2K7CA

Nmr structure of mg2+-bound cabp1 c-domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
ADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 1
publication title NMR Structure of Mg2+-bound CaBP1 C-domain
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7cA00
1ZACA 1HQVA 1W7IB 3GOFA 3IQQA 3KPXA 4P2YB 3OP0A 1B8CA 2OPOA 2KYCA 4PHNA 1SCVA 1JFJA 2WCBA 1YR5A 2LVVA 3I5IB 1FI6A 1WDCB 1XYDA 2P6BB 4JWQA 4MLWA 3A8RA 3AAJA 1JFKA 1TOPA 3PN7C 3AKBA 1C7VA 2ZRSA 2HETA 4OV2A 3SG6A 2BCBA 1AJ5A 1NX0A 1C7WA 1S6CA 1YX7A 1YRTB 2AAOA 4MZKA 2LVKA 4MRYA 1WLMA 2M8UA 1QX7A 2K2AA 2JU0A 3VRNA 1FF1A 1OSAA 1NSHA 4U8DA 1AP4A 5I2LA 1B8LA 2CNPA 3FIAA 3FS7A 1F4QA 1S26D 1YRUB 1OMRA 1QV0A 3QRXA 5HKWA 5K89A 1M46A 1F54A 1IQ3A 2K61A 4CFRA 2F2PA 4ORAB 3BUWB 1SCMB 3F45A 1CLLA 2G9BA 3OX5A 4YGDB 1J7RA 1CKKA 2HQ8A 1CLMA 1S6JA 4PHJA 4PE7A 1CMFA 4GBAA 1UHJA 1LA0A 1QJTA 3VRQA 3BUMB 2KI6D 5HLVA 3DD4A 3BQ3A 2D8NA 1MUXA 1L7ZA 1N2DA 3A4UB 4ORBB 3TUYB 2KGBC 3ICBA 1H8BA 1QASA 1M39A 2LMVA 3TS5B 1FBVA 1OMVA 1LXFC 1SYMA 1Y0VH 4AOMA 1U5IA 1TNXA 1H4BA 1OMDA 2K7BA 2COLB 4MEWA 1QTXA 1A75A 1UHNA 3SIAA 1DJIA 3TDUA 1FPWA 1V1GA 1V1FA 1SY9A 1PK0D 3GK1A 5CSNA 1IJ6A 1XA5A 2LHLA 2LP2A 2JZIA 4OVNF 3JTDC 1F4OA 1KFUS 1DJHA 1RTP1 2WOSA 4OCIA 4AQIA 1TNQA 1MWNA 1RROA 2OTGC 1LA3A 4PHMA 1NCYA 4DCKA 2JXLA 1BT6A 3ZWHA 1K90D 1EXRA 3LCPC 1HT9A 1SR6C 3AAKA 3DVMA 1ZMZA 2MA2A 2KBIA 4YBHB 1PRWA 2M3WA 2EGDA 1TN4A 2KQ6A 1YX8A 3PLFB 3AKAA 5CSJA 5PALA 4DUQA 3EVVA 4YGCB 2KFFA 1XVJA 1YUUA 1KWOB 3FWBA 2I2RE 5DKQA 1B4CA 2Y5IA 3DF0A 1BLQA 2WCEA 1YTZC 2WCFA 5J3XA 5CPVA 3EKJA 2MLFC 1UP5A 2CBLA 1K2HA 3I5GB 1CNPA 2NLNA 1DJXA 3I5IC 2RGIA 3NSOA 2FOTA 2EHBA 1Y1AA 1KK8C 3WHTB 2H2KA 1A2XA 3WNXB 2NZ0A 4NDDA 4P5OE 3BXKA 3EK7A 3I5HC 4HREE 2H61C 4DIRA 1SW8A 5F6TA 2BKIB 3CWGA 2BBMA 1QLKA 4GPLB 4XJKB 1AUIB 4I5NB 1N0YA 1MXLC 3NSKA 1DJWA 1CB1A 1RFJA 2KFGA 1B47A 3O6BA 1J7QA 1NIWA 1IG5A 2H61A 2L98A 3OB1B 1EG3A 3FWCA 1A4PA 1S1EA 4GFTA 1KSMA 3DVKA 3KHEA 1PULA 2MAZA 1J55A 4E68A 1WRLA 2CXJA 1K94A 3LL8B 1NYAA 1SRAA 2BCAA 1F70A 1YUSA 2MRDA 2F2OA 2QACA 1IGVA 1YVLA 2KDHA 1MQ1A 1B9AA 1NWDA 4TNCA 3IF7A 1LKJA 4MZJA 2JOJA 1K9UA 2ZFDA 4GAOA 1DGVA 1NCXA 1TRFA 1IWQA 1XK4C 2JT3A 1DF0A 4PE4A 3SG7A 4DRWA 1S6IA 2L0PA 1QVIY 3CR4X 5HLOA 4HRGA 1JUOA 2LVIA 1L2OC 2KOTA 1QXPA 1S5GZ 5JOLA 1F55A 1C07A 1QX2A 1XO5A 1NCZA 3O78A 3BOWB 2JT8A 4IL1A 5G08A 3CTNA 1XK4A 1QX5B 3EKHA 3PM8A 1TNPA 4QJ5B 2LC5A 1QIVA 3CZTX 1AK8A 1NP8A 1ZUZA 2KFHA 2TN4A 1CDNA 1SL7A 2EC6B 3HCMA 4C0LA 2BBNA 2QPTA 3WHUB 4D1EA 2JRFA 1JWDA 2F3ZA 1QS7A 1WLZA 2JXCA 2K0JA 3PATA 1E8AA 4YGEB 3SG2A 3RLZA 1LVCD 3OB2B 1A29A 2M1KB 3ZNIA 4A4CA 1TNWA 1IRJA 2K7DA 2KI4C 1ODBA 1B7TY 1CLBA 2M1UA 1SBJA 2F33A 2HPSA 1CFPA 1F71A 1BOCA 2M29A 4NQGA 2JT0A 2NXQA 1PALA 1AHRA 1CDPA 1IKUA 4M2QA 1EJ3A 2L50A 1B8RA 1UHIA 2I94A 2VRGA 3DVEA 3JVTC 2JULA 3MSEB 5IBWA 1OE9B 2KAYA 1J7PA 3C1VA 3I5GC 1DTLA 3KO0A 4Q04A 3BUOB 2BECA 4BY4A 2LE9B 2GV5A 1CDLA 1RJVA 1ALWA 4CFQA 1DJZA 1KCYA 2F3YA 1QLSA 1NPQA 1TCFA 4M2PA 2KHNA 3BUXB 2FCEA 4HSZA 4PDZA 3SG5A 2FCDA 2LMUA 2WORA 5I2QA 2LLTA 1KSOA 2E30A 2O5GA 1M45A 3VRRA 3EK8A 2HF5A 3LK0A 1K96A 4CIDA 2JTTA 2M0RA 1K95A 2O60A 3TZ1A 2PASA 2DOQA 1NX2A 1IQ5A 2GGZA 1JF0A 1OQPA 4PHKA 1CFCA 3D0YA 2PMYA 1NX1A 2KAXA 4MSPA 3TDIA 4ICBA 4PE1A 1LINA 1DMOA 1QVIZ 1K9KA 2Q91A 2BL0B 1U5IB 1GGWA 2PVBA 1KK7Y 3EK4A 1A75B 1WDCC 4YRUA 2GGMA 2OS8B 1JC2A 3PSRA 4USLA 4YGAA 1Y6WA 1NUBA 1WY9A 1UURA 4OKHA 1KQMB 1MF8B 1PSRA 1R6PA 4AQJA 2KYFA 3IQOA 2L4IA 2BKHB 1QV1A 2M97A 2ZN8A 3E3RA 1S36A 4OR9B 2R2IA 3JTDB 1CDMA 5AEQA 1MXEA 4A4BA 5FYXA 5AERA 1KFXL 1EG4A 2JQ6A 2B1UA 1R2UA 4FQOA 5D69A 1PSBA 1OZOA 2LUXA 4PE0A 2HQWA 3I5FB 5I8NA 3O4YA 5ER4X 4GGFC 1SR6B 1D1OA 1XFZO 4FTGA 1AJ4A 1SCMC 3VRPA 2LANA 2M49B 3LLEA 4MVFA 3KF9A 1N65A 3DF0B 1DJYA 5I2OA 1A03A 3CS1A 2LV7A 4MRXA 2ZKMX 2SASA 3GK2A 2BCXA 1GQMA 1SPYA 5CSFA 3WXAA 3EVRA 2EC6C 4GGFA 1IH0A 1BR1B 1WRKA 5KTYA 5AANA 2KAVA 3TUYC 4QJ4B 2Q4UA 3CGAA 3OX6A 3HX4A 4CPVA 4QJ3B 1K93D 2L2EA 3TS5C 4JQ0D 1PVAA 4PCWA 3LK1A 4HRHA 4YGBB 4YI8A 1UUSA 2K8MB 1TTXA 1K8UA 1KK8B 4MBEA 1PVBA 1SKTA 5GQQC 1MR8A 4C0JA 1QATA 5HKZA 2F8PA 1XFUO 2KI6C 4BY5A 1K9PA 3NSLA 1G33A 3I5HB 2G2BA 2KNEA 1DVIA 2LUCA 1UHHA 1VRKA 1RK9A 2ZRTA 3OHMB 1KK7Z 2V53A 3K21A 4WQ3A 3CLNA 3VGOA 4WRIA 2LMTA 2JNFA 2PSRA 2L51A 4NDBA 2L5XB 3D10A 5BPJA 4ORCB 1BJFA 4GGNA 3PFVA 1AVSA 2A4JA 5HKYA 1SK6D 2JC2A 4L9MA 4F0ZB 2K7CA 2LVJA 1J1EA 1EL4A 2L4HA 2ZN9A 3GK4X 4N1FA 1KWOC 3SIBA 3PN7B 4XYNA 2WNDA 4ETOA 3BYAA 1XFVO 1M63B 4M2OA 1DGUA 1DF0B 2KGRA 4N5XA 5DKNA 2ISDA 4YI9A 3H4SE 2M7NA 2BL0C 1ZFSA 1F8HA 3O2PA 2K2FA 4DS7A 2I7AA 3SG3A 3TDZA 1KFXS 1S3PA 2OS8C 2M7LA 1BF5A 5KSZA 3KEVA 4JPZB 1CTRA 1G4YR 2E6WA 2BE4A 4ZCVA 3RM1A 5JJGA 1KQMC 2PALA 1XFXO 1JBAA 2KQYA 5ER5A 1L2OB 1FI5A 5AFPA 1CM4A 4WQ2A 3PALA 2FJUB 1YVHA 2CCMA 2LAPA 1ALVA 1GJYA 1CFDA 1TIZA 2BE6A 4MZLA 1BMOA 1RECA 2K7OA 2LCPA 1Q80A 2JTZA 2MJWB 2LP3A 4NDCA 2Y1MA 2KBMA 2LHIA 2LM5A 4N1GA 1OOJA 2I18A 5AXIA 4R1EA 1FW4A 1EH2A 1DJGA 1UWOA 2AUCA 2LLUA 3SG4A 1JF2A 2MLEC 4PALA 5D7FA 4ZCUA 3NSIA 4UPGA 4C0KA 1SL8A 1X02A 1BG1A 3I5FC 1IJ5A 1J1DA 1MHOA 1Y1XA 5CSIA 1CM1A 2MBXA 1B1GA 1OZSA 3SJSA 1TCOB 1BU3A 4XJKA 2NCOA 1DT7B 2JNXA 1QIWA 1GGZA 3CR5X 2Y4QA 2KI4B 2LNKA 2CT9A 1CFFA 1CMGA 4MN0A 1S5GY 1SNLA 4GUKA 5HYDA 4I5KA 1RWYA 2JWWA 2IS9A 3EVUA 1JSAA 3VROA 1BODA 2PRUA 1Y1UA 2LLSA 3JVTB 2WC8A 2M9GA 3BUNB 4I5JA 1G8IA 3M0WA 1YURA 2ZNDA 2OTGB 1W7JB 2Y1NA 1J7OA 1UHKA 5TNCA 2NCPA 1ZOTB 2JPTA 2SCPA 1B7TZ 3NXAA 2ZNEA 1XFWO 4CLNA 1KQVA 2AMIA 3D0YB 1XFYO 3DVJA 1YUTA 5DKRA 4GNKB 5B8IB 1NX3A 3CR2A 4I5LB 1SL9A 1SMGA 2KSPA 1KFUL 2CTNA 1M31A 3BOWA 5KU1A 1BR4B 1WRZA 2MHHA
