3NXAA

X-ray structure of the apo form of human s100a16
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
100
structure length
100
Chain Sequence
DCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A16
publication title Structural characterization of human S100A16, a low-affinity calcium binder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 32
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nxaA00
1BR1B 1QJTA 2LP2A 2BL0C 2LNKA 5D69A 1CLLA 1DJIA 2Y4QA 1SL7A 3DD4A 3IF7A 2OTGB 4P2YB 3WHUB 4MRXA 1NX3A 1F55A 3MSEB 3LK0A 3JTDB 2ZNEA 1M45A 1Y1AA 2KAVA 2LHIA 3KHEA 1XYDA 2M7NA 2PRUA 1MWNA 2BL0B 4BY5A 2H61A 1ZACA 2I2RE 1F8HA 1IG5A 2FOTA 2MJWB 1LA0A 4PE1A 2LE9B 1M39A 1DJXA 1K2HA 1ALWA 2JT3A 4I5KA 2NZ0A 3KPXA 1J7OA 2KI6C 2K0JA 1QASA 2LVJA 1EXRA 1WDCB 3H4SE 5BPJA 1CFCA 1DJZA 2HQ8A 3VRRA 2AMIA 2NXQA 3DVKA 3CLNA 1GJYA 1FI5A 2M3WA 1FW4A 4GGNA 4MRYA 1AK8A 4I5LB 3M0WA 1SL8A 1JF0A 2JULA 1CM4A 4QJ4B 2ZN8A 1V1GA 1IQ5A 4PALA 1NIWA 4QJ3B 3CR5X 1QLSA 3DVJA 1CFPA 1AHRA 1AUIB 1RJVA 1QVIY 1B8RA 2LHLA 1K93D 1OOJA 2O60A 3K21A 1LA3A 2ZRSA 1TOPA 3ZNIA 4A4CA 2L50A 1RK9A 1MUXA 2MLFC 3D10A 3VRNA 1W7IB 3AKAA 4AQIA 1QVIZ 1SCMC 3EK8A 1HQVA 1PSRA 2G9BA 1XFYO 1A29A 3NXAA 1OMRA 1HT9A 4DUQA 3O2PA 1H4BA 4I5NB 4USLA 1G8IA 1QX5B 3TUYC 3PFVA 2JT8A 1UWOA 1J1EA 1CKKA 2CBLA 2L4IA 4MZLA 4OCIA 4R1EA 4C0LA 1TNQA 3RM1A 4XYNA 1NPQA 1TNWA 1SCMB 4ORCB 2BE6A 4CFQA 1RROA 1BT6A 2PSRA 4GGFA 2BKIB 5DKRA 2L5XB 1UHJA 2H2KA 2LAPA 2LLTA 4M2QA 1QIVA 2KYFA 4TNCA 1OZSA 3TUYB 2JXCA 2QACA 2RGIA 3FWBA 2CCMA 1A75A 2M9GA 5DKQA 3BXKA 2KAXA 1BJFA 1CMGA 1OMVA 2I94A 3BUOB 5JOLA 2KFFA 1JF2A 3CR2A 1UHNA 1L7ZA 1JWDA 1NUBA 3BOWA 3BUWB 2LCPA 1FBVA 2LLUA 1XO5A 1U5IA 1YURA 1LINA 3DF0A 4ICBA 3VGOA 3AKBA 1J7PA 1VRKA 4YBHB 2M29A 2LMVA 3FS7A 1N0YA 3E3RA 1KK7Z 2EGDA 2CTNA 1CNPA 5ER4X 1IRJA 1TIZA 3CR4X 5I2LA 2KOTA 1KFXL 1M31A 5AEQA 3TDZA 2M0RA 3LCPC 3OB1B 2CXJA 1B8CA 2MHHA 3SG3A 1AJ4A 