B;  2NCO A;  2PAS A;  3K21 A;  5EL2 A;  1CDM A;  4C0K A;  4JQ0 D;  2LP2 A;  1IRJ A;  1NCZ A;  2KFH A;  2YGU A;  3CAB A;  3S0D A;  3BUM B;  1KK8 B;  3TDI A;  1BJF A;  5F6T A;  5GQQ C;  2KLD A;  3KPX A;  2JOJ A;  2KPH A;  1TIZ A;  1CFP A;  1DF0 A;  1U5I B;  2Y5I A;  3OX6 A;  5HKZ A;  1FF1 A;  3IF7 A;  1DT7 B;  1OE9 B;  4CFR A;  4PE0 A;  2KOT A;  2R2I A;  3B87 A;  4N1G A;  3EKJ A;  4U8D A;  1DJW A;  5CPV A;  1YVL A;  3SIA A;  1XVJ A;  2CBL A;  2MHH A;  2MJW B;  4M2O A;  1TUZ A;  1CMG A;  3BOW B;  3EK8 A;  3NXA A;  2M9G A;  1MUX A;  2LMT A;  3JVT B;  2KSP A;  4ICB A;  4BY4 A;  3MSE B;  2JT8 A;  3OB2 B;  4YGE B;  3D77 A;  4WRI A;  1A4P A;  2GV5 A;  3KHE A;  5HYD A;  1XFY O;  2JQ6 A;  1YRU B;  2AAO A;  4PHK A;  1K95 A;  3IQQ A;  2BL0 C;  4I5N B;  1IJ6 A;  1WRK A;  3UO9 A;  1AK8 A;  2KI4 C;  1ZUZ A;  3VRP A;  1KWO B;  1K2H A;  1AVS A;  2LHI A;  1Y0V H;  2JNF A;  4GGF A;  2L4I A;  3OBV A;  1DJI A;  1OW4 A;  4Q04 A;  3PLF B;  4YBH B;  1WDC C;  2LUC A;  3PAT A;  2HQ8 A;  4NDB A;  1OOJ A;  1S6C A;  1K96 A;  3SG7 A;  3PM8 A;  1DQE A;  2OS8 C;  1SR6 B;  3PJI A;  3WHU B;  1KFX L;  4GAO A;  5IBW A;  2ZN8 A;  3O4X A;  5HKW A;  1SL9 A;  2L50 A;  1IJ5 A;  2O60 A;  1FW4 A;  1AHR A;  1PSB A;  3BUO B;  1OSA A;  1YUT A;  2CCM A;  4M2P A;  3LCP C;  1NSH A;  3I5I B;  5AEQ A;  3SG5 A;  1IGV A;  2L4H A;  3DVK A;  4MZK A;  1K93 D;  1M31 A;  4F0Z B;  2K8M B;  1DGU A;  2MA2 A;  2FJY A;  1M45 A;  3DY9 A;  4CID A;  4PE4 A;  1V1F A;  1JBA A;  2JTZ A;  2H2K A;  3B7A A;  1ZMZ A;  1NUB A;  3OX5 A;  3GK1 A;  1DMO A;  3E3R A;  1SK6 D;  1F4O A;  4P2Y B;  1L2O C;  1RTP 1;  2E30 A;  1FPW A;  1YUR A;  1W9Z A;  1XK4 A;  2KGR A;  4L9M A;  2QEB A;  1NCY A;  4DIR A;  3DZT A;  2EC6 C;  4PCW A;  2QEO A;  2GTE A;  3I5G B;  2BE4 A;  4OR9 B;  1REC A;  2K7D A;  3SS3 A;  2F3Y A;  3FE9 A;  5AER A;  1BMO A;  4PDZ A;  2TN4 A;  3CLN A;  1NX1 A;  1UHJ A;  1QAT A;  2WCH A;  2M97 A;  2QEV A;  4DS7 A;  1M39 A;  3NGV A;  1B7T Z;  2BCX A;  2E6W A;  2F3Z A;  3I5F B;  3HCM A;  1LXF C;  2NCP A;  2M1U