chains in the Genus database with same CATH superfamily
1T14A 1HQVA 1W7IB 1ZACA 3GOFA 3IQQA 3KPXA 4P2YB 3OP0A 1B8CA 3BFBA 1DC1A 2OPOA 2KYCA 4PHNA 1SCVA 1JFJA 2WCBA 1YR5A 2LVVA 1OOFA 3I5IB 1FI6A 1WDCB 1XYDA 2KLDA 2P6BB 4JWQA 4MLWA 3A8RA 3AAJA 1JFKA 1TOPA 3PN7C 3AKBA 1OW4A 1C7VA 2ZRSA 2HETA 2KPHA 4OV2A 3SG6A 2BCBA 1AJ5A 1NX0A 1C7WA 1S6CA 1YX7A 1YRTB 2QEBA 2AAOA 4MZKA 2LVKA 4MRYA 1WLMA 2M8UA 1QX7A 2K2AA 2JU0A 3VRNA 2P70A 1FF1A 1OSAA 2WCHA 1NSHA 4U8DA 1AP4A 5I2LA 1B8LA 2CNPA 3FIAA 3FS7A 1F4QA 1S26D 1YRUB 1OMRA 1QV0A 3QRXA 5HKWA 5K89A 1M46A 3DYEA 1F54A 5I94A 1IQ3A 2K61A 4CFRA 2F2PA 4ORAB 3BUWB 1SCMB 3F45A 1CLLA 2G9BA 3OX5A 4PT1A 4YGDB 1J7RA 1CKKA 2HQ8A 1CLMA 1S6JA 4PHJA 4PE7A 1ORGA 1CMFA 4GBAA 5FI6A 1UHJA 1LA0A 1QJTA 3VRQA 4KYNA 3BUMB 2KI6D 5HLVA 3DD4A 3BQ3A 2D8NA 1MUXA 1L7ZA 3N7HA 1N2DA 3A4UB 4ORBB 3TUYB 2KGBC 4OZDA 3NGVA 3ICBA 1H8BA 2QEVA 1QASA 1M39A 2LMVA 3TS5B 1FBVA 1OMVA 2GTEA 1LXFC 1SYMA 1Y0VH 4AOMA 1U5IA 1TNXA 1H4BA 1OMDA 2K7BA 2COLB 4MEWA 1TUZA 1QTXA 1A75A 1UHNA 5EL2A 1DJIA 3SIAA 3TDUA 1V1GA 3CABA 1FPWA 1V1FA 1SY9A 1PK0D 3GK1A 5CSNA 1IJ6A 1XA5A 2LHLA 2LP2A 2JZIA 3FE9A 4OVNF 3O4XA 3JTDC 1F4OA 1KFUS 1DJHA 1RTP1 2WOSA 4OCIA 4AQIA 1TNQA 1MWNA 1RROA 2OTGC 1LA3A 4PHMA 1NCYA 4DCKA 2JXLA 1BT6A 3ZWHA 1DELA 1K90D 1EXRA 3LCPC 3S0EA 1HT9A 1SR6C 3AAKA 3DVMA 1ZMZA 2MA2A 2KBIA 4YBHB 1PRWA 2M3WA 2EGDA 1TN4A 2KQ6A 1YX8A 3PLFB 3AKAA 5CSJA 5PALA 4DUQA 2L2CA 2WC6A 3EVVA 4YGCB 2KFFA 1XVJA 2WCLA 1YUUA 1KWOB 1SSEB 3FWBA 2I2RE 5DKQA 2QEHA 1B4CA 2Y5IA 3DF0A 1BLQA 2WCEA 1YTZC 2WCFA 5J3XA 5CPVA 3EKJA 2MLFC 1UP5A 2CBLA 1K2HA 3I5GB 1CNPA 2NLNA 1DJXA 3I5IC 2RGIA 3NSOA 2FOTA 2EHBA 1Y1AA 1KK8C 3WHTB 2H2KA 1A2XA 3WNXB 2NZ0A 4NDDA 4P5OE 3BXKA 3EK7A 3I5HC 4HREE 2H61C 3SS5A 4DIRA 1SW8A 5F6TA 2BKIB 3CWGA 2BBMA 1QLKA 4GPLB 3R1PA 4XJKB 1AUIB 4I5NB 1N0YA 1MXLC 3NSKA 1DJWA 1CB1A 1RFJA 2KFGA 1B47A 3O6BA 3V2LA 1J7QA 1NIWA 3S0GA 1IG5A 2H61A 2L98A 3OB1B 1EG3A 1W9ZA 3FWCA 1A4PA 1S1EA 4GFTA 1KSMA 3BFHA 3DVKA 3KHEA 1PULA 2MAZA 1J55A 3NHTA 1WRLA 2CXJA 1K94A 3LL8B 4E68A 1NYAA 1SRAA 2BCAA 1F70A 1YUSA 2MRDA 2F2OA 2QACA 3DXLA 1IGVA 3PJIA 3D74A 1YVLA 2KDHA 3UNWA 1MQ1A 1B9AA 1NWDA 4TNCA 3IF7A 1LKJA 4MZJA 2JOJA 3L4LA 1K9UA 2ZFDA 1DQEA 4GAOA 1DGVA 1NCXA 1XK4C 1IWQA 1C3ZA 1TRFA 1DF0A 2JT3A 4PE4A 3SG7A 1S6IA 4DRWA 2L0PA 1QVIY 3CR4X 5HLOA 3L4AA 4HRGA 1JUOA 2LVIA 3B7AA 3B88A 1L2OC 2KLEA 2KOTA 1QXPA 3EG5B 1S5GZ 5JOLA 1F55A 1C07A 1QX2A 1XO5A 1NCZA 2PQLA 3BOWB 2JT8A 3O78A 1C3YA 4IL1A 2YGUA 5G08A 3CTNA 1XK4A 1QX5B 3EKHA 3PM8A 1TNPA 4QJ5B 2LC5A 1QIVA 3K1EA 3CZTX 1AK8A 1NP8A 3CYZA 1ZUZA 3D73A 2KFHA 2TN4A 1CDNA 1SL7A 2EC6B 3HCMA 4IJ7A 2BBNA 2QPTA 3WHUB 4C0LA 2JRFA 4D1EA 2F3ZA 1JWDA 1QS7A 1WLZA 2JXCA 3BFAA 2K0JA 3PATA 1E8AA 4YGEB 3SG2A 3RLZA 1LVCD 3OB2B 1A29A 2M1KB 3QMEA 5FI7A 3ZNIA 4A4CA 1TNWA 1IRJA 2WCJA 2K7DA 3R1OA 2KI4C 1ODBA 2WCKA 1B7TY 2L5YA 1CLBA 2M1UA 1SBJA 2F33A 2HPSA 1CFPA 1F71A 1BOCA 2M29A 4NQGA 2JT0A 2NXQA 1PALA 5HL1A 1AHRA 1CDPA 1IKUA 4M2QA 1EJ3A 2L50A 1B8RA 1UHIA 2I94A 2VRGA 3DVEA 3JVTC 2JULA 3MSEB 5IBWA 1OE9B 2KAYA 1J7PA 3C1VA 3I5GC 1DTLA 3KO0A 4Q04A 3BUOB 2BECA 4BY4A 2LE9B 2GV5A 1CDLA 1RJVA 1ALWA 4CFQA 5DICA 1DJZA 1KCYA 2F3YA 1QLSA 1NPQA 1TCFA 4M2PA 2KHNA 3BUXB 3OGNA 2FCEA 4HSZA 4PDZA 3SG5A 2FCDA 3SS3A 2LMUA 4JD9A 2WORA 5I2QA 2LLTA 1KSOA 2PYQA 2E30A 2O5GA 1M45A 3VRRA 3EK8A 2HF5A 3BJHA 3LK0A 1K96A 4CIDA 2JTTA 2M0RA 1K95A 2O60A 3TZ1A 2PASA 2DOQA 1NX2A 1IQ5A 2GGZA 1JF0A 1OQPA 4PHKA 1CFCA 3D0YA 2PMYA 1NX1A 4F7FA 3S0AA 3S0DA 2KAXA 4MSPA 3TDIA 4ICBA 4PE1A 1LINA 3R1VA 1DMOA 1QVIZ 1K9KA 2Q91A 2BL0B 1U5IB 1GGWA 2PVBA 1TWOA 1KK7Y 1DEKA 1A75B 3EK4A 1WDCC 4YRUA 2GGMA 2OS8B 1JC2A 3PSRA 4USLA 4INWA 4YGAA 1Y6WA 4FQTA 1NUBA 1WY9A 1UURA 4OKHA 1KQMB 1MF8B 4JKTA 1PSRA 3VB1A 1R6PA 4AQJA 2KYFA 3IQOA 2L4IA 2BKHB 1QV1A 2M97A 2ZN8A 3E3RA 1S36A 4OR9B 2R2IA 3JTDB 1CDMA 5AEQA 3B86A 1MXEA 4A4BA 1OOIX 2P71A 5FYXA 5AERA 1KFXL 1EG4A 2JQ6A 2B1UA 1R2UA 4FQOA 5D69A 1PSBA 1OZOA 1Z4HA 2LUXA 4PE0A 2HQWA 3I5FB 5I8NA 3O4YA 5ER4X 4GGFC 1SR6B 1D1OA 1XFZO 4FTGA 1AJ4A 1SCMC 2ERBA 2LANA 3VRPA 1XFRA 2M49B 3LLEA 4MVFA 3KF9A 1N65A 3B87A 1DJYA 3DF0B 5I2OA 1A03A 3CS1A 2LV7A 4MRXA 4NDCA 3CZ1A 2ZKMX 2SASA 3GK2A 2BCXA 1GQMA 1SPYA 5CSFA 3WXAA 3EVRA 2EC6C 4GGFA 1IH0A 1BR1B 1WRKA 5KTYA 5AANA 2KAVA 3TUYC 3RZSA 4QJ4B 2Q4UA 3CGAA 3OX6A 3HX4A 4CPVA 2K60A 4QJ3B 1K93D 2L2EA 3TS5C 4JQ0D 1PVAA 3L47A 4PCWA 3LK1A 4HRHA 4YGBB 4YI8A 1UUSA 2K8MB 1TTXA 1K8UA 1KK8B 4MBEA 1PVBA 1SKTA 5GQQC 1MR8A 4C0JA 1QATA 3Q8IA 5HKZA 2F8PA 1XFUO 2KI6C 2QEOA 4BY5A 1K9PA 1OOHA 3NSLA 1G33A 1TUJA 3I5HB 2G2BA 2KNEA 1DVIA 2LUCA 1UHHA 1VRKA 1RK9A 2ZRTA 3OHMB 1KK7Z 2V53A 3K21A 4WQ3A 3CLNA 3D76A 3VGOA 1QWVA 1Z2CB 4WRIA 2LMTA 2JNFA 2PSRA 2L51A 4NDBA 2L5XB 3D10A 5BPJA 4ORCB 1P28A 3S0BA 1BJFA 4GGNA 3PFVA 1AVSA 2A4JA 3CDNA 5HKYA 1SK6D 2JC2A 4L9MA 4F0ZB 2FJYA 2K7CA 2LVJA 2JPOA 1J1EA 1EL4A 2L4HA 2ZN9A 3GK4X 4N1FA 1KWOC 3SIBA 3PN7B 4XYNA 2WNDA 4ETOA 3BYAA 1XFVO 1M63B 4M2OA 1DGUA 1DF0B 2KGRA 3D78A 4N5XA 5DKNA 2ISDA 4YI9A 3H4SE 2M7NA 2BL0C 1ZFSA 1F8HA 3O2PA 2K2FA 2WCMA 4DS7A 2I7AA 3SG3A 3TDZA 1KFXS 1S3PA 