2K7CA

Nmr structure of mg2+-bound cabp1 c-domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
ADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calcium-binding protein 1
publication title NMR Structure of Mg2+-bound CaBP1 C-domain
rcsb
source organism Homo sapiens
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7cA00
1UP5A 2K7DA 1E8AA 1XO5A 2QPTA 3LCPC 1U5IB 2OS8B 1PVAA 1YUSA 1OE9B 1WDCB 1JWDA 1MUXA 2A4JA 2M0RA 3EVUA 3GK2A 4GGNA 5GQQC 1JSAA 1RJVA 2E6WA 1WDCC 2ZFDA 1XFZO 2LVJA 2M1UA 1FBVA 2L4IA 1J7OA 4PE1A 2L4HA 3DVEA 1CDLA 1TTXA 2F8PA 3BUXB 5AXIA 1WRLA 2KAYA 2LLSA 1YX8A 3I5GB 5G08A 3FIAA 3PN7C 2LMUA 3A4UB 2FCEA 2K61A 2LP2A 1JF0A 2BE6A 5AERA 3OB1B 2LCPA 1KFXS 2PRUA 2KI6D 1GQMA 4P5OE 2WC8A 2I94A 4ICBA 4PCWA 3SG2A 4NDDA 2P6BB 3ICBA 3SJSA 1PK0D 2JOJA 3M0WA 4JQ0D 3BUWB 4ZCVA 1S36A 1CFDA 1J7RA 1Q80A 2WCBA 4FTGA 1ZMZA 2JULA 2KHNA 4OR9B 2KQYA 3SG7A 5TNCA 2CNPA 1KK8B 2KBIA 1BR1B 1OSAA 4U8DA 1IG5A 1KK8C 3F45A 2ZRTA 1F71A 1A03A 3EVVA 5ER4X 2H61C 1CNPA 3AKBA 4PHMA 3OP0A 1R6PA 1DJGA 1F4QA 2JT8A 1K9UA 1M63B 1SMGA 1EG3A 4MRXA 3BUOB 1F55A 5PALA 5AFPA 4ZCUA 3TDZA 1J55A 1BR4B 1C7VA 2Y1NA 1NP8A 5AANA 1UHKA 2AAOA 3I5IB 1KSOA 1IRJA 4MN0A 1UHHA 2BBNA 1TOPA 1TN4A 1YR5A 2AMIA 2WCEA 1XFWO 2LUXA 1JF2A 1CDPA 3I5FC 4GPLB 1SPYA 1JBAA 1H4BA 1LINA 1QIVA 2JXCA 4USLA 3TZ1A 1DF0A 2K2AA 1JC2A 2LC5A 2KI6C 1B8CA 1M31A 5F6TA 1G4YR 1NX1A 1OZOA 1RECA 1SR6C 5JOLA 1NYAA 4WQ3A 4P2YB 4HSZA 1SL9A 1OMDA 1UUSA 1NCYA 2LMVA 2ZN8A 1ALVA 1BJFA 2ZKMX 2BCBA 2CXJA 3I5HB 3TS5B 1UHJA 1CLLA 2LNKA 3VRQA 1TCFA 2KBMA 5HYDA 2MHHA 3I5HC 3TS5C 3KF9A 2LLUA 1RROA 2JNXA 1N65A 1RWYA 1PALA 2JZIA 2KDHA 3ZNIA 1NCXA 3VGOA 1CMFA 1CKKA 5AEQA 1CDMA 1EL4A 2F3ZA 4YI9A 2LHLA 2I18A 1SKTA 1NPQA 4GFTA 1SL8A 1A2XA 2H61A 2PALA 1SCMB 3BUNB 1SCMC 2L2EA 2LANA 3DD4A 1KFUL 2MBXA 3PFVA 4C0LA 4FQOA 3E3RA 1M46A 2CTNA 4XYNA 2F33A 3HCMA 4AQJA 1GJYA 4GUKA 4CLNA 5J3XA 1YX7A 1BT6A 1NWDA 2KYFA 2NCOA 5FYXA 5I8NA 1MQ1A 2WCFA 2I2RE 3FWBA 4QJ5B 1K95A 3TDUA 1XVJA 2Y4QA 2BBMA 1NIWA 3KEVA 3WNXB 1FW4A 1Y0VH 2LE9B 3C1VA 1CLMA 3D0YA 1BODA 4ORCB 3VRPA 1FI5A 1QXPA 2JQ6A 2M7LA 5HKZA 5HLOA 2KAXA 1SYMA 1OMRA 4DCKA 1GGZA 1CB1A 3O78A 2CCMA 1AUIB 3SIAA 3VROA 2BE4A 2HQWA 2EHBA 1BU3A 5HKYA 3LL8B 1SNLA 1K96A 2EC6B 2DOQA 4MRYA 4C0KA 2K7BA 1G33A 1DF0B 2EC6C 2BECA 5KSZA 2L0PA 2JPTA 1DVIA 1PVBA 3PN7B 2G2BA 5DKRA 4A4CA 1BMOA 1EH2A 3PALA 5KTYA 3CR2A 1MR8A 1M45A 2Q4UA 1XK4A 1AVSA 2JRFA 4YRUA 1XFVO 2LVKA 3CR5X 1ZACA 5BPJA 2R2IA 1SBJA 2B1UA 2JT3A 3IQOA 4PE0A 2VRGA 4BY5A 1TCOB 2JC2A 3WHTB 1V1FA 1WLMA 1KFXL 5CPVA 1YUTA 1K9PA 1CFCA 2BL0C 2ZNDA 2RGIA 1XFUO 1QASA 3KHEA 1IGVA 2JU0A 1SK6D 2SASA 1S3PA 1ODBA 4PDZA 1CM4A 2MJWB 3QRXA 1DGUA 4YI8A 4F0ZB 4JPZB 2KFGA 3SG4A 1W7JB 3EVRA 1N0YA 1QIWA 2LLTA 1DJHA 5CSIA 2ZRSA 3LK0A 4HRHA 3NSOA 3WHUB 1QS7A 3VRRA 2MAZA 1F54A 3AAJA 1KCYA 2GGZA 2NXQA 3I5FB 4ETOA 4CPVA 1KK7Z 1BG1A 2F2OA 3CZTX 5I2QA 2BCXA 2TN4A 2M8UA 1LA3A 5DKQA 1SL7A 2M1KB 3D0YB 3FWCA 2KI4B 1BF5A 3EKHA 1K94A 4N5XA 2L98A 1VRKA 5B8IB 5IBWA 1K2HA 2KI4C 1SR6B 2Y1MA 2M49B 2JWWA 3BYAA 4CIDA 3ZWHA 1S5GZ 2IS9A 1UHNA 4I5KA 4NDCA 1B1GA 2M97A 3FS7A 1MHOA 1XFYO 4MZJA 2WOSA 1Y1AA 2E30A 1S1EA 1DJIA 1PULA 2BCAA 2BKHB 1LKJA 2KAVA 3O4YA 1QATA 2COLB 4N1FA 1CTRA 2LAPA 2M7NA 3BQ3A 1NUBA 1QLKA 1CM1A 2JTZA 5I2LA 2Y5IA 4YGAA 1MF8B 2K2FA 4YGCB 1NCZA 3DF0B 3LK1A 4N1GA 3HX4A 1J1DA 2L51A 3CS1A 1XK4C 1EG4A 2MA2A 1AJ4A 4A4BA 4HREE 1M39A 1R2UA 1QJTA 3PSRA 1UURA 1L7ZA 4BY4A 1WRZA 3IF7A 4GAOA 2ZNEA 4M2OA 4MZKA 4NDBA 1RTP1 2KYCA 4TNCA 4DS7A 1FI6A 2HQ8A 1X02A 1FPWA 2G9BA 2AUCA 1YVLA 3IQQA 3CGAA 4M2QA 1KFUS 1SY9A 4MZLA 3LLEA 3PATA 4R1EA 3GOFA 4PHKA 4D1EA 4MBEA 1AP4A 1KQVA 3DVJA 1QV1A 3EKJA 5ER5A 2F2PA 1J1EA 1IJ6A 1PSRA 4MEWA 3O6BA 2M29A 1F8HA 2MLEC 4CFQA 2M9GA 1S6JA 2NCPA 5CSJA 2L50A 1Y1XA 3EK8A 2OTGB 1YRTB 2JXLA 1CFPA 5I2OA 4L9MA 2OTGC 1A4PA 3AKAA 1L2OC 2LVIA 3NSLA 1D1OA 2MLFC 2MRDA 1N2DA 2K7CA 4PHNA 1EXRA 2WNDA 4AQIA 2FOTA 4XJKA 4DRWA 4IL1A 1KK7Y 2PVBA 1A75A 1RK9A 2JTTA 1QVIY 2LV7A 1DJWA 3DF0A 1KSMA 4MVFA 4PALA 2OS8C 1GGWA 2FJUB 1DGVA 3A8RA 3CTNA 4QJ4B 1QX5B 3CWGA 1F70A 1TNQA 2CT9A 1IH0A 1H8BA 2ISDA 1S5GY 3D10A 1B7TZ 4PHJA 2BL0B 4WRIA 1W7IB 4PE7A 1YRUB 1TNWA 1MWNA 2KGRA 1S6IA 5DKNA 1G8IA 2QACA 1Y6WA 3K21A 2KNEA 1B8LA 5CSFA 1TNXA 3KPXA 3I5GC 3O2PA 2NZ0A 4YGEB 3SIBA 3SG3A 1AJ5A 3BOWA 2O5GA 3SG6A 1YURA 3JVTB 1CFFA 1SRAA 2KFHA 2HPSA 1SCVA 3KO0A 3CLNA 3JVTC 2K0JA 4Q04A 3BXKA 2PSRA 1NSHA 3DVKA 5CSNA 4WQ2A 3OHMB 4YGBB 4GGFC 1C7WA 1NX3A 1QX7A 2JNFA 4OVNF 2LM5A 1WLZA 2I7AA 4NQGA 4QJ3B 1NX0A 1KWOB 1DJYA 1QVIZ 1IQ5A 1JFKA 1KWOC 1HQVA 1OMVA 2PASA 3EK4A 3TUYB 1KQMB 1ZFSA 2NLNA 2ZN9A 2LMTA 4PE4A 3TUYC 3CR4X 1KQMC 1S26D 1IWQA 3BUMB 3RLZA 1K9KA 1WRKA 1XYDA 4ORBB 1DMOA 4GNKB 4OCIA 5D69A 4OV2A 4AOMA 4GBAA 2GGMA 1AHRA 2L5XB 1U5IA 1UWOA 1OOJA 1YVHA 3WXAA 2KFFA 3I5IC 1A29A 2D8NA 3OX6A 1TRFA 5JJGA 1K93D 1JFJA 1V1GA 4CFRA 1DT7B 4E68A 4UPGA 1NX2A 1TIZA 4XJKB 3RM1A 4HRGA 1B4CA 1ZOTB 1JUOA 2KGBC 3MSEB 1A75B 1MXEA 3TDIA 1CLBA 4MSPA 2HETA 2PMYA 1PRWA 1OQPA 1SW8A 1C07A 1HT9A 2CBLA 1MXLC 1QLSA 2KOTA 1BLQA 1J7PA 1B8RA 4I5LB 2EGDA 4DUQA 1IKUA 1AK8A 1LA0A 4DIRA 2WORA 4GGFA 2LP3A 5K89A 1YTZC 2KQ6A 2M3WA 3NSKA 3GK4X 4MLWA 4C0JA 4I5NB 2F3YA 2GV5A 1B47A 5HLVA 1J7QA 1QV0A 5HKWA 1QTXA 2HF5A 1K8UA 1IJ5A 1LVCD 1S6CA 3VRNA 1TNPA 3GK1A 3BOWB 3H4SE 1DTLA 3EK7A 1EJ3A 1B7TY 1DJZA 2LUCA 2LVVA 2BKIB 2Q91A 2V53A 1F4OA 1FF1A 1B9AA 2FCDA 3AAKA 1XA5A 1RFJA 2SCPA 4ORAB 1PSBA 1ZUZA 3PM8A 4YGDB 1OZSA 3NXAA 3OB2B 1UHIA 1CDNA 4OKHA 1DJXA 2H2KA 1K90D 3SG5A 3JTDB 2OPOA 1QX2A 1BOCA 1IQ3A 2O60A 3JTDC 1L2OB 4M2PA 1YUUA 2K7OA 5D7FA 1LXFC 3NSIA 1ALWA 1WY9A 2LHIA 4I5JA 4YBHB 1Y1UA 3PLFB 1XFXO 1CMGA 2JT0A 3OX5A 5KU1A 2KSPA 3DVMA 4JWQA 2K8MB