A;  4M2Q A;  4AOM A;  2HPS A;  3ICB A;  1PSR A;  1QLS A;  1SCM C;  4YI8 A;  2PAL A;  1RFJ A;  3IQO A;  3GOF A;  1PVA A;  5DKR A;  2P71 A;  4AQJ A;  4FQO A;  2K0J A;  1CDN A;  3HX4 A;  4WQ2 A;  3S0B A;  1YX7 A;  1PRW A;  2KDH A;  3S0F A;  1JF2 A;  1QWV A;  2M3W A;  2K60 A;  1CFD A;  1UP5 A;  1HT9 A;  4ORC B;  1ZOT B;  4A4C A;  1PK0 D;  1QX2 A;  4HSZ A;  1X02 A;  1IIO A;  3PN7 B;  2ISD A;  1OOF A;  1SSE B;  4GGF C;  3S0G A;  3JTD C;  4MEW A;  2JUL A;  4QJ4 B;  4MZL A;  3WHT B;  1M63 B;  2A4J A;  1W7I B;  1EG4 A;  1NX0 A;  3L4L A;  3LK0 A;  1CFF A;  1EH2 A;  1Y6W A;  1F8H A;  3VRO A;  1P28 A;  3FIA A;  1SKT A;  1C7V A;  4CPV A;  3EK4 A;  1CMF A;  3A8R A;  1E8A A;  2I7A A;  4HRE E;  2KBM A;  4WQ3 A;  1U5I A;  2PQL A;  1XFW O;  2JT0 A;  1F71 A;  4INX A;  5AFP A;  1KFU L;  2KNE A;  2G2B A;  2ZN9 A;  1DGV A;  2WC6 A;  2P6B B;  3CR2 A;  4MVF A;  1C07 A;  1JFK A;  4E68 A;  1GQM A;  2I2R E;  4PE1 A;  4I5K A;  4PHJ A;  1XFX O;  3BOW A;  3B6X A;  3N7H A;  1QTX A;  2LMU A;  5ER5 A;  2CXJ A;  1B7T Y;  3SG6 A;  1H4B A;  1KSO A;  1S1E A;  5G08 A;  1DTL A;  1A29 A;  5AXI A;  1CLL A;  2FOT A;  2QAC A;  2BL0 B;  3CTN A;  2JT3 A;  3OP0 A;  1NIW A;  1MF8 B;  1KQM C;  1JC2 A;  1GM0 A;  1S26 D;  1LA0 A;  2CT9 A;  5J3X A;  1UUS A;  1XK4 C;  1SCV A;  1K90 D;  1WDC B;  4QJ5 B;  1GGZ A;  4GNK B;  5KSZ A;  1RRO A;  1Z2C B;  3D0Y B;  4JWQ A;  4GPL B;  1NCX A;  1ORG A;  2LVK A;  3BFB A;  2SCP A;  4ORA B;  3TS5 C;  1J1D A;  5CSJ A;  1F55 A;  2H8V A;  1YRT B;  2LVV A;  1QX7 A;  5FYX A;  4YGB B;  4UPG A;  1AJ5 A;  4R1E A;  3D74 A;  2L2E A;  1NPQ A;  1BOC A;  2BKH B;  4CFQ A;  2BCA A;  3EVU A;  2BBM A;  4INW A;  2WCL A;  3AKB A;  3CR4 X;  1DJH A;  2LLU A;  3EVR A;  4YGA A;  2FCE A;  3CZT X;  1SMG A;  3TUY C;  1XA5 A;  1ALV A;  2L98 A;  2JU0 A;  2BNX A;  1EJ3 A;  1KQV A;  4YGC B;  1QIW A;  1W7J B;  5DKQ A;  3NSI A;  2L5Y A;  1CB1 A;  3QME A;  2M7N A;  4TNC A;  2LUX A;  3CZ2 A;  4XJK A;  2QPT A;  4PHM A;  1CDP A;  1CLM A;  1CTR A;  3OB1 B;  1TTX A;  2HQW A;  1ZAC A;  1NX2 