3CZ2A 2OS8C 2M7LA 1BF5A 5KSZA 3KEVA 4JPZB 1CTRA 1G4YR 2BNXA 2E6WA 2BE4A 4ZCVA 3RM1A 5JJGA 1KQMC 2PALA 1XFXO 1JBAA 2KQYA 5ER5A 1L2OB 1FI5A 2WC5A 5AFPA 1CM4A 4WQ2A 3FE6A 3PALA 2FJUB 1YVHA 2CCMA 2LAPA 1ALVA 1GJYA 1CFDA 1TIZA 2BE6A 4MZLA 1BMOA 1RECA 2K7OA 2LCPA 1Q80A 2JTZA 2MJWB 2BAPA 2LP3A 2Y1MA 2KBMA 2LHIA 2LM5A 4N1GA 1OOJA 2I18A 3PM2A 4R1EA 1FW4A 5AXIA 1EH2A 1DJGA 1LS8A 3SS4A 1UWOA 2AUCA 3S0FA 2LLUA 3SG4A 1JF2A 2MLEC 3DZTA 4PALA 5D7FA 4ZCUA 3NSIA 4UPGA 3OBVA 1SL8A 1X02A 4C0KA 3I5FC 1BG1A 1IJ5A 1J1DA 1MHOA 1Y1XA 5CSIA 1CM1A 2MBXA 1B1GA 1OZSA 3SJSA 1TCOB 1BU3A 3D75A 4XJKA 2NCOA 1DT7B 2JNXA 1QIWA 1GGZA 3B6XA 3CR5X 2Y4QA 2KI4B 5FI2A 2LNKA 2CT9A 3CZ0A 3NHIA 1CFFA 1CMGA 4MN0A 1S5GY 1SNLA 3R72A 4GUKA 5HYDA 4I5KA 3FE8A 1RWYA 2JWWA 2IS9A 3EVUA 1JSAA 3VROA 1BODA 2PRUA 1Y1UA 2LLSA 3JVTB 2WC8A 2M9GA 3IVTA 1OOGA 3BUNB 4I5JA 1G8IA 3M0WA 1YURA 2ZNDA 2OTGB 1W7JB 2Y1NA 1J7OA 1UHKA 4INXA 5TNCA 2NCPA 5D3OA 1ZOTB 2JPTA 2SCPA 1B7TZ 3NXAA 2ZNEA 1XFWO 4CLNA 1KQVA 2AMIA 3D77A 1IIOA 3D0YB 1XFYO 3DVJA 2QDIA 1YUTA 1GM0A 5DKRA 4GNKB 5B8IB 1NX3A 3CR2A 4I5LB 1SL9A 1SMGA 2KSPA 1KFUL 3DY9A 2CTNA 3UO9A 1M31A 3BOWA 5KU1A 1BR4B 1WRZA 2H8VA 2MHHA
chains in the Genus database with same CATH topology
1ZACA 1HQVA 1W7IB 3GOFA 3IQQA 3KPXA 4P2YB 3OP0A 1B8CA 2OPOA 2KYCA 4PHNA 1SCVA 1JFJA 2WCBA 1YR5A 2LVVA 3I5IB 1FI6A 1WDCB 1XYDA 2P6BB 4JWQA 4MLWA 3A8RA 3AAJA 1JFKA 1TOPA 3PN7C 3AKBA 1C7VA 2ZRSA 2HETA 4OV2A 3SG6A 2BCBA 1AJ5A 1NX0A 1C7WA 1S6CA 1YX7A 1YRTB 2AAOA 4MZKA 2LVKA 4MRYA 1WLMA 2M8UA 1QX7A 2K2AA 2JU0A 3VRNA 1FF1A 1OSAA 1NSHA 4U8DA 1AP4A 5I2LA 1B8LA 2CNPA 3FIAA 3FS7A 1F4QA 1S26D 1YRUB 1OMRA 1QV0A 3QRXA 5HKWA 5K89A 1M46A 1F54A 1IQ3A 2K61A 4CFRA 2F2PA 4ORAB 3BUWB 1SCMB 3F45A 1CLLA 2G9BA 3OX5A 4YGDB 1J7RA 1CKKA 2HQ8A 1CLMA 1S6JA 4PHJA 4PE7A 1CMFA 4GBAA 1UHJA 1LA0A 1QJTA 3VRQA 3BUMB 2KI6D 5HLVA 3DD4A 3BQ3A 2D8NA 1MUXA 1L7ZA 1N2DA 3A4UB 4ORBB 3TUYB 2KGBC 3ICBA 1H8BA 1QASA 1M39A 2LMVA 3TS5B 1FBVA 1OMVA 1LXFC 1SYMA 1Y0VH 4AOMA 1U5IA 1TNXA 1H4BA 1OMDA 2K7BA 2COLB 4MEWA 1QTXA 1A75A 1UHNA 3SIAA 1DJIA 3TDUA 1FPWA 1V1GA 1V1FA 1SY9A 1PK0D 3GK1A 5CSNA 1IJ6A 1XA5A 2LHLA 2LP2A 2JZIA 4OVNF 3JTDC 1F4OA 1KFUS 1DJHA 1RTP1 2WOSA 4OCIA 4AQIA 1TNQA 1MWNA 1RROA 2OTGC 1LA3A 4PHMA 1NCYA 4DCKA 2JXLA 1BT6A 3ZWHA 1K90D 1EXRA 3LCPC 1HT9A 1SR6C 3AAKA 3DVMA 1ZMZA 2MA2A 2KBIA 4YBHB 1PRWA 2M3WA 2EGDA 1TN4A 2KQ6A 1YX8A 3PLFB 3AKAA 5CSJA 5PALA 4DUQA 3EVVA 4YGCB 2KFFA 1XVJA 1YUUA 1KWOB 3FWBA 2I2RE 5DKQA 1B4CA 2Y5IA 3DF0A 1BLQA 2WCEA 1YTZC 2WCFA 5J3XA 5CPVA 3EKJA 2MLFC 1UP5A 2CBLA 1K2HA 3I5GB 1CNPA 2NLNA 1DJXA 3I5IC 2RGIA 3NSOA 2FOTA 2EHBA 1Y1AA 1KK8C 3WHTB 2H2KA 1A2XA 3WNXB 2NZ0A 4NDDA 4P5OE 3BXKA 3EK7A 3I5HC 4HREE 2H61C 4DIRA 1SW8A 5F6TA 2BKIB 3CWGA 2BBMA 1QLKA 4GPLB 4XJKB 1AUIB 4I5NB 1N0YA 1MXLC 3NSKA 1DJWA 1CB1A 1RFJA 2KFGA 1B47A 3O6BA 1J7QA 1NIWA 1IG5A 2H61A 2L98A 3OB1B 1EG3A 3FWCA 1A4PA 1S1EA 4GFTA 1KSMA 3DVKA 3KHEA 1PULA 2MAZA 1J55A 4E68A 1WRLA 2CXJA 1K94A 3LL8B 1NYAA 1SRAA 2BCAA 1F70A 1YUSA 2MRDA 2F2OA 2QACA 1IGVA 1YVLA 2KDHA 1MQ1A 1B9AA 1NWDA 4TNCA 3IF7A 1LKJA 4MZJA 2JOJA 1K9UA 2ZFDA 4GAOA 1DGVA 1NCXA 1TRFA 1IWQA 1XK4C 2JT3A 1DF0A 4PE4A 3SG7A 4DRWA 1S6IA 2L0PA 1QVIY 3CR4X 5HLOA 4HRGA 1JUOA 2LVIA 1L2OC 2KOTA 1QXPA 1S5GZ 5JOLA 1F55A 1C07A 1QX2A 1XO5A 1NCZA 3O78A 3BOWB 2JT8A 4IL1A 5G08A 3CTNA 1XK4A 1QX5B 3EKHA 3PM8A 1TNPA 4QJ5B 2LC5A 1QIVA 3CZTX 1AK8A 1NP8A 1ZUZA 2KFHA 2TN4A 1CDNA 1SL7A 2EC6B 3HCMA 4C0LA 2BBNA 2QPTA 3WHUB 4D1EA 2JRFA 1JWDA 2F3ZA 1QS7A 1WLZA 2JXCA 2K0JA 3PATA 1E8AA 4YGEB 3SG2A 3RLZA 1LVCD 3OB2B 1A29A 2M1KB 3ZNIA 4A4CA 1TNWA 1IRJA 2K7DA 2KI4C 1ODBA 1B7TY 1CLBA 2M1UA 1SBJA 2F33A 2HPSA 1CFPA 1F71A 1BOCA 2M29A 4NQGA 2JT0A 2NXQA 1PALA 1AHRA 1CDPA 1IKUA 4M2QA 1EJ3A 2L50A 1B8RA 1UHIA 2I94A 2VRGA 3DVEA 3JVTC 2JULA 3MSEB 5IBWA 1OE9B 2KAYA 1J7PA 3C1VA 3I5GC 1DTLA 3KO0A 4Q04A 3BUOB 2BECA 4BY4A 2LE9B 2GV5A 1CDLA 1RJVA 1ALWA 4CFQA 1DJZA 1KCYA 2F3YA 1QLSA 1NPQA 1TCFA 4M2PA 2KHNA 3BUXB 2FCEA 4HSZA 4PDZA 3SG5A 2FCDA 2LMUA 2WORA 5I2QA 2LLTA 1KSOA 2E30A 2O5GA 1M45A 3VRRA 3EK8A 2HF5A 3LK0A 1K96A 4CIDA 2JTTA 2M0RA 1K95A 2O60A 3TZ1A 2PASA 2DOQA 1NX2A 1IQ5A 2GGZA 1JF0A 1OQPA 4PHKA 1CFCA 3D0YA 2PMYA 1NX1A 2KAXA 4MSPA 3TDIA 4ICBA 4PE1A 1LINA 1DMOA 1QVIZ 1K9KA 2Q91A 2BL0B 1U5IB 1GGWA 2PVBA 1KK7Y 3EK4A 1A75B 1WDCC 4YRUA 2GGMA 2OS8B 1JC2A 3PSRA 4USLA 4YGAA 1Y6WA 1NUBA 1WY9A 1UURA 4OKHA 1KQMB 1MF8B 1PSRA 1R6PA 4AQJA 2KYFA 3IQOA 2L4IA 2BKHB 1QV1A 2M97A 2ZN8A 3E3RA 1S36A 4OR9B 2R2IA 3JTDB 1CDMA 5AEQA 1MXEA 4A4BA 5FYXA 5AERA 1KFXL 1EG4A 2JQ6A 2B1UA 1R2UA 4FQOA 5D69A 1PSBA 1OZOA 2LUXA 4PE0A 2HQWA 3I5FB 5I8NA 3O4YA 5ER4X 4GGFC 1SR6B 1D1OA 1XFZO 4FTGA 1AJ4A 1SCMC 3VRPA 2LANA 2M49B 3LLEA 4MVFA 3KF9A 1N65A 3DF0B 1DJYA 5I2OA 1A03A 3CS1A 2LV7A 4MRXA 2ZKMX 2SASA 3GK2A 2BCXA 1GQMA 1SPYA 5CSFA 3WXAA 3EVRA 2EC6C 4GGFA 1IH0A 1BR1B 1WRKA 5KTYA 5AANA 2KAVA 3TUYC 4QJ4B 2Q4UA 3CGAA 3OX6A 3HX4A 4CPVA 4QJ3B 1K93D 2L2EA 3TS5C 4JQ0D 1PVAA 4PCWA 3LK1A 4HRHA 4YGBB 4YI8A 1UUSA 2K8MB 1TTXA 1K8UA 1KK8B 4MBEA 1PVBA 1SKTA 5GQQC 1MR8A 4C0JA 1QATA 5HKZA 2F8PA 1XFUO 2KI6C 4BY5A 1K9PA 3NSLA 1G33A 3I5HB 2G2BA 2KNEA 1DVIA 2LUCA 1UHHA 1VRKA 1RK9A 2ZRTA 3OHMB 1KK7Z 2V53A 3K21A 4WQ3A 3CLNA 3VGOA 4WRIA 2LMTA 2JNFA 2PSRA 2L51A 4NDBA 2L5XB 3D10A 5BPJA 4ORCB 1BJFA 4GGNA 3PFVA 1AVSA 2A4JA 5HKYA 1SK6D 2JC2A 4L9MA 4F0ZB 2K7CA 2LVJA 1J1EA 