2K7CA

Nmr structure of mg2+-bound cabp1 c-domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
ADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 1
publication title NMR Structure of Mg2+-bound CaBP1 C-domain
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7cA00
2I18A 3CZTX 2F2OA 1B8RA 1OMRA 1YX7A 3H4SE 4OV2A 1D1OA 1CLBA 3JTDB 3KF9A 2I2RE 1GJYA 3OX6A 1M46A 2BL0C 2CBLA 2L98A 2CXJA 3BYAA 3KHEA 2LMTA 2ZNEA 3EVRA 3NXAA 4ZCUA 1F8HA 1JF0A 1RROA 5CSJA 1TCOB 2LC5A 1OQPA 1SNLA 1DVIA 1SYMA 1UHIA 3TS5B 1M31A 4M2PA 5CSFA 2R2IA 1CDNA 3IF7A 1A2XA 1KWOC 2OS8B 4YBHB 3CWGA 2M7LA 3JVTB 1XVJA 2JQ6A 2PMYA 4Q04A 1YX8A 3PSRA 3ZWHA 3HX4A 3TUYB 1GQMA 3OP0A 3EVUA 3AAKA 3BQ3A 2LNKA 3FWBA 4JWQA 1AK8A 5CSIA 1KSMA 2ZN8A 4PHJA 1XK4C 4OKHA 2KI4C 5HKZA 3KO0A 1RFJA 2NCPA 1ALWA 3A4UB 3CR4X 1OZSA 1TNPA 4HRHA 2HPSA 1NX1A 4ORAB 1SR6C 1U5IA 3SG5A 2H61C 4DUQA 1QIWA 1XFYO 1CLLA 1WRZA 1QX5B 3FIAA 1WRKA 2BL0B 2ZKMX 2M1KB 3D0YA 2KBMA 1S6IA 1J55A 3LCPC 2ZRSA 1EJ3A 1ODBA 1LA0A 1YRTB 4I5NB 4ZCVA 1MUXA 1MXEA 1OZOA 1QXPA 2JC2A 3GOFA 3KEVA 1WDCB 1FI6A 1S6CA 4PE7A 2LHLA 2M49B 2M3WA 1QS7A 1JSAA 5HKWA 1DJIA 2F3YA 1SK6D 3DVJA 1FI5A 1KWOB 2QACA 2K2FA 4MEWA 1LXFC 4N5XA 4XJKA 1KFXS 3ZNIA 2LLUA 3I5GC 1CDPA 1UHHA 4CPVA 2JTTA 1Y1XA 2KGBC 2KI4B 1L2OC 2BE4A 1KQMB 2KYFA 2L5XB 3BUXB 4L9MA 1X02A 3CGAA 2M9GA 3OHMB 4C0LA 1YUSA 4IL1A 1DGVA 1SR6B 2KFGA 2PALA 1F54A 2WC8A 1AJ5A 1K93D 1NSHA 1S5GY 5HKYA 4AQIA 2EHBA 1CDMA 1V1GA 1J1EA 2LUXA 3VRRA 1WLZA 4CIDA 1UHJA 2M8UA 1OOJA 1IRJA 1YUTA 2KHNA 2L4IA 1F70A 4XYNA 5D7FA 1K8UA 2CNPA 1S5GZ 1S1EA 5IBWA 1IKUA 1NPQA 1E8AA 1BODA 5DKQA 3KPXA 1B1GA 1PVAA 1QVIY 1CLMA 3M0WA 1SRAA 3DF0B 5PALA 2K7BA 2K7CA 1KFXL 3SG2A 3OB1B 1MXLC 3HCMA 1BR1B 3CR5X 4N1GA 3VGOA 2GGMA 2L51A 4M2QA 1C7VA 4ORCB 1J7PA 2LP3A 2M29A 1KK8B 4PE1A 1J7OA 1XA5A 2MA2A 1DJWA 2MBXA 2BBNA 4A4CA 1L2OB 2I7AA 1Y0VH 1QVIZ 2LANA 3EKJA 1BR4B 3D10A 2FCEA 1DT7B 2M7NA 3EK7A 1J1DA 2FCDA 3GK4X 4HSZA 1IGVA 2AAOA 1C07A 2BCXA 2LHIA 1K96A 2KBIA 4OCIA 1TNWA 1JBAA 1PSRA 4FTGA 1RECA 1TNXA 2JT3A 1SCMC 1IG5A 1FPWA 2EC6B 1IQ3A 2MLFC 1FW4A 1UUSA 2JT0A 2LE9B 2JXCA 1H8BA 2HETA 4WQ2A 1M63B 1QASA 2Y1NA 5GQQC 3VRQA 4YGBB 3I5FC 1ZOTB 3BOWB 1KFUS 3I5IC 1TCFA 2JU0A 4JQ0D 1TNQA 2FJUB 1NIWA 2LUCA 1PRWA 2PASA 2G9BA 1CFCA 1IJ5A 1DMOA 2OPOA 1R6PA 5HLOA 1WLMA 1OMVA 5KU1A 2ZFDA 2JT8A 2OTGB 4CLNA 4I5LB 3DD4A 3E3RA 1QV0A 1SPYA 1TN4A 2NCOA 5B8IB 2O60A 3CLNA 1A29A 3PN7C 5BPJA 3I5HB 1K94A 4ETOA 1KK7Y 1W7IB 1AHRA 2SCPA 1F55A 3PATA 3MSEB 2Y1MA 3OB2B 1PSBA 2PSRA 2KGRA 4YRUA 1QTXA 2LCPA 2QPTA 3IQQA 4E68A 1UHKA 4YGDB 3WHTB 1YVLA 2LAPA 5TNCA 4MZKA 1KK7Z 4GFTA 2L50A 4P5OE 1FBVA 3I5IB 2MRDA 1XYDA 5AEQA 1NCYA 1G33A 1PULA 2BECA 1B8CA 2KQ6A 3FWCA 3O78A 4OVNF 1Y1UA 1EG3A 4MZLA 1M39A 2KI6C 1PK0D 2JWWA 5J3XA 4CFRA 4MVFA 5HYDA 1DJYA 3A8RA 1NYAA 3OX5A 1F4QA 4GNKB 1UURA 2F33A 2L2EA 5I2OA 2M97A 2GGZA 5AFPA 4AQJA 4GAOA 1DJZA 2KI6D 4MRXA 1YUUA 3PN7B 2H61A 1B4CA 1HQVA 1LINA 3TDZA 4ICBA 1YURA 1CM1A 2NXQA 2BCAA 2DOQA 1ZUZA 1BF5A 5AERA 3F45A 2B1UA 3K21A 2KNEA 2F8PA 4C0KA 1BT6A 2F2PA 1MF8B 2HQ8A 3PFVA 1NUBA 1SKTA 2KQYA 2K7DA 2WNDA 4NDBA 2JTZA 2LM5A 2SASA 3DF0A 4OR9B 1S3PA 2KAVA 3WHUB 4PE4A 1ZACA 1Q80A 1MHOA 3NSIA 3CR2A 2LMUA 3SG6A 4DCKA 1K9KA 2K2AA 2MLEC 2BE6A 3BUMB 4TNCA 1A75B 1VRKA 1YVHA 4MBEA 5CSNA 1LKJA 3I5GB 2JOJA 1BOCA 1FF1A 2MAZA 2K8MB 1CM4A 2NLNA 4FQOA 5CPVA 1BG1A 1JF2A 1XFXO 2D8NA 4C0JA 5ER4X 1NCZA 3JTDC 1B47A 2TN4A 4PHNA 4I5KA 1BMOA 2PRUA 1OE9B 3VRNA 1YRUB 1N2DA 1R2UA 2RGIA 1CFFA 5D69A 3CTNA 3EKHA 4PALA 2WOSA 2LLSA 1LVCD 1SW8A 1Y1AA 3SG4A 1EH2A 5K89A 3TS5C 2H2KA 1ZFSA 2BBMA 2CT9A 5HLVA 4QJ3B 2ISDA 1DJHA 4BY4A 1IWQA 5DKNA 4DIRA 2LV7A 2OS8C 1AP4A 1K2HA 1J7RA 2K61A 1BLQA 3TUYC 4GGFA 2AMIA 1UHNA 3BUWB 3BOWA 4MSPA 2P6BB 3IQOA 4HRGA 2KYCA 1NX2A 2ZRTA 3EVVA 5AANA 1QIVA 2COLB 3O6BA 1TOPA 2MHHA 4PE0A 1NX3A 3BUNB 3DVKA 1A03A 1CMFA 1W7JB 1JWDA 4UPGA 3FS7A 3EK8A 1MR8A 1DJGA 3AKBA 1YTZC 2F3ZA 2Q4UA 3TDUA 4GGNA 4DS7A 2FOTA 1EG4A 1DGUA 1QJTA 2JNXA 2WCBA 1V1FA 3LK0A 3NSLA 4MLWA 4YGCB 1XFWO 1KSOA 4GPLB 2CCMA 2G2BA 1JFJA 2K7OA 2LVVA 2LVIA 1C7WA 2AUCA 4I5JA 4U8DA 2BCBA 3LL8B 3PLFB 1UWOA 2BKIB 3EK4A 2JPTA 1JC2A 1RJVA 1XFUO 2HF5A 2JZIA 5FYXA 4YGEB 4DRWA 1CTRA 3QRXA 4BY5A 3GK1A 5I2QA 1IH0A 1QLSA 1WDCC 4M2OA 1CNPA 1KCYA 4MN0A 1XFVO 1SCMB 1N65A 4USLA 2L0PA 4R1EA 3AKAA 1CFDA 1G8IA 3SG3A 3BXKA 2HQWA 1N0YA 1PALA 3ICBA 1TTXA 4GBAA 1IQ5A 2MJWB 4ORBB 3GK2A 1AJ4A 2ZN9A 4AOMA 3NSKA 1SCVA 1WY9A 1KFUL 2JULA 3I5FB 2CTNA 1QV1A 2Y4QA 1KQMC 3BUOB 4N1FA 4QJ5B 2WCEA 1UP5A 1QATA 1BJFA 1NCXA 2V53A 2KFHA 1SBJA 2A4JA 2KAXA 2KDHA 2LP2A 2O5GA 1DJXA 1SY9A 3LLEA 2VRGA 1U5IB 1S6JA 1TRFA 1Y6WA 5AXIA 2K0JA 2JNFA 5ER5A 1SL8A 3O4YA 1XK4A 1SL9A 4CFQA 3SJSA 5I2LA 1QLKA 1BU3A 1MWNA 1ZMZA 3VROA 4F0ZB 3RM1A 4GUKA 2E30A 3D0YB 2EGDA 1NP8A 1A4PA 2LMVA 1S36A 1JUOA 2GV5A 1SL7A 1NX0A 1RK9A 2WORA 4QJ4B 1K9PA 2Q91A 1AUIB 2E6WA 3RLZA 4WQ3A 4XJKB 1B9AA 3WXAA 1RTP1 2L4HA 1KK8C 1GGWA 1HT9A 5DKRA 4D1EA 2JRFA 1J7QA 4MRYA 1B8LA 1F4OA 1CFPA 5KTYA 4YGAA 5I8NA 1NWDA 2LVKA 3VRPA 2LLTA 1OMDA 1M45A 3TDIA 1A75A 1LA3A 3TZ1A 5JJGA 1K95A 1PVBA 1S26D 1QX7A 1MQ1A 1GGZA 2I94A 3PALA 1QX2A 1L7ZA 4P2YB 1F71A 1XFZO 2EC6C 4PDZA 3CS1A 3DVEA 4MZJA 1G4YR 3LK1A 2JXLA 4WRIA 1JFKA 1B7TY 1SMGA 2KAYA 4PCWA 4NDCA 1TIZA 2Y5IA 4PHMA 1DTLA 3SIBA 4GGFC 1H4BA 3SIAA 4PHKA 4YI9A 1CDLA 2LVJA 3PM8A 5G08A 2NZ0A 1CKKA 3AAJA 1ALVA 3C1VA 1IJ6A 1B7TZ 1K9UA 4JPZB 5KSZA 3JVTC 2ZNDA 1DF0A 2PVBA 4NQGA 1AVSA 1WRLA 1EL4A 1OSAA 3NSOA 5JOLA 5F6TA 4YI8A 2M1UA 1DF0B 2KSPA 1CMGA 2OTGC 1KQVA 2BKHB 4HREE 4A4BA 1YR5A 3DVMA 1K90D 2IS9A 2KFFA 4NDDA 1XO5A 3I5HC 2M0RA 3O2PA 2WCFA 1RWYA 2KOTA 3SG7A 1EXRA 3WNXB 1CB1A