A;  1S6J A;  1V1G A;  1A75 B;  4PHN A;  3B88 A;  3LK1 A;  3L4A A;  2LAP A;  2Y1M A;  3EKH A;  3FS7 A;  1B1G A;  3K1E A;  3C1V A;  4DRW A;  1QV1 A;  2OTG C;  2K61 A;  2QEH A;  1N65 A;  1WLZ A;  3KEV A;  5HKY A;  1IWQ A;  3L47 A;  1TNW A;  4F7F A;  3GK4 X;  5HLO A;  1A03 A;  1CNP A;  1J7O A;  1T14 A;  1TNQ A;  2WOS A;  1TNP A;  1DF0 B;  1MXL C;  1BT6 A;  3LLE A;  2MLF C;  2PSR A;  3BFH A;  2ERB A;  1AJ4 A;  1XFV O;  2JXC A;  3D78 A;  1K8U A;  3BXK A;  1TN4 A;  1XO5 A;  4DCK A;  1DJX A;  2ZND A;  1OOI X;  1BLQ A;  3O4Y A;  3TDZ A;  1IG5 A;  1YVH A;  5CSF A;  3EG5 B;  4ZCU A;  1QIV A;  2WCK A;  1WY9 A;  1SW8 A;  1B8R A;  5HLV A;  2M7L A;  3SS4 A;  1D1O A;  1CKK A;  3SIB A;  3VRQ A;  2Q91 A;  1YX8 A;  1EXR A;  2HET A;  1KSM A;  2JWW A;  1SPY A;  1LA3 A;  3JTD B;  3PAL A;  2F2O A;  4A4B A;  2MRD A;  2M49 B;  2LAN A;  3WNX B;  3NHI A;  1G33 A;  2QDI A;  2BEC A;  1BR4 B;  2D8N A;  2O5G A;  1QS7 A;  1ALW A;  1OMR A;  5JOL A;  3I5H C;  3DVJ A;  1Q80 A;  4IJ7 A;  1UHH A;  3SS5 A;  3OHM B;  1B47 A;  2K2F A;  1JUO A;  1Y1X A;  4HRH A;  4PT1 A;  2BKI B;  3FE6 A;  1NP8 A;  5TNC A;  1L7Z A;  1IQ3 A;  3AAJ A;  1DEK A;  1OMD A;  1KCY A;  2LNK A;  2K2A A;  2LMV A;  5CSI A;  1G8I A;  3FWC A;  3VGO A;  1KFX S;  3DF0 A;  3VB1 A;  4DUQ A;  2DOQ A;  2RGI A;  3TZ1 A;  1CLB A;  1R2U A;  4OCI A;  4QJ3 B;  5CSN A;  3PFV A;  1AP4 A;  3D75 A;  5I2L A;  1PAL A;  1IQ5 A;  1XFZ O;  2PYQ A;  3Q8I A;  1YR5 A;  2KQY A;  3O6B A;  4OZD A;  2K7O A;  1OQP A;  3V2L A;  3CZ1 A;  2L0P A;  3I5G C;  1AUI B;  1TUJ A;  1B8C A;  1OZS A;  2G9B A;  1K94 A;  1IKU A;  1XYD A;  1WRZ A;  2PVB A;  3DYE A;  1J55 A;  1QXP A;  1PUL A;  3H4S E;  4YI9 A;  2M1K B;  3AAK A;  2COL B;  2LLT A;  5KTY A;  2CTN A;  1MHO A;  3KO0 A;  1Z4H A;  1XFU O;  2M0R A;  3I5F C;  1VRK A;  2KQ6 A;  1FI5 A;  1QX5 B;  4I5L B;  4PAL A;  1IH0 A;  1TOP A;  3SG3 A;  2L51 A;  2M8U A;  3SG4 A;  3DD4 A;  2KI4 B;  1RK9 A;  3BUX B;  1N2D A;  1F54 A;  3TUY B;  2V53 A;  4JD9 A;  1SL7 A;  2JZI A;  1K9U A;  3KF9 A;  2JRF A;  