1EL4A 2L4HA 2ZN9A 3GK4X 4N1FA 1KWOC 3SIBA 3PN7B 4XYNA 2WNDA 4ETOA 3BYAA 1XFVO 1M63B 4M2OA 1DGUA 1DF0B 2KGRA 4N5XA 5DKNA 2ISDA 4YI9A 3H4SE 2M7NA 2BL0C 1ZFSA 1F8HA 3O2PA 2K2FA 4DS7A 2I7AA 3SG3A 3TDZA 1KFXS 1S3PA 2OS8C 2M7LA 1BF5A 5KSZA 3KEVA 4JPZB 1CTRA 1G4YR 2E6WA 2BE4A 4ZCVA 3RM1A 5JJGA 1KQMC 2PALA 1XFXO 1JBAA 2KQYA 5ER5A 1L2OB 1FI5A 5AFPA 1CM4A 4WQ2A 3PALA 2FJUB 1YVHA 2CCMA 2LAPA 1ALVA 1GJYA 1CFDA 1TIZA 2BE6A 4MZLA 1BMOA 1RECA 2K7OA 2LCPA 1Q80A 2JTZA 2MJWB 2LP3A 4NDCA 2Y1MA 2KBMA 2LHIA 2LM5A 4N1GA 1OOJA 2I18A 5AXIA 4R1EA 1FW4A 1EH2A 1DJGA 1UWOA 2AUCA 2LLUA 3SG4A 1JF2A 2MLEC 4PALA 5D7FA 4ZCUA 3NSIA 4UPGA 4C0KA 1SL8A 1X02A 1BG1A 3I5FC 1IJ5A 1J1DA 1MHOA 1Y1XA 5CSIA 1CM1A 2MBXA 1B1GA 1OZSA 3SJSA 1TCOB 1BU3A 4XJKA 2NCOA 1DT7B 2JNXA 1QIWA 1GGZA 3CR5X 2Y4QA 2KI4B 2LNKA 2CT9A 1CFFA 1CMGA 4MN0A 1S5GY 1SNLA 4GUKA 5HYDA 4I5KA 1RWYA 2JWWA 2IS9A 3EVUA 1JSAA 3VROA 1BODA 2PRUA 1Y1UA 2LLSA 3JVTB 2WC8A 2M9GA 3BUNB 4I5JA 1G8IA 3M0WA 1YURA 2ZNDA 2OTGB 1W7JB 2Y1NA 1J7OA 1UHKA 5TNCA 2NCPA 1ZOTB 2JPTA 2SCPA 1B7TZ 3NXAA 2ZNEA 1XFWO 4CLNA 1KQVA 2AMIA 3D0YB 1XFYO 3DVJA 1YUTA 5DKRA 4GNKB 5B8IB 1NX3A 3CR2A 4I5LB 1SL9A 1SMGA 2KSPA 1KFUL 2CTNA 1M31A 3BOWA 5KU1A 1BR4B 1WRZA 2MHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAC A;  1HQV A;  1W7I B;  3GOF A;  3IQQ A;  3KPX A;  4P2Y B;  3OP0 A;  1B8C A;  2OPO A;  2KYC A;  4PHN A;  1SCV A;  1JFJ A;  2WCB A;  1YR5 A;  2LVV A;  3I5I B;  1FI6 A;  1WDC B;  1XYD A;  2P6B B;  4JWQ A;  4MLW A;  3A8R A;  3AAJ A;  1JFK A;  1TOP A;  3PN7 C;  3AKB A;  1C7V A;  2ZRS A;  2HET A;  4OV2 A;  3SG6 A;  2BCB A;  1AJ5 A;  1NX0 A;  1C7W A;  1S6C A;  1YX7 A;  1YRT B;  2AAO A;  4MZK A;  2LVK A;  4MRY A;  1WLM A;  2M8U A;  1QX7 A;  2K2A A;  2JU0 A;  3VRN A;  1FF1 A;  1OSA A;  1NSH A;  4U8D A;  1AP4 A;  5I2L A;  1B8L A;  2CNP A;  3FIA A;  3FS7 A;  1F4Q A;  1S26 D;  1YRU B;  1OMR A;  1QV0 A;  3QRX A;  5HKW A;  5K89 A;  1M46 A;  1F54 A;  1IQ3 A;  2K61 A;  4CFR A;  2F2P A;  4ORA B;  3BUW B;  1SCM B;  3F45 A;  1CLL A;  2G9B A;  3OX5 A;  4YGD B;  1J7R A;  1CKK A;  2HQ8 A;  1CLM A;  1S6J A;  4PHJ A;  4PE7 A;  1CMF A;  4GBA A;  1UHJ A;  1LA0 A;  1QJT A;  3VRQ A;  3BUM B;  2KI6 D;  5HLV A;  3DD4 A;  3BQ3 A;  2D8N A;  1MUX A;  1L7Z A;  1N2D A;  3A4U B;  4ORB B;  3TUY B;  2KGB C;  3ICB A;  1H8B A;  1QAS A;  1M39 A;  2LMV A;  3TS5 B;  1FBV A;  1OMV A;  1LXF C;  1SYM A;  1Y0V H;  4AOM A;  1U5I A;  1TNX A;  1H4B A;  1OMD A;  2K7B A;  2COL B;  4MEW A;  1QTX A;  1A75 A;  1UHN A;  3SIA A;  1DJI A;  3TDU A;  1FPW A;  1V1G A;  1V1F A;  1SY9 A;  1PK0 D;  3GK1 A;  5CSN A;  1IJ6 A;  1XA5 A;  2LHL A;  2LP2 A;  2JZI A;  4OVN F;  3JTD C;  1F4O A;  1KFU S;  1DJH A;  1RTP 1;  2WOS A;  4OCI A;  4AQI A;  1TNQ A;  1MWN A;  1RRO A;  2OTG C;  1LA3 A;  4PHM A;  1NCY A;  4DCK A;  2JXL A;  1BT6 A;  3ZWH A;  1K90 D;  1EXR A;  3LCP C;  1HT9 A;  1SR6 C;  3AAK A;  3DVM A;  1ZMZ A;  2MA2 A;  2KBI A;  4YBH B;  1PRW A;  2M3W A;  2EGD A;  1TN4 A;  2KQ6 A;  1YX8 A;  3PLF B;  3AKA A;  5CSJ A;  5PAL A;  4DUQ A;  3EVV A;  4YGC B;  2KFF A;  1XVJ A;  1YUU A;  1KWO B;  3FWB A;  2I2R E;  5DKQ A;  1B4C A;  2Y5I A;  3DF0 A;  1BLQ A;  2WCE A;  1YTZ C;  2WCF A;  5J3X A;  5CPV A;  3EKJ A;  2MLF C;  1UP5 A;  2CBL A;  1K2H A;  3I5G B;  1CNP A;  2NLN A;  1DJX A;  3I5I C;  2RGI A;  3NSO A;  2FOT A;  2EHB A;  1Y1A A;  1KK8 C;  3WHT B;  2H2K A;  1A2X A;  3WNX B;  2NZ0 A;  4NDD A;  4P5O E;  3BXK A;  3EK7 A;  3I5H C;  4HRE E;  2H61 C;  4DIR A;  1SW8 A;  5F6T A;  2BKI B;  3CWG A;  2BBM A;  1QLK A;  4GPL B;  4XJK B;  1AUI B;  4I5N B;  1N0Y A;  1MXL C;  3NSK A;  1DJW A;  1CB1 A;  1RFJ A;  2KFG A;  1B47 A;  3O6B A;  1J7Q A;  1NIW A;  1IG5 A;  2H61 A;  2L98 A;  3OB1 B;  1EG3 A;  3FWC A;  1A4P A;  1S1E A;  4GFT A;  1KSM A;  3DVK A;  3KHE A;  1PUL A;  2MAZ A;  1J55 A;  4E68 A;  1WRL A;  2CXJ A;  1K94 A;  3LL8 B;  1NYA A;  1SRA A;  2BCA A;  1F70 A;  1YUS A;  2MRD A;  2F2O A;  2QAC A;  1IGV A;  1YVL A;  2KDH A;  1MQ1 A;  1B9A A;  1NWD A;  4TNC A;  3IF7 A;  1LKJ A;  4MZJ A;  2JOJ A;  1K9U A;  2ZFD A;  4GAO A;  1DGV A;  1NCX A;  1TRF A;  1IWQ A;  1XK4 C;  2JT3 A;  1DF0 A;  4PE4 A;  3SG7 A;  4DRW A;  1S6I A;  2L0P A;  1QVI Y;  3CR4 X;  5HLO A;  4HRG A;  1JUO A;  2LVI A;  1L2O C;  2KOT A;  1QXP A;  1S5G Z;  5JOL A;  1F55 A;  1C07 A;  1QX2 A;  1XO5 A;  1NCZ A;  3O78 A;  3BOW B;  2JT8 A;  4IL1 A;  5G08 A;  3CTN A;  1XK4 A;  1QX5 B;  3EKH A;  3PM8 A;  1TNP A;  4QJ5 B;  2LC5 A;  1QIV A;  3CZT X;  1AK8 A;  1NP8 A;  1ZUZ A;  2KFH A;  2TN4 A;  1CDN A;  1SL7 A;  2EC6 B;  3HCM A;  4C0L A;  2BBN A;  2QPT A;  3WHU B;  4D1E A;  2JRF A;  1JWD A;  2F3Z A;  1QS7 A;  1WLZ A;  2JXC A;  2K0J A;  3PAT A;  1E8A A;  4YGE B;  3SG2 A;  3RLZ A;  1LVC D;  3OB2 B;  1A29 A;  2M1K B;  3ZNI A;  4A4C A;  1TNW A;  1IRJ A;  2K7D A;  2KI4 C;  1ODB A;  1B7T Y;  1CLB A;  2M1U A;  1SBJ A;  2F33 A;  2HPS A;  1CFP A;  1F71 A;  1BOC A;  2M29 A;  4NQG A;  2JT0 A;  2NXQ A;  1PAL A;  1AHR A;  1CDP A;  1IKU A;  4M2Q A;  1EJ3 A;  2L50 A;  1B8R A;  1UHI A;  2I94 A;  2VRG A;  3DVE A;  3JVT C;  2JUL A;  3MSE B;  5IBW A;  1OE9 B;  2KAY A;  1J7P A;  3C1V A;  3I5G C;  1DTL A;  3KO0 A;  4Q04 A;  3BUO B;  2BEC A;  4BY4 A;  2LE9 B;  2GV5 A;  1CDL A;  1RJV A;  1ALW A;  4CFQ A;  1DJZ A;  1KCY A;  2F3Y A;  1QLS A;  1NPQ A;  1TCF A;  4M2P A;  