chains in the Genus database with same CATH superfamily
3PJIA 1UP5A 2K7DA 1E8AA 1XO5A 2QPTA 3LCPC 3OBVA 1U5IB 2BAPA 2OS8B 1PVAA 1YUSA 1OE9B 1T14A 1WDCB 1JWDA 1MUXA 2A4JA 2M0RA 3BFHA 3EVUA 3GK2A 4GGNA 5FI6A 5GQQC 1RJVA 1JSAA 2E6WA 1WDCC 2ZFDA 1XFZO 2LVJA 2M1UA 1SSEB 3L47A 1FBVA 2L4IA 1J7OA 4PE1A 2L4HA 1OOFA 2KPHA 2WCHA 3DVEA 1CDLA 1TTXA 2F8PA 3BUXB 3FE8A 5AXIA 1WRLA 2KAYA 2LLSA 1YX8A 2PYQA 3I5GB 5G08A 3FIAA 3PN7C 2LMUA 3A4UB 2FCEA 2K61A 2LP2A 1JF0A 2BNXA 2BE6A 5AERA 3OB1B 2LCPA 1OOHA 1KFXS 2PRUA 2KI6D 1GM0A 1GQMA 4P5OE 2WC8A 2I94A 3DY9A 4ICBA 4PCWA 3SG2A 4NDDA 2P6BB 3ICBA 3IVTA 5D3OA 3SJSA 1DQEA 1PK0D 2JOJA 3M0WA 4JQ0D 3BUWB 4ZCVA 3D77A 1S36A 1CFDA 1J7RA 1Q80A 2WCBA 4FTGA 1ZMZA 2JULA 2KHNA 2KLEA 2KQYA 4OR9B 3SG7A 5TNCA 2CNPA 1KK8B 3RZSA 2KBIA 1BR1B 3BJHA 3R1VA 1OSAA 4U8DA 1IG5A 2WC5A 1KK8C 3F45A 4INXA 2ZRTA 1F71A 1A03A 3EVVA 5ER4X 2H61C 1CNPA 3AKBA 2K60A 4PHMA 3OP0A 1R6PA 1DJGA 1F4QA 4KYNA 2L5YA 2JT8A 1K9UA 1M63B 1SMGA 1EG3A 5FI2A 4MRXA 3BUOB 1F55A 5PALA 1C3ZA 5AFPA 4ZCUA 3TDZA 1J55A 1TUZA 1BR4B 1C7VA 2Y1NA 1NP8A 3B6XA 5AANA 1UHKA 2AAOA 3I5IB 3L4LA 1KSOA 1IRJA 4MN0A 1UHHA 2BBNA 1TOPA 3NGVA 3B88A 1TN4A 1YR5A 2AMIA 2WCEA 1XFWO 2LUXA 1JF2A 1CDPA 3I5FC 3R72A 1SPYA 4GPLB 1JBAA 1H4BA 1LINA 1QIVA 2JXCA 4USLA 3SS4A 3TZ1A 3EG5B 1DF0A 2K2AA 1JC2A 2LC5A 2KI6C 1B8CA 3DXLA 1M31A 5F6TA 1G4YR 1NX1A 1OZOA 1RECA 1SR6C 5JOLA 1NYAA 4WQ3A 4P2YB 4HSZA 1SL9A 1OMDA 1UUSA 1NCYA 2LMVA 2ZN8A 3FE6A 1ALVA 1BJFA 2ZKMX 2BCBA 2CXJA 3I5HB 3TS5B 1UHJA 1CLLA 2LNKA 3R1PA 3VRQA 1TCFA 2KBMA 5HYDA 2MHHA 3I5HC 3TS5C 3KF9A 2LLUA 1RROA 2JNXA 1N65A 1RWYA 1PALA 2JZIA 2KDHA 3ZNIA 1NCXA 3VGOA 1CMFA 1CKKA 5AEQA 1CDMA 1EL4A 2F3ZA 4YI9A 2LHLA 2I18A 1SKTA 1NPQA 4GFTA 1SL8A 1A2XA 2H61A 2PALA 1SCMB 3BUNB 5DICA 1SCMC 2L2EA 2LANA 3DD4A 3DZTA 1KFUL 2MBXA 3PFVA 4C0LA 4FQOA 3E3RA 1M46A 2CTNA 4XYNA 2F33A 3HCMA 4AQJA 1GJYA 4GUKA 4CLNA 5J3XA 1YX7A 1BT6A 1NWDA 2KYFA 2NCOA 5FYXA 5I8NA 1MQ1A 2WCFA 2I2RE 2WCMA 3FWBA 4QJ5B 1K95A 1QWVA 1XVJA 2Y4QA 3TDUA 2BBMA 1NIWA 3KEVA 3WNXB 3N7HA 2FJYA 1FW4A 1Y0VH 2LE9B 3C1VA 1CLMA 3D0YA 1BODA 4ORCB 3VRPA 2WCKA 1FI5A 1QXPA 2JQ6A 2M7LA 5HKZA 5HLOA 2KAXA 1SYMA 1OMRA 4DCKA 1GGZA 1CB1A 3O78A 2CCMA 1AUIB 3SIAA 3VROA 2BE4A 2HQWA 2EHBA 1BU3A 5HKYA 3S0FA 3LL8B 1DC1A 1SNLA 1K96A 2EC6B 2DOQA 4MRYA 4C0KA 2K7BA 1G33A 1DF0B 2EC6C 2BECA 5KSZA 2L0PA 3Q8IA 2JPTA 1DVIA 1PVBA 3PN7B 2G2BA 3NHIA 5DKRA 1BMOA 3SS5A 3UNWA 4A4CA 1EH2A 2JPOA 3PALA 5KTYA 3CR2A 1MR8A 1M45A 2Q4UA 3S0AA 1XK4A 1AVSA 2JRFA 4YRUA 1XFVO 2LVKA 3CR5X 1ZACA 5BPJA 2R2IA 1SBJA 2B1UA 2JT3A 3IQOA 4PE0A 2VRGA 4BY5A 2H8VA 1TCOB 2JC2A 3WHTB 1V1FA 1WLMA 1KFXL 5CPVA 1YUTA 4OZDA 1K9PA 1CFCA 2BL0C 5HL1A 2ZNDA 2RGIA 2YGUA 1XFUO 1QASA 3KHEA 1IGVA 2JU0A 1SK6D 1Z4HA 2SASA 1S3PA 3R1OA 1ODBA 4PDZA 3UO9A 1CM4A 2MJWB 3QRXA 1DGUA 4YI8A 4F0ZB 4JPZB 2KFGA 4INWA 3SG4A 3D73A 1W7JB 3EVRA 1N0YA 1QIWA 2LLTA 1DJHA 5CSIA 2ZRSA 3FE9A 3LK0A 4HRHA 3NSOA 3WHUB 1QS7A 3VRRA 2MAZA 1F54A 3AAJA 1KCYA 2GGZA 2QDIA 2NXQA 3I5FB 4ETOA 4CPVA 1KK7Z 2P71A 1BG1A 2F2OA 3CZTX 5I2QA 2BCXA 2TN4A 2M8UA 1LA3A 5DKQA 1SL7A 2M1KB 3D0YB 3FWCA 1W9ZA 2KI4B 2P70A 1BF5A 3EKHA 1K94A 4N5XA 2L98A 1VRKA 3K1EA 3VB1A 5B8IB 5IBWA 1K2HA 2KI4C 1SR6B 2Y1MA 2M49B 2JWWA 3BYAA 4CIDA 5I94A 3ZWHA 4F7FA 1S5GZ 2IS9A 1UHNA 4I5KA 4NDCA 1B1GA 2M97A 3FS7A 4PT1A 1MHOA 1XFYO 4MZJA 2WOSA 1Y1AA 3QMEA 2E30A 1S1EA 1DJIA 1PULA 2BCAA 2BKHB 1LKJA 2KAVA 3O4YA 1QATA 3BFAA 2COLB 4N1FA 1CTRA 2LAPA 3S0GA 3B7AA 2M7NA 4JKTA 2WCJA 3BQ3A 1NUBA 1QLKA 1CM1A 2JTZA 3CZ2A 5I2LA 2Y5IA 4YGAA 1MF8B 2K2FA 4YGCB 1NCZA 3DF0B 3LK1A 4N1GA 3HX4A 4FQTA 1J1DA 2L51A 3CS1A 1XK4C 1EG4A 2MA2A 1AJ4A 3D78A 4A4BA 4HREE 1M39A 1R2UA 1QJTA 3PSRA 1UURA 1L7ZA 4BY4A 1WRZA 3CDNA 3IF7A 4GAOA 2ZNEA 4M2OA 4MZKA 4NDBA 1DELA 1RTP1 2KYCA 4TNCA 4DS7A 1FI6A 2HQ8A 1X02A 4IJ7A 1FPWA 2G9BA 1TUJA 2AUCA 1YVLA 3IQQA 3CGAA 4M2QA 1KFUS 1SY9A 4MZLA 3LLEA 3PATA 4R1EA 3GOFA 4PHKA 4D1EA 4MBEA 1AP4A 1KQVA 3DVJA 1QV1A 3EKJA 5ER5A 2F2PA 1J1EA 1IJ6A 1LS8A 1PSRA 4MEWA 3O6BA 2M29A 1F8HA 2MLEC 4CFQA 2M9GA 1S6JA 1OOIX 2NCPA 5CSJA 2L50A 1Y1XA 3EK8A 2OTGB 1YRTB 3SS3A 2JXLA 1CFPA 5I2OA 4L9MA 2OTGC 1A4PA 3AKAA 1L2OC 2QEOA 2LVIA 3NSLA 1D1OA 2MLFC 2MRDA 1N2DA 2K7CA 4PHNA 1IIOA 1EXRA 2WNDA 4AQIA 2FOTA 4XJKA 4DRWA 4IL1A 1KK7Y 2PVBA 1A75A 1RK9A 2JTTA 1QVIY 2LV7A 1DJWA 3DF0A 3DYEA 3S0BA 1KSMA 4MVFA 4PALA 3O4XA 3BFBA 1OOGA 2OS8C 1GGWA 2FJUB 1DGVA 5EL2A 3A8RA 3CTNA 4QJ4B 1QX5B 3CWGA 1F70A 1TNQA 2CT9A 1IH0A 1H8BA 2ISDA 1S5GY 3D10A 3D75A 1B7TZ 4PHJA 2BL0B 4WRIA 1OW4A 1W7IB 4PE7A 1YRUB 1TNWA 1MWNA 2KGRA 1S6IA 5DKNA 1G8IA 2QACA 1Y6WA 3K21A 2KNEA 1B8LA 5CSFA 1TNXA 3KPXA 1C3YA 3I5GC 3O2PA 2NZ0A 1TWOA 4YGEB 3SIBA 3SG3A 1AJ5A 3BOWA 2O5GA 3SG6A 1YURA 3JVTB 1CFFA 1SRAA 2KFHA 2HPSA 1SCVA 3KO0A 3CLNA 3JVTC 2K0JA 4Q04A 3BXKA 3CZ0A 2PSRA 1NSHA 3DVKA 5CSNA 4WQ2A 3OHMB 4YGBB 4GGFC 1C7WA 1NX3A 1QX7A 1XFRA 2JNFA 4OVNF 2LM5A 1WLZA 2I7AA 4NQGA 4QJ3B 1NX0A 1KWOB 2ERBA 1DJYA 2KLDA 1QVIZ 1IQ5A 1JFKA 1KWOC 2WC6A 3CZ1A 1HQVA 1OMVA 2PASA 3EK4A 3TUYB 1KQMB 1ZFSA 2NLNA 2ZN9A 2LMTA 4PE4A 