1NCZA 2JOJA 2QPTA 3KF9A 4QJ5B 1YRTB 1RECA 1SYMA 2ZKMX 4ORBB 1BOCA 1JFJA 2MAZA 1NX0A 2I18A 4U8DA 2ISDA 3OB2B 2JWWA 1F4QA 4OKHA 2KAYA 4BY4A 1N2DA 1NWDA 2NCOA 1IQ3A 3IQOA 2D8NA 2KYCA 4IL1A 1KFXS 4PHJA 1R2UA 2M49B 2MA2A 4MVFA 2JNFA 3GOFA 4YGEB 2LP3A 1XFZO 3FIAA 2BCAA 4XJKB 1R6PA 2K7DA 1TNPA 2KBMA 1WDCC 2K8MB 2O5GA 1PULA 1CDLA 4YI9A 1XFUO 1QLKA 1FPWA 1NP8A 1QATA 2M1UA 3D0YB 1J7QA 4M2OA 3ICBA 5KU1A 1GGWA 5CPVA 3F45A 1A03A 1K9KA 1KK8C 4GUKA 2LC5A 1KSOA 3TDUA 1SBJA 1L2OC 1WLMA 1DF0B 3CTNA 2KFHA 4NQGA 1B47A 2FCEA 4GPLB 4PDZA 1QX7A 1K95A 1EH2A 1TN4A 2FJUB 3LL8B 3OX5A 5TNCA 4PE7A 1SRAA 3SG2A 1M46A 4UPGA 1PK0D 4AOMA 2ZNDA 2WCFA 2BE4A 1IJ5A 4DS7A 1BMOA 4YI8A 2R2IA 2KI6D 3HX4A 1KK8B 1TRFA 2CT9A 2E30A 1L2OB 1K9PA 2EC6C 3OP0A 1WRKA 2MBXA 5B8IB 3PATA 2BECA 2F3ZA 2JTZA 2LLSA 1LVCD 5J3XA 2AAOA 2H61C 1TNXA 1A4PA 2Y1MA 2KDHA 4P5OE 1LKJA 1QXPA 4WQ2A 4OV2A 3VRPA 2KQYA 1GQMA 4JWQA 2K7BA 5CSNA 1B9AA 1OZOA 2WCEA 2EC6B 2LVVA 1PRWA 5ER5A 1XK4C 1ALVA 4NDCA 3PM8A 2MLEC 1XA5A 3CWGA 1CLBA 1KQVA 1UUSA 5CSIA 1MR8A 1BG1A 3EK4A 1MXLC 1K9UA 3SIAA 4D1EA 1B1GA 4HSZA 1G4YR 1YUSA 4L9MA 2KSPA 2LVKA 3TS5C 2ZFDA 2BBNA 2FCDA 4OVNF 2KNEA 3I5FC 2KI4C 2GV5A 2E6WA 2CNPA 3SG7A 3KEVA 1GGZA 4ETOA 5I2OA 3GK1A 1E8AA 5CSJA 1BU3A 4C0JA 1QV0A 5KTYA 1FI6A 2KFGA 1Q80A 1M63B 1CDPA 1S26D 4E68A 2P6BB 3AAJA 1K90D 1KFUL 4MSPA 4N5XA 4NDBA 3TS5B 3VROA 4YGBB 2HQWA 1BF5A 3I5FB 2KI4B 1YR5A 1DJGA 4DRWA 1KK7Y 3EKHA 1CDNA 1G33A 3VRQA 4MEWA 4NDDA 4PCWA 1B7TY 2F8PA 2KGBC 5HKYA 1XFVO 3AAKA 1QV1A 2KGRA 2JXLA 3SG5A 2K2AA 4I5JA 1B7TZ 1KFUS 4AQJA 2Y5IA 1IGVA 1K8UA 2PALA 1CB1A 3EKJA 3HCMA 4M2PA 2Q4UA 3NSOA 5F6TA 1H8BA 3QRXA 4XJKA 2MRDA 3RLZA 4WQ3A 1NYAA 2HF5A 3OHMB 1KWOC 4ZCUA 2WC8A 1OQPA 2WORA 1J1DA 1YUUA 4MZJA 3D0YA 1SPYA 2GGZA 1DJHA 1SY9A 3NSKA 2AUCA 3PN7C 1RWYA 1F4OA 2K61A 1A75B 1EG3A 4DIRA 1OMDA 1DF0A 1YX8A 2K7CA 1DMOA 4N1FA 3CGAA 4YGDB 1PALA 2PVBA 4CIDA 3ZWHA 2M8UA 5D7FA 4PE4A 1MQ1A 1F54A 