1MQ1 A;  1EL4 A;  1QVI Y;  2BE6 A;  3BUW B;  4I5J A;  3NHT A;  5ER4 X;  4JKT A;  2BBN A;  1S3P A;  2LC5 A;  2OPO A;  1EG3 A;  1JF0 A;  2PRU A;  2OS8 B;  1B9A A;  2MBX A;  4N1F A;  1TWO A;  1DVI A;  2JXL A;  1R6P A;  1HQV A;  3VRR A;  1F4Q A;  2LE9 B;  1YUS A;  3TDU A;  1YUU A;  2KHN A;  1MXE A;  5D3O A;  3R1V A;  2MLE C;  1NWD A;  3SG2 A;  2OTG B;  2K7B A;  4ETO A;  2WC8 A;  1TCF A;  1QLK A;  2F8P A;  2Y4Q A;  4NQG A;  1DC1 A;  4YRU A;  1UHN A;  1FI6 A;  1BG1 A;  2LVI A;  2WOR A;  2GGM A;  3BYA A;  1F70 A;  1KK7 Z;  1CFC A;  2L2C A;  1B8L A;  1LVC D;  1RJV A;  5PAL A;  2KI6 D;  3PM2 A;  1YTZ C;  4USL A;  2NLN A;  4BY5 A;  2KAY A;  1L2O B;  1J7Q A;  3FWB A;  2H61 A;  5I2O A;  2Q4U A;  2F2P A;  4FTG A;  1H8B A;  3FE8 A;  4IL1 A;  5FI2 A;  2LP3 A;  3CWG A;  2GGZ A;  1K9P A;  1C7W A;  2ZKM X;  2EC6 B;  2EGD A;  1QV0 A;  4MLW A;  4N5X A;  4AQI A;  3IVT A;  1CM4 A;  3S0A A;  2KGB C;  2M29 A;  1KFU S;  1C3Y A;  1KK8 C;  4PE7 A;  3RZS A;  2P70 A;  1WRL A;  1SYM A;  2ZFD A;  2PMY A;  3R1P A;  4OV2 A;  3O2P A;  2EHB A;  1LIN A;  3DXL A;  1CM1 A;  1S5G Z;  5D69 A;  4MRX A;  1SCM B;  1UHK A;  2Y1N A;  1BOD A;  1K9K A;  5I2Q A;  2LVJ A;  1BU3 A;  3S0E A;  1WLM A;  3I5H B;  2LHL A;  4ORB B;  2ZRS A;  3JVT C;  2WCF A;  4MRY A;  3VRN A;  3DVM A;  3CZ0 A;  1G4Y R;  1SNL A;  1J7P A;  1UHI A;  1ZFS A;  1GJY A;  2JPT A;  3O78 A;  1N0Y A;  4GBA A;  5BPJ A;  1TNX A;  1QJT A;  2AUC A;  1KWO C;  1KK7 Y;  3NSL A;  5DIC A;  1S36 A;  2KFF A;  1TCO B;  4JPZ B;  4OVN F;  4CLN A;  3A4U B;  1JSA A;  4XJK B;  3QRX A;  1S6I A;  3D73 A;  3AKA A;  2KAV A;  1SR6 C;  2KLE A;  3F45 A;  2FCD A;  2WCM A;  4NDC A;  1BR1 B;  1SL8 A;  1UWO A;  2KYF A;  5FI6 A;  3DVE A;  3EVV A;  5I94 A;  2K7C A;  2KAX A;  2KYC A;  3BQ3 A;  1M46 A;  1QVI Z;  2AMI A;  4OKH A;  1LS8 A;  2I18 A;  1FBV A;  3I5I C;  1UUR A;  2BAP A;  4ZCV A;  3ZNI A;  3NSK A;  1OOH A;  1JWD A;  4MSP A;  3NSO A;  2KFG A;  4XYN A;  2KI6 C;  2MAZ A;  3PSR A;  1S5G Y;  2L5X B;  2JC2 A;  2LLS A;  2NXQ A;  3WXA A;  1DJZ A;  2BCB A;  2WND A;  3M0W A;  3CYZ A;  1BF5 A;  1C3Z A;  1OZO A;  2JPO A;  3CR5 X;  5D7F A;  1SRA A;  5K89 A;  4GFT A;  2IS9 A;  1KQM B; 