3TUYC 3CR4X 1KQMC 2QEBA 1S26D 1IWQA 3CYZA 3D76A 3S0DA 3BUMB 3RLZA 1K9KA 1WRKA 1XYDA 4ORBB 1DMOA 2QEHA 4GNKB 4OCIA 5D69A 4OV2A 2GTEA 4JD9A 2QEVA 4AOMA 4GBAA 2GGMA 1AHRA 2L5XB 1U5IA 1UWOA 1OOJA 1YVHA 3WXAA 3D74A 2KFFA 3I5IC 1A29A 2D8NA 3OX6A 1TRFA 5JJGA 1K93D 1JFJA 1V1GA 4CFRA 1DT7B 4E68A 4UPGA 1NX2A 1TIZA 3PM2A 4XJKB 3RM1A 4HRGA 1B4CA 1ZOTB 1JUOA 2KGBC 3MSEB 5FI7A 1A75B 1MXEA 3TDIA 1CLBA 2L2CA 4MSPA 2HETA 2PMYA 1PRWA 1OQPA 1SW8A 3B86A 1C07A 1HT9A 2CBLA 3OGNA 1MXLC 1QLSA 2KOTA 1DEKA 1BLQA 1J7PA 1B8RA 4I5LB 2EGDA 4DUQA 1IKUA 1AK8A 1LA0A 4DIRA 2WORA 4GGFA 2LP3A 5K89A 1YTZC 1ORGA 2KQ6A 2M3WA 3GK4X 3NSKA 4MLWA 4C0JA 4I5NB 2F3YA 2GV5A 1B47A 5HLVA 1J7QA 1QV0A 1P28A 5HKWA 1QTXA 2HF5A 1K8UA 1IJ5A 1LVCD 1S6CA 3VRNA 1TNPA 3CABA 3BOWB 3GK1A 3H4SE 1DTLA 3EK7A 1EJ3A 3V2LA 1B7TY 1DJZA 2LUCA 2LVVA 2BKIB 2Q91A 2V53A 1F4OA 3S0EA 1FF1A 1B9AA 2FCDA 3AAKA 1XA5A 1RFJA 2SCPA 4ORAB 1PSBA 1ZUZA 3PM8A 4YGDB 1OZSA 2WCLA 3NXAA 3OB2B 1UHIA 1CDNA 4OKHA 1DJXA 2H2KA 3L4AA 1K90D 2PQLA 3SG5A 3JTDB 2OPOA 1QX2A 1BOCA 1IQ3A 3B87A 2O60A 3JTDC 1L2OB 1Z2CB 4M2PA 1YUUA 2K7OA 5D7FA 3NHTA 1LXFC 3NSIA 1ALWA 1WY9A 2LHIA 4I5JA 4YBHB 1Y1UA 3PLFB 1XFXO 1CMGA 2JT0A 3OX5A 5KU1A 2KSPA 3DVMA 4JWQA 2K8MB
chains in the Genus database with same CATH topology
1UP5A 2K7DA 1E8AA 1XO5A 2QPTA 3LCPC 1U5IB 2OS8B 1PVAA 1YUSA 1OE9B 1WDCB 1JWDA 1MUXA 2A4JA 2M0RA 3EVUA 3GK2A 4GGNA 5GQQC 1JSAA 1RJVA 2E6WA 1WDCC 2ZFDA 1XFZO 2LVJA 2M1UA 1FBVA 2L4IA 1J7OA 4PE1A 2L4HA 3DVEA 1CDLA 1TTXA 2F8PA 3BUXB 5AXIA 1WRLA 2KAYA 2LLSA 1YX8A 3I5GB 5G08A 3FIAA 3PN7C 2LMUA 3A4UB 2FCEA 2K61A 2LP2A 1JF0A 2BE6A 5AERA 3OB1B 2LCPA 1KFXS 2PRUA 2KI6D 1GQMA 4P5OE 2WC8A 2I94A 4ICBA 4PCWA 3SG2A 4NDDA 2P6BB 3ICBA 3SJSA 1PK0D 2JOJA 3M0WA 4JQ0D 3BUWB 4ZCVA 1S36A 1CFDA 1J7RA 1Q80A 2WCBA 4FTGA 1ZMZA 2JULA 2KHNA 4OR9B 2KQYA 3SG7A 5TNCA 2CNPA 1KK8B 2KBIA 1BR1B 1OSAA 4U8DA 1IG5A 1KK8C 3F45A 2ZRTA 1F71A 1A03A 3EVVA 5ER4X 2H61C 1CNPA 3AKBA 4PHMA 3OP0A 1R6PA 1DJGA 1F4QA 2JT8A 1K9UA 1M63B 1SMGA 1EG3A 4MRXA 3BUOB 1F55A 5PALA 5AFPA 4ZCUA 3TDZA 1J55A 1BR4B 1C7VA 2Y1NA 1NP8A 5AANA 1UHKA 2AAOA 3I5IB 1KSOA 1IRJA 4MN0A 1UHHA 2BBNA 1TOPA 1TN4A 1YR5A 2AMIA 2WCEA 1XFWO 2LUXA 1JF2A 1CDPA 3I5FC 4GPLB 1SPYA 1JBAA 1H4BA 1LINA 1QIVA 2JXCA 4USLA 3TZ1A 1DF0A 2K2AA 1JC2A 2LC5A 2KI6C 1B8CA 1M31A 5F6TA 1G4YR 1NX1A 1OZOA 1RECA 1SR6C 5JOLA 1NYAA 4WQ3A 4P2YB 4HSZA 1SL9A 1OMDA 1UUSA 1NCYA 2LMVA 2ZN8A 1ALVA 1BJFA 2ZKMX 2BCBA 2CXJA 3I5HB 3TS5B 1UHJA 1CLLA 2LNKA 3VRQA 1TCFA 2KBMA 5HYDA 2MHHA 3I5HC 3TS5C 3KF9A 2LLUA 1RROA 2JNXA 1N65A 1RWYA 1PALA 2JZIA 2KDHA 3ZNIA 1NCXA 3VGOA 1CMFA 1CKKA 5AEQA 1CDMA 1EL4A 2F3ZA 4YI9A 2LHLA 2I18A 1SKTA 1NPQA 4GFTA 1SL8A 1A2XA 2H61A 2PALA 1SCMB 3BUNB 1SCMC 2L2EA 2LANA 3DD4A 1KFUL 2MBXA 3PFVA 4C0LA 4FQOA 3E3RA 1M46A 2CTNA 4XYNA 2F33A 3HCMA 4AQJA 1GJYA 4GUKA 4CLNA 5J3XA 1YX7A 1BT6A 1NWDA 2KYFA 2NCOA 5FYXA 5I8NA 1MQ1A 2WCFA 2I2RE 3FWBA 4QJ5B 1K95A 3TDUA 1XVJA 2Y4QA 2BBMA 1NIWA 3KEVA 3WNXB 1FW4A 1Y0VH 2LE9B 3C1VA 1CLMA 3D0YA 1BODA 4ORCB 3VRPA 1FI5A 1QXPA 2JQ6A 2M7LA 5HKZA 5HLOA 2KAXA 1SYMA 1OMRA 4DCKA 1GGZA 1CB1A 3O78A 2CCMA 1AUIB 3SIAA 3VROA 2BE4A 2HQWA 2EHBA 1BU3A 5HKYA 3LL8B 1SNLA 1K96A 2EC6B 2DOQA 4MRYA 4C0KA 2K7BA 1G33A 1DF0B 2EC6C 2BECA 5KSZA 2L0PA 2JPTA 1DVIA 1PVBA 3PN7B 2G2BA 5DKRA 4A4CA 1BMOA 1EH2A 3PALA 5KTYA 3CR2A 1MR8A 1M45A 2Q4UA 1XK4A 1AVSA 2JRFA 4YRUA 1XFVO 2LVKA 3CR5X 1ZACA 5BPJA 2R2IA 1SBJA 2B1UA 2JT3A 3IQOA 4PE0A 2VRGA 4BY5A 1TCOB 2JC2A 3WHTB 1V1FA 1WLMA 1KFXL 5CPVA 1YUTA 1K9PA 1CFCA 2BL0C 2ZNDA 2RGIA 1XFUO 1QASA 3KHEA 1IGVA 2JU0A 1SK6D 2SASA 1S3PA 1ODBA 4PDZA 1CM4A 2MJWB 3QRXA 1DGUA 4YI8A 4F0ZB 4JPZB 2KFGA 3SG4A 1W7JB 3EVRA 1N0YA 1QIWA 2LLTA 1DJHA 5CSIA 2ZRSA 3LK0A 4HRHA 3NSOA 3WHUB 1QS7A 3VRRA 2MAZA 1F54A 3AAJA 1KCYA 2GGZA 2NXQA 3I5FB 4ETOA 4CPVA 1KK7Z 1BG1A 2F2OA 3CZTX 5I2QA 2BCXA 2TN4A 2M8UA 1LA3A 5DKQA 1SL7A 2M1KB 3D0YB 3FWCA 2KI4B 1BF5A 3EKHA 1K94A 4N5XA 2L98A 1VRKA 5B8IB 5IBWA 1K2HA 2KI4C 1SR6B 2Y1MA 2M49B 2JWWA 3BYAA 4CIDA 3ZWHA 1S5GZ 2IS9A 1UHNA 4I5KA 4NDCA 1B1GA 2M97A 3FS7A 1MHOA 1XFYO 4MZJA 2WOSA 1Y1AA 2E30A 1S1EA 1DJIA 1PULA 2BCAA 2BKHB 1LKJA 2KAVA 3O4YA 1QATA 2COLB 4N1FA 1CTRA 2LAPA 2M7NA 3BQ3A 1NUBA 1QLKA 1CM1A 2JTZA 5I2LA 2Y5IA 4YGAA 1MF8B 2K2FA 4YGCB 1NCZA 3DF0B 3LK1A 4N1GA 3HX4A 1J1DA 2L51A 3CS1A 1XK4C 1EG4A 2MA2A 1AJ4A 4A4BA 4HREE 1M39A 1R2UA 1QJTA 3PSRA 1UURA 1L7ZA 4BY4A 1WRZA 3IF7A 4GAOA 2ZNEA 4M2OA 4MZKA 4NDBA 1RTP1 2KYCA 4TNCA 4DS7A 1FI6A 2HQ8A 1X02A 1FPWA 2G9BA 2AUCA 1YVLA 3IQQA 3CGAA 4M2QA 1KFUS 1SY9A 4MZLA 3LLEA 3PATA 4R1EA 3GOFA 4PHKA 4D1EA 4MBEA 1AP4A 1KQVA 3DVJA 1QV1A 3EKJA 5ER5A 2F2PA 1J1EA 1IJ6A 1PSRA 4MEWA 3O6BA 2M29A 1F8HA 2MLEC 4CFQA 2M9GA 1S6JA 2NCPA 5CSJA 2L50A 1Y1XA 3EK8A 2OTGB 1YRTB 2JXLA 1CFPA 5I2OA 4L9MA 2OTGC 1A4PA 3AKAA 1L2OC 2LVIA 3NSLA 1D1OA 2MLFC 2MRDA 1N2DA 2K7CA 4PHNA 1EXRA 2WNDA 4AQIA 2FOTA 4XJKA 4DRWA 4IL1A 1KK7Y 2PVBA 1A75A 1RK9A 2JTTA 1QVIY 2LV7A 1DJWA 3DF0A 1KSMA 4MVFA 4PALA 2OS8C 1GGWA 2FJUB 1DGVA 3A8RA 3CTNA 4QJ4B 1QX5B 3CWGA 1F70A 1TNQA 2CT9A 1IH0A 1H8BA 2ISDA 1S5GY 3D10A 1B7TZ 4PHJA 2BL0B 4WRIA 1W7IB 4PE7A 1YRUB 1TNWA 1MWNA 2KGRA 1S6IA 5DKNA 1G8IA 2QACA 1Y6WA 3K21A 2KNEA 1B8LA 5CSFA 1TNXA 3KPXA 3I5GC 3O2PA 2NZ0A 4YGEB 3SIBA 3SG3A 1AJ5A 3BOWA 2O5GA 3SG6A 1YURA 3JVTB 1CFFA 1SRAA 2KFHA 2HPSA 1SCVA 3KO0A 3CLNA 3JVTC 2K0JA 4Q04A 3BXKA 2PSRA 1NSHA 3DVKA 5CSNA 