1EJ3A 1KWOB 2ZN9A 3EVUA 2L51A 2LUXA 2V53A 3BOWB 1SNLA 4F0ZB 5AANA 3PN7B 1TCFA 1AP4A 1U5IB 1DJYA 1DTLA 1Y1UA 4OR9B 1TTXA 3NSLA 5AERA 1PVAA 1C7VA 1S5GY 3TZ1A 3SG4A 4MLWA 1WLZA 4JQ0D 3BUNB 3TDIA 1V1FA 1S6JA 5HKZA 1UURA 5GQQC 2ZRTA 4CLNA 5IBWA 1SK6D 1MXEA 1QIWA 3OX6A 2LMUA 3EK7A 4HRHA 1X02A 2G2BA 1S5GZ 2BBMA 4Q04A 3SJSA 3WNXB 1NSHA 1SW8A 3SIBA 1QX2A 1CM1A 3LLEA 4WRIA 4CFRA 1SCVA 3DVEA 4FTGA 5I2QA 2IS9A 3FWCA 1QTXA 4YGAA 1PVBA 4GAOA 2BCBA 1OSAA 1RTP1 3A4UB 3EVVA 3JVTC 4PHMA 1DT7B 1DGVA 1XVJA 1IJ6A 2DOQA 1K94A 5JJGA 4GBAA 1SMGA 1BR4B 3WXAA 2SCPA 3A8RA 2K7OA 1WRLA 2F2PA 2PASA 3BQ3A 1MF8B 5HKWA 1XK4A 1A2XA 4DCKA 2NCPA 2LUCA 2F33A 1JFKA 2WOSA 3O78A 3JVTB 1FF1A 2JPTA 4C0KA 1YUTA 4GNKB 1KSMA 1NX2A 1J7RA 1ZFSA 1IH0A 2OS8C 1NX1A 1SL9A 1B8LA 1BLQA 1S1EA 1EL4A 1YVHA 4PHKA 1JC2A 4CPVA 1DGUA 3CS1A 3SG6A 1AJ5A 4YRUA 2KQ6A 1BODA 5CSFA 1D1OA 2Q91A 1YTZC 3I5GC 5HLOA 4A4BA 1ODBA 1C7WA 2PMYA 1OE9B 4YGCB 4MN0A 1S6CA 1ZUZA 1UP5A 2L98A 2OS8B 3WHTB 3PLFB 1SKTA 1YVLA 3KO0A 1SR6C 1ZOTB 1F71A 5FYXA 2JRFA 1KQMC 2JQ6A 1QS7A 2K2FA 5DKNA 1NCXA 2LM5A 2EHBA 3BUXB 5HLVA 2JNXA 2M7LA 1KCYA 1YRUB 3I5GB 1MHOA 4PE0A 3I5IC 2F2OA 5KSZA 3PSRA 3IQQA 4HRGA 1C07A 1JSAA 3GK2A 2COLB 2NLNA 1SR6B 2LMTA 1KQMB 3PALA 3BUMB 2L2EA 2Y1NA 3NSIA 5AFPA 1IKUA 2JZIA 2GGMA 4JPZB 2HETA 4GGFC 3I5IB 1DVIA 2JT0A 1AVSA 4ZCVA 3EVRA 1CTRA 5K89A 2KHNA 2BKHB 1TCOB 4GFTA 1IWQA 1UHIA 3C1VA 1JUOA 2KBIA 1CFDA 1XFWO 2HPSA 3DVMA 2WCBA 2LVIA 4ORAB 1S3PA 1UHKA 1ZMZA 2M1KB 5I8NA 2WNDA 2JC2A 4FQOA 1WRZA 2VRGA 4HREE 1DJWA 1CLMA 2L4HA 1J55A 2A4JA 2TN4A 1S6IA 3I5HC 2L0PA 2JU0A 1CFFA 2LV7A 3O6BA 1LXFC 1UHHA 2F3YA 3CZTX 1EG4A 1N65A 1NCYA 1WY9A 3LK1A 5HYDA 1CMFA 1CDMA 2SASA 1Y1XA 4MZKA 1YX7A 2M97A 3BYAA 1JBAA 2OPOA 5G08A 1W7JB 1F70A 2B1UA 2OTGC 4MBEA 1PSBA 2LANA 1Y6WA 2I7AA 5PALA 1Y0VH 3I5HB 2JTTA 5AXIA 3GK4X 1K96A 1S36A 2BCXA 3DF0B 4PHNA 3JTDC 4N1GA 1B4CA 1XFXO 3O4YA 1RFJA
chains in the Genus database with same CATH superfamily