#chains in the Genus database with same CATH homology
 2KBI A;  2H61 C;  3BUN B;  1Y1U A;  1J7R A;  4GGN A;  4NDD A;  1CDL A;  1NX3 A;  3RLZ A;  1GGW A;  2WCB A;  3RM1 A;  3D0Y A;  4GUK A;  4C0L A;  2CNP A;  4MN0 A;  3GK2 A;  4P5O E;  1MWN A;  3CS1 A;  2LCP A;  3TS5 B;  1Y1A A;  4MZJ A;  2SAS A;  3D10 A;  1TRF A;  3LL8 B;  5I8N A;  1A2X A;  1SBJ A;  4D1E A;  2JNX A;  3SJS A;  1RWY A;  2HF5 A;  2F33 A;  3CGA A;  1ODB A;  2LM5 A;  2FJU B;  1MR8 A;  4C0J A;  1SY9 A;  4HRG A;  4YGD B;  5AAN A;  2ZRT A;  1LKJ A;  2NZ0 A;  5JJG A;  5B8I B;  5KU1 A;  1J1E A;  1QAS A;  1OMV A;  2I94 A;  5DKN A;  1JFJ A;  1PVB A;  2LV7 A;  2ZNE A;  1B4C A;  3EK7 A;  2B1U A;  3ZWH A;  1DJY A;  4MBE A;  1NYA A;  1DJG A;  3PN7 C;  2JTT A;  1A75 A;  2VRG A;  2WCE A;  3DF0 B;  2NCO A;  2PAS A;  3K21 A;  1CDM A;  4C0K A;  4JQ0 D;  2LP2 A;  1IRJ A;  1NCZ A;  2KFH A;  3BUM B;  1KK8 B;  3TDI A;  1BJF A;  5F6T A;  5GQQ C;  3KPX A;  2JOJ A;  1FF1 A;  1TIZ A;  1CFP A;  1DF0 A;  1U5I B;  2Y5I A;  3OX6 A;  5HKZ A;  3IF7 A;  1DT7 B;  1OE9 B;  4CFR A;  4PE0 A;  2KOT A;  2R2I A;  4N1G A;  3EKJ A;  4U8D A;  1DJW A;  5CPV A;  1YVL A;  3SIA A;  1XVJ A;  2CBL A;  2MHH A;  2MJW B;  4M2O A;  1CMG A;  3BOW B;  3EK8 A;  3NXA A;  2M9G A;  1MUX A;  2LMT A;  3JVT B;  2KSP A;  4ICB A;  4BY4 A;  3MSE B;  2JT8 A;  3OB2 B;  4YGE B;  4WRI A;  1A4P A;  2GV5 A;  3KHE A;  5HYD A;  1XFY O;  2JQ6 A;  1YRU B;  2AAO A;  4PHK A;  1K95 A;  3IQQ A;  2BL0 C;  4I5N B;  1IJ6 A;  1WRK A;  1AK8 A;  2KI4 C;  1ZUZ A;  3VRP A;  1KWO B;  1K2H A;  1AVS A;  2LHI A;  1Y0V H;  2JNF A;  4GGF A;  2L4I A;  1DJI A;  4Q04 A;  3PLF B;  4YBH B;  1WDC C;  2LUC A;  3PAT A;  2HQ8 A;  4NDB A;  1OOJ A;  1S6C A;  1K96 A;  3SG7 A;  3PM8 A;  2OS8 C;  1SR6 B;  3WHU B;  1KFX L;  4GAO A;  5IBW A;  2ZN8 A;  5HKW A;  1SL9 A;  2L50 A;  1IJ5 A;  2O60 A;  1FW4 A;  1AHR A;  1PSB A;  3BUO B;  1OSA A;  1YUT A;  