chains in the Genus database with same CATH superfamily
2I18A 3CZTX 2F2OA 1B8RA 1OMRA 1YX7A 3H4SE 4OV2A 4KYNA 1D1OA 2WCJA 1CLBA 3JTDB 4OZDA 3KF9A 2I2RE 1GJYA 3OX6A 1M46A 2BL0C 2CBLA 2L98A 1W9ZA 2CXJA 3BYAA 3KHEA 2LMTA 2ZNEA 3EVRA 3NXAA 4ZCUA 1F8HA 1JF0A 1RROA 5CSJA 1TCOB 2LC5A 1OQPA 1SNLA 3B88A 1DVIA 1SYMA 1UHIA 3TS5B 1M31A 4M2PA 5CSFA 2R2IA 1CDNA 3IF7A 2FJYA 1A2XA 1KWOC 2OS8B 2L2CA 3CWGA 4YBHB 2WCLA 2M7LA 3JVTB 1XVJA 2JQ6A 3R1OA 2PMYA 4Q04A 1YX8A 1DELA 3PSRA 3ZWHA 3HX4A 3TUYB 1GQMA 3OP0A 3EVUA 3AAKA 1Z4HA 3BQ3A 2LNKA 3FWBA 4JWQA 1AK8A 5CSIA 1KSMA 2ZN8A 4PHJA 1XK4C 4OKHA 2KI4C 5HKZA 3SS4A 3KO0A 1RFJA 2NCPA 1ALWA 3A4UB 3CR4X 1DC1A 1OZSA 1TNPA 4HRHA 2HPSA 1NX1A 5DICA 4ORAB 1SR6C 1U5IA 2JPOA 3SG5A 2H61C 4DUQA 2QEVA 1QIWA 1XFYO 1CLLA 3D75A 1WRZA 1QX5B 3FIAA 1WRKA 2BL0B 2ZKMX 2M1KB 3D0YA 2WCMA 5FI6A 2KBMA 1S6IA 1J55A 3LCPC 2ZRSA 1EJ3A 1ODBA 3Q8IA 1LA0A 1YRTB 3OBVA 4I5NB 4ZCVA 1MUXA 1MXEA 1OZOA 1QXPA 2JC2A 3GOFA 3KEVA 1WDCB 3D77A 1FI6A 1S6CA 4PE7A 2LHLA 2M49B 2M3WA 1QS7A 1JSAA 5HKWA 1DJIA 2F3YA 1SK6D 3DVJA 1FI5A 1KWOB 2QACA 2K2FA 4MEWA 1LXFC 4N5XA 4XJKA 1KFXS 3ZNIA 2LLUA 3I5GC 1CDPA 1UHHA 4CPVA 2JTTA 1Y1XA 2L5YA 2KGBC 2KI4B 1L2OC 2BE4A 1KQMB 2KYFA 2L5XB 3BUXB 4L9MA 3S0GA 1X02A 3CGAA 2M9GA 3OHMB 4C0LA 1YUSA 4IL1A 1DGVA 1SR6B 2KFGA 2PALA 1F54A 3NGVA 2WC8A 1AJ5A 1K93D 1NSHA 1S5GY 5HKYA 4AQIA 3O4XA 2EHBA 1CDMA 1V1GA 1J1EA 1LS8A 2LUXA 3VRRA 1WLZA 4CIDA 1UHJA 2M8UA 1OOJA 1IRJA 1YUTA 2KHNA 2L4IA 1F70A 4XYNA 2ERBA 2H8VA 5D7FA 1K8UA 2CNPA 3QMEA 4IJ7A 1S5GZ 1S1EA 2PYQA 5IBWA 1IKUA 1NPQA 1E8AA 1BODA 5DKQA 3KPXA 1B1GA 1PVAA 3FE8A 1QVIY 1CLMA 3M0WA 1SRAA 3DF0B 5PALA 2K7BA 2K7CA 1KFXL 3SG2A 4JKTA 3OB1B 1MXLC 3HCMA 1BR1B 3CR5X 4N1GA 3VGOA 2GGMA 2L51A 3EG5B 4M2QA 4ORCB 1J7PA 2LP3A 2M29A 1KK8B 4PE1A 1J7OA 1XA5A 2MA2A 1DJWA 2MBXA 2BBNA 4A4CA 3CABA 1L2OB 2I7AA 1Y0VH 1QVIZ 2LANA 3VB1A 3EKJA 1BR4B 3D10A 3D73A 2FCEA 1DT7B 2M7NA 3EK7A 1J1DA 2FCDA 1TUJA 3GK4X 1OW4A 4HSZA 1IGVA 2AAOA 1C07A 2BCXA 3S0BA 1GM0A 2LHIA 1K96A 2KBIA 3DZTA 4OCIA 1TNWA 1JBAA 1PSRA 2KPHA 4FTGA 4INWA 1RECA 1TNXA 2JT3A 1DEKA 1SCMC 1IG5A 1C7VA 1FPWA 2EC6B 2BAPA 1P28A 1IQ3A 2MLFC 1FW4A 1UUSA 2JT0A 2LE9B 2JXCA 1H8BA 2HETA 4WQ2A 1M63B 1QASA 2Y1NA 5GQQC 3VRQA 4YGBB 3I5FC 1ZOTB 3BJHA 3BOWB 1KFUS 2WC5A 1TCFA 2JU0A 3I5IC 3L4LA 4JQ0D 1TNQA 2FJUB 5HL1A 1NIWA 2LUCA 5D3OA 1PRWA 2PASA 2G9BA 1CFCA 4F7FA 1IJ5A 2QEBA 1DQEA 3B87A 1DMOA 2PQLA 2OPOA 1R6PA 5HLOA 1WLMA 3N7HA 1OMVA 5KU1A 2ZFDA 2JT8A 3PM2A 2OTGB 4CLNA 4I5LB 3DD4A 3E3RA 1QV0A 1SPYA 1TN4A 2NCOA 3DY9A 2O60A 3CLNA 5B8IB 1A29A 2GTEA 3PN7C 5BPJA 3I5HB 1K94A 4ETOA 1KK7Y 1W7IB 3L47A 1AHRA 1QWVA 2SCPA 1F55A 3PATA 3MSEB 3RZSA 3B7AA 2Y1MA 3OB2B 1PSBA 2PSRA 2KGRA 4YRUA 1QTXA 2LCPA 2QPTA 3IQQA 4E68A 1UHKA 4YGDB 3CZ0A 1YVLA 3WHTB 3CYZA 2LAPA 5TNCA 4MZKA 1KK7Z 3CDNA 4GFTA 2L50A 1T14A 4P5OE 1FBVA 3I5IB 2MRDA 5EL2A 1XYDA 5AEQA 1NCYA 1G33A 1PULA 2BECA 1B8CA 2KQ6A 3FWCA 3O78A 4OVNF 1Y1UA 1EG3A 4MZLA 1M39A 2KI6C 1PK0D 2JWWA 5J3XA 4CFRA 4MVFA 5HYDA 1DJYA 3A8RA 1NYAA 3SS3A 3OX5A 1F4QA 4GNKB 1UURA 2F33A 2L2EA 5I2OA 2M97A 2GGZA 5AFPA 4AQJA 4GAOA 3D74A 1DJZA 2KI6D 4MRXA 1YUUA 3PN7B 2H61A 1B4CA 1HQVA 1LINA 3TDZA 4ICBA 1YURA 1CM1A 2NXQA 2BCAA 2DOQA 1ZUZA 3OGNA 1BF5A 5AERA 3F45A 2B1UA 3K21A 3NHIA 1IIOA 2KNEA 2F8PA 4C0KA 1BT6A 2F2PA 3V2LA 4FQTA 1MF8B 2HQ8A 3PFVA 1NUBA 1SKTA 2KQYA 2K7DA 2WNDA 4NDBA 2JTZA 2LM5A 2SASA 3B86A 3DF0A 4OR9B 4PT1A 1S3PA 2KAVA 3WHUB 2QDIA 4PE4A 1ZACA 1Q80A 1MHOA 1OOGA 3CR2A 2LMUA 3NSIA 3SG6A 4DCKA 1K9KA 2K2AA 2MLEC 3CZ2A 3UNWA 3DYEA 2BE6A 3BUMB 4TNCA 1A75B 1VRKA 1YVHA 4MBEA 5CSNA 1LKJA 3I5GB 2JOJA 1BOCA 1FF1A 1TUZA 2MAZA 2K8MB 1CM4A 2NLNA 4FQOA 5CPVA 1BG1A 1JF2A 1XFXO 2D8NA 3FE6A 4C0JA 5ER4X 1NCZA 3JTDC 1B47A 2TN4A 4PHNA 4I5KA 1BMOA 2PRUA 1OE9B 3VRNA 1YRUB 1N2DA 1R2UA 2RGIA 1CFFA 5D69A 3CTNA 3EKHA 4PALA 2WOSA 2LLSA 1LVCD 1SW8A 1Y1AA 3SG4A 3S0AA 1EH2A 5K89A 3TS5C 2H2KA 1ZFSA 2BBMA 2CT9A 1XFRA 4QJ3B 5HLVA 2ISDA 3S0EA 1DJHA 4BY4A 1IWQA 5DKNA 4DIRA 2LV7A 2OS8C 1AP4A 1K2HA 1J7RA 2K61A 3R1VA 1TWOA 2QEOA 1BLQA 2K60A 3TUYC 4GGFA 2AMIA 3R1PA 1UHNA 3BUWB 3BOWA 3L4AA 4MSPA 1C3YA 2P6BB 3IQOA 4HRGA 2KYCA 1NX2A 2ZRTA 3EVVA 5AANA 1QIVA 1Z2CB 2COLB 3O6BA 1TOPA 2MHHA 4PE0A 1NX3A 3BUNB 3DVKA 1A03A 1CMFA 1W7JB 1JWDA 4UPGA 3FS7A 3EK8A 1MR8A 1DJGA 3AKBA 1YTZC 2F3ZA 2Q4UA 3TDUA 4GGNA 4DS7A 2FOTA 1EG4A 1DGUA 1QJTA 2JNXA 2WCBA 1V1FA 3LK0A 3NSLA 4MLWA 4YGCB 1XFWO 1KSOA 4GPLB 2CCMA 2G2BA 4JD9A 2K7OA 2LVVA 2LVIA 1JFJA 1C7WA 2AUCA 3BFBA 4I5JA 2BCBA 4U8DA 3LL8B 3PLFB 1UWOA 2BKIB 1ORGA 3EK4A 2JPTA 3IVTA 1JC2A 1RJVA 3CZ1A 1XFUO 2HF5A 2JZIA 5FYXA 4YGEB 4DRWA 1CTRA 3QRXA 4BY5A 3GK1A 5I2QA 1IH0A 1QLSA 1WDCC 4M2OA 1CNPA 3S0DA 3K1EA 1KCYA 4MN0A 1XFVO 1SCMB 1N65A 2P70A 4USLA 3UO9A 2L0PA 4R1EA 3AKAA 1CFDA 1G8IA 3SG3A 3BXKA 2HQWA 1N0YA 1PALA 3ICBA 1TTXA 4GBAA 1IQ5A 2MJWB 4ORBB 3GK2A 3D78A 1AJ4A 2ZN9A 4AOMA 3NSKA 1SCVA 5I94A 1WY9A 1KFUL 2JULA 3I5FB 2CTNA 1QV1A 2Y4QA 3DXLA 1KQMC 1OOFA 3R72A 3BUOB 4N1FA 4QJ5B 2WCEA 1UP5A 1QATA 1BJFA 1NCXA 2V53A 1C3ZA 2KFHA 1SBJA 3NHTA 2A4JA 2KAXA 2KDHA 2LP2A 2O5GA 1DJXA 1SY9A 3LLEA 