4WQ2A 3OHMB 4YGBB 4GGFC 1C7WA 1NX3A 1QX7A 2JNFA 4OVNF 2LM5A 1WLZA 2I7AA 4NQGA 4QJ3B 1NX0A 1KWOB 1DJYA 1QVIZ 1IQ5A 1JFKA 1KWOC 1HQVA 1OMVA 2PASA 3EK4A 3TUYB 1KQMB 1ZFSA 2NLNA 2ZN9A 2LMTA 4PE4A 3TUYC 3CR4X 1KQMC 1S26D 1IWQA 3BUMB 3RLZA 1K9KA 1WRKA 1XYDA 4ORBB 1DMOA 4GNKB 4OCIA 5D69A 4OV2A 4AOMA 4GBAA 2GGMA 1AHRA 2L5XB 1U5IA 1UWOA 1OOJA 1YVHA 3WXAA 2KFFA 3I5IC 1A29A 2D8NA 3OX6A 1TRFA 5JJGA 1K93D 1JFJA 1V1GA 4CFRA 1DT7B 4E68A 4UPGA 1NX2A 1TIZA 4XJKB 3RM1A 4HRGA 1B4CA 1ZOTB 1JUOA 2KGBC 3MSEB 1A75B 1MXEA 3TDIA 1CLBA 4MSPA 2HETA 2PMYA 1PRWA 1OQPA 1SW8A 1C07A 1HT9A 2CBLA 1MXLC 1QLSA 2KOTA 1BLQA 1J7PA 1B8RA 4I5LB 2EGDA 4DUQA 1IKUA 1AK8A 1LA0A 4DIRA 2WORA 4GGFA 2LP3A 5K89A 1YTZC 2KQ6A 2M3WA 3NSKA 3GK4X 4MLWA 4C0JA 4I5NB 2F3YA 2GV5A 1B47A 5HLVA 1J7QA 1QV0A 5HKWA 1QTXA 2HF5A 1K8UA 1IJ5A 1LVCD 1S6CA 3VRNA 1TNPA 3GK1A 3BOWB 3H4SE 1DTLA 3EK7A 1EJ3A 1B7TY 1DJZA 2LUCA 2LVVA 2BKIB 2Q91A 2V53A 1F4OA 1FF1A 1B9AA 2FCDA 3AAKA 1XA5A 1RFJA 2SCPA 4ORAB 1PSBA 1ZUZA 3PM8A 4YGDB 1OZSA 3NXAA 3OB2B 1UHIA 1CDNA 4OKHA 1DJXA 2H2KA 1K90D 3SG5A 3JTDB 2OPOA 1QX2A 1BOCA 1IQ3A 2O60A 3JTDC 1L2OB 4M2PA 1YUUA 2K7OA 5D7FA 1LXFC 3NSIA 1ALWA 1WY9A 2LHIA 4I5JA 4YBHB 1Y1UA 3PLFB 1XFXO 1CMGA 2JT0A 3OX5A 5KU1A 2KSPA 3DVMA 4JWQA 2K8MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UP5 A;  2K7D A;  1E8A A;  1XO5 A;  2QPT A;  3LCP C;  1U5I B;  2OS8 B;  1PVA A;  1YUS A;  1OE9 B;  1WDC B;  1JWD A;  1MUX A;  2A4J A;  2M0R A;  3EVU A;  3GK2 A;  4GGN A;  5GQQ C;  1JSA A;  1RJV A;  2E6W A;  1WDC C;  2ZFD A;  1XFZ O;  2LVJ A;  2M1U A;  1FBV A;  2L4I A;  1J7O A;  4PE1 A;  2L4H A;  3DVE A;  1CDL A;  1TTX A;  2F8P A;  3BUX B;  5AXI A;  1WRL A;  2KAY A;  2LLS A;  1YX8 A;  3I5G B;  5G08 A;  3FIA A;  3PN7 C;  2LMU A;  3A4U B;  2FCE A;  2K61 A;  2LP2 A;  1JF0 A;  2BE6 A;  5AER A;  3OB1 B;  2LCP A;  1KFX S;  2PRU A;  2KI6 D;  1GQM A;  4P5O E;  2WC8 A;  2I94 A;  4ICB A;  4PCW A;  3SG2 A;  4NDD A;  2P6B B;  3ICB A;  3SJS A;  1PK0 D;  2JOJ A;  3M0W A;  4JQ0 D;  3BUW B;  4ZCV A;  1S36 A;  1CFD A;  1J7R A;  1Q80 A;  2WCB A;  4FTG A;  1ZMZ A;  2JUL A;  2KHN A;  4OR9 B;  2KQY A;  3SG7 A;  5TNC A;  2CNP A;  1KK8 B;  2KBI A;  1BR1 B;  1OSA A;  4U8D A;  1IG5 A;  1KK8 C;  3F45 A;  2ZRT A;  1F71 A;  1A03 A;  3EVV A;  5ER4 X;  2H61 C;  1CNP A;  3AKB A;  4PHM A;  3OP0 A;  1R6P A;  1DJG A;  1F4Q A;  2JT8 A;  1K9U A;  1M63 B;  1SMG A;  1EG3 A;  4MRX A;  3BUO B;  1F55 A;  5PAL A;  5AFP A;  4ZCU A;  3TDZ A;  1J55 A;  1BR4 B;  1C7V A;  2Y1N A;  1NP8 A;  5AAN A;  1UHK A;  2AAO A;  3I5I B;  1KSO A;  1IRJ A;  4MN0 A;  1UHH A;  2BBN A;  1TOP A;  1TN4 A;  1YR5 A;  2AMI A;  2WCE A;  1XFW O;  2LUX A;  1JF2 A;  1CDP A;  3I5F C;  4GPL B;  1SPY A;  1JBA A;  1H4B A;  1LIN A;  1QIV A;  2JXC A;  4USL A;  3TZ1 A;  1DF0 A;  2K2A A;  1JC2 A;  2LC5 A;  2KI6 C;  1B8C A;  1M31 A;  5F6T A;  1G4Y R;  1NX1 A;  1OZO A;  1REC A;  1SR6 C;  5JOL A;  1NYA A;  4WQ3 A;  4P2Y B;  4HSZ A;  1SL9 A;  1OMD A;  1UUS A;  1NCY A;  2LMV A;  2ZN8 A;  1ALV A;  1BJF A;  2ZKM X;  2BCB A;  2CXJ A;  3I5H B;  3TS5 B;  1UHJ A;  1CLL A;  2LNK A;  3VRQ A;  1TCF A;  2KBM A;  5HYD A;  2MHH A;  3I5H C;  3TS5 C;  3KF9 A;  2LLU A;  1RRO A;  2JNX A;  1N65 A;  1RWY A;  1PAL A;  2JZI A;  2KDH A;  3ZNI A;  1NCX A;  3VGO A;  1CMF A;  1CKK A;  5AEQ A;  1CDM A;  1EL4 A;  2F3Z A;  4YI9 A;  2LHL A;  2I18 A;  1SKT A;  1NPQ A;  4GFT A;  1SL8 A;  1A2X A;  2H61 A;  2PAL A;  1SCM B;  3BUN B;  1SCM C;  2L2E A;  2LAN A;  3DD4 A;  1KFU L;  2MBX A;  3PFV A;  4C0L A;  4FQO A;  3E3R A;  1M46 A;  2CTN A;  4XYN A;  2F33 A;  3HCM A;  4AQJ A;  1GJY A;  4GUK A;  4CLN A;  5J3X A;  1YX7 A;  1BT6 A;  1NWD A;  2KYF A;  2NCO A;  5FYX A;  5I8N A;  1MQ1 A;  2WCF A;  2I2R E;  3FWB A;  4QJ5 B;  1K95 A;  3TDU A;  1XVJ A;  2Y4Q A;  2BBM A;  1NIW A;  3KEV A;  3WNX B;  1FW4 A;  1Y0V H;  2LE9 B;  3C1V A;  1CLM A;  3D0Y A;  1BOD A;  4ORC B;  3VRP A;  1FI5 A;  1QXP A;  2JQ6 A;  2M7L A;  5HKZ A;  5HLO A;  2KAX A;  1SYM A;  1OMR A;  4DCK A;  1GGZ A;  1CB1 A;  3O78 A;  2CCM A;  1AUI B;  3SIA A;  3VRO A;  2BE4 A;  2HQW A;  2EHB A;  1BU3 A;  5HKY A;  3LL8 B;  1SNL A;  1K96 A;  2EC6 B;  2DOQ A;  4MRY A;  4C0K A;  2K7B A;  1G33 A;  1DF0 B;  2EC6 C;  2BEC A;  5KSZ A;  2L0P A;  2JPT A;  1DVI A;  1PVB A;  3PN7 B;  2G2B A;  5DKR A;  4A4C A;  1BMO A;  1EH2 A;  3PAL A;  5KTY A;  3CR2 A;  1MR8 A;  1M45 A;  2Q4U A;  1XK4 A;  1AVS A;  2JRF A;  4YRU A;  1XFV O;  2LVK A;  3CR5 X;  1ZAC A;  5BPJ A;  2R2I A;  1SBJ A;  2B1U A;  2JT3 A;  3IQO A;  4PE0 A;  2VRG A;  4BY5 A;  1TCO B;  2JC2 A;  3WHT B;  1V1F A;  1WLM A;  1KFX L;  5CPV A;  1YUT A;  1K9P A;  1CFC A;  2BL0 C;  2ZND A;  2RGI A;  1XFU O;  1QAS A;  3KHE A;  1IGV A;  2JU0 A;  1SK6 D;  2SAS A;  1S3P A;  1ODB A;  4PDZ A;  1CM4 A;  2MJW B;  3QRX A;  1DGU A;  4YI8 A;  4F0Z B;  4JPZ B;  2KFG A;  3SG4 A;  1W7J B;  3EVR A;  1N0Y A;  1QIW A;  2LLT A;  1DJH A;  5CSI A;  2ZRS A;  3LK0 A;  4HRH A;  3NSO A;  3WHU B;  1QS7 A;  3VRR A;  2MAZ A;  1F54 A;  3AAJ A;  1KCY A;  2GGZ A;  2NXQ A;  3I5F B;  4ETO A;  4CPV A;  1KK7 Z;  1BG1 A;  2F2O A;  3CZT X;  5I2Q A;  2BCX A;  2TN4 A;  2M8U A;  1LA3 A;  5DKQ A;  1SL7 A;  2M1K B;  3D0Y B;  3FWC A;  2KI4 B;  1BF5 A;  3EKH A;  1K94 A;  4N5X A;  2L98 A;  1VRK A;  5B8I B;  5IBW A;  1K2H A;  2KI4 C;  1SR6 B;  2Y1M A;  2M49 B;  2JWW A;  