2CCM A;  4M2P A;  3LCP C;  1NSH A;  3I5I B;  5AEQ A;  3SG5 A;  1IGV A;  2L4H A;  3DVK A;  4MZK A;  1K93 D;  1M31 A;  4F0Z B;  2K8M B;  1DGU A;  2MA2 A;  1M45 A;  4CID A;  4PE4 A;  1V1F A;  1JBA A;  2JTZ A;  2H2K A;  1ZMZ A;  1NUB A;  3OX5 A;  3GK1 A;  1DMO A;  3E3R A;  1SK6 D;  1F4O A;  4P2Y B;  1L2O C;  1RTP 1;  2E30 A;  1FPW A;  1YUR A;  1XK4 A;  2KGR A;  4L9M A;  1NCY A;  4DIR A;  2EC6 C;  4PCW A;  3I5G B;  2BE4 A;  4OR9 B;  1REC A;  2K7D A;  2F3Y A;  5AER A;  1BMO A;  4PDZ A;  2TN4 A;  3CLN A;  1NX1 A;  1UHJ A;  1QAT A;  2M97 A;  4DS7 A;  1M39 A;  1B7T Z;  2BCX A;  2E6W A;  2F3Z A;  3I5F B;  3HCM A;  1LXF C;  2NCP A;  2M1U A;  4M2Q A;  4AOM A;  2HPS A;  3ICB A;  1PSR A;  1QLS A;  1SCM C;  4YI8 A;  2PAL A;  1RFJ A;  3IQO A;  3GOF A;  1PVA A;  5DKR A;  4AQJ A;  4FQO A;  2K0J A;  1CDN A;  3HX4 A;  4WQ2 A;  1YX7 A;  1PRW A;  2KDH A;  1JF2 A;  2M3W A;  1CFD A;  1UP5 A;  1HT9 A;  4ORC B;  1ZOT B;  4A4C A;  1PK0 D;  1QX2 A;  4HSZ A;  1X02 A;  3PN7 B;  2ISD A;  4GGF C;  3JTD C;  4MEW A;  2JUL A;  4QJ4 B;  4MZL A;  3WHT B;  1M63 B;  2A4J A;  1W7I B;  1EG4 A;  1NX0 A;  3LK0 A;  1CFF A;  1EH2 A;  1F8H A;  1Y6W A;  3VRO A;  3FIA A;  1SKT A;  1C7V A;  4CPV A;  3EK4 A;  1CMF A;  3A8R A;  1E8A A;  2I7A A;  4HRE E;  2KBM A;  4WQ3 A;  1U5I A;  1XFW O;  2JT0 A;  1F71 A;  5AFP A;  1KFU L;  2KNE A;  2G2B A;  2ZN9 A;  1DGV A;  2P6B B;  3CR2 A;  4MVF A;  1C07 A;  1JFK A;  4E68 A;  1GQM A;  2I2R E;  4PE1 A;  4I5K A;  4PHJ A;  1XFX O;  3BOW A;  1QTX A;  2LMU A;  5ER5 A;  2CXJ A;  1B7T Y;  3SG6 A;  1H4B A;  1KSO A;  1S1E A;  5G08 A;  1DTL A;  1A29 A;  5AXI A;  1CLL A;  2FOT A;  2QAC A;  2BL0 B;  3CTN A;  2JT3 A;  3OP0 A;  1NIW A;  1MF8 B;  1KQM C;  1JC2 A;  1S26 D;  1LA0 A;  2CT9 A;  5J3X A;  1UUS A;  1SCV A;  1WDC B;  1K90 D;  1XK4 C;  4QJ5 B;  1GGZ A;  4GNK B;  5KSZ A;  1RRO A;  3D0Y B;  4JWQ A;  4GPL B;  1NCX A;  2LVK A;  2SCP A;  4ORA B;  3TS5 C;  1J1D A;  5CSJ A;  1F55 A;  1YRT B;  2LVV A;  1QX7 A;  5FYX A;  4YGB B;  4UPG A;  1AJ5 A;  4R1E A;  2L2E