2VRGA 1U5IB 1S6JA 1TRFA 1Y6WA 3SS5A 5AXIA 2K0JA 2JNFA 5ER5A 1SL8A 3O4YA 1XK4A 1SL9A 4CFQA 3SJSA 5I2LA 1QLKA 1BU3A 1MWNA 1ZMZA 3VROA 4F0ZB 3RM1A 4GUKA 2E30A 3D0YB 2EGDA 1NP8A 1A4PA 3BFAA 2LMVA 3S0FA 2WC6A 1S36A 1JUOA 2GV5A 1SL7A 1NX0A 1RK9A 2KLEA 2WORA 4QJ4B 1K9PA 3PJIA 2Q91A 1AUIB 2BNXA 2E6WA 2YGUA 3RLZA 4WQ3A 4XJKB 1B9AA 3WXAA 1RTP1 2L4HA 1KK8C 1GGWA 1HT9A 5DKRA 4D1EA 2JRFA 1J7QA 2P71A 4MRYA 1B8LA 2KLDA 1F4OA 1CFPA 2WCKA 5KTYA 4YGAA 5I8NA 1NWDA 1SSEB 2LVKA 3D76A 3VRPA 2LLTA 1OMDA 1M45A 3TDIA 1A75A 1LA3A 3TZ1A 5JJGA 1K95A 1PVBA 1OOHA 1S26D 1QX7A 1MQ1A 1GGZA 2I94A 3PALA 1QX2A 1L7ZA 4P2YB 1F71A 1XFZO 2EC6C 4PDZA 3CS1A 3DVEA 5FI7A 4MZJA 1G4YR 3LK1A 2JXLA 4WRIA 1JFKA 1B7TY 1SMGA 2KAYA 2QEHA 4PCWA 4NDCA 1TIZA 2Y5IA 4PHMA 1DTLA 3FE9A 3SIBA 3B6XA 4GGFC 1H4BA 3SIAA 4PHKA 4YI9A 1CDLA 2LVJA 3PM8A 5FI2A 5G08A 2NZ0A 1CKKA 3AAJA 1ALVA 3C1VA 1IJ6A 1B7TZ 1K9UA 4INXA 4JPZB 5KSZA 2WCHA 3JVTC 2ZNDA 1DF0A 2PVBA 1OOIX 3BFHA 1AVSA 4NQGA 1WRLA 1EL4A 1OSAA 3NSOA 5JOLA 5F6TA 4YI8A 2M1UA 1DF0B 2KSPA 1CMGA 2OTGC 1KQVA 2BKHB 4HREE 4A4BA 1YR5A 3DVMA 1K90D 2IS9A 2KFFA 4NDDA 1XO5A 3I5HC 2M0RA 3O2PA 2WCFA 1RWYA 2KOTA 3SG7A 1EXRA 3WNXB 1CB1A
chains in the Genus database with same CATH topology
2I18A 3CZTX 2F2OA 1B8RA 1OMRA 1YX7A 3H4SE 4OV2A 1D1OA 1CLBA 3JTDB 3KF9A 2I2RE 1GJYA 3OX6A 1M46A 2BL0C 2CBLA 2L98A 2CXJA 3BYAA 3KHEA 2LMTA 2ZNEA 3EVRA 3NXAA 4ZCUA 1F8HA 1JF0A 1RROA 5CSJA 1TCOB 2LC5A 1OQPA 1SNLA 1DVIA 1SYMA 1UHIA 3TS5B 1M31A 4M2PA 5CSFA 2R2IA 1CDNA 3IF7A 1A2XA 1KWOC 2OS8B 4YBHB 3CWGA 2M7LA 3JVTB 1XVJA 2JQ6A 2PMYA 4Q04A 1YX8A 3PSRA 3ZWHA 3HX4A 3TUYB 1GQMA 3OP0A 3EVUA 3AAKA 3BQ3A 2LNKA 3FWBA 4JWQA 1AK8A 5CSIA 1KSMA 2ZN8A 4PHJA 1XK4C 4OKHA 2KI4C 5HKZA 3KO0A 1RFJA 2NCPA 1ALWA 3A4UB 3CR4X 1OZSA 1TNPA 4HRHA 2HPSA 1NX1A 4ORAB 1SR6C 1U5IA 3SG5A 2H61C 4DUQA 1QIWA 1XFYO 1CLLA 1WRZA 1QX5B 3FIAA 1WRKA 2BL0B 2ZKMX 2M1KB 3D0YA 2KBMA 1S6IA 1J55A 3LCPC 2ZRSA 1EJ3A 1ODBA 1LA0A 1YRTB 4I5NB 4ZCVA 1MUXA 1MXEA 1OZOA 1QXPA 2JC2A 3GOFA 3KEVA 1WDCB 1FI6A 1S6CA 4PE7A 2LHLA 2M49B 2M3WA 1QS7A 1JSAA 5HKWA 1DJIA 2F3YA 1SK6D 3DVJA 1FI5A 1KWOB 2QACA 2K2FA 4MEWA 1LXFC 4N5XA 4XJKA 1KFXS 3ZNIA 2LLUA 3I5GC 1CDPA 1UHHA 4CPVA 2JTTA 1Y1XA 2KGBC 2KI4B 1L2OC 2BE4A 1KQMB 2KYFA 2L5XB 3BUXB 4L9MA 1X02A 3CGAA 2M9GA 3OHMB 4C0LA 1YUSA 4IL1A 1DGVA 1SR6B 2KFGA 2PALA 1F54A 2WC8A 1AJ5A 1K93D 1NSHA 1S5GY 5HKYA 4AQIA 2EHBA 1CDMA 1V1GA 1J1EA 2LUXA 3VRRA 1WLZA 4CIDA 1UHJA 2M8UA 1OOJA 1IRJA 1YUTA 2KHNA 2L4IA 1F70A 4XYNA 5D7FA 1K8UA 2CNPA 1S5GZ 1S1EA 5IBWA 1IKUA 1NPQA 1E8AA 1BODA 5DKQA 3KPXA 1B1GA 1PVAA 1QVIY 1CLMA 3M0WA 1SRAA 3DF0B 5PALA 2K7BA 2K7CA 1KFXL 3SG2A 3OB1B 1MXLC 3HCMA 1BR1B 3CR5X 4N1GA 3VGOA 2GGMA 2L51A 4M2QA 1C7VA 4ORCB 1J7PA 2LP3A 2M29A 1KK8B 4PE1A 1J7OA 1XA5A 2MA2A 1DJWA 2MBXA 2BBNA 4A4CA 1L2OB 2I7AA 1Y0VH 1QVIZ 2LANA 3EKJA 1BR4B 3D10A 2FCEA 1DT7B 2M7NA 3EK7A 1J1DA 2FCDA 3GK4X 4HSZA 1IGVA 2AAOA 1C07A 2BCXA 2LHIA 1K96A 2KBIA 4OCIA 1TNWA 1JBAA 1PSRA 4FTGA 1RECA 1TNXA 2JT3A 1SCMC 1IG5A 1FPWA 2EC6B 1IQ3A 2MLFC 1FW4A 1UUSA 2JT0A 2LE9B 2JXCA 1H8BA 2HETA 4WQ2A 1M63B 1QASA 2Y1NA 5GQQC 3VRQA 4YGBB 3I5FC 1ZOTB 3BOWB 1KFUS 3I5IC 1TCFA 2JU0A 4JQ0D 1TNQA 2FJUB 1NIWA 2LUCA 1PRWA 2PASA 2G9BA 1CFCA 1IJ5A 1DMOA 2OPOA 1R6PA 5HLOA 1WLMA 1OMVA 5KU1A 2ZFDA 2JT8A 2OTGB 4CLNA 4I5LB 3DD4A 3E3RA 1QV0A 1SPYA 1TN4A 2NCOA 5B8IB 2O60A 3CLNA 1A29A 3PN7C 5BPJA 3I5HB 1K94A 4ETOA 1KK7Y 1W7IB 1AHRA 2SCPA 1F55A 3PATA 3MSEB 2Y1MA 3OB2B 1PSBA 2PSRA 2KGRA 4YRUA 1QTXA 2LCPA 2QPTA 3IQQA 4E68A 1UHKA 4YGDB 3WHTB 1YVLA 2LAPA 5TNCA 4MZKA 1KK7Z 4GFTA 2L50A 4P5OE 1FBVA 3I5IB 2MRDA 1XYDA 5AEQA 1NCYA 1G33A 1PULA 2BECA 1B8CA 2KQ6A 3FWCA 3O78A 4OVNF 1Y1UA 1EG3A 4MZLA 1M39A 2KI6C 1PK0D 2JWWA 5J3XA 4CFRA 4MVFA 5HYDA 1DJYA 3A8RA 1NYAA 3OX5A 1F4QA 4GNKB 1UURA 2F33A 2L2EA 5I2OA 2M97A 2GGZA 5AFPA 4AQJA 4GAOA 1DJZA 2KI6D 4MRXA 1YUUA 3PN7B 2H61A 1B4CA 1HQVA 1LINA 3TDZA 4ICBA 1YURA 1CM1A 2NXQA 2BCAA 2DOQA 1ZUZA 1BF5A 5AERA 3F45A 2B1UA 3K21A 2KNEA 2F8PA 4C0KA 1BT6A 2F2PA 1MF8B 2HQ8A 3PFVA 1NUBA 1SKTA 2KQYA 2K7DA 2WNDA 4NDBA 2JTZA 2LM5A 2SASA 3DF0A 4OR9B 1S3PA 2KAVA 3WHUB 4PE4A 1ZACA 1Q80A 1MHOA 3NSIA 3CR2A 2LMUA 3SG6A 4DCKA 1K9KA 2K2AA 2MLEC 2BE6A 3BUMB 4TNCA 1A75B 1VRKA 1YVHA 4MBEA 5CSNA 1LKJA 3I5GB 2JOJA 1BOCA 1FF1A 2MAZA 2K8MB 1CM4A 2NLNA 4FQOA 5CPVA 1BG1A 1JF2A 1XFXO 2D8NA 4C0JA 5ER4X 1NCZA 3JTDC 1B47A 2TN4A 4PHNA 4I5KA 1BMOA 2PRUA 1OE9B 3VRNA 1YRUB 1N2DA 1R2UA 2RGIA 1CFFA 5D69A 3CTNA 3EKHA 4PALA 2WOSA 2LLSA 1LVCD 1SW8A 1Y1AA 3SG4A 1EH2A 5K89A 3TS5C 2H2KA 1ZFSA 2BBMA 2CT9A 5HLVA 4QJ3B 2ISDA 1DJHA 4BY4A 1IWQA 5DKNA 4DIRA 2LV7A 2OS8C 1AP4A 1K2HA 1J7RA 2K61A 1BLQA 3TUYC 4GGFA 2AMIA 1UHNA 3BUWB 3BOWA 4MSPA 2P6BB 3IQOA 4HRGA 2KYCA 1NX2A 2ZRTA 3EVVA 5AANA 1QIVA 2COLB 3O6BA 1TOPA 2MHHA 4PE0A 1NX3A 3BUNB 3DVKA 1A03A 1CMFA 1W7JB 1JWDA 4UPGA 3FS7A 3EK8A 1MR8A 1DJGA 3AKBA 1YTZC 2F3ZA 2Q4UA 3TDUA 4GGNA 4DS7A 2FOTA 1EG4A 1DGUA 1QJTA 2JNXA 2WCBA 1V1FA 3LK0A 3NSLA 4MLWA 4YGCB 1XFWO 1KSOA 4GPLB 2CCMA 2G2BA 1JFJA 2K7OA 2LVVA 2LVIA 1C7WA 2AUCA 4I5JA 4U8DA 2BCBA 3LL8B 3PLFB 1UWOA 2BKIB 3EK4A 2JPTA 1JC2A 1RJVA 1XFUO 2HF5A 2JZIA 5FYXA 4YGEB 4DRWA 1CTRA 3QRXA 4BY5A 3GK1A 5I2QA 1IH0A 1QLSA 1WDCC 4M2OA 1CNPA 1KCYA 4MN0A 1XFVO 1SCMB 1N65A 4USLA 2L0PA 4R1EA 3AKAA 1CFDA 1G8IA 3SG3A 3BXKA 2HQWA 1N0YA 1PALA 3ICBA 1TTXA 4GBAA 1IQ5A 2MJWB 4ORBB 3GK2A 1AJ4A 2ZN9A 