2KHN A;  3BUX B;  2FCE A;  4HSZ A;  4PDZ A;  3SG5 A;  2FCD A;  2LMU A;  2WOR A;  5I2Q A;  2LLT A;  1KSO A;  2E30 A;  2O5G A;  1M45 A;  3VRR A;  3EK8 A;  2HF5 A;  3LK0 A;  1K96 A;  4CID A;  2JTT A;  2M0R A;  1K95 A;  2O60 A;  3TZ1 A;  2PAS A;  2DOQ A;  1NX2 A;  1IQ5 A;  2GGZ A;  1JF0 A;  1OQP A;  4PHK A;  1CFC A;  3D0Y A;  2PMY A;  1NX1 A;  2KAX A;  4MSP A;  3TDI A;  4ICB A;  4PE1 A;  1LIN A;  1DMO A;  1QVI Z;  1K9K A;  2Q91 A;  2BL0 B;  1U5I B;  1GGW A;  2PVB A;  1KK7 Y;  3EK4 A;  1A75 B;  1WDC C;  4YRU A;  2GGM A;  2OS8 B;  1JC2 A;  3PSR A;  4USL A;  4YGA A;  1Y6W A;  1NUB A;  1WY9 A;  1UUR A;  4OKH A;  1KQM B;  1MF8 B;  1PSR A;  1R6P A;  4AQJ A;  2KYF A;  3IQO A;  2L4I A;  2BKH B;  1QV1 A;  2M97 A;  2ZN8 A;  3E3R A;  1S36 A;  4OR9 B;  2R2I A;  3JTD B;  1CDM A;  5AEQ A;  1MXE A;  4A4B A;  5FYX A;  5AER A;  1KFX L;  1EG4 A;  2JQ6 A;  2B1U A;  1R2U A;  4FQO A;  5D69 A;  1PSB A;  1OZO A;  2LUX A;  4PE0 A;  2HQW A;  3I5F B;  5I8N A;  3O4Y A;  5ER4 X;  4GGF C;  1SR6 B;  1D1O A;  1XFZ O;  4FTG A;  1AJ4 A;  1SCM C;  3VRP A;  2LAN A;  2M49 B;  3LLE A;  4MVF A;  3KF9 A;  1N65 A;  3DF0 B;  1DJY A;  5I2O A;  1A03 A;  3CS1 A;  2LV7 A;  4MRX A;  2ZKM X;  2SAS A;  3GK2 A;  2BCX A;  1GQM A;  1SPY A;  5CSF A;  3WXA A;  3EVR A;  2EC6 C;  4GGF A;  1IH0 A;  1BR1 B;  1WRK A;  5KTY A;  5AAN A;  2KAV A;  3TUY C;  4QJ4 B;  2Q4U A;  3CGA A;  3OX6 A;  3HX4 A;  4CPV A;  4QJ3 B;  1K93 D;  2L2E A;  3TS5 C;  4JQ0 D;  1PVA A;  4PCW A;  3LK1 A;  4HRH A;  4YGB B;  4YI8 A;  1UUS A;  2K8M B;  1TTX A;  1K8U A;  1KK8 B;  4MBE A;  1PVB A;  1SKT A;  5GQQ C;  1MR8 A;  4C0J A;  1QAT A;  5HKZ A;  2F8P A;  1XFU O;  2KI6 C;  4BY5 A;  1K9P A;  3NSL A;  1G33 A;  3I5H B;  2G2B A;  2KNE A;  1DVI A;  2LUC A;  1UHH A;  1VRK A;  1RK9 A;  2ZRT A;  3OHM B;  1KK7 Z;  2V53 A;  3K21 A;  4WQ3 A;  3CLN A;  3VGO A;  4WRI A;  2LMT A;  2JNF A;  2PSR A;  2L51 A;  4NDB A;  2L5X B;  3D10 A;  5BPJ A;  4ORC B;  1BJF A;  4GGN A;  3PFV A;  1AVS A;  2A4J A;  5HKY A;  1SK6 D;  2JC2 A;  4L9M A;  4F0Z B;  2K7C A;  2LVJ A;  1J1E A;  1EL4 A;  2L4H A;  2ZN9 A;  3GK4 X;  4N1F A;  1KWO C;  3SIB A;  3PN7 B;  4XYN A;  2WND A;  4ETO A;  3BYA A;  1XFV O;  1M63 B;  4M2O A;  1DGU A;  1DF0 B;  2KGR A;  4N5X A;  5DKN A;  2ISD A;  4YI9 A;  3H4S E;  2M7N A;  2BL0 C;  1ZFS A;  1F8H A;  3O2P A;  2K2F A;  4DS7 A;  2I7A A;  3SG3 A;  3TDZ A;  1KFX S;  1S3P A;  2OS8 C;  2M7L A;  1BF5 A;  5KSZ A;  3KEV A;  4JPZ B;  1CTR A;  1G4Y R;  2E6W A;  2BE4 A;  4ZCV A;  3RM1 A;  5JJG A;  1KQM C;  2PAL A;  1XFX O;  1JBA A;  2KQY A;  5ER5 A;  1L2O B;  1FI5 A;  5AFP A;  1CM4 A;  4WQ2 A;  3PAL A;  2FJU B;  1YVH A;  2CCM A;  2LAP A;  1ALV A;  1GJY A;  1CFD A;  1TIZ A;  2BE6 A;  4MZL A;  1BMO A;  1REC A;  2K7O A;  2LCP A;  1Q80 A;  2JTZ A;  2MJW B;  2LP3 A;  4NDC A;  2Y1M A;  2KBM A;  2LHI A;  2LM5 A;  4N1G A;  1OOJ A;  2I18 A;  5AXI A;  4R1E A;  1FW4 A;  1EH2 A;  1DJG A;  1UWO A;  2AUC A;  2LLU A;  3SG4 A;  1JF2 A;  2MLE C;  4PAL A;  5D7F A;  4ZCU A;  3NSI A;  4UPG A;  4C0K A;  1SL8 A;  1X02 A;  1BG1 A;  3I5F C;  1IJ5 A;  1J1D A;  1MHO A;  1Y1X A;  5CSI A;  1CM1 A;  2MBX A;  1B1G A;  1OZS A;  3SJS A;  1TCO B;  1BU3 A;  4XJK A;  2NCO A;  1DT7 B;  2JNX A;  1QIW A;  1GGZ A;  3CR5 X;  2Y4Q A;  2KI4 B;  2LNK A;  2CT9 A;  1CFF A;  1CMG A;  4MN0 A;  1S5G Y;  1SNL A;  4GUK A;  5HYD A;  4I5K A;  1RWY A;  2JWW A;  2IS9 A;  3EVU A;  1JSA A;  3VRO A;  1BOD A;  2PRU A;  1Y1U A;  2LLS A;  3JVT B;  2WC8 A;  2M9G A;  3BUN B;  4I5J A;  1G8I A;  3M0W A;  1YUR A;  2ZND A;  2OTG B;  1W7J B;  2Y1N A;  1J7O A;  1UHK A;  5TNC A;  2NCP A;  1ZOT B;  2JPT A;  2SCP A;  1B7T Z;  3NXA A;  2ZNE A;  1XFW O;  4CLN A;  1KQV A;  2AMI A;  3D0Y B;  1XFY O;  3DVJ A;  1YUT A;  5DKR A;  4GNK B;  5B8I B;  1NX3 A;  3CR2 A;  4I5L B;  1SL9 A;  1SMG A;  2KSP A;  1KFU L;  2CTN A;  1M31 A;  3BOW A;  5KU1 A;  1BR4 B;  1WRZ A;  2MHH A; 
#chains in the Genus database with same CATH topology
 1T14 A;  1HQV A;  1W7I B;  1ZAC A;  3GOF A;  3IQQ A;  3KPX A;  4P2Y B;  3OP0 A;  1B8C A;  3BFB A;  1DC1 A;  2OPO A;  2KYC A;  4PHN A;  1SCV A;  1JFJ A;  2WCB A;  1YR5 A;  2LVV A;  1OOF A;  3I5I B;  1FI6 A;  1WDC B;  1XYD A;  2KLD A;  2P6B B;  4JWQ A;  4MLW A;  3A8R A;  3AAJ A;  1JFK A;  1TOP A;  3PN7 C;  3AKB A;  1OW4 A;  1C7V A;  2ZRS A;  2HET A;  2KPH A;  4OV2 A;  3SG6 A;  2BCB A;  1AJ5 A;  1NX0 A;  1C7W A;  1S6C A;  1YX7 A;  1YRT B;  2QEB A;  2AAO A;  4MZK A;  2LVK A;  4MRY A;  1WLM A;  2M8U A;  1QX7 A;  2K2A A;  2JU0 A;  3VRN A;  2P70 A;  1FF1 A;  1OSA A;  2WCH A;  1NSH A;  4U8D A;  1AP4 A;  5I2L A;  1B8L A;  2CNP A;  3FIA A;  3FS7 A;  1F4Q A;  1S26 D;  1YRU B;  1OMR A;  1QV0 A;  3QRX A;  5HKW A;  5K89 A;  1M46 A;  3DYE A;  1F54 A;  5I94 A;  1IQ3 A;  2K61 A;  4CFR A;  2F2P A;  4ORA B;  3BUW B;  1SCM B;  3F45 A;  1CLL A;  2G9B A;  3OX5 A;  4PT1 A;  4YGD B;  1J7R A;  1CKK A;  2HQ8 A;  1CLM A;  1S6J A;  4PHJ A;  4PE7 A;  1ORG A;  1CMF A;  4GBA A;  5FI6 A;  1UHJ A;  1LA0 A;  1QJT A;  3VRQ A;  4KYN A;  3BUM B;  2KI6 D;  5HLV A;  3DD4 A;  3BQ3 A;  2D8N A;  1MUX A;  1L7Z A;  3N7H A;  1N2D A;  3A4U B;  4ORB B;  3TUY B;  2KGB C;  4OZD A;  3NGV A;  3ICB A;  1H8B A;  2QEV A;  1QAS A;  1M39 A;  2LMV A;  3TS5 B;  1FBV A;  1OMV A;  2GTE A;  1LXF C;  1SYM A;  1Y0V H;  4AOM A;  1U5I A;  1TNX