3BYA A;  4CID A;  3ZWH A;  1S5G Z;  2IS9 A;  1UHN A;  4I5K A;  4NDC A;  1B1G A;  2M97 A;  3FS7 A;  1MHO A;  1XFY O;  4MZJ A;  2WOS A;  1Y1A A;  2E30 A;  1S1E A;  1DJI A;  1PUL A;  2BCA A;  2BKH B;  1LKJ A;  2KAV A;  3O4Y A;  1QAT A;  2COL B;  4N1F A;  1CTR A;  2LAP A;  2M7N A;  3BQ3 A;  1NUB A;  1QLK A;  1CM1 A;  2JTZ A;  5I2L A;  2Y5I A;  4YGA A;  1MF8 B;  2K2F A;  4YGC B;  1NCZ A;  3DF0 B;  3LK1 A;  4N1G A;  3HX4 A;  1J1D A;  2L51 A;  3CS1 A;  1XK4 C;  1EG4 A;  2MA2 A;  1AJ4 A;  4A4B A;  4HRE E;  1M39 A;  1R2U A;  1QJT A;  3PSR A;  1UUR A;  1L7Z A;  4BY4 A;  1WRZ A;  3IF7 A;  4GAO A;  2ZNE A;  4M2O A;  4MZK A;  4NDB A;  1RTP 1;  2KYC A;  4TNC A;  4DS7 A;  1FI6 A;  2HQ8 A;  1X02 A;  1FPW A;  2G9B A;  2AUC A;  1YVL A;  3IQQ A;  3CGA A;  4M2Q A;  1KFU S;  1SY9 A;  4MZL A;  3LLE A;  3PAT A;  4R1E A;  3GOF A;  4PHK A;  4D1E A;  4MBE A;  1AP4 A;  1KQV A;  3DVJ A;  1QV1 A;  3EKJ A;  5ER5 A;  2F2P A;  1J1E A;  1IJ6 A;  1PSR A;  4MEW A;  3O6B A;  2M29 A;  1F8H A;  2MLE C;  4CFQ A;  2M9G A;  1S6J A;  2NCP A;  5CSJ A;  2L50 A;  1Y1X A;  3EK8 A;  2OTG B;  1YRT B;  2JXL A;  1CFP A;  5I2O A;  4L9M A;  2OTG C;  1A4P A;  3AKA A;  1L2O C;  2LVI A;  3NSL A;  1D1O A;  2MLF C;  2MRD A;  1N2D A;  2K7C A;  4PHN A;  1EXR A;  2WND A;  4AQI A;  2FOT A;  4XJK A;  4DRW A;  4IL1 A;  1KK7 Y;  2PVB A;  1A75 A;  1RK9 A;  2JTT A;  1QVI Y;  2LV7 A;  1DJW A;  3DF0 A;  1KSM A;  4MVF A;  4PAL A;  2OS8 C;  1GGW A;  2FJU B;  1DGV A;  3A8R A;  3CTN A;  4QJ4 B;  1QX5 B;  3CWG A;  1F70 A;  1TNQ A;  2CT9 A;  1IH0 A;  1H8B A;  2ISD A;  1S5G Y;  3D10 A;  1B7T Z;  4PHJ A;  2BL0 B;  4WRI A;  1W7I B;  4PE7 A;  1YRU B;  1TNW A;  1MWN A;  2KGR A;  1S6I A;  5DKN A;  1G8I A;  2QAC A;  1Y6W A;  3K21 A;  2KNE A;  1B8L A;  5CSF A;  1TNX A;  3KPX A;  3I5G C;  3O2P A;  2NZ0 A;  4YGE B;  3SIB A;  3SG3 A;  1AJ5 A;  3BOW A;  2O5G A;  3SG6 A;  1YUR A;  3JVT B;  1CFF A;  1SRA A;  2KFH A;  2HPS A;  1SCV A;  3KO0 A;  3CLN A;  3JVT C;  2K0J A;  4Q04 A;  3BXK A;  2PSR A;  1NSH A;  3DVK A;  5CSN A;  4WQ2 A;  3OHM B;  4YGB B;  4GGF C;  1C7W A;  1NX3 A;  1QX7 A;  2JNF A;  4OVN F;  2LM5 A;  1WLZ A;  2I7A A;  4NQG A;  4QJ3 B;  1NX0 A;  1KWO B;  1DJY A;  1QVI Z;  1IQ5 A;  1JFK A;  1KWO C;  1HQV A;  1OMV A;  2PAS A;  3EK4 A;  3TUY B;  1KQM B;  1ZFS A;  2NLN A;  2ZN9 A;  2LMT A;  4PE4 A;  3TUY C;  3CR4 X;  1KQM C;  1S26 D;  1IWQ A;  3BUM B;  3RLZ A;  1K9K A;  1WRK A;  1XYD A;  4ORB B;  1DMO A;  4GNK B;  4OCI A;  5D69 A;  4OV2 A;  4AOM A;  4GBA A;  2GGM A;  1AHR A;  2L5X B;  1U5I A;  1UWO A;  1OOJ A;  1YVH A;  3WXA A;  2KFF A;  3I5I C;  1A29 A;  2D8N A;  3OX6 A;  1TRF A;  5JJG A;  1K93 D;  1JFJ A;  1V1G A;  4CFR A;  1DT7 B;  4E68 A;  4UPG A;  1NX2 A;  1TIZ A;  4XJK B;  3RM1 A;  4HRG A;  1B4C A;  1ZOT B;  1JUO A;  2KGB C;  3MSE B;  1A75 B;  1MXE A;  3TDI A;  1CLB A;  4MSP A;  2HET A;  2PMY A;  1PRW A;  1OQP A;  1SW8 A;  1C07 A;  1HT9 A;  2CBL A;  1MXL C;  1QLS A;  2KOT A;  1BLQ A;  1J7P A;  1B8R A;  4I5L B;  2EGD A;  4DUQ A;  1IKU A;  1AK8 A;  1LA0 A;  4DIR A;  2WOR A;  4GGF A;  2LP3 A;  5K89 A;  1YTZ C;  2KQ6 A;  2M3W A;  3NSK A;  3GK4 X;  4MLW A;  4C0J A;  4I5N B;  2F3Y A;  2GV5 A;  1B47 A;  5HLV A;  1J7Q A;  1QV0 A;  5HKW A;  1QTX A;  2HF5 A;  1K8U A;  1IJ5 A;  1LVC D;  1S6C A;  3VRN A;  1TNP A;  3GK1 A;  3BOW B;  3H4S E;  1DTL A;  3EK7 A;  1EJ3 A;  1B7T Y;  1DJZ A;  2LUC A;  2LVV A;  2BKI B;  2Q91 A;  2V53 A;  1F4O A;  1FF1 A;  1B9A A;  2FCD A;  3AAK A;  1XA5 A;  1RFJ A;  2SCP A;  4ORA B;  1PSB A;  1ZUZ A;  3PM8 A;  4YGD B;  1OZS A;  3NXA A;  3OB2 B;  1UHI A;  1CDN A;  4OKH A;  1DJX A;  2H2K A;  1K90 D;  3SG5 A;  3JTD B;  2OPO A;  1QX2 A;  1BOC A;  1IQ3 A;  2O60 A;  3JTD C;  1L2O B;  4M2P A;  1YUU A;  2K7O A;  5D7F A;  1LXF C;  3NSI A;  1ALW A;  1WY9 A;  2LHI A;  4I5J A;  4YBH B;  1Y1U A;  3PLF B;  1XFX O;  1CMG A;  2JT0 A;  3OX5 A;  5KU1 A;  2KSP A;  3DVM A;  4JWQ A;  2K8M B; 
#chains in the Genus database with same CATH topology
 3PJI A;  1UP5 A;  2K7D A;  1E8A A;  1XO5 A;  2QPT A;  3LCP C;  3OBV A;  1U5I B;  2BAP A;  2OS8 B;  1PVA A;  1YUS A;  1OE9 B;  1T14 A;  1WDC B;  1JWD A;  1MUX A;  2A4J A;  2M0R A;  3BFH A;  3EVU A;  3GK2 A;  4GGN A;  5FI6 A;  5GQQ C;  1RJV A;  1JSA A;  2E6W A;  1WDC C;  2ZFD A;  1XFZ O;  2LVJ A;  2M1U A;  1SSE B;  3L47 A;  1FBV A;  2L4I A;  1J7O A;  4PE1 A;  2L4H A;  1OOF A;  2KPH A;  2WCH A;  3DVE A;  1CDL A;  1TTX A;  2F8P A;  3BUX B;  3FE8 A;  5AXI A;  1WRL A;  2KAY A;  2LLS A;  1YX8 A;  2PYQ A;  3I5G B;  5G08 A;  3FIA A;  3PN7 C;  2LMU A;  3A4U B;  2FCE A;  2K61 A;  2LP2 A;  1JF0 A;  2BNX A;  2BE6 A;  5AER A;  3OB1 B;  2LCP A;  1OOH A;  1KFX S;  2PRU A;  2KI6 D;  1GM0 A;  1GQM A;  4P5O E;  2WC8 A;  2I94 A;  3DY9 A;  4ICB A;  4PCW A;  3SG2 A;  4NDD A;  2P6B B;  3ICB A;  3IVT A;  5D3O A;  3SJS A;  1DQE A;  1PK0 D;  2JOJ A;  3M0W A;  4JQ0 D;  3BUW B;  4ZCV A;  3D77 A;  1S36 A;  1CFD A;  1J7R A;  1Q80 A;  2WCB A;  4FTG A;  1ZMZ A;  2JUL A;  2KHN A;  2KLE A;  2KQY A;  4OR9 B;  3SG7 A;  5TNC A;  2CNP A;  1KK8 B;  3RZS A;  2KBI A;  1BR1 B;  3BJH A;  3R1V A;  1OSA A;  4U8D A;  1IG5 A;  2WC5 A;  1KK8 C;  3F45 A;  4INX A;  2ZRT A;  1F71 A;  1A03 A;  3EVV A;  5ER4 X;  2H61 C;  1CNP A;  3AKB A;  2K60 A;  4PHM A;  3OP0 A;  1R6P A;  1DJG A;  1F4Q A;  4KYN A;  2L5Y A;  