A;  1NPQ A;  1BOC A;  2BKH B;  4CFQ A;  2BCA A;  3EVU A;  2BBM A;  3AKB A;  3CR4 X;  3EVR A;  1DJH A;  2LLU A;  4YGA A;  2FCE A;  3CZT X;  1SMG A;  3TUY C;  1XA5 A;  1ALV A;  2L98 A;  2JU0 A;  1EJ3 A;  1KQV A;  4YGC B;  1QIW A;  1W7J B;  5DKQ A;  3NSI A;  1CB1 A;  2M7N A;  4TNC A;  2LUX A;  4XJK A;  2QPT A;  4PHM A;  1CDP A;  1CLM A;  1CTR A;  3OB1 B;  1TTX A;  2HQW A;  1ZAC A;  1NX2 A;  1S6J A;  1V1G A;  1A75 B;  4PHN A;  3LK1 A;  2LAP A;  2Y1M A;  3EKH A;  3FS7 A;  1B1G A;  3C1V A;  4DRW A;  1QV1 A;  2OTG C;  2K61 A;  1N65 A;  1WLZ A;  3KEV A;  5HKY A;  1IWQ A;  1TNW A;  3GK4 X;  5HLO A;  1A03 A;  1CNP A;  1J7O A;  1TNQ A;  2WOS A;  1TNP A;  1DF0 B;  1MXL C;  1BT6 A;  3LLE A;  2MLF C;  2PSR A;  1AJ4 A;  1XFV O;  2JXC A;  1K8U A;  3BXK A;  1TN4 A;  1XO5 A;  4DCK A;  1DJX A;  2ZND A;  1BLQ A;  3O4Y A;  3TDZ A;  1IG5 A;  1YVH A;  5CSF A;  4ZCU A;  1QIV A;  1WY9 A;  1SW8 A;  1B8R A;  5HLV A;  2M7L A;  1D1O A;  1CKK A;  3SIB A;  3VRQ A;  2Q91 A;  1YX8 A;  1EXR A;  2HET A;  1KSM A;  2JWW A;  1SPY A;  1LA3 A;  3JTD B;  3PAL A;  2F2O A;  4A4B A;  2MRD A;  2M49 B;  2LAN A;  3WNX B;  1G33 A;  2BEC A;  1BR4 B;  2D8N A;  2O5G A;  1QS7 A;  1ALW A;  1OMR A;  5JOL A;  3I5H C;  3DVJ A;  1Q80 A;  1UHH A;  3OHM B;  1B47 A;  2K2F A;  1JUO A;  1Y1X A;  4HRH A;  2BKI B;  1IQ3 A;  1NP8 A;  5TNC A;  1L7Z A;  3AAJ A;  1KCY A;  1OMD A;  2LNK A;  2K2A A;  2LMV A;  5CSI A;  1G8I A;  3FWC A;  3VGO A;  1KFX S;  3DF0 A;  4DUQ A;  2DOQ A;  2RGI A;  3TZ1 A;  1CLB A;  1R2U A;  4OCI A;  4QJ3 B;  5CSN A;  3PFV A;  1AP4 A;  5I2L A;  1PAL A;  1IQ5 A;  1XFZ O;  1YR5 A;  2KQY A;  3O6B A;  2K7O A;  1OQP A;  2L0P A;  3I5G C;  1AUI B;  1B8C A;  1OZS A;  2G9B A;  1K94 A;  1IKU A;  1XYD A;  1WRZ A;  2PVB A;  1J55 A;  1QXP A;  1PUL A;  3H4S E;  4YI9 A;  2M1K B;  3AAK A;  2COL B;  2LLT A;  5KTY A;  2CTN A;  1MHO A;  3KO0 A;  1XFU O;  2M0R A;  3I5F C;  1VRK A;  2KQ6 A;  1FI5 A;  1QX5 B;  4I5L B;  4PAL A;  1IH0 A;  1TOP A;  3SG3 A;  2L51 A;  2M8U A;  3SG4 A;  3DD4 A;  2KI4 B;  1RK9 