A;  1H4B A;  1OMD A;  2K7B A;  2COL B;  4MEW A;  1TUZ A;  1QTX A;  1A75 A;  1UHN A;  5EL2 A;  1DJI A;  3SIA A;  3TDU A;  1V1G A;  3CAB A;  1FPW A;  1V1F A;  1SY9 A;  1PK0 D;  3GK1 A;  5CSN A;  1IJ6 A;  1XA5 A;  2LHL A;  2LP2 A;  2JZI A;  3FE9 A;  4OVN F;  3O4X A;  3JTD C;  1F4O A;  1KFU S;  1DJH A;  1RTP 1;  2WOS A;  4OCI A;  4AQI A;  1TNQ A;  1MWN A;  1RRO A;  2OTG C;  1LA3 A;  4PHM A;  1NCY A;  4DCK A;  2JXL A;  1BT6 A;  3ZWH A;  1DEL A;  1K90 D;  1EXR A;  3LCP C;  3S0E A;  1HT9 A;  1SR6 C;  3AAK A;  3DVM A;  1ZMZ A;  2MA2 A;  2KBI A;  4YBH B;  1PRW A;  2M3W A;  2EGD A;  1TN4 A;  2KQ6 A;  1YX8 A;  3PLF B;  3AKA A;  5CSJ A;  5PAL A;  4DUQ A;  2L2C A;  2WC6 A;  3EVV A;  4YGC B;  2KFF A;  1XVJ A;  2WCL A;  1YUU A;  1KWO B;  1SSE B;  3FWB A;  2I2R E;  5DKQ A;  2QEH A;  1B4C A;  2Y5I A;  3DF0 A;  1BLQ A;  2WCE A;  1YTZ C;  2WCF A;  5J3X A;  5CPV A;  3EKJ A;  2MLF C;  1UP5 A;  2CBL A;  1K2H A;  3I5G B;  1CNP A;  2NLN A;  1DJX A;  3I5I C;  2RGI A;  3NSO A;  2FOT A;  2EHB A;  1Y1A A;  1KK8 C;  3WHT B;  2H2K A;  1A2X A;  3WNX B;  2NZ0 A;  4NDD A;  4P5O E;  3BXK A;  3EK7 A;  3I5H C;  4HRE E;  2H61 C;  3SS5 A;  4DIR A;  1SW8 A;  5F6T A;  2BKI B;  3CWG A;  2BBM A;  1QLK A;  4GPL B;  3R1P A;  4XJK B;  1AUI B;  4I5N B;  1N0Y A;  1MXL C;  3NSK A;  1DJW A;  1CB1 A;  1RFJ A;  2KFG A;  1B47 A;  3O6B A;  3V2L A;  1J7Q A;  1NIW A;  3S0G A;  1IG5 A;  2H61 A;  2L98 A;  3OB1 B;  1EG3 A;  1W9Z A;  3FWC A;  1A4P A;  1S1E A;  4GFT A;  1KSM A;  3BFH A;  3DVK A;  3KHE A;  1PUL A;  2MAZ A;  1J55 A;  3NHT A;  1WRL A;  2CXJ A;  1K94 A;  3LL8 B;  4E68 A;  1NYA A;  1SRA A;  2BCA A;  1F70 A;  1YUS A;  2MRD A;  2F2O A;  2QAC A;  3DXL A;  1IGV A;  3PJI A;  3D74 A;  1YVL A;  2KDH A;  3UNW A;  1MQ1 A;  1B9A A;  1NWD A;  4TNC A;  3IF7 A;  1LKJ A;  4MZJ A;  2JOJ A;  3L4L A;  1K9U A;  2ZFD A;  1DQE A;  4GAO A;  1DGV A;  1NCX A;  1XK4 C;  1IWQ A;  1C3Z A;  1TRF A;  1DF0 A;  2JT3 A;  4PE4 A;  3SG7 A;  1S6I A;  4DRW A;  2L0P A;  1QVI Y;  3CR4 X;  5HLO A;  3L4A A;  4HRG A;  1JUO A;  2LVI A;  3B7A A;  3B88 A;  1L2O C;  2KLE A;  2KOT A;  1QXP A;  3EG5 B;  1S5G Z;  5JOL A;  1F55 A;  1C07 A;  1QX2 A;  1XO5 A;  1NCZ A;  2PQL A;  3BOW B;  2JT8 A;  3O78 A;  1C3Y A;  4IL1 A;  2YGU A;  5G08 A;  3CTN A;  1XK4 A;  1QX5 B;  3EKH A;  3PM8 A;  1TNP A;  4QJ5 B;  2LC5 A;  1QIV A;  3K1E A;  3CZT X;  1AK8 A;  1NP8 A;  3CYZ A;  1ZUZ A;  3D73 A;  2KFH A;  2TN4 A;  1CDN A;  1SL7 A;  2EC6 B;  3HCM A;  4IJ7 A;  2BBN A;  2QPT A;  3WHU B;  4C0L A;  2JRF A;  4D1E A;  2F3Z A;  1JWD A;  1QS7 A;  1WLZ A;  2JXC A;  3BFA A;  2K0J A;  3PAT A;  1E8A A;  4YGE B;  3SG2 A;  3RLZ A;  1LVC D;  3OB2 B;  1A29 A;  2M1K B;  3QME A;  5FI7 A;  3ZNI A;  4A4C A;  1TNW A;  1IRJ A;  2WCJ A;  2K7D A;  3R1O A;  2KI4 C;  1ODB A;  2WCK A;  1B7T Y;  2L5Y A;  1CLB A;  2M1U A;  1SBJ A;  2F33 A;  2HPS A;  1CFP A;  1F71 A;  1BOC A;  2M29 A;  4NQG A;  2JT0 A;  2NXQ A;  1PAL A;  5HL1 A;  1AHR A;  1CDP A;  1IKU A;  4M2Q A;  1EJ3 A;  2L50 A;  1B8R A;  1UHI A;  2I94 A;  2VRG A;  3DVE A;  3JVT C;  2JUL A;  3MSE B;  5IBW A;  1OE9 B;  2KAY A;  1J7P A;  3C1V A;  3I5G C;  1DTL A;  3KO0 A;  4Q04 A;  3BUO B;  2BEC A;  4BY4 A;  2LE9 B;  2GV5 A;  1CDL A;  1RJV A;  1ALW A;  4CFQ A;  5DIC A;  1DJZ A;  1KCY A;  2F3Y A;  1QLS A;  1NPQ A;  1TCF A;  4M2P A;  2KHN A;  3BUX B;  3OGN A;  2FCE A;  4HSZ A;  4PDZ A;  3SG5 A;  2FCD A;  3SS3 A;  2LMU A;  4JD9 A;  2WOR A;  5I2Q A;  2LLT A;  1KSO A;  2PYQ A;  2E30 A;  2O5G A;  1M45 A;  3VRR A;  3EK8 A;  2HF5 A;  3BJH A;  3LK0 A;  1K96 A;  4CID A;  2JTT A;  2M0R A;  1K95 A;  2O60 A;  3TZ1 A;  2PAS A;  2DOQ A;  1NX2 A;  1IQ5 A;  2GGZ A;  1JF0 A;  1OQP A;  4PHK A;  1CFC A;  3D0Y A;  2PMY A;  1NX1 A;  4F7F A;  3S0A A;  3S0D A;  2KAX A;  4MSP A;  3TDI A;  4ICB A;  4PE1 A;  1LIN A;  3R1V A;  1DMO A;  1QVI Z;  1K9K A;  2Q91 A;  2BL0 B;  1U5I B;  1GGW A;  2PVB A;  1TWO A;  1KK7 Y;  1DEK A;  1A75 B;  3EK4 A;  1WDC C;  4YRU A;  2GGM A;  2OS8 B;  1JC2 A;  3PSR A;  4USL A;  4INW A;  4YGA A;  1Y6W A;  4FQT A;  1NUB A;  1WY9 A;  1UUR A;  4OKH A;  1KQM B;  1MF8 B;  4JKT A;  1PSR A;  3VB1 A;  1R6P A;  4AQJ A;  2KYF A;  3IQO A;  2L4I A;  2BKH B;  1QV1 A;  2M97 A;  2ZN8 A;  3E3R A;  1S36 A;  4OR9 B;  2R2I A;  3JTD B;  1CDM A;  5AEQ A;  3B86 A;  1MXE A;  4A4B A;  1OOI X;  2P71 A;  5FYX A;  5AER A;  1KFX L;  1EG4 A;  2JQ6 A;  2B1U A;  1R2U A;  4FQO A;  5D69 A;  1PSB A;  1OZO A;  1Z4H A;  2LUX A;  4PE0 A;  2HQW A;  3I5F B;  5I8N A;  3O4Y A;  5ER4 X;  4GGF C;  1SR6 B;  1D1O A;  1XFZ O;  4FTG A;  1AJ4 A;  1SCM C;  2ERB A;  2LAN A;  3VRP A;  1XFR A;  2M49 B;  3LLE A;  4MVF A;  3KF9 A;  1N65 A;  3B87 A;  1DJY A;  3DF0 B;  5I2O A;  1A03 A;  3CS1 A;  2LV7 A;  4MRX A;  4NDC A;  3CZ1 A;  2ZKM X;  2SAS A;  3GK2 A;  2BCX A;  1GQM A;  1SPY A;  5CSF A;  3WXA A;  3EVR A;  2EC6 C;  4GGF A;  1IH0 A;  1BR1 B;  1WRK A;  5KTY A;  5AAN A;  2KAV A;  3TUY C;  3RZS A;  4QJ4 B;  2Q4U A;  3CGA A;  3OX6 A;  3HX4 A;  4CPV A;  2K60 A;  4QJ3 B;  1K93 D;  2L2E A;  3TS5 C;  4JQ0 D;  1PVA A;  3L47 A;  4PCW A;  3LK1 A;  4HRH A;  4YGB B;  4YI8 A;  1UUS A;  2K8M B;  1TTX A;  1K8U A;  1KK8 B;  4MBE A;  1PVB A;  1SKT A;  5GQQ C;  1MR8 A;  4C0J A;  1QAT A;  3Q8I A;  5HKZ A;  2F8P A;  1XFU O;  2KI6 C;  2QEO A;  4BY5 A;  1K9P A;  1OOH A;  3NSL A;  