1BR1B 1QJTA 2LP2A 2BL0C 2LNKA 2QEVA 5D69A 2BAPA 1CLLA 1DJIA 2Y4QA 1SL7A 3DD4A 3IF7A 2OTGB 4P2YB 3WHUB 3DY9A 4MRXA 1NX3A 1F55A 3MSEB 3CZ1A 3LK0A 5FI6A 3JTDB 3FE6A 2ZNEA 1M45A 1Y1AA 2KAVA 1OW4A 2LHIA 3KHEA 1XYDA 2M7NA 2PRUA 1MWNA 2BL0B 4BY5A 1Z4HA 1ZACA 2H61A 2I2RE 3IVTA 1F8HA 3FE8A 1IG5A 2FOTA 2MJWB 4INXA 1LA0A 4PE1A 2LE9B 1M39A 1DJXA 1K2HA 1ALWA 2JT3A 4I5KA 2NZ0A 3KPXA 1J7OA 3SS4A 4INWA 2KI6C 2K0JA 1QASA 2LVJA 1EXRA 1WDCB 3H4SE 5BPJA 1CFCA 1DJZA 2ERBA 2HQ8A 3VRRA 2AMIA 2NXQA 3DVKA 3CLNA 1GJYA 1FI5A 2M3WA 1FW4A 4GGNA 4MRYA 1AK8A 4I5LB 3M0WA 2BNXA 2KPHA 1SL8A 1JF0A 2JULA 1CM4A 4QJ4B 2ZN8A 1V1GA 1IQ5A 4PALA 1NIWA 4QJ3B 3CR5X 1QLSA 3DVJA 1CFPA 1AHRA 1AUIB 1RJVA 1QVIY 1B8RA 2LHLA 1K93D 1OOJA 2O60A 3K21A 1LA3A 2ZRSA 3R1VA 1TOPA 3ZNIA 4A4CA 2L50A 5I94A 1RK9A 1QWVA 1MUXA 3OBVA 2MLFC 3B7AA 3D10A 3VRNA 1W7IB 3UO9A 3AKAA 4AQIA 1QVIZ 1SCMC 3EK8A 1HQVA 1PSRA 2G9BA 1XFYO 1A29A 3NXAA 1OMRA 3R1PA 2WC6A 1HT9A 4DUQA 3O2PA 1H4BA 4I5NB 4USLA 1G8IA 1QX5B 3TUYC 3PFVA 2JT8A 1UWOA 1J1EA 1CKKA 2CBLA 2L4IA 4MZLA 4OCIA 4R1EA 4C0LA 5D3OA 1TNQA 3RM1A 4XYNA 1NPQA 1TNWA 1SCMB 4ORCB 2BE6A 4CFQA 1RROA 1BT6A 2PSRA 4GGFA 2BKIB 5DKRA 1ORGA 2L5XB 1UHJA 2H2KA 2LAPA 2LLTA 1TUZA 4M2QA 1DQEA 1QIVA 2KYFA 4TNCA 1OZSA 3TUYB 3B87A 2FJYA 2JXCA 2QACA 2RGIA 1Z2CB 2CCMA 3FWBA 5EL2A 1A75A 2M9GA 5DKQA 3BXKA 3V2LA 2KAXA 1BJFA 1CMGA 1OMVA 2I94A 3BUOB 5JOLA 2KFFA 1JF2A 3CR2A 1UHNA 1OOHA 1L7ZA 1JWDA 1NUBA 3BOWA 3BUWB 2LCPA 1FBVA 2LLUA 1XO5A 1U5IA 1YURA 1LINA 3BFAA 3DF0A 4ICBA 3VGOA 3AKBA 1DEKA 1J7PA 1VRKA 4YBHB 2M29A 2LMVA 3FS7A 4OZDA 1N0YA 3E3RA 1IIOA 1KK7Z 2EGDA 2CTNA 1CNPA 5ER4X 1IRJA 3SS3A 1TIZA 3CR4X 5I2LA 2KOTA 1KFXL 1M31A 5AEQA 3TDZA 2M0RA 3LCPC 3OB1B 2CXJA 1B8CA 2MHHA 3SG3A 1AJ4A 1NCZA 3S0FA 2JOJA 2QPTA 4KYNA 3KF9A 4QJ5B 1YRTB 1RECA 1SYMA 2ZKMX 4ORBB 1BOCA 1JFJA 2MAZA 1NX0A 2I18A 4U8DA 2ISDA 3OB2B 2JWWA 1F4QA 3PM2A 4OKHA 2KAYA 4BY4A 1N2DA 