4AOMA 3NSKA 1SCVA 1WY9A 1KFUL 2JULA 3I5FB 2CTNA 1QV1A 2Y4QA 1KQMC 3BUOB 4N1FA 4QJ5B 2WCEA 1UP5A 1QATA 1BJFA 1NCXA 2V53A 2KFHA 1SBJA 2A4JA 2KAXA 2KDHA 2LP2A 2O5GA 1DJXA 1SY9A 3LLEA 2VRGA 1U5IB 1S6JA 1TRFA 1Y6WA 5AXIA 2K0JA 2JNFA 5ER5A 1SL8A 3O4YA 1XK4A 1SL9A 4CFQA 3SJSA 5I2LA 1QLKA 1BU3A 1MWNA 1ZMZA 3VROA 4F0ZB 3RM1A 4GUKA 2E30A 3D0YB 2EGDA 1NP8A 1A4PA 2LMVA 1S36A 1JUOA 2GV5A 1SL7A 1NX0A 1RK9A 2WORA 4QJ4B 1K9PA 2Q91A 1AUIB 2E6WA 3RLZA 4WQ3A 4XJKB 1B9AA 3WXAA 1RTP1 2L4HA 1KK8C 1GGWA 1HT9A 5DKRA 4D1EA 2JRFA 1J7QA 4MRYA 1B8LA 1F4OA 1CFPA 5KTYA 4YGAA 5I8NA 1NWDA 2LVKA 3VRPA 2LLTA 1OMDA 1M45A 3TDIA 1A75A 1LA3A 3TZ1A 5JJGA 1K95A 1PVBA 1S26D 1QX7A 1MQ1A 1GGZA 2I94A 3PALA 1QX2A 1L7ZA 4P2YB 1F71A 1XFZO 2EC6C 4PDZA 3CS1A 3DVEA 4MZJA 1G4YR 3LK1A 2JXLA 4WRIA 1JFKA 1B7TY 1SMGA 2KAYA 4PCWA 4NDCA 1TIZA 2Y5IA 4PHMA 1DTLA 3SIBA 4GGFC 1H4BA 3SIAA 4PHKA 4YI9A 1CDLA 2LVJA 3PM8A 5G08A 2NZ0A 1CKKA 3AAJA 1ALVA 3C1VA 1IJ6A 1B7TZ 1K9UA 4JPZB 5KSZA 3JVTC 2ZNDA 1DF0A 2PVBA 4NQGA 1AVSA 1WRLA 1EL4A 1OSAA 3NSOA 5JOLA 5F6TA 4YI8A 2M1UA 1DF0B 2KSPA 1CMGA 2OTGC 1KQVA 2BKHB 4HREE 4A4BA 1YR5A 3DVMA 1K90D 2IS9A 2KFFA 4NDDA 1XO5A 3I5HC 2M0RA 3O2PA 2WCFA 1RWYA 2KOTA 3SG7A 1EXRA 3WNXB 1CB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I18 A;  3CZT X;  2F2O A;  1B8R A;  1OMR A;  1YX7 A;  3H4S E;  4OV2 A;  1D1O A;  1CLB A;  3JTD B;  3KF9 A;  2I2R E;  1GJY A;  3OX6 A;  1M46 A;  2BL0 C;  2CBL A;  2L98 A;  2CXJ A;  3BYA A;  3KHE A;  2LMT A;  2ZNE A;  3EVR A;  3NXA A;  4ZCU A;  1F8H A;  1JF0 A;  1RRO A;  5CSJ A;  1TCO B;  2LC5 A;  1OQP A;  1SNL A;  1DVI A;  1SYM A;  1UHI A;  3TS5 B;  1M31 A;  4M2P A;  5CSF A;  2R2I A;  1CDN A;  3IF7 A;  1A2X A;  1KWO C;  2OS8 B;  4YBH B;  3CWG A;  2M7L A;  3JVT B;  1XVJ A;  2JQ6 A;  2PMY A;  4Q04 A;  1YX8 A;  3PSR A;  3ZWH A;  3HX4 A;  3TUY B;  1GQM A;  3OP0 A;  3EVU A;  3AAK A;  3BQ3 A;  2LNK A;  3FWB A;  4JWQ A;  1AK8 A;  5CSI A;  1KSM A;  2ZN8 A;  4PHJ A;  1XK4 C;  4OKH A;  2KI4 C;  5HKZ A;  3KO0 A;  1RFJ A;  2NCP A;  1ALW A;  3A4U B;  3CR4 X;  1OZS A;  1TNP A;  4HRH A;  2HPS A;  1NX1 A;  4ORA B;  1SR6 C;  1U5I A;  3SG5 A;  2H61 C;  4DUQ A;  1QIW A;  1XFY O;  1CLL A;  1WRZ A;  1QX5 B;  3FIA A;  1WRK A;  2BL0 B;  2ZKM X;  2M1K B;  3D0Y A;  2KBM A;  1S6I A;  1J55 A;  3LCP C;  2ZRS A;  1EJ3 A;  1ODB A;  1LA0 A;  1YRT B;  4I5N B;  4ZCV A;  1MUX A;  1MXE A;  1OZO A;  1QXP A;  2JC2 A;  3GOF A;  3KEV A;  1WDC B;  1FI6 A;  1S6C A;  4PE7 A;  2LHL A;  2M49 B;  2M3W A;  1QS7 A;  1JSA A;  5HKW A;  1DJI A;  2F3Y A;  1SK6 D;  3DVJ A;  1FI5 A;  1KWO B;  2QAC A;  2K2F A;  4MEW A;  1LXF C;  4N5X A;  4XJK A;  1KFX S;  3ZNI A;  2LLU A;  3I5G C;  1CDP A;  1UHH A;  4CPV A;  2JTT A;  1Y1X A;  2KGB C;  2KI4 B;  1L2O C;  2BE4 A;  1KQM B;  2KYF A;  2L5X B;  3BUX B;  4L9M A;  1X02 A;  3CGA A;  2M9G A;  3OHM B;  4C0L A;  1YUS A;  4IL1 A;  1DGV A;  1SR6 B;  2KFG A;  2PAL A;  1F54 A;  2WC8 A;  1AJ5 A;  1K93 D;  1NSH A;  1S5G Y;  5HKY A;  4AQI A;  2EHB A;  1CDM A;  1V1G A;  1J1E A;  2LUX A;  3VRR A;  1WLZ A;  4CID A;  1UHJ A;  2M8U A;  1OOJ A;  1IRJ A;  1YUT A;  2KHN A;  2L4I A;  1F70 A;  4XYN A;  5D7F A;  1K8U A;  2CNP A;  1S5G Z;  1S1E A;  5IBW A;  1IKU A;  1NPQ A;  1E8A A;  1BOD A;  5DKQ A;  3KPX A;  1B1G A;  1PVA A;  1QVI Y;  1CLM A;  3M0W A;  1SRA A;  3DF0 B;  5PAL A;  2K7B A;  2K7C A;  1KFX L;  3SG2 A;  3OB1 B;  1MXL C;  3HCM A;  1BR1 B;  3CR5 X;  4N1G A;  3VGO A;  2GGM A;  2L51 A;  4M2Q A;  1C7V A;  4ORC B;  1J7P A;  2LP3 A;  2M29 A;  1KK8 B;  4PE1 A;  1J7O A;  1XA5 A;  2MA2 A;  1DJW A;  2MBX A;  2BBN A;  4A4C A;  1L2O B;  2I7A A;  1Y0V H;  1QVI Z;  2LAN A;  3EKJ A;  1BR4 B;  3D10 A;  2FCE A;  1DT7 B;  2M7N A;  3EK7 A;  1J1D A;  2FCD A;  3GK4 X;  4HSZ A;  1IGV A;  2AAO A;  1C07 A;  2BCX A;  2LHI A;  1K96 A;  2KBI A;  4OCI A;  1TNW A;  1JBA A;  1PSR A;  4FTG A;  1REC A;  1TNX A;  2JT3 A;  1SCM C;  1IG5 A;  1FPW A;  2EC6 B;  1IQ3 A;  2MLF C;  1FW4 A;  1UUS A;  2JT0 A;  2LE9 B;  2JXC A;  1H8B A;  2HET A;  4WQ2 A;  1M63 B;  1QAS A;  2Y1N A;  5GQQ C;  3VRQ A;  4YGB B;  3I5F C;  1ZOT B;  3BOW B;  1KFU S;  3I5I C;  1TCF A;  2JU0 A;  4JQ0 D;  1TNQ A;  2FJU B;  1NIW A;  2LUC A;  1PRW A;  2PAS A;  2G9B A;  1CFC A;  1IJ5 A;  1DMO A;  2OPO A;  1R6P A;  5HLO A;  1WLM A;  1OMV A;  5KU1 A;  2ZFD A;  2JT8 A;  2OTG B;  4CLN A;  4I5L B;  3DD4 A;  3E3R A;  1QV0 A;  1SPY A;  1TN4 A;  2NCO A;  5B8I B;  2O60 A;  3CLN A;  1A29 A;  3PN7 C;  5BPJ A;  3I5H B;  1K94 A;  4ETO A;  1KK7 Y;  1W7I B;  1AHR A;  2SCP A;  1F55 A;  3PAT A;  3MSE B;  2Y1M A;  3OB2 B;  1PSB A;  2PSR A;  2KGR A;  4YRU A;  1QTX A;  2LCP A;  2QPT A;  3IQQ A;  4E68 A;  1UHK A;  4YGD B;  3WHT B;  1YVL A;  2LAP A;  5TNC A;  4MZK A;  1KK7 Z;  4GFT A;  2L50 A;  4P5O E;  1FBV A;  3I5I B;  2MRD A;  1XYD A;  5AEQ A;  1NCY A;  1G33 A;  1PUL A;  2BEC A;  1B8C A;  2KQ6 A;  3FWC A;  3O78 A;  4OVN F;  1Y1U A;  1EG3 A;  4MZL A;  1M39 A;  2KI6 C;  1PK0 D;  2JWW A;  5J3X A;  4CFR A;  4MVF A;  5HYD A;  1DJY A;  3A8R A;  1NYA A;  3OX5 A;  1F4Q A;  4GNK B;  1UUR A;  2F33 A;  2L2E A;  5I2O A;  2M97 A;  2GGZ A;  5AFP A;  4AQJ A;  4GAO A;  1DJZ A;  2KI6 D;  4MRX A;  1YUU A;  3PN7 B;  2H61 A;  1B4C A;  1HQV A;  1LIN A;  3TDZ A;  4ICB A;  1YUR A;  1CM1 A;  2NXQ A;  2BCA A;  2DOQ A;  1ZUZ A;  1BF5 A;  5AER A;  3F45 A;  