2JT8 A;  1K9U A;  1M63 B;  1SMG A;  1EG3 A;  5FI2 A;  4MRX A;  3BUO B;  1F55 A;  5PAL A;  1C3Z A;  5AFP A;  4ZCU A;  3TDZ A;  1J55 A;  1TUZ A;  1BR4 B;  1C7V A;  2Y1N A;  1NP8 A;  3B6X A;  5AAN A;  1UHK A;  2AAO A;  3I5I B;  3L4L A;  1KSO A;  1IRJ A;  4MN0 A;  1UHH A;  2BBN A;  1TOP A;  3NGV A;  3B88 A;  1TN4 A;  1YR5 A;  2AMI A;  2WCE A;  1XFW O;  2LUX A;  1JF2 A;  1CDP A;  3I5F C;  3R72 A;  1SPY A;  4GPL B;  1JBA A;  1H4B A;  1LIN A;  1QIV A;  2JXC A;  4USL A;  3SS4 A;  3TZ1 A;  3EG5 B;  1DF0 A;  2K2A A;  1JC2 A;  2LC5 A;  2KI6 C;  1B8C A;  3DXL A;  1M31 A;  5F6T A;  1G4Y R;  1NX1 A;  1OZO A;  1REC A;  1SR6 C;  5JOL A;  1NYA A;  4WQ3 A;  4P2Y B;  4HSZ A;  1SL9 A;  1OMD A;  1UUS A;  1NCY A;  2LMV A;  2ZN8 A;  3FE6 A;  1ALV A;  1BJF A;  2ZKM X;  2BCB A;  2CXJ A;  3I5H B;  3TS5 B;  1UHJ A;  1CLL A;  2LNK A;  3R1P A;  3VRQ A;  1TCF A;  2KBM A;  5HYD A;  2MHH A;  3I5H C;  3TS5 C;  3KF9 A;  2LLU A;  1RRO A;  2JNX A;  1N65 A;  1RWY A;  1PAL A;  2JZI A;  2KDH A;  3ZNI A;  1NCX A;  3VGO A;  1CMF A;  1CKK A;  5AEQ A;  1CDM A;  1EL4 A;  2F3Z A;  4YI9 A;  2LHL A;  2I18 A;  1SKT A;  1NPQ A;  4GFT A;  1SL8 A;  1A2X A;  2H61 A;  2PAL A;  1SCM B;  3BUN B;  5DIC A;  1SCM C;  2L2E A;  2LAN A;  3DD4 A;  3DZT A;  1KFU L;  2MBX A;  3PFV A;  4C0L A;  4FQO A;  3E3R A;  1M46 A;  2CTN A;  4XYN A;  2F33 A;  3HCM A;  4AQJ A;  1GJY A;  4GUK A;  4CLN A;  5J3X A;  1YX7 A;  1BT6 A;  1NWD A;  2KYF A;  2NCO A;  5FYX A;  5I8N A;  1MQ1 A;  2WCF A;  2I2R E;  2WCM A;  3FWB A;  4QJ5 B;  1K95 A;  1QWV A;  1XVJ A;  2Y4Q A;  3TDU A;  2BBM A;  1NIW A;  3KEV A;  3WNX B;  3N7H A;  2FJY A;  1FW4 A;  1Y0V H;  2LE9 B;  3C1V A;  1CLM A;  3D0Y A;  1BOD A;  4ORC B;  3VRP A;  2WCK A;  1FI5 A;  1QXP A;  2JQ6 A;  2M7L A;  5HKZ A;  5HLO A;  2KAX A;  1SYM A;  1OMR A;  4DCK A;  1GGZ A;  1CB1 A;  3O78 A;  2CCM A;  1AUI B;  3SIA A;  3VRO A;  2BE4 A;  2HQW A;  2EHB A;  1BU3 A;  5HKY A;  3S0F A;  3LL8 B;  1DC1 A;  1SNL A;  1K96 A;  2EC6 B;  2DOQ A;  4MRY A;  4C0K A;  2K7B A;  1G33 A;  1DF0 B;  2EC6 C;  2BEC A;  5KSZ A;  2L0P A;  3Q8I A;  2JPT A;  1DVI A;  1PVB A;  3PN7 B;  2G2B A;  3NHI A;  5DKR A;  1BMO A;  3SS5 A;  3UNW A;  4A4C A;  1EH2 A;  2JPO A;  3PAL A;  5KTY A;  3CR2 A;  1MR8 A;  1M45 A;  2Q4U A;  3S0A A;  1XK4 A;  1AVS A;  2JRF A;  4YRU A;  1XFV O;  2LVK A;  3CR5 X;  1ZAC A;  5BPJ A;  2R2I A;  1SBJ A;  2B1U A;  2JT3 A;  3IQO A;  4PE0 A;  2VRG A;  4BY5 A;  2H8V A;  1TCO B;  2JC2 A;  3WHT B;  1V1F A;  1WLM A;  1KFX L;  5CPV A;  1YUT A;  4OZD A;  1K9P A;  1CFC A;  2BL0 C;  5HL1 A;  2ZND A;  2RGI A;  2YGU A;  1XFU O;  1QAS A;  3KHE A;  1IGV A;  2JU0 A;  1SK6 D;  1Z4H A;  2SAS A;  1S3P A;  3R1O A;  1ODB A;  4PDZ A;  3UO9 A;  1CM4 A;  2MJW B;  3QRX A;  1DGU A;  4YI8 A;  4F0Z B;  4JPZ B;  2KFG A;  4INW A;  3SG4 A;  3D73 A;  1W7J B;  3EVR A;  1N0Y A;  1QIW A;  2LLT A;  1DJH A;  5CSI A;  2ZRS A;  3FE9 A;  3LK0 A;  4HRH A;  3NSO A;  3WHU B;  1QS7 A;  3VRR A;  2MAZ A;  1F54 A;  3AAJ A;  1KCY A;  2GGZ A;  2QDI A;  2NXQ A;  3I5F B;  4ETO A;  4CPV A;  1KK7 Z;  2P71 A;  1BG1 A;  2F2O A;  3CZT X;  5I2Q A;  2BCX A;  2TN4 A;  2M8U A;  1LA3 A;  5DKQ A;  1SL7 A;  2M1K B;  3D0Y B;  3FWC A;  1W9Z A;  2KI4 B;  2P70 A;  1BF5 A;  3EKH A;  1K94 A;  4N5X A;  2L98 A;  1VRK A;  3K1E A;  3VB1 A;  5B8I B;  5IBW A;  1K2H A;  2KI4 C;  1SR6 B;  2Y1M A;  2M49 B;  2JWW A;  3BYA A;  4CID A;  5I94 A;  3ZWH A;  4F7F A;  1S5G Z;  2IS9 A;  1UHN A;  4I5K A;  4NDC A;  1B1G A;  2M97 A;  3FS7 A;  4PT1 A;  1MHO A;  1XFY O;  4MZJ A;  2WOS A;  1Y1A A;  3QME A;  2E30 A;  1S1E A;  1DJI A;  1PUL A;  2BCA A;  2BKH B;  1LKJ A;  2KAV A;  3O4Y A;  1QAT A;  3BFA A;  2COL B;  4N1F A;  1CTR A;  2LAP A;  3S0G A;  3B7A A;  2M7N A;  4JKT A;  2WCJ A;  3BQ3 A;  1NUB A;  1QLK A;  1CM1 A;  2JTZ A;  3CZ2 A;  5I2L A;  2Y5I A;  4YGA A;  1MF8 B;  2K2F A;  4YGC B;  1NCZ A;  3DF0 B;  3LK1 A;  4N1G A;  3HX4 A;  4FQT A;  1J1D A;  2L51 A;  3CS1 A;  1XK4 C;  1EG4 A;  2MA2 A;  1AJ4 A;  3D78 A;  4A4B A;  4HRE E;  1M39 A;  1R2U A;  1QJT A;  3PSR A;  1UUR A;  1L7Z A;  4BY4 A;  1WRZ A;  3CDN A;  3IF7 A;  4GAO A;  2ZNE A;  4M2O A;  4MZK A;  4NDB A;  1DEL A;  1RTP 1;  2KYC A;  4TNC A;  4DS7 A;  1FI6 A;  2HQ8 A;  1X02 A;  4IJ7 A;  1FPW A;  2G9B A;  1TUJ A;  2AUC A;  1YVL A;  3IQQ A;  3CGA A;  4M2Q A;  1KFU S;  1SY9 A;  4MZL A;  3LLE A;  3PAT A;  4R1E A;  3GOF A;  4PHK A;  4D1E A;  4MBE A;  1AP4 A;  1KQV A;  3DVJ A;  1QV1 A;  3EKJ A;  5ER5 A;  2F2P A;  1J1E A;  1IJ6 A;  1LS8 A;  1PSR A;  4MEW A;  3O6B A;  2M29 A;  1F8H A;  2MLE C;  4CFQ A;  2M9G A;  1S6J A;  1OOI X;  2NCP A;  5CSJ A;  2L50 A;  1Y1X A;  3EK8 A;  2OTG B;  1YRT B;  3SS3 A;  2JXL A;  1CFP A;  5I2O A;  4L9M A;  2OTG C;  1A4P A;  3AKA A;  1L2O C;  2QEO A;  2LVI A;  3NSL A;  1D1O A;  2MLF C;  2MRD A;  1N2D A;  2K7C A;  4PHN A;  1IIO A;  1EXR A;  2WND A;  4AQI A;  2FOT A;  4XJK A;  4DRW A;  4IL1 A;  1KK7 Y;  2PVB A;  1A75 A;  1RK9 A;  2JTT A;  1QVI Y;  2LV7 A;  1DJW A;  3DF0 A;  3DYE A;  3S0B A;  1KSM A;  4MVF A;  4PAL A;  3O4X A;  3BFB A;  1OOG A;  2OS8 C;  1GGW A;  2FJU B;  1DGV A;  5EL2 A;  3A8R A;  3CTN A;  4QJ4 B;  1QX5 B;  3CWG A;  1F70 A;  1TNQ A;  2CT9 A;  1IH0 A;  1H8B A;  2ISD A;  1S5G Y;  3D10 A;  3D75 A;  1B7T Z;  4PHJ A;  2BL0 B;  4WRI A;  1OW4 A;  1W7I B;  4PE7 A;  1YRU B;  