3S0GA 1NWDA 2NCOA 2QDIA 1IQ3A 3IQOA 2D8NA 2KYCA 4IL1A 3NHIA 3L47A 1KFXS 2WCHA 4PHJA 1R2UA 2M49B 2MA2A 2WCLA 4MVFA 2JNFA 1P28A 3GOFA 3S0AA 4YGEB 2LP3A 1XFZO 3FIAA 1T14A 2BCAA 1OOIX 4XJKB 1R6PA 2K7DA 1TNPA 2K60A 3DYEA 2KBMA 1WDCC 2K8MB 2O5GA 1PULA 1CDLA 4YI9A 1XFUO 1QLKA 1FPWA 1NP8A 1QATA 2M1UA 3D0YB 1J7QA 4M2OA 3ICBA 5KU1A 1GGWA 5CPVA 3F45A 1A03A 1K9KA 1KK8C 3D77A 4GUKA 2LC5A 1KSOA 3TDUA 1SBJA 1L2OC 1WLMA 1DF0B 3B86A 3CTNA 2KFHA 4NQGA 1B47A 2FCEA 4GPLB 3R72A 4PDZA 1QX7A 3DXLA 1K95A 1EH2A 1TN4A 2FJUB 3LL8B 3OX5A 5TNCA 4PE7A 1SRAA 3NGVA 1GM0A 3SG2A 1M46A 4UPGA 1PK0D 4AOMA 2ZNDA 2KLEA 2WCFA 2BE4A 3EG5B 1IJ5A 4DS7A 1BMOA 4YI8A 2R2IA 2KI6D 3HX4A 1KK8B 1TRFA 2CT9A 2E30A 1L2OB 1K9PA 2EC6C 3OP0A 1WRKA 2MBXA 2QEHA 5B8IB 3PATA 2BECA 2F3ZA 2JTZA 2LLSA 1LVCD 5J3XA 2AAOA 2H61C 1TNXA 1A4PA 2Y1MA 4F7FA 2KDHA 4P5OE 1LKJA 1QXPA 4WQ2A 4OV2A 3VRPA 2KQYA 1GQMA 4JWQA 3VB1A 2K7BA 5CSNA 1B9AA 1OZOA 2WCEA 2EC6B 2LVVA 1PRWA 5ER5A 1XK4C 1ALVA 4NDCA 3PM8A 2MLEC 1XA5A 3CWGA 1CLBA 1KQVA 1UUSA 1DC1A 5CSIA 1MR8A 1BG1A 3EK4A 1MXLC 1K9UA 3SIAA 4D1EA 1B1GA 4HSZA 1G4YR 1YUSA 4L9MA 2KSPA 2LVKA 3TS5C 2ZFDA 2QEBA 2BBNA 2FCDA 4OVNF 2KNEA 3I5FC 2KI4C 2GV5A 2E6WA 2CNPA 3SG7A 3KEVA 1GGZA 4ETOA 5I2OA 3GK1A 1E8AA 5CSJA 1BU3A 4C0JA 1QV0A 5KTYA 1FI6A 2KFGA 1Q80A 1M63B 1TUJA 1XFRA 1CDPA 1S26D 4E68A 2P6BB 3AAJA 1K90D 1KFUL 4MSPA 4N5XA 4NDBA 3TS5B 3VROA 4YGBB 2HQWA 1BF5A 3I5FB 2KI4B 3R1OA 1YR5A 1DJGA 4DRWA 3CDNA 3Q8IA 1KK7Y 3EKHA 1CDNA 1G33A 3VRQA 2QEOA 3DZTA 4MEWA 4NDDA 4PCWA 5DICA 1B7TY 2WCJA 3BFBA 2F8PA 2KGBC 3B88A 5HKYA 1XFVO 3AAKA 1QV1A 2KGRA 3S0DA 2JXLA 3SG5A 2K2AA 4I5JA 1B7TZ 1KFUS 4AQJA 2Y5IA 4JKTA 1IGVA 1K8UA 2PALA 1CB1A 3EKJA 3L4AA 1OOFA 3HCMA 2Q4UA 3NSOA 4M2PA 3B6XA 5F6TA 1H8BA 3QRXA 4XJKA 2MRDA 3RLZA 4WQ3A 1NYAA 2HF5A 2P71A 5FI2A 3OHMB 1KWOC 4ZCUA 2WC8A 1OQPA 2WORA 1J1DA 1YUUA 4FQTA 3D0YA 1SPYA 4MZJA 2GGZA 1DJHA 1SY9A 3NSKA 2AUCA 3PN7C 3CABA 1RWYA 1F4OA 