1G33 A;  1TUJ A;  3I5H B;  2G2B A;  2KNE A;  1DVI A;  2LUC A;  1UHH A;  1VRK A;  1RK9 A;  2ZRT A;  3OHM B;  1KK7 Z;  2V53 A;  3K21 A;  4WQ3 A;  3CLN A;  3D76 A;  3VGO A;  1QWV A;  1Z2C B;  4WRI A;  2LMT A;  2JNF A;  2PSR A;  2L51 A;  4NDB A;  2L5X B;  3D10 A;  5BPJ A;  4ORC B;  1P28 A;  3S0B A;  1BJF A;  4GGN A;  3PFV A;  1AVS A;  2A4J A;  3CDN A;  5HKY A;  1SK6 D;  2JC2 A;  4L9M A;  4F0Z B;  2FJY A;  2K7C A;  2LVJ A;  2JPO A;  1J1E A;  1EL4 A;  2L4H A;  2ZN9 A;  3GK4 X;  4N1F A;  1KWO C;  3SIB A;  3PN7 B;  4XYN A;  2WND A;  4ETO A;  3BYA A;  1XFV O;  1M63 B;  4M2O A;  1DGU A;  1DF0 B;  2KGR A;  3D78 A;  4N5X A;  5DKN A;  2ISD A;  4YI9 A;  3H4S E;  2M7N A;  2BL0 C;  1ZFS A;  1F8H A;  3O2P A;  2K2F A;  2WCM A;  4DS7 A;  2I7A A;  3SG3 A;  3TDZ A;  1KFX S;  1S3P A;  3CZ2 A;  2OS8 C;  2M7L A;  1BF5 A;  5KSZ A;  3KEV A;  4JPZ B;  1CTR A;  1G4Y R;  2BNX A;  2E6W A;  2BE4 A;  4ZCV A;  3RM1 A;  5JJG A;  1KQM C;  2PAL A;  1XFX O;  1JBA A;  2KQY A;  5ER5 A;  1L2O B;  1FI5 A;  2WC5 A;  5AFP A;  1CM4 A;  4WQ2 A;  3FE6 A;  3PAL A;  2FJU B;  1YVH A;  2CCM A;  2LAP A;  1ALV A;  1GJY A;  1CFD A;  1TIZ A;  2BE6 A;  4MZL A;  1BMO A;  1REC A;  2K7O A;  2LCP A;  1Q80 A;  2JTZ A;  2MJW B;  2BAP A;  2LP3 A;  2Y1M A;  2KBM A;  2LHI A;  2LM5 A;  4N1G A;  1OOJ A;  2I18 A;  3PM2 A;  4R1E A;  1FW4 A;  5AXI A;  1EH2 A;  1DJG A;  1LS8 A;  3SS4 A;  1UWO A;  2AUC A;  3S0F A;  2LLU A;  3SG4 A;  1JF2 A;  2MLE C;  3DZT A;  4PAL A;  5D7F A;  4ZCU A;  3NSI A;  4UPG A;  3OBV A;  1SL8 A;  1X02 A;  4C0K A;  3I5F C;  1BG1 A;  1IJ5 A;  1J1D A;  1MHO A;  1Y1X A;  5CSI A;  1CM1 A;  2MBX A;  1B1G A;  1OZS A;  3SJS A;  1TCO B;  1BU3 A;  3D75 A;  4XJK A;  2NCO A;  1DT7 B;  2JNX A;  1QIW A;  1GGZ A;  3B6X A;  3CR5 X;  2Y4Q A;  2KI4 B;  5FI2 A;  2LNK A;  2CT9 A;  3CZ0 A;  3NHI A;  1CFF A;  1CMG A;  4MN0 A;  1S5G Y;  1SNL A;  3R72 A;  4GUK A;  5HYD A;  4I5K A;  3FE8 A;  1RWY A;  2JWW A;  2IS9 A;  3EVU A;  1JSA A;  3VRO A;  1BOD A;  2PRU A;  1Y1U A;  2LLS A;  3JVT B;  2WC8 A;  2M9G A;  3IVT A;  1OOG A;  3BUN B;  4I5J A;  1G8I A;  3M0W A;  1YUR A;  2ZND A;  2OTG B;  1W7J B;  2Y1N A;  1J7O A;  1UHK A;  4INX A;  5TNC A;  2NCP A;  5D3O A;  1ZOT B;  2JPT A;  2SCP A;  1B7T Z;  3NXA A;  2ZNE A;  1XFW O;  4CLN A;  1KQV A;  2AMI A;  3D77 A;  1IIO A;  3D0Y B;  1XFY O;  3DVJ A;  2QDI A;  1YUT A;  1GM0 A;  5DKR A;  4GNK B;  5B8I B;  1NX3 A;  3CR2 A;  4I5L B;  1SL9 A;  1SMG A;  2KSP A;  1KFU L;  3DY9 A;  2CTN A;  3UO9 A;  1M31 A;  3BOW A;  5KU1 A;  1BR4 B;  1WRZ A;  2H8V A;  2MHH A; 
#chains in the Genus database with same CATH homology
 1ZAC A;  1HQV A;  1W7I B;  3GOF A;  3IQQ A;  3KPX A;  4P2Y B;  3OP0 A;  1B8C A;  2OPO A;  2KYC A;  4PHN A;  1SCV A;  1JFJ A;  2WCB A;  1YR5 A;  2LVV A;  3I5I B;  1FI6 A;  1WDC B;  1XYD A;  2P6B B;  4JWQ A;  4MLW A;  3A8R A;  3AAJ A;  1JFK A;  1TOP A;  3PN7 C;  3AKB A;  1C7V A;  2ZRS A;  2HET A;  4OV2 A;  3SG6 A;  2BCB A;  1AJ5 A;  1NX0 A;  1C7W A;  1S6C A;  1YX7 A;  1YRT B;  2AAO A;  4MZK A;  2LVK A;  4MRY A;  1WLM A;  2M8U A;  1QX7 A;  2K2A A;  2JU0 A;  3VRN A;  1FF1 A;  1OSA A;  1NSH A;  4U8D A;  1AP4 A;  5I2L A;  1B8L A;  2CNP A;  3FIA A;  3FS7 A;  1F4Q A;  1S26 D;  1YRU B;  1OMR A;  1QV0 A;  3QRX A;  5HKW A;  5K89 A;  1M46 A;  1F54 A;  1IQ3 A;  2K61 A;  4CFR A;  2F2P A;  4ORA B;  3BUW B;  1SCM B;  3F45 A;  1CLL A;  2G9B A;  3OX5 A;  4YGD B;  1J7R A;  1CKK A;  2HQ8 A;  1CLM A;  1S6J A;  4PHJ A;  4PE7 A;  1CMF A;  4GBA A;  1UHJ A;  1LA0 A;  1QJT A;  3VRQ A;  3BUM B;  2KI6 D;  5HLV A;  3DD4 A;  3BQ3 A;  2D8N A;  1MUX A;  1L7Z A;  1N2D A;  3A4U B;  4ORB B;  3TUY B;  2KGB C;  3ICB A;  1H8B A;  1QAS A;  1M39 A;  2LMV A;  3TS5 B;  1FBV A;  1OMV A;  1LXF C;  1SYM A;  1Y0V H;  4AOM A;  1U5I A;  1TNX A;  1H4B A;  1OMD A;  2K7B A;  2COL B;  4MEW A;  1QTX A;  1A75 A;  1UHN A;  3SIA A;  1DJI A;  3TDU A;  1FPW A;  1V1G A;  1V1F A;  1SY9 A;  1PK0 D;  3GK1 A;  5CSN A;  1IJ6 A;  1XA5 A;  2LHL A;  2LP2 A;  2JZI A;  4OVN F;  3JTD C;  1F4O A;  1KFU S;  1DJH A;  1RTP 1;  2WOS A;  4OCI A;  4AQI A;  1TNQ A;  1MWN A;  1RRO A;  2OTG C;  1LA3 A;  4PHM A;  1NCY A;  4DCK A;  2JXL A;  1BT6 A;  3ZWH A;  1K90 D;  1EXR A;  3LCP C;  1HT9 A;  1SR6 C;  3AAK A;  3DVM A;  1ZMZ A;  2MA2 A;  2KBI A;  4YBH B;  1PRW A;  2M3W A;  2EGD A;  1TN4 A;  2KQ6 A;  1YX8 A;  3PLF B;  3AKA A;  5CSJ A;  5PAL A;  4DUQ A;  3EVV A;  4YGC B;  2KFF A;  1XVJ A;  1YUU A;  1KWO B;  3FWB A;  2I2R E;  5DKQ A;  1B4C A;  2Y5I A;  3DF0 A;  1BLQ A;  2WCE A;  1YTZ C;  2WCF A;  5J3X A;  5CPV A;  3EKJ A;  2MLF C;  1UP5 A;  2CBL A;  1K2H A;  3I5G B;  1CNP A;  2NLN A;  1DJX A;  3I5I C;  2RGI A;  3NSO A;  2FOT A;  2EHB A;  1Y1A A;  1KK8 C;  3WHT B;  2H2K A;  1A2X A;  3WNX B;  2NZ0 A;  4NDD A;  4P5O E;  3BXK A;  3EK7 A;  3I5H C;  4HRE E;  2H61 C;  4DIR A;  1SW8 A;  5F6T A;  2BKI B;  3CWG A;  2BBM A;  1QLK A;  4GPL B;  4XJK B;  1AUI B;  4I5N B;  1N0Y A;  1MXL C;  3NSK A;  1DJW A;  1CB1 A;  1RFJ A;  2KFG A;  1B47 A;  3O6B A;  1J7Q A;  1NIW A;  1IG5 A;  2H61 A;  2L98 A;  3OB1 B;  1EG3 A;  3FWC A;  1A4P A;  1S1E A;  4GFT A;  1KSM A;  3DVK A;  3KHE A;  1PUL A;  2MAZ A;  1J55 A;  4E68 A;  1WRL A;  2CXJ A;  1K94 A;  3LL8 B;  1NYA A;  1SRA A;  2BCA A;  1F70 A;  1YUS A;  2MRD A;  2F2O A;  2QAC A;  1IGV A;  1YVL A;  