1TNW A;  1MWN A;  2KGR A;  1S6I A;  5DKN A;  1G8I A;  2QAC A;  1Y6W A;  3K21 A;  2KNE A;  1B8L A;  5CSF A;  1TNX A;  3KPX A;  1C3Y A;  3I5G C;  3O2P A;  2NZ0 A;  1TWO A;  4YGE B;  3SIB A;  3SG3 A;  1AJ5 A;  3BOW A;  2O5G A;  3SG6 A;  1YUR A;  3JVT B;  1CFF A;  1SRA A;  2KFH A;  2HPS A;  1SCV A;  3KO0 A;  3CLN A;  3JVT C;  2K0J A;  4Q04 A;  3BXK A;  3CZ0 A;  2PSR A;  1NSH A;  3DVK A;  5CSN A;  4WQ2 A;  3OHM B;  4YGB B;  4GGF C;  1C7W A;  1NX3 A;  1QX7 A;  1XFR A;  2JNF A;  4OVN F;  2LM5 A;  1WLZ A;  2I7A A;  4NQG A;  4QJ3 B;  1NX0 A;  1KWO B;  2ERB A;  1DJY A;  2KLD A;  1QVI Z;  1IQ5 A;  1JFK A;  1KWO C;  2WC6 A;  3CZ1 A;  1HQV A;  1OMV A;  2PAS A;  3EK4 A;  3TUY B;  1KQM B;  1ZFS A;  2NLN A;  2ZN9 A;  2LMT A;  4PE4 A;  3TUY C;  3CR4 X;  1KQM C;  2QEB A;  1S26 D;  1IWQ A;  3CYZ A;  3D76 A;  3S0D A;  3BUM B;  3RLZ A;  1K9K A;  1WRK A;  1XYD A;  4ORB B;  1DMO A;  2QEH A;  4GNK B;  4OCI A;  5D69 A;  4OV2 A;  2GTE A;  4JD9 A;  2QEV A;  4AOM A;  4GBA A;  2GGM A;  1AHR A;  2L5X B;  1U5I A;  1UWO A;  1OOJ A;  1YVH A;  3WXA A;  3D74 A;  2KFF A;  3I5I C;  1A29 A;  2D8N A;  3OX6 A;  1TRF A;  5JJG A;  1K93 D;  1JFJ A;  1V1G A;  4CFR A;  1DT7 B;  4E68 A;  4UPG A;  1NX2 A;  1TIZ A;  3PM2 A;  4XJK B;  3RM1 A;  4HRG A;  1B4C A;  1ZOT B;  1JUO A;  2KGB C;  3MSE B;  5FI7 A;  1A75 B;  1MXE A;  3TDI A;  1CLB A;  2L2C A;  4MSP A;  2HET A;  2PMY A;  1PRW A;  1OQP A;  1SW8 A;  3B86 A;  1C07 A;  1HT9 A;  2CBL A;  3OGN A;  1MXL C;  1QLS A;  2KOT A;  1DEK A;  1BLQ A;  1J7P A;  1B8R A;  4I5L B;  2EGD A;  4DUQ A;  1IKU A;  1AK8 A;  1LA0 A;  4DIR A;  2WOR A;  4GGF A;  2LP3 A;  5K89 A;  1YTZ C;  1ORG A;  2KQ6 A;  2M3W A;  3GK4 X;  3NSK A;  4MLW A;  4C0J A;  4I5N B;  2F3Y A;  2GV5 A;  1B47 A;  5HLV A;  1J7Q A;  1QV0 A;  1P28 A;  5HKW A;  1QTX A;  2HF5 A;  1K8U A;  1IJ5 A;  1LVC D;  1S6C A;  3VRN A;  1TNP A;  3CAB A;  3BOW B;  3GK1 A;  3H4S E;  1DTL A;  3EK7 A;  1EJ3 A;  3V2L A;  1B7T Y;  1DJZ A;  2LUC A;  2LVV A;  2BKI B;  2Q91 A;  2V53 A;  1F4O A;  3S0E A;  1FF1 A;  1B9A A;  2FCD A;  3AAK A;  1XA5 A;  1RFJ A;  2SCP A;  4ORA B;  1PSB A;  1ZUZ A;  3PM8 A;  4YGD B;  1OZS A;  2WCL A;  3NXA A;  3OB2 B;  1UHI A;  1CDN A;  4OKH A;  1DJX A;  2H2K A;  3L4A A;  1K90 D;  2PQL A;  3SG5 A;  3JTD B;  2OPO A;  1QX2 A;  1BOC A;  1IQ3 A;  3B87 A;  2O60 A;  3JTD C;  1L2O B;  1Z2C B;  4M2P A;  1YUU A;  2K7O A;  5D7F A;  3NHT A;  1LXF C;  3NSI A;  1ALW A;  1WY9 A;  2LHI A;  4I5J A;  4YBH B;  1Y1U A;  3PLF B;  1XFX O;  1CMG A;  2JT0 A;  3OX5 A;  5KU1 A;  2KSP A;  3DVM A;  4JWQ A;  2K8M B; 
#chains in the Genus database with same CATH homology
 1UP5 A;  2K7D A;  1E8A A;  1XO5 A;  2QPT A;  3LCP C;  1U5I B;  2OS8 B;  1PVA A;  1YUS A;  1OE9 B;  1WDC B;  1JWD A;  1MUX A;  2A4J A;  2M0R A;  3EVU A;  3GK2 A;  4GGN A;  5GQQ C;  1JSA A;  1RJV A;  2E6W A;  1WDC C;  2ZFD A;  1XFZ O;  2LVJ A;  2M1U A;  1FBV A;  2L4I A;  1J7O A;  4PE1 A;  2L4H A;  3DVE A;  1CDL A;  1TTX A;  2F8P A;  3BUX B;  5AXI A;  1WRL A;  2KAY A;  2LLS A;  1YX8 A;  3I5G B;  5G08 A;  3FIA A;  3PN7 C;  2LMU A;  3A4U B;  2FCE A;  2K61 A;  2LP2 A;  1JF0 A;  2BE6 A;  5AER A;  3OB1 B;  2LCP A;  1KFX S;  2PRU A;  2KI6 D;  1GQM A;  4P5O E;  2WC8 A;  2I94 A;  4ICB A;  4PCW A;  3SG2 A;  4NDD A;  2P6B B;  3ICB A;  3SJS A;  1PK0 D;  2JOJ A;  3M0W A;  4JQ0 D;  3BUW B;  4ZCV A;  1S36 A;  1CFD A;  1J7R A;  1Q80 A;  2WCB A;  4FTG A;  1ZMZ A;  2JUL A;  2KHN A;  4OR9 B;  2KQY A;  3SG7 A;  5TNC A;  2CNP A;  1KK8 B;  2KBI A;  1BR1 B;  1OSA A;  4U8D A;  1IG5 A;  1KK8 C;  3F45 A;  2ZRT A;  1F71 A;  1A03 A;  3EVV A;  5ER4 X;  2H61 C;  1CNP A;  3AKB A;  4PHM A;  3OP0 A;  1R6P A;  1DJG A;  1F4Q A;  2JT8 A;  1K9U A;  1M63 B;  1SMG A;  1EG3 A;  4MRX A;  3BUO B;  1F55 A;  5PAL A;  5AFP A;  4ZCU A;  3TDZ A;  1J55 A;  1BR4 B;  1C7V A;  2Y1N A;  1NP8 A;  5AAN A;  1UHK A;  2AAO A;  3I5I B;  1KSO A;  1IRJ A;  4MN0 A;  1UHH A;  2BBN A;  1TOP A;  1TN4 A;  1YR5 A;  2AMI A;  2WCE A;  1XFW O;  2LUX A;  1JF2 A;  1CDP A;  3I5F C;  4GPL B;  1SPY A;  1JBA A;  1H4B A;  1LIN A;  1QIV A;  2JXC A;  4USL A;  3TZ1 A;  1DF0 A;  2K2A A;  1JC2 A;  2LC5 A;  2KI6 C;  1B8C A;  1M31 A;  5F6T A;  1G4Y R;  1NX1 A;  1OZO A;  1REC A;  1SR6 C;  5JOL A;  1NYA A;  4WQ3 A;  4P2Y B;  4HSZ A;  1SL9 A;  1OMD A;  1UUS A;  1NCY A;  2LMV A;  2ZN8 A;  1ALV A;  1BJF A;  2ZKM X;  2BCB A;  2CXJ A;  3I5H B;  3TS5 B;  1UHJ A;  1CLL A;  2LNK A;  3VRQ A;  1TCF A;  2KBM A;  5HYD A;  2MHH A;  3I5H C;  3TS5 C;  3KF9 A;  2LLU A;  1RRO A;  2JNX A;  1N65 A;  1RWY A;  1PAL A;  2JZI A;  2KDH A;  3ZNI A;  1NCX A;  3VGO A;  1CMF A;  1CKK A;  5AEQ A;  1CDM A;  1EL4 A;  2F3Z A;  4YI9 A;  2LHL A;  2I18 A;  1SKT A;  1NPQ A;  4GFT A;  1SL8 A;  1A2X A;  2H61 A;  2PAL A;  1SCM B;  3BUN B;  1SCM C;  2L2E A;  2LAN A;  3DD4 A;  1KFU L;  2MBX A;  3PFV A;  4C0L A;  4FQO A;  3E3R A;  1M46 A;  2CTN A;  4XYN A;  2F33 A;  3HCM A;  4AQJ A;  1GJY A;  4GUK A;  4CLN A;  5J3X A;  1YX7 A;  1BT6 A;  1NWD A;  2KYF A;  2NCO A;  5FYX A;  5I8N A;  1MQ1 A;  2WCF A;  2I2R E;  3FWB A;  4QJ5 B;  1K95 A;  3TDU A;  1XVJ A;  2Y4Q A;  2BBM A;  1NIW A;  3KEV A;  3WNX B;  1FW4 A;  1Y0V H;  2LE9 B;  3C1V A;  1CLM A;  3D0Y A;  1BOD A;  4ORC B;  3VRP A;  1FI5 A;  1QXP A;  2JQ6 A;  2M7L A;  5HKZ A;  5HLO A;  2KAX A;  1SYM A;  1OMR A;  4DCK