2B1U A;  3K21 A;  2KNE A;  2F8P A;  4C0K A;  1BT6 A;  2F2P A;  1MF8 B;  2HQ8 A;  3PFV A;  1NUB A;  1SKT A;  2KQY A;  2K7D A;  2WND A;  4NDB A;  2JTZ A;  2LM5 A;  2SAS A;  3DF0 A;  4OR9 B;  1S3P A;  2KAV A;  3WHU B;  4PE4 A;  1ZAC A;  1Q80 A;  1MHO A;  3NSI A;  3CR2 A;  2LMU A;  3SG6 A;  4DCK A;  1K9K A;  2K2A A;  2MLE C;  2BE6 A;  3BUM B;  4TNC A;  1A75 B;  1VRK A;  1YVH A;  4MBE A;  5CSN A;  1LKJ A;  3I5G B;  2JOJ A;  1BOC A;  1FF1 A;  2MAZ A;  2K8M B;  1CM4 A;  2NLN A;  4FQO A;  5CPV A;  1BG1 A;  1JF2 A;  1XFX O;  2D8N A;  4C0J A;  5ER4 X;  1NCZ A;  3JTD C;  1B47 A;  2TN4 A;  4PHN A;  4I5K A;  1BMO A;  2PRU A;  1OE9 B;  3VRN A;  1YRU B;  1N2D A;  1R2U A;  2RGI A;  1CFF A;  5D69 A;  3CTN A;  3EKH A;  4PAL A;  2WOS A;  2LLS A;  1LVC D;  1SW8 A;  1Y1A A;  3SG4 A;  1EH2 A;  5K89 A;  3TS5 C;  2H2K A;  1ZFS A;  2BBM A;  2CT9 A;  5HLV A;  4QJ3 B;  2ISD A;  1DJH A;  4BY4 A;  1IWQ A;  5DKN A;  4DIR A;  2LV7 A;  2OS8 C;  1AP4 A;  1K2H A;  1J7R A;  2K61 A;  1BLQ A;  3TUY C;  4GGF A;  2AMI A;  1UHN A;  3BUW B;  3BOW A;  4MSP A;  2P6B B;  3IQO A;  4HRG A;  2KYC A;  1NX2 A;  2ZRT A;  3EVV A;  5AAN A;  1QIV A;  2COL B;  3O6B A;  1TOP A;  2MHH A;  4PE0 A;  1NX3 A;  3BUN B;  3DVK A;  1A03 A;  1CMF A;  1W7J B;  1JWD A;  4UPG A;  3FS7 A;  3EK8 A;  1MR8 A;  1DJG A;  3AKB A;  1YTZ C;  2F3Z A;  2Q4U A;  3TDU A;  4GGN A;  4DS7 A;  2FOT A;  1EG4 A;  1DGU A;  1QJT A;  2JNX A;  2WCB A;  1V1F A;  3LK0 A;  3NSL A;  4MLW A;  4YGC B;  1XFW O;  1KSO A;  4GPL B;  2CCM A;  2G2B A;  1JFJ A;  2K7O A;  2LVV A;  2LVI A;  1C7W A;  2AUC A;  4I5J A;  4U8D A;  2BCB A;  3LL8 B;  3PLF B;  1UWO A;  2BKI B;  3EK4 A;  2JPT A;  1JC2 A;  1RJV A;  1XFU O;  2HF5 A;  2JZI A;  5FYX A;  4YGE B;  4DRW A;  1CTR A;  3QRX A;  4BY5 A;  3GK1 A;  5I2Q A;  1IH0 A;  1QLS A;  1WDC C;  4M2O A;  1CNP A;  1KCY A;  4MN0 A;  1XFV O;  1SCM B;  1N65 A;  4USL A;  2L0P A;  4R1E A;  3AKA A;  1CFD A;  1G8I A;  3SG3 A;  3BXK A;  2HQW A;  1N0Y A;  1PAL A;  3ICB A;  1TTX A;  4GBA A;  1IQ5 A;  2MJW B;  4ORB B;  3GK2 A;  1AJ4 A;  2ZN9 A;  4AOM A;  3NSK A;  1SCV A;  1WY9 A;  1KFU L;  2JUL A;  3I5F B;  2CTN A;  1QV1 A;  2Y4Q A;  1KQM C;  3BUO B;  4N1F A;  4QJ5 B;  2WCE A;  1UP5 A;  1QAT A;  1BJF A;  1NCX A;  2V53 A;  2KFH A;  1SBJ A;  2A4J A;  2KAX A;  2KDH A;  2LP2 A;  2O5G A;  1DJX A;  1SY9 A;  3LLE A;  2VRG A;  1U5I B;  1S6J A;  1TRF A;  1Y6W A;  5AXI A;  2K0J A;  2JNF A;  5ER5 A;  1SL8 A;  3O4Y A;  1XK4 A;  1SL9 A;  4CFQ A;  3SJS A;  5I2L A;  1QLK A;  1BU3 A;  1MWN A;  1ZMZ A;  3VRO A;  4F0Z B;  3RM1 A;  4GUK A;  2E30 A;  3D0Y B;  2EGD A;  1NP8 A;  1A4P A;  2LMV A;  1S36 A;  1JUO A;  2GV5 A;  1SL7 A;  1NX0 A;  1RK9 A;  2WOR A;  4QJ4 B;  1K9P A;  2Q91 A;  1AUI B;  2E6W A;  3RLZ A;  4WQ3 A;  4XJK B;  1B9A A;  3WXA A;  1RTP 1;  2L4H A;  1KK8 C;  1GGW A;  1HT9 A;  5DKR A;  4D1E A;  2JRF A;  1J7Q A;  4MRY A;  1B8L A;  1F4O A;  1CFP A;  5KTY A;  4YGA A;  5I8N A;  1NWD A;  2LVK A;  3VRP A;  2LLT A;  1OMD A;  1M45 A;  3TDI A;  1A75 A;  1LA3 A;  3TZ1 A;  5JJG A;  1K95 A;  1PVB A;  1S26 D;  1QX7 A;  1MQ1 A;  1GGZ A;  2I94 A;  3PAL A;  1QX2 A;  1L7Z A;  4P2Y B;  1F71 A;  1XFZ O;  2EC6 C;  4PDZ A;  3CS1 A;  3DVE A;  4MZJ A;  1G4Y R;  3LK1 A;  2JXL A;  4WRI A;  1JFK A;  1B7T Y;  1SMG A;  2KAY A;  4PCW A;  4NDC A;  1TIZ A;  2Y5I A;  4PHM A;  1DTL A;  3SIB A;  4GGF C;  1H4B A;  3SIA A;  4PHK A;  4YI9 A;  1CDL A;  2LVJ A;  3PM8 A;  5G08 A;  2NZ0 A;  1CKK A;  3AAJ A;  1ALV A;  3C1V A;  1IJ6 A;  1B7T Z;  1K9U A;  4JPZ B;  5KSZ A;  3JVT C;  2ZND A;  1DF0 A;  2PVB A;  4NQG A;  1AVS A;  1WRL A;  1EL4 A;  1OSA A;  3NSO A;  5JOL A;  5F6T A;  4YI8 A;  2M1U A;  1DF0 B;  2KSP A;  1CMG A;  2OTG C;  1KQV A;  2BKH B;  4HRE E;  4A4B A;  1YR5 A;  3DVM A;  1K90 D;  2IS9 A;  2KFF A;  4NDD A;  1XO5 A;  3I5H C;  2M0R A;  3O2P A;  2WCF A;  1RWY A;  2KOT A;  3SG7 A;  1EXR A;  3WNX B;  1CB1 A; 
#chains in the Genus database with same CATH topology
 2I18 A;  3CZT X;  2F2O A;  1B8R A;  1OMR A;  1YX7 A;  3H4S E;  4OV2 A;  4KYN A;  1D1O A;  2WCJ A;  1CLB A;  3JTD B;  4OZD A;  3KF9 A;  2I2R E;  1GJY A;  3OX6 A;  1M46 A;  2BL0 C;  2CBL A;  2L98 A;  1W9Z A;  2CXJ A;  3BYA A;  3KHE A;  2LMT A;  2ZNE A;  3EVR A;  3NXA A;  4ZCU A;  1F8H A;  1JF0 A;  1RRO A;  5CSJ A;  1TCO B;  2LC5 A;  1OQP A;  1SNL A;  3B88 A;  1DVI A;  1SYM A;  1UHI A;  3TS5 B;  1M31 A;  4M2P A;  5CSF A;  2R2I A;  1CDN A;  3IF7 A;  2FJY A;  1A2X A;  1KWO C;  2OS8 B;  2L2C A;  3CWG A;  4YBH B;  2WCL A;  2M7L A;  3JVT B;  1XVJ A;  2JQ6 A;  3R1O A;  2PMY A;  4Q04 A;  1YX8 A;  1DEL A;  3PSR A;  3ZWH A;  3HX4 A;  3TUY B;  1GQM A;  3OP0 A;  3EVU A;  3AAK A;  1Z4H A;  3BQ3 A;  2LNK A;  3FWB A;  4JWQ A;  1AK8 A;  5CSI A;  1KSM A;  2ZN8 A;  4PHJ A;  1XK4 C;  4OKH A;  2KI4 C;  5HKZ A;  3SS4 A;  3KO0 A;  1RFJ A;  2NCP A;  1ALW A;  3A4U B;  3CR4 X;  1DC1 A;  1OZS A;  1TNP A;  4HRH A;  2HPS A;  1NX1 A;  5DIC A;  4ORA B;  1SR6 C;  1U5I A;  2JPO A;  3SG5 A;  2H61 C;  4DUQ A;  2QEV A;  1QIW A;  1XFY O;  1CLL A;  3D75 A;  1WRZ A;  1QX5 B;  3FIA A;  1WRK A;  2BL0 B;  2ZKM X;  2M1K B;  3D0Y A;  2WCM A;  5FI6 A;  2KBM A;  1S6I A;  1J55 A;  3LCP C;  2ZRS A;  1EJ3 A;  1ODB A;  3Q8I A;  1LA0 A;  1YRT B;  3OBV A;  4I5N B;  4ZCV A;  1MUX A;  1MXE A;  1OZO A;  1QXP A;  2JC2 A;  3GOF A;  3KEV