A;  3BUX B;  1N2D A;  1F54 A;  3TUY B;  2V53 A;  1SL7 A;  2JZI A;  1K9U A;  3KF9 A;  2JRF A;  1MQ1 A;  1EL4 A;  1QVI Y;  2BE6 A;  3BUW B;  4I5J A;  5ER4 X;  2BBN A;  1S3P A;  2LC5 A;  2OPO A;  1EG3 A;  1JF0 A;  2PRU A;  2OS8 B;  1B9A A;  2MBX A;  4N1F A;  1DVI A;  2JXL A;  1R6P A;  1HQV A;  3VRR A;  1F4Q A;  2LE9 B;  1YUS A;  3TDU A;  1YUU A;  2KHN A;  1MXE A;  2MLE C;  1NWD A;  3SG2 A;  2OTG B;  2K7B A;  4ETO A;  2WC8 A;  1TCF A;  1QLK A;  2F8P A;  2Y4Q A;  4NQG A;  4YRU A;  1UHN A;  1FI6 A;  1BG1 A;  2LVI A;  2WOR A;  2GGM A;  3BYA A;  1F70 A;  1KK7 Z;  1CFC A;  1B8L A;  1LVC D;  1RJV A;  5PAL A;  2KI6 D;  1YTZ C;  4USL A;  2NLN A;  4BY5 A;  2KAY A;  1L2O B;  1J7Q A;  3FWB A;  2H61 A;  5I2O A;  2Q4U A;  2F2P A;  4FTG A;  1H8B A;  4IL1 A;  2LP3 A;  3CWG A;  2GGZ A;  1K9P A;  1C7W A;  2ZKM X;  2EC6 B;  2EGD A;  1QV0 A;  4MLW A;  4N5X A;  4AQI A;  1CM4 A;  2KGB C;  2M29 A;  1KFU S;  1KK8 C;  4PE7 A;  1WRL A;  1SYM A;  2ZFD A;  2PMY A;  4OV2 A;  3O2P A;  2EHB A;  1LIN A;  1CM1 A;  1S5G Z;  5D69 A;  4MRX A;  1SCM B;  1UHK A;  2Y1N A;  1BOD A;  1K9K A;  5I2Q A;  2LVJ A;  1BU3 A;  1WLM A;  3I5H B;  2LHL A;  4ORB B;  2ZRS A;  3JVT C;  2WCF A;  4MRY A;  3VRN A;  3DVM A;  1G4Y R;  1SNL A;  1J7P A;  1UHI A;  1ZFS A;  1GJY A;  2JPT A;  3O78 A;  1N0Y A;  4GBA A;  5BPJ A;  1TNX A;  1QJT A;  2AUC A;  1KWO C;  1KK7 Y;  3NSL A;  1S36 A;  2KFF A;  1TCO B;  4JPZ B;  4OVN F;  4CLN A;  3A4U B;  1JSA A;  4XJK B;  3QRX A;  1S6I A;  3AKA A;  2KAV A;  1SR6 C;  3F45 A;  2FCD A;  4NDC A;  1BR1 B;  1SL8 A;  1UWO A;  2KYF A;  3DVE A;  3EVV A;  2K7C A;  2KAX A;  2KYC A;  3BQ3 A;  1M46 A;  1QVI Z;  2AMI A;  4OKH A;  2I18 A;  1FBV A;  3I5I C;  1UUR A;  4ZCV A;  3ZNI A;  3NSK A;  1JWD A;  4MSP A;  3NSO A;  2KFG A;  4XYN A;  2KI6 C;  2MAZ A;  3PSR A;  1S5G Y;  2L5X B;  2JC2 A;  2LLS A;  2NXQ A;  3WXA A;  1DJZ A;  2BCB A;  2WND A;  3M0W A;  1BF5 A;  1OZO A;  5D7F A;  3CR5 X;  1SRA A;  5K89 A;  4GFT A;  2IS9 A;  1KQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...