A;  1GGZ A;  1CB1 A;  3O78 A;  2CCM A;  1AUI B;  3SIA A;  3VRO A;  2BE4 A;  2HQW A;  2EHB A;  1BU3 A;  5HKY A;  3LL8 B;  1SNL A;  1K96 A;  2EC6 B;  2DOQ A;  4MRY A;  4C0K A;  2K7B A;  1G33 A;  1DF0 B;  2EC6 C;  2BEC A;  5KSZ A;  2L0P A;  2JPT A;  1DVI A;  1PVB A;  3PN7 B;  2G2B A;  5DKR A;  4A4C A;  1BMO A;  1EH2 A;  3PAL A;  5KTY A;  3CR2 A;  1MR8 A;  1M45 A;  2Q4U A;  1XK4 A;  1AVS A;  2JRF A;  4YRU A;  1XFV O;  2LVK A;  3CR5 X;  1ZAC A;  5BPJ A;  2R2I A;  1SBJ A;  2B1U A;  2JT3 A;  3IQO A;  4PE0 A;  2VRG A;  4BY5 A;  1TCO B;  2JC2 A;  3WHT B;  1V1F A;  1WLM A;  1KFX L;  5CPV A;  1YUT A;  1K9P A;  1CFC A;  2BL0 C;  2ZND A;  2RGI A;  1XFU O;  1QAS A;  3KHE A;  1IGV A;  2JU0 A;  1SK6 D;  2SAS A;  1S3P A;  1ODB A;  4PDZ A;  1CM4 A;  2MJW B;  3QRX A;  1DGU A;  4YI8 A;  4F0Z B;  4JPZ B;  2KFG A;  3SG4 A;  1W7J B;  3EVR A;  1N0Y A;  1QIW A;  2LLT A;  1DJH A;  5CSI A;  2ZRS A;  3LK0 A;  4HRH A;  3NSO A;  3WHU B;  1QS7 A;  3VRR A;  2MAZ A;  1F54 A;  3AAJ A;  1KCY A;  2GGZ A;  2NXQ A;  3I5F B;  4ETO A;  4CPV A;  1KK7 Z;  1BG1 A;  2F2O A;  3CZT X;  5I2Q A;  2BCX A;  2TN4 A;  2M8U A;  1LA3 A;  5DKQ A;  1SL7 A;  2M1K B;  3D0Y B;  3FWC A;  2KI4 B;  1BF5 A;  3EKH A;  1K94 A;  4N5X A;  2L98 A;  1VRK A;  5B8I B;  5IBW A;  1K2H A;  2KI4 C;  1SR6 B;  2Y1M A;  2M49 B;  2JWW A;  3BYA A;  4CID A;  3ZWH A;  1S5G Z;  2IS9 A;  1UHN A;  4I5K A;  4NDC A;  1B1G A;  2M97 A;  3FS7 A;  1MHO A;  1XFY O;  4MZJ A;  2WOS A;  1Y1A A;  2E30 A;  1S1E A;  1DJI A;  1PUL A;  2BCA A;  2BKH B;  1LKJ A;  2KAV A;  3O4Y A;  1QAT A;  2COL B;  4N1F A;  1CTR A;  2LAP A;  2M7N A;  3BQ3 A;  1NUB A;  1QLK A;  1CM1 A;  2JTZ A;  5I2L A;  2Y5I A;  4YGA A;  1MF8 B;  2K2F A;  4YGC B;  1NCZ A;  3DF0 B;  3LK1 A;  4N1G A;  3HX4 A;  1J1D A;  2L51 A;  3CS1 A;  1XK4 C;  1EG4 A;  2MA2 A;  1AJ4 A;  4A4B A;  4HRE E;  1M39 A;  1R2U A;  1QJT A;  3PSR A;  1UUR A;  1L7Z A;  4BY4 A;  1WRZ A;  3IF7 A;  4GAO A;  2ZNE A;  4M2O A;  4MZK A;  4NDB A;  1RTP 1;  2KYC A;  4TNC A;  4DS7 A;  1FI6 A;  2HQ8 A;  1X02 A;  1FPW A;  2G9B A;  2AUC A;  1YVL A;  3IQQ A;  3CGA A;  4M2Q A;  1KFU S;  1SY9 A;  4MZL A;  3LLE A;  3PAT A;  4R1E A;  3GOF A;  4PHK A;  4D1E A;  4MBE A;  1AP4 A;  1KQV A;  3DVJ A;  1QV1 A;  3EKJ A;  5ER5 A;  2F2P A;  1J1E A;  1IJ6 A;  1PSR A;  4MEW A;  3O6B A;  2M29 A;  1F8H A;  2MLE C;  4CFQ A;  2M9G A;  1S6J A;  2NCP A;  5CSJ A;  2L50 A;  1Y1X A;  3EK8 A;  2OTG B;  1YRT B;  2JXL A;  1CFP A;  5I2O A;  4L9M A;  2OTG C;  1A4P A;  3AKA A;  1L2O C;  2LVI A;  3NSL A;  1D1O A;  2MLF C;  2MRD A;  1N2D A;  2K7C A;  4PHN A;  1EXR A;  2WND A;  4AQI A;  2FOT A;  4XJK A;  4DRW A;  4IL1 A;  1KK7 Y;  2PVB A;  1A75 A;  1RK9 A;  2JTT A;  1QVI Y;  2LV7 A;  1DJW A;  3DF0 A;  1KSM A;  4MVF A;  4PAL A;  2OS8 C;  1GGW A;  2FJU B;  1DGV A;  3A8R A;  3CTN A;  4QJ4 B;  1QX5 B;  3CWG A;  1F70 A;  1TNQ A;  2CT9 A;  1IH0 A;  1H8B A;  2ISD A;  1S5G Y;  3D10 A;  1B7T Z;  4PHJ A;  2BL0 B;  4WRI A;  1W7I B;  4PE7 A;  1YRU B;  1TNW A;  1MWN A;  2KGR A;  1S6I A;  5DKN A;  1G8I A;  2QAC A;  1Y6W A;  3K21 A;  2KNE A;  1B8L A;  5CSF A;  1TNX A;  3KPX A;  3I5G C;  3O2P A;  2NZ0 A;  4YGE B;  3SIB A;  3SG3 A;  1AJ5 A;  3BOW A;  2O5G A;  3SG6 A;  1YUR A;  3JVT B;  1CFF A;  1SRA A;  2KFH A;  2HPS A;  1SCV A;  3KO0 A;  3CLN A;  3JVT C;  2K0J A;  4Q04 A;  3BXK A;  2PSR A;  1NSH A;  3DVK A;  5CSN A;  4WQ2 A;  3OHM B;  4YGB B;  4GGF C;  1C7W A;  1NX3 A;  1QX7 A;  2JNF A;  4OVN F;  2LM5 A;  1WLZ A;  2I7A A;  4NQG A;  4QJ3 B;  1NX0 A;  1KWO B;  1DJY A;  1QVI Z;  1IQ5 A;  1JFK A;  1KWO C;  1HQV A;  1OMV A;  2PAS A;  3EK4 A;  3TUY B;  1KQM B;  1ZFS A;  2NLN A;  2ZN9 A;  2LMT A;  4PE4 A;  3TUY C;  3CR4 X;  1KQM C;  1S26 D;  1IWQ A;  3BUM B;  3RLZ A;  1K9K A;  1WRK A;  1XYD A;  4ORB B;  1DMO A;  4GNK B;  4OCI A;  5D69 A;  4OV2 A;  4AOM A;  4GBA A;  2GGM A;  1AHR A;  2L5X B;  1U5I A;  1UWO A;  1OOJ A;  1YVH A;  3WXA A;  2KFF A;  3I5I C;  1A29 A;  2D8N A;  3OX6 A;  1TRF A;  5JJG A;  1K93 D;  1JFJ A;  1V1G A;  4CFR A;  1DT7 B;  4E68 A;  4UPG A;  1NX2 A;  1TIZ A;  4XJK B;  3RM1 A;  4HRG A;  1B4C A;  1ZOT B;  1JUO A;  2KGB C;  3MSE B;  1A75 B;  1MXE A;  3TDI A;  1CLB A;  4MSP A;  2HET A;  2PMY A;  1PRW A;  1OQP A;  1SW8 A;  1C07 A;  1HT9 A;  2CBL A;  1MXL C;  1QLS A;  2KOT A;  1BLQ A;  1J7P A;  1B8R A;  4I5L B;  2EGD A;  4DUQ A;  1IKU A;  1AK8 A;  1LA0 A;  4DIR A;  2WOR A;  4GGF A;  2LP3 A;  5K89 A;  1YTZ C;  2KQ6 A;  2M3W A;  3NSK A;  3GK4 X;  4MLW A;  4C0J A;  4I5N B;  2F3Y A;  2GV5 A;  1B47 A;  5HLV A;  1J7Q A;  1QV0 A;  5HKW A;  1QTX A;  2HF5 A;  1K8U A;  1IJ5 A;  1LVC D;  1S6C A;  3VRN A;  1TNP A;  3GK1 A;  3BOW B;  3H4S E;  1DTL A;  3EK7 A;  1EJ3 A;  1B7T Y;  1DJZ A;  2LUC A;  2LVV A;  2BKI B;  2Q91 A;  2V53 A;  1F4O A;  1FF1 A;  1B9A A;  2FCD A;  3AAK A;  1XA5 A;  1RFJ A;  2SCP A;  4ORA B;  1PSB A;  1ZUZ A;  3PM8 A;  4YGD B;  1OZS A;  3NXA A;  3OB2 B;  1UHI A;  1CDN A;  4OKH A;  1DJX A;  2H2K A;  1K90 D;  3SG5 A;  3JTD B;  2OPO A;  1QX2 A;  1BOC A;  1IQ3 A;  2O60 A;  3JTD C;  1L2O B;  4M2P A;  1YUU A;  2K7O A;  5D7F A;  1LXF C;  3NSI A;  1ALW A;  1WY9 A;  2LHI A;  4I5J A;  4YBH B;  1Y1U A;  3PLF B;  1XFX O;  1CMG A;  2JT0 A;  3OX5 A;  5KU1 A;  2KSP A;  3DVM A;  4JWQ A;  2K8M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...