A;  1WDC B;  3D77 A;  1FI6 A;  1S6C A;  4PE7 A;  2LHL A;  2M49 B;  2M3W A;  1QS7 A;  1JSA A;  5HKW A;  1DJI A;  2F3Y A;  1SK6 D;  3DVJ A;  1FI5 A;  1KWO B;  2QAC A;  2K2F A;  4MEW A;  1LXF C;  4N5X A;  4XJK A;  1KFX S;  3ZNI A;  2LLU A;  3I5G C;  1CDP A;  1UHH A;  4CPV A;  2JTT A;  1Y1X A;  2L5Y A;  2KGB C;  2KI4 B;  1L2O C;  2BE4 A;  1KQM B;  2KYF A;  2L5X B;  3BUX B;  4L9M A;  3S0G A;  1X02 A;  3CGA A;  2M9G A;  3OHM B;  4C0L A;  1YUS A;  4IL1 A;  1DGV A;  1SR6 B;  2KFG A;  2PAL A;  1F54 A;  3NGV A;  2WC8 A;  1AJ5 A;  1K93 D;  1NSH A;  1S5G Y;  5HKY A;  4AQI A;  3O4X A;  2EHB A;  1CDM A;  1V1G A;  1J1E A;  1LS8 A;  2LUX A;  3VRR A;  1WLZ A;  4CID A;  1UHJ A;  2M8U A;  1OOJ A;  1IRJ A;  1YUT A;  2KHN A;  2L4I A;  1F70 A;  4XYN A;  2ERB A;  2H8V A;  5D7F A;  1K8U A;  2CNP A;  3QME A;  4IJ7 A;  1S5G Z;  1S1E A;  2PYQ A;  5IBW A;  1IKU A;  1NPQ A;  1E8A A;  1BOD A;  5DKQ A;  3KPX A;  1B1G A;  1PVA A;  3FE8 A;  1QVI Y;  1CLM A;  3M0W A;  1SRA A;  3DF0 B;  5PAL A;  2K7B A;  2K7C A;  1KFX L;  3SG2 A;  4JKT A;  3OB1 B;  1MXL C;  3HCM A;  1BR1 B;  3CR5 X;  4N1G A;  3VGO A;  2GGM A;  2L51 A;  3EG5 B;  4M2Q A;  4ORC B;  1J7P A;  2LP3 A;  2M29 A;  1KK8 B;  4PE1 A;  1J7O A;  1XA5 A;  2MA2 A;  1DJW A;  2MBX A;  2BBN A;  4A4C A;  3CAB A;  1L2O B;  2I7A A;  1Y0V H;  1QVI Z;  2LAN A;  3VB1 A;  3EKJ A;  1BR4 B;  3D10 A;  3D73 A;  2FCE A;  1DT7 B;  2M7N A;  3EK7 A;  1J1D A;  2FCD A;  1TUJ A;  3GK4 X;  1OW4 A;  4HSZ A;  1IGV A;  2AAO A;  1C07 A;  2BCX A;  3S0B A;  1GM0 A;  2LHI A;  1K96 A;  2KBI A;  3DZT A;  4OCI A;  1TNW A;  1JBA A;  1PSR A;  2KPH A;  4FTG A;  4INW A;  1REC A;  1TNX A;  2JT3 A;  1DEK A;  1SCM C;  1IG5 A;  1C7V A;  1FPW A;  2EC6 B;  2BAP A;  1P28 A;  1IQ3 A;  2MLF C;  1FW4 A;  1UUS A;  2JT0 A;  2LE9 B;  2JXC A;  1H8B A;  2HET A;  4WQ2 A;  1M63 B;  1QAS A;  2Y1N A;  5GQQ C;  3VRQ A;  4YGB B;  3I5F C;  1ZOT B;  3BJH A;  3BOW B;  1KFU S;  2WC5 A;  1TCF A;  2JU0 A;  3I5I C;  3L4L A;  4JQ0 D;  1TNQ A;  2FJU B;  5HL1 A;  1NIW A;  2LUC A;  5D3O A;  1PRW A;  2PAS A;  2G9B A;  1CFC A;  4F7F A;  1IJ5 A;  2QEB A;  1DQE A;  3B87 A;  1DMO A;  2PQL A;  2OPO A;  1R6P A;  5HLO A;  1WLM A;  3N7H A;  1OMV A;  5KU1 A;  2ZFD A;  2JT8 A;  3PM2 A;  2OTG B;  4CLN A;  4I5L B;  3DD4 A;  3E3R A;  1QV0 A;  1SPY A;  1TN4 A;  2NCO A;  3DY9 A;  2O60 A;  3CLN A;  5B8I B;  1A29 A;  2GTE A;  3PN7 C;  5BPJ A;  3I5H B;  1K94 A;  4ETO A;  1KK7 Y;  1W7I B;  3L47 A;  1AHR A;  1QWV A;  2SCP A;  1F55 A;  3PAT A;  3MSE B;  3RZS A;  3B7A A;  2Y1M A;  3OB2 B;  1PSB A;  2PSR A;  2KGR A;  4YRU A;  1QTX A;  2LCP A;  2QPT A;  3IQQ A;  4E68 A;  1UHK A;  4YGD B;  3CZ0 A;  1YVL A;  3WHT B;  3CYZ A;  2LAP A;  5TNC A;  4MZK A;  1KK7 Z;  3CDN A;  4GFT A;  2L50 A;  1T14 A;  4P5O E;  1FBV A;  3I5I B;  2MRD A;  5EL2 A;  1XYD A;  5AEQ A;  1NCY A;  1G33 A;  1PUL A;  2BEC A;  1B8C A;  2KQ6 A;  3FWC A;  3O78 A;  4OVN F;  1Y1U A;  1EG3 A;  4MZL A;  1M39 A;  2KI6 C;  1PK0 D;  2JWW A;  5J3X A;  4CFR A;  4MVF A;  5HYD A;  1DJY A;  3A8R A;  1NYA A;  3SS3 A;  3OX5 A;  1F4Q A;  4GNK B;  1UUR A;  2F33 A;  2L2E A;  5I2O A;  2M97 A;  2GGZ A;  5AFP A;  4AQJ A;  4GAO A;  3D74 A;  1DJZ A;  2KI6 D;  4MRX A;  1YUU A;  3PN7 B;  2H61 A;  1B4C A;  1HQV A;  1LIN A;  3TDZ A;  4ICB A;  1YUR A;  1CM1 A;  2NXQ A;  2BCA A;  2DOQ A;  1ZUZ A;  3OGN A;  1BF5 A;  5AER A;  3F45 A;  2B1U A;  3K21 A;  3NHI A;  1IIO A;  2KNE A;  2F8P A;  4C0K A;  1BT6 A;  2F2P A;  3V2L A;  4FQT A;  1MF8 B;  2HQ8 A;  3PFV A;  1NUB A;  1SKT A;  2KQY A;  2K7D A;  2WND A;  4NDB A;  2JTZ A;  2LM5 A;  2SAS A;  3B86 A;  3DF0 A;  4OR9 B;  4PT1 A;  1S3P A;  2KAV A;  3WHU B;  2QDI A;  4PE4 A;  1ZAC A;  1Q80 A;  1MHO A;  1OOG A;  3CR2 A;  2LMU A;  3NSI A;  3SG6 A;  4DCK A;  1K9K A;  2K2A A;  2MLE C;  3CZ2 A;  3UNW A;  3DYE A;  2BE6 A;  3BUM B;  4TNC A;  1A75 B;  1VRK A;  1YVH A;  4MBE A;  5CSN A;  1LKJ A;  3I5G B;  2JOJ A;  1BOC A;  1FF1 A;  1TUZ A;  2MAZ A;  2K8M B;  1CM4 A;  2NLN A;  4FQO A;  5CPV A;  1BG1 A;  1JF2 A;  1XFX O;  2D8N A;  3FE6 A;  4C0J A;  5ER4 X;  1NCZ A;  3JTD C;  1B47 A;  2TN4 A;  4PHN A;  4I5K A;  1BMO A;  2PRU A;  1OE9 B;  3VRN A;  1YRU B;  1N2D A;  1R2U A;  2RGI A;  1CFF A;  5D69 A;  3CTN A;  3EKH A;  4PAL A;  2WOS A;  2LLS A;  1LVC D;  1SW8 A;  1Y1A A;  3SG4 A;  3S0A A;  1EH2 A;  5K89 A;  3TS5 C;  2H2K A;  1ZFS A;  2BBM A;  2CT9 A;  1XFR A;  4QJ3 B;  5HLV A;  2ISD A;  3S0E A;  1DJH A;  4BY4 A;  1IWQ A;  5DKN A;  4DIR A;  2LV7 A;  2OS8 C;  1AP4 A;  1K2H A;  1J7R A;  2K61 A;  3R1V A;  1TWO A;  2QEO A;  1BLQ A;  2K60 A;  3TUY C;  4GGF A;  2AMI A;  3R1P A;  1UHN A;  3BUW B;  3BOW A;  3L4A A;  4MSP A;  1C3Y A;  2P6B B;  3IQO A;  4HRG A;  2KYC A;  1NX2 A;  2ZRT A;  3EVV A;  5AAN A;  1QIV A;  1Z2C B;  2COL B;  3O6B A;  1TOP A;  2MHH A;  4PE0 A;  1NX3 A;  3BUN B;  3DVK A;  1A03 A;  1CMF A;  1W7J B;  1JWD A;  4UPG A;  3FS7 A;  3EK8 A;  1MR8 A;  1DJG A;  3AKB A;  1YTZ C;  2F3Z A;  2Q4U A;  3TDU A;  4GGN A;  4DS7 A;  2FOT A;  1EG4 A;  1DGU A;  1QJT A;  2JNX A;  2WCB A;  1V1F A;  3LK0 A;  3NSL A;  4MLW A;  4YGC B;  1XFW O;  1KSO A;  4GPL B;  2CCM A;  2G2B A;  4JD9 A;  2K7O A;  2LVV A;  2LVI A;  1JFJ A;  1C7W A;  2AUC A;  3BFB A;  4I5J A;  2BCB A;  4U8D A;  3LL8 B;  3PLF B;  1UWO A;  2BKI B;  1ORG A;  3EK4 A;  2JPT