2KDH A;  1MQ1 A;  1B9A A;  1NWD A;  4TNC A;  3IF7 A;  1LKJ A;  4MZJ A;  2JOJ A;  1K9U A;  2ZFD A;  4GAO A;  1DGV A;  1NCX A;  1TRF A;  1IWQ A;  1XK4 C;  2JT3 A;  1DF0 A;  4PE4 A;  3SG7 A;  4DRW A;  1S6I A;  2L0P A;  1QVI Y;  3CR4 X;  5HLO A;  4HRG A;  1JUO A;  2LVI A;  1L2O C;  2KOT A;  1QXP A;  1S5G Z;  5JOL A;  1F55 A;  1C07 A;  1QX2 A;  1XO5 A;  1NCZ A;  3O78 A;  3BOW B;  2JT8 A;  4IL1 A;  5G08 A;  3CTN A;  1XK4 A;  1QX5 B;  3EKH A;  3PM8 A;  1TNP A;  4QJ5 B;  2LC5 A;  1QIV A;  3CZT X;  1AK8 A;  1NP8 A;  1ZUZ A;  2KFH A;  2TN4 A;  1CDN A;  1SL7 A;  2EC6 B;  3HCM A;  4C0L A;  2BBN A;  2QPT A;  3WHU B;  4D1E A;  2JRF A;  1JWD A;  2F3Z A;  1QS7 A;  1WLZ A;  2JXC A;  2K0J A;  3PAT A;  1E8A A;  4YGE B;  3SG2 A;  3RLZ A;  1LVC D;  3OB2 B;  1A29 A;  2M1K B;  3ZNI A;  4A4C A;  1TNW A;  1IRJ A;  2K7D A;  2KI4 C;  1ODB A;  1B7T Y;  1CLB A;  2M1U A;  1SBJ A;  2F33 A;  2HPS A;  1CFP A;  1F71 A;  1BOC A;  2M29 A;  4NQG A;  2JT0 A;  2NXQ A;  1PAL A;  1AHR A;  1CDP A;  1IKU A;  4M2Q A;  1EJ3 A;  2L50 A;  1B8R A;  1UHI A;  2I94 A;  2VRG A;  3DVE A;  3JVT C;  2JUL A;  3MSE B;  5IBW A;  1OE9 B;  2KAY A;  1J7P A;  3C1V A;  3I5G C;  1DTL A;  3KO0 A;  4Q04 A;  3BUO B;  2BEC A;  4BY4 A;  2LE9 B;  2GV5 A;  1CDL A;  1RJV A;  1ALW A;  4CFQ A;  1DJZ A;  1KCY A;  2F3Y A;  1QLS A;  1NPQ A;  1TCF A;  4M2P A;  2KHN A;  3BUX B;  2FCE A;  4HSZ A;  4PDZ A;  3SG5 A;  2FCD A;  2LMU A;  2WOR A;  5I2Q A;  2LLT A;  1KSO A;  2E30 A;  2O5G A;  1M45 A;  3VRR A;  3EK8 A;  2HF5 A;  3LK0 A;  1K96 A;  4CID A;  2JTT A;  2M0R A;  1K95 A;  2O60 A;  3TZ1 A;  2PAS A;  2DOQ A;  1NX2 A;  1IQ5 A;  2GGZ A;  1JF0 A;  1OQP A;  4PHK A;  1CFC A;  3D0Y A;  2PMY A;  1NX1 A;  2KAX A;  4MSP A;  3TDI A;  4ICB A;  4PE1 A;  1LIN A;  1DMO A;  1QVI Z;  1K9K A;  2Q91 A;  2BL0 B;  1U5I B;  1GGW A;  2PVB A;  1KK7 Y;  3EK4 A;  1A75 B;  1WDC C;  4YRU A;  2GGM A;  2OS8 B;  1JC2 A;  3PSR A;  4USL A;  4YGA A;  1Y6W A;  1NUB A;  1WY9 A;  1UUR A;  4OKH A;  1KQM B;  1MF8 B;  1PSR A;  1R6P A;  4AQJ A;  2KYF A;  3IQO A;  2L4I A;  2BKH B;  1QV1 A;  2M97 A;  2ZN8 A;  3E3R A;  1S36 A;  4OR9 B;  2R2I A;  3JTD B;  1CDM A;  5AEQ A;  1MXE A;  4A4B A;  5FYX A;  5AER A;  1KFX L;  1EG4 A;  2JQ6 A;  2B1U A;  1R2U A;  4FQO A;  5D69 A;  1PSB A;  1OZO A;  2LUX A;  4PE0 A;  2HQW A;  3I5F B;  5I8N A;  3O4Y A;  5ER4 X;  4GGF C;  1SR6 B;  1D1O A;  1XFZ O;  4FTG A;  1AJ4 A;  1SCM C;  3VRP A;  2LAN A;  2M49 B;  3LLE A;  4MVF A;  3KF9 A;  1N65 A;  3DF0 B;  1DJY A;  5I2O A;  1A03 A;  3CS1 A;  2LV7 A;  4MRX A;  2ZKM X;  2SAS A;  3GK2 A;  2BCX A;  1GQM A;  1SPY A;  5CSF A;  3WXA A;  3EVR A;  2EC6 C;  4GGF A;  1IH0 A;  1BR1 B;  1WRK A;  5KTY A;  5AAN A;  2KAV A;  3TUY C;  4QJ4 B;  2Q4U A;  3CGA A;  3OX6 A;  3HX4 A;  4CPV A;  4QJ3 B;  1K93 D;  2L2E A;  3TS5 C;  4JQ0 D;  1PVA A;  4PCW A;  3LK1 A;  4HRH A;  4YGB B;  4YI8 A;  1UUS A;  2K8M B;  1TTX A;  1K8U A;  1KK8 B;  4MBE A;  1PVB A;  1SKT A;  5GQQ C;  1MR8 A;  4C0J A;  1QAT A;  5HKZ A;  2F8P A;  1XFU O;  2KI6 C;  4BY5 A;  1K9P A;  3NSL A;  1G33 A;  3I5H B;  2G2B A;  2KNE A;  1DVI A;  2LUC A;  1UHH A;  1VRK A;  1RK9 A;  2ZRT A;  3OHM B;  1KK7 Z;  2V53 A;  3K21 A;  4WQ3 A;  3CLN A;  3VGO A;  4WRI A;  2LMT A;  2JNF A;  2PSR A;  2L51 A;  4NDB A;  2L5X B;  3D10 A;  5BPJ A;  4ORC B;  1BJF A;  4GGN A;  3PFV A;  1AVS A;  2A4J A;  5HKY A;  1SK6 D;  2JC2 A;  4L9M A;  4F0Z B;  2K7C A;  2LVJ A;  1J1E A;  1EL4 A;  2L4H A;  2ZN9 A;  3GK4 X;  4N1F A;  1KWO C;  3SIB A;  3PN7 B;  4XYN A;  2WND A;  4ETO A;  3BYA A;  1XFV O;  1M63 B;  4M2O A;  1DGU A;  1DF0 B;  2KGR A;  4N5X A;  5DKN A;  2ISD A;  4YI9 A;  3H4S E;  2M7N A;  2BL0 C;  1ZFS A;  1F8H A;  3O2P A;  2K2F A;  4DS7 A;  2I7A A;  3SG3 A;  3TDZ A;  1KFX S;  1S3P A;  2OS8 C;  2M7L A;  1BF5 A;  5KSZ A;  3KEV A;  4JPZ B;  1CTR A;  1G4Y R;  2E6W A;  2BE4 A;  4ZCV A;  3RM1 A;  5JJG A;  1KQM C;  2PAL A;  1XFX O;  1JBA A;  2KQY A;  5ER5 A;  1L2O B;  1FI5 A;  5AFP A;  1CM4 A;  4WQ2 A;  3PAL A;  2FJU B;  1YVH A;  2CCM A;  2LAP A;  1ALV A;  1GJY A;  1CFD A;  1TIZ A;  2BE6 A;  4MZL A;  1BMO A;  1REC A;  2K7O A;  2LCP A;  1Q80 A;  2JTZ A;  2MJW B;  2LP3 A;  4NDC A;  2Y1M A;  2KBM A;  2LHI A;  2LM5 A;  4N1G A;  1OOJ A;  2I18 A;  5AXI A;  4R1E A;  1FW4 A;  1EH2 A;  1DJG A;  1UWO A;  2AUC A;  2LLU A;  3SG4 A;  1JF2 A;  2MLE C;  4PAL A;  5D7F A;  4ZCU A;  3NSI A;  4UPG A;  4C0K A;  1SL8 A;  1X02 A;  1BG1 A;  3I5F C;  1IJ5 A;  1J1D A;  1MHO A;  1Y1X A;  5CSI A;  1CM1 A;  2MBX A;  1B1G A;  1OZS A;  3SJS A;  1TCO B;  1BU3 A;  4XJK A;  2NCO A;  1DT7 B;  2JNX A;  1QIW A;  1GGZ A;  3CR5 X;  2Y4Q A;  2KI4 B;  2LNK A;  2CT9 A;  1CFF A;  1CMG A;  4MN0 A;  1S5G Y;  1SNL A;  4GUK A;  5HYD A;  4I5K A;  1RWY A;  2JWW A;  2IS9 A;  3EVU A;  1JSA A;  3VRO A;  1BOD A;  2PRU A;  1Y1U A;  2LLS A;  3JVT B;  2WC8 A;  2M9G A;  3BUN B;  4I5J A;  1G8I A;  3M0W A;  1YUR A;  2ZND A;  2OTG B;  1W7J B;  2Y1N A;  1J7O A;  1UHK A;  5TNC A;  2NCP A;  1ZOT B;  2JPT A;  2SCP A;  1B7T Z;  3NXA A;  2ZNE A;  1XFW O;  4CLN A;  1KQV A;  2AMI A;  3D0Y B;  1XFY O;  3DVJ A;  1YUT A;  5DKR A;  4GNK B;  5B8I B;  1NX3 A;  3CR2 A;  4I5L B;  1SL9 A;  1SMG A;  2KSP A;  1KFU L;  2CTN A;  1M31 A;  3BOW A;  5KU1 A;  1BR4 B;  1WRZ A;  2MHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...