A;  3IVT A;  1JC2 A;  1RJV A;  3CZ1 A;  1XFU O;  2HF5 A;  2JZI A;  5FYX A;  4YGE B;  4DRW A;  1CTR A;  3QRX A;  4BY5 A;  3GK1 A;  5I2Q A;  1IH0 A;  1QLS A;  1WDC C;  4M2O A;  1CNP A;  3S0D A;  3K1E A;  1KCY A;  4MN0 A;  1XFV O;  1SCM B;  1N65 A;  2P70 A;  4USL A;  3UO9 A;  2L0P A;  4R1E A;  3AKA A;  1CFD A;  1G8I A;  3SG3 A;  3BXK A;  2HQW A;  1N0Y A;  1PAL A;  3ICB A;  1TTX A;  4GBA A;  1IQ5 A;  2MJW B;  4ORB B;  3GK2 A;  3D78 A;  1AJ4 A;  2ZN9 A;  4AOM A;  3NSK A;  1SCV A;  5I94 A;  1WY9 A;  1KFU L;  2JUL A;  3I5F B;  2CTN A;  1QV1 A;  2Y4Q A;  3DXL A;  1KQM C;  1OOF A;  3R72 A;  3BUO B;  4N1F A;  4QJ5 B;  2WCE A;  1UP5 A;  1QAT A;  1BJF A;  1NCX A;  2V53 A;  1C3Z A;  2KFH A;  1SBJ A;  3NHT A;  2A4J A;  2KAX A;  2KDH A;  2LP2 A;  2O5G A;  1DJX A;  1SY9 A;  3LLE A;  2VRG A;  1U5I B;  1S6J A;  1TRF A;  1Y6W A;  3SS5 A;  5AXI A;  2K0J A;  2JNF A;  5ER5 A;  1SL8 A;  3O4Y A;  1XK4 A;  1SL9 A;  4CFQ A;  3SJS A;  5I2L A;  1QLK A;  1BU3 A;  1MWN A;  1ZMZ A;  3VRO A;  4F0Z B;  3RM1 A;  4GUK A;  2E30 A;  3D0Y B;  2EGD A;  1NP8 A;  1A4P A;  3BFA A;  2LMV A;  3S0F A;  2WC6 A;  1S36 A;  1JUO A;  2GV5 A;  1SL7 A;  1NX0 A;  1RK9 A;  2KLE A;  2WOR A;  4QJ4 B;  1K9P A;  3PJI A;  2Q91 A;  1AUI B;  2BNX A;  2E6W A;  2YGU A;  3RLZ A;  4WQ3 A;  4XJK B;  1B9A A;  3WXA A;  1RTP 1;  2L4H A;  1KK8 C;  1GGW A;  1HT9 A;  5DKR A;  4D1E A;  2JRF A;  1J7Q A;  2P71 A;  4MRY A;  1B8L A;  2KLD A;  1F4O A;  1CFP A;  2WCK A;  5KTY A;  4YGA A;  5I8N A;  1NWD A;  1SSE B;  2LVK A;  3D76 A;  3VRP A;  2LLT A;  1OMD A;  1M45 A;  3TDI A;  1A75 A;  1LA3 A;  3TZ1 A;  5JJG A;  1K95 A;  1PVB A;  1OOH A;  1S26 D;  1QX7 A;  1MQ1 A;  1GGZ A;  2I94 A;  3PAL A;  1QX2 A;  1L7Z A;  4P2Y B;  1F71 A;  1XFZ O;  2EC6 C;  4PDZ A;  3CS1 A;  3DVE A;  5FI7 A;  4MZJ A;  1G4Y R;  3LK1 A;  2JXL A;  4WRI A;  1JFK A;  1B7T Y;  1SMG A;  2KAY A;  2QEH A;  4PCW A;  4NDC A;  1TIZ A;  2Y5I A;  4PHM A;  1DTL A;  3FE9 A;  3SIB A;  3B6X A;  4GGF C;  1H4B A;  3SIA A;  4PHK A;  4YI9 A;  1CDL A;  2LVJ A;  3PM8 A;  5FI2 A;  5G08 A;  2NZ0 A;  1CKK A;  3AAJ A;  1ALV A;  3C1V A;  1IJ6 A;  1B7T Z;  1K9U A;  4INX A;  4JPZ B;  5KSZ A;  2WCH A;  3JVT C;  2ZND A;  1DF0 A;  2PVB A;  1OOI X;  3BFH A;  1AVS A;  4NQG A;  1WRL A;  1EL4 A;  1OSA A;  3NSO A;  5JOL A;  5F6T A;  4YI8 A;  2M1U A;  1DF0 B;  2KSP A;  1CMG A;  2OTG C;  1KQV A;  2BKH B;  4HRE E;  4A4B A;  1YR5 A;  3DVM A;  1K90 D;  2IS9 A;  2KFF A;  4NDD A;  1XO5 A;  3I5H C;  2M0R A;  3O2P A;  2WCF A;  1RWY A;  2KOT A;  3SG7 A;  1EXR A;  3WNX B;  1CB1 A; 
#chains in the Genus database with same CATH homology
 2I18 A;  3CZT X;  2F2O A;  1B8R A;  1OMR A;  1YX7 A;  3H4S E;  4OV2 A;  1D1O A;  1CLB A;  3JTD B;  3KF9 A;  2I2R E;  1GJY A;  3OX6 A;  1M46 A;  2BL0 C;  2CBL A;  2L98 A;  2CXJ A;  3BYA A;  3KHE A;  2LMT A;  2ZNE A;  3EVR A;  3NXA A;  4ZCU A;  1F8H A;  1JF0 A;  1RRO A;  5CSJ A;  1TCO B;  2LC5 A;  1OQP A;  1SNL A;  1DVI A;  1SYM A;  1UHI A;  3TS5 B;  1M31 A;  4M2P A;  5CSF A;  2R2I A;  1CDN A;  3IF7 A;  1A2X A;  1KWO C;  2OS8 B;  4YBH B;  3CWG A;  2M7L A;  3JVT B;  1XVJ A;  2JQ6 A;  2PMY A;  4Q04 A;  1YX8 A;  3PSR A;  3ZWH A;  3HX4 A;  3TUY B;  1GQM A;  3OP0 A;  3EVU A;  3AAK A;  3BQ3 A;  2LNK A;  3FWB A;  4JWQ A;  1AK8 A;  5CSI A;  1KSM A;  2ZN8 A;  4PHJ A;  1XK4 C;  4OKH A;  2KI4 C;  5HKZ A;  3KO0 A;  1RFJ A;  2NCP A;  1ALW A;  3A4U B;  3CR4 X;  1OZS A;  1TNP A;  4HRH A;  2HPS A;  1NX1 A;  4ORA B;  1SR6 C;  1U5I A;  3SG5 A;  2H61 C;  4DUQ A;  1QIW A;  1XFY O;  1CLL A;  1WRZ A;  1QX5 B;  3FIA A;  1WRK A;  2BL0 B;  2ZKM X;  2M1K B;  3D0Y A;  2KBM A;  1S6I A;  1J55 A;  3LCP C;  2ZRS A;  1EJ3 A;  1ODB A;  1LA0 A;  1YRT B;  4I5N B;  4ZCV A;  1MUX A;  1MXE A;  1OZO A;  1QXP A;  2JC2 A;  3GOF A;  3KEV A;  1WDC B;  1FI6 A;  1S6C A;  4PE7 A;  2LHL A;  2M49 B;  2M3W A;  1QS7 A;  1JSA A;  5HKW A;  1DJI A;  2F3Y A;  1SK6 D;  3DVJ A;  1FI5 A;  1KWO B;  2QAC A;  2K2F A;  4MEW A;  1LXF C;  4N5X A;  4XJK A;  1KFX S;  3ZNI A;  2LLU A;  3I5G C;  1CDP A;  1UHH A;  4CPV A;  2JTT A;  1Y1X A;  2KGB C;  2KI4 B;  1L2O C;  2BE4 A;  1KQM B;  2KYF A;  2L5X B;  3BUX B;  4L9M A;  1X02 A;  3CGA A;  2M9G A;  3OHM B;  4C0L A;  1YUS A;  4IL1 A;  1DGV A;  1SR6 B;  2KFG A;  2PAL A;  1F54 A;  2WC8 A;  1AJ5 A;  1K93 D;  1NSH A;  1S5G Y;  5HKY A;  4AQI A;  2EHB A;  1CDM A;  1V1G A;  1J1E A;  2LUX A;  3VRR A;  1WLZ A;  4CID A;  1UHJ A;  2M8U A;  1OOJ A;  1IRJ A;  1YUT A;  2KHN A;  2L4I A;  1F70 A;  4XYN A;  5D7F A;  1K8U A;  2CNP A;  1S5G Z;  1S1E A;  5IBW A;  1IKU A;  1NPQ A;  1E8A A;  1BOD A;  5DKQ A;  3KPX A;  1B1G A;  1PVA A;  1QVI Y;  1CLM A;  3M0W A;  1SRA A;  3DF0 B;  5PAL A;  2K7B A;  2K7C A;  1KFX L;  3SG2 A;  3OB1 B;  1MXL C;  3HCM A;  1BR1 B;  3CR5 X;  4N1G A;  3VGO A;  2GGM A;  2L51 A;  4M2Q A;  1C7V A;  4ORC B;  1J7P A;  2LP3 A;  2M29 A;  1KK8 B;  4PE1 A;  1J7O A;  1XA5 A;  2MA2 A;  1DJW A;  2MBX A;  2BBN A;  4A4C A;  1L2O B;  2I7A A;  1Y0V H;  1QVI Z;  2LAN A;  3EKJ A;  1BR4 B;  3D10 A;  2FCE A;  1DT7 B;  2M7N A;  3EK7 A;  1J1D A;  2FCD A;  3GK4 X;  4HSZ A;  1IGV A;  2AAO A;  1C07 A;  2BCX A;  2LHI A;  1K96 A;  2KBI A;  4OCI A;  1TNW A;  1JBA A;  1PSR A;  4FTG A;  1REC A;  1TNX A;  2JT3 A;  1SCM C;  1IG5 A;  1FPW A;  2EC6 B;  1IQ3 A;  2MLF C;  1FW4 A;  1UUS A;  2JT0 A;  2LE9 B;  2JXC A;  1H8B A;  2HET A;  4WQ2 A;  1M63 B;  1QAS A;  2Y1N A;  5GQQ C;  3VRQ A;  4YGB B;  3I5F C;  1ZOT B;  3BOW B;  1KFU S;  3I5I C;  1TCF A;  2JU0 A;  4JQ0 D;  1TNQ A;  2FJU B;  1NIW A;  2LUC A;  1PRW A;  2PAS A;  2G9B A;  1CFC A;  1IJ5 A;  1DMO A;  2OPO A;  1R6P A;  5HLO A;  1WLM A;  1OMV A;  5KU1 A;  2ZFD A;  2JT8 A;  2OTG B;  4CLN A;  4I5L B;  3DD4 A;  3E3R A;  1QV0 A;  1SPY A;  1TN4 A;  2NCO A;  5B8I B;  2O60 A;  3CLN A;  1A29 A;  3PN7 C;  5BPJ A;  3I5H B;  1K94 A;  4ETO A;  1KK7 Y;  1W7I B;  1AHR A;  2SCP A;  1F55 A;  3PAT A;  3MSE B;  2Y1M A;  3OB2 B;  1PSB A;  2PSR A;  2KGR A;  4YRU A;  1QTX A;  2LCP A;  2QPT A;  3IQQ A;  4E68 A;  1UHK A;  4YGD B;  3WHT B;  1YVL A;  2LAP A;  5TNC A;  4MZK A;  1KK7 Z;  4GFT A;  2L50 A;  4P5O E;  1FBV A;  3I5I B;  2MRD A;  1XYD A;  5AEQ A;  1NCY A;  1G33 A;  1PUL A;  2BEC A;  1B8C A;  2KQ6 A;  3FWC A;  3O78 A;  4OVN F;  1Y1U A;  1EG3 A;  4MZL A;  1M39 A;  2KI6 C;  1PK0 D;  2JWW A;  5J3X A;  4CFR A;  4MVF A;  5HYD A;  1DJY A;  3A8R A;  1NYA A;  3OX5 A;  1F4Q A;  4GNK B;  1UUR A;  2F33 A;  2L2E A;  5I2O A;  2M97 A;  2GGZ A;  5AFP A;  4AQJ A;  4GAO A;  1DJZ A;  2KI6 D;  4MRX A;  1YUU A;  3PN7 B;  2H61 A;  1B4C A;  1HQV A;  1LIN A;  3TDZ A;  4ICB A;  1YUR A;  1CM1 A;  2NXQ A;  2BCA A;  2DOQ A;  1ZUZ A;  1BF5 A;  5AER A;  3F45 A;  2B1U A;  3K21 A;  2KNE A;  2F8P A;  4C0K A;  1BT6 A;  2F2P A;  1MF8 B;  2HQ8 A;  3PFV A;  1NUB A;  1SKT A;  2KQY A;  2K7D A;  2WND A;  4NDB A;  2JTZ A;  2LM5 A;  2SAS A;  3DF0 A;  4OR9 B;  1S3P A;  2KAV A;  3WHU B;  4PE4 A;  1ZAC A;  1Q80 A;  1MHO A;  3NSI A;  3CR2 A;  2LMU A;  3SG6 A;  4DCK A;  1K9K A;  2K2A A;  2MLE C;  2BE6 A;  3BUM B;  4TNC A;  1A75 B;  1VRK A;  1YVH A;  4MBE A;  5CSN A;  1LKJ A;  3I5G B;  2JOJ A;  1BOC A;  1FF1 A;  2MAZ A;  2K8M B;  1CM4 A;  2NLN A;  4FQO A;  5CPV A;  1BG1 A;  1JF2 A;  1XFX O;  2D8N A;  4C0J A;  5ER4 X;  1NCZ A;  3JTD C;  1B47 A;  2TN4 A;  4PHN A;  4I5K A;  1BMO A;  2PRU A;  1OE9 B;  3VRN A;  1YRU B;  1N2D A;  1R2U A;  2RGI A;  1CFF A;  5D69 A;  3CTN A;  3EKH A;  4PAL A;  2WOS A;  2LLS A;  1LVC D;  1SW8 A;  1Y1A A;  3SG4 A;  1EH2 A;  5K89 A;  3TS5 C;  2H2K A;  1ZFS A;  2BBM A;  2CT9 A;  5HLV A;  4QJ3 B;  2ISD A;  1DJH A;  4BY4 A;  1IWQ A;  5DKN A;  4DIR A;  2LV7 A;  2OS8 C;  1AP4 A;  1K2H A;  1J7R A;  2K61 A;  1BLQ A;  3TUY C;  4GGF A;  2AMI A;  1UHN A;  3BUW B;  3BOW A;  4MSP A;  2P6B B;  3IQO A;  4HRG A;  2KYC A;  1NX2 A;  2ZRT A;  3EVV A;  5AAN A;  1QIV A;  2COL B;  3O6B A;  1TOP A;  2MHH A;  4PE0 A;  1NX3 A;  3BUN B;  3DVK A;  1A03 A;  1CMF A;  1W7J B;  1JWD A;  4UPG A;  3FS7 A;  3EK8 A;  1MR8 A;  1DJG A;  3AKB A;  1YTZ C;  2F3Z A;  2Q4U A;  3TDU A;  4GGN A;  4DS7 A;  2FOT A;  1EG4 A;  1DGU A;  1QJT A;  2JNX A;  2WCB A;  1V1F A;  3LK0 A;  3NSL A;  4MLW A;  4YGC B;  1XFW O;  1KSO A;  4GPL B;  2CCM A;  2G2B A;  1JFJ A;  2K7O A;  2LVV A;  2LVI A;  1C7W A;  2AUC A;  4I5J A;  4U8D A;  2BCB A;  3LL8 B;  3PLF B;  1UWO A;  2BKI B;  3EK4 A;  2JPT A;  1JC2 A;  1RJV A;  1XFU O;  2HF5 A;  2JZI A;  5FYX A;  4YGE B;  4DRW A;  1CTR A;  3QRX A;  4BY5 A;  3GK1 A;  5I2Q A;  1IH0 A;  1QLS A;  1WDC C;  4M2O A;  1CNP A;  1KCY A;  4MN0 A;  1XFV O;  1SCM B;  1N65 A;  4USL A;  2L0P A;  4R1E A;  3AKA A;  1CFD A;  1G8I A;  3SG3 A;  3BXK A;  2HQW A;  1N0Y A;  1PAL A;  3ICB A;  1TTX A;  4GBA A;  1IQ5 A;  2MJW B;  4ORB B;  3GK2 A;  1AJ4 A;  2ZN9 A;  4AOM A;  3NSK A;  1SCV A;  1WY9 A;  1KFU L;  2JUL A;  3I5F B;  2CTN A;  1QV1 A;  2Y4Q A;  1KQM C;  3BUO B;  4N1F A;  4QJ5 B;  2WCE A;  1UP5 A;  1QAT A;  1BJF A;  1NCX A;  2V53 A;  2KFH A;  1SBJ A;  2A4J A;  2KAX A;  2KDH A;  2LP2 A;  2O5G A;  1DJX A;  1SY9 A;  3LLE A;  2VRG A;  1U5I B;  1S6J A;  1TRF A;  1Y6W A;  5AXI A;  2K0J A;  2JNF A;  5ER5 A;  1SL8 A;  3O4Y A;  1XK4 A;  1SL9 A;  4CFQ A;  3SJS A;  5I2L A;  1QLK A;  1BU3 A;  1MWN A;  1ZMZ A;  3VRO A;  4F0Z B;  3RM1 A;  4GUK A;  2E30 A;  3D0Y B;  2EGD A;  1NP8 A;  1A4P A;  2LMV A;  1S36 A;  1JUO A;  2GV5 A;  1SL7 A;  1NX0 A;  1RK9 A;  2WOR A;  4QJ4 B;  1K9P A;  2Q91 A;  1AUI B;  2E6W A;  3RLZ A;  4WQ3 A;  4XJK B;  1B9A A;  3WXA A;  1RTP 1;  2L4H A;  1KK8 C;  1GGW A;  1HT9 A;  5DKR A;  4D1E A;  2JRF A;  1J7Q A;  4MRY A;  1B8L A;  1F4O A;  1CFP A;  5KTY A;  4YGA A;  5I8N A;  1NWD A;  2LVK A;  3VRP A;  2LLT A;  1OMD A;  1M45 A;  3TDI A;  1A75 A;  1LA3 A;  3TZ1 A;  5JJG A;  1K95 A;  1PVB A;  1S26 D;  1QX7 A;  1MQ1 A;  1GGZ A;  2I94 A;  3PAL A;  1QX2 A;  1L7Z A;  4P2Y B;  1F71 A;  1XFZ O;  2EC6 C;  4PDZ A;  3CS1 A;  3DVE A;  4MZJ A;  1G4Y R;  3LK1 A;  2JXL A;  4WRI A;  1JFK A;  1B7T Y;  1SMG A;  2KAY A;  4PCW A;  4NDC A;  1TIZ A;  2Y5I A;  4PHM A;  1DTL A;  3SIB A;  4GGF C;  1H4B A;  3SIA A;  4PHK A;  4YI9 A;  1CDL A;  2LVJ A;  3PM8 A;  5G08 A;  2NZ0 A;  1CKK A;  3AAJ A;  1ALV A;  3C1V A;  1IJ6 A;  1B7T Z;  1K9U A;  4JPZ B;  5KSZ A;  3JVT C;  2ZND A;  1DF0 A;  2PVB A;  4NQG A;  1AVS A;  1WRL A;  1EL4 A;  1OSA A;  3NSO A;  5JOL A;  5F6T A;  4YI8 A;  2M1U A;  1DF0 B;  2KSP A;  1CMG A;  2OTG C;  1KQV A;  2BKH B;  4HRE E;  4A4B A;  1YR5 A;  3DVM A;  1K90 D;  2IS9 A;  2KFF A;  4NDD A;  1XO5 A;  3I5H C;  2M0R A;  3O2P A;  2WCF A;  1RWY A;  2KOT A;  3SG7 A;  1EXR A;  3WNX B;  1CB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...