2L5YA 2K61A 3D78A 1A75B 1EG3A 4DIRA 1OMDA 1DF0A 1YX8A 2K7CA 1DMOA 4N1FA 3CGAA 4YGDB 1PALA 2PVBA 4CIDA 3ZWHA 2M8UA 5D7FA 4PE4A 1MQ1A 1F54A 1EJ3A 1KWOB 2ZN9A 3EVUA 2L51A 2LUXA 2V53A 3RZSA 3BOWB 1SNLA 4F0ZB 5AANA 3PN7B 1TCFA 2WCKA 1AP4A 1U5IB 1DJYA 1DTLA 3D73A 1Y1UA 4OR9B 1TTXA 3NSLA 3PJIA 1PVAA 5AERA 1C7VA 1S5GY 3TZ1A 3SG4A 4MLWA 1WLZA 4JQ0D 3BUNB 3TDIA 1V1FA 1S6JA 5HKZA 1UURA 3D74A 2ZRTA 5GQQC 4CLNA 5IBWA 1SK6D 1MXEA 1QIWA 3K1EA 3OX6A 2P70A 2LMUA 3EK7A 4HRHA 1X02A 2G2BA 2PQLA 1S5GZ 2BBMA 4Q04A 3SJSA 3WNXB 1NSHA 1SW8A 3SIBA 1QX2A 1CM1A 3LLEA 4WRIA 4CFRA 1SCVA 3DVEA 4FTGA 5I2QA 2IS9A 3FWCA 1QTXA 5FI7A 4YGAA 1C3YA 1PVBA 4GAOA 2BCBA 1LS8A 1OSAA 1RTP1 3A4UB 3EVVA 3JVTC 4PHMA 1DT7B 1DGVA 1XVJA 3CZ0A 3CZ2A 1IJ6A 2DOQA 1K94A 5JJGA 2H8VA 1SMGA 4GBAA 1BR4B 3WXAA 3S0BA 2SCPA 3A8RA 2K7OA 1WRLA 2F2PA 2PASA 3BQ3A 1MF8B 5HKWA 1XK4A 1A2XA 4DCKA 2NCPA 3D76A 2WCMA 2LUCA 3OGNA 2F33A 1JFKA 2WOSA 3O78A 3JVTB 1FF1A 2JPTA 4C0KA 1YUTA 4GNKB 1KSMA 1NX2A 1J7RA 1ZFSA 1IH0A 2OS8C 1NX1A 1SL9A 1B8LA 1BLQA 1S1EA 3CYZA 1EL4A 1YVHA 4PHKA 1JC2A 4CPVA 1DGUA 3CS1A 3SG6A 5HL1A 1AJ5A 4YRUA 2KQ6A 1BODA 5CSFA 1D1OA 3L4LA 2Q91A 1YTZC 3I5GC 5HLOA 4A4BA 1ODBA 1C7WA 2PMYA 1OE9B 4YGCB 1C3ZA 4MN0A 1S6CA 1ZUZA 3N7HA 1UP5A 2L98A 4JD9A 2OS8B 3WHTB 3PLFB 1SKTA 1YVLA 3BFHA 3KO0A 1SR6C 1ZOTB 1F71A 5FYXA 2JRFA 1KQMC 2JQ6A 1QS7A 2K2FA 5DKNA 3FE9A 1NCXA 2LM5A 2EHBA 3BUXB 1SSEB 5HLVA 2JNXA 2M7LA 1KCYA 1YRUB 3I5GB 1MHOA 4PE0A 3I5IC 1TWOA 2F2OA 5KSZA 3PSRA 3IQQA 4HRGA 2GTEA 1C07A 3GK2A 1JSAA 2COLB 2NLNA 3UNWA 3BJHA 1SR6B 2LMTA 2PYQA 1KQMB 3PALA 3BUMB 2L2EA 2Y1NA 3NSIA 4PT1A 5AFPA 1IKUA 1OOGA 3QMEA 2JZIA 2GGMA 1DELA 4JPZB 2L2CA 2HETA 4GGFC 3I5IB 1DVIA 2JT0A 1AVSA 4ZCVA 3EVRA 1CTRA 2KLDA 5K89A 2KHNA 2BKHB 1TCOB 4GFTA 1IWQA 1UHIA 3C1VA 1JUOA 2KBIA 1CFDA 1XFWO 2HPSA 3DVMA 2WCBA 2LVIA 3NHTA 4ORAB 1S3PA 1W9ZA 3D75A 1UHKA 1ZMZA 2M1KB 5I8NA 2WNDA 2JC2A 4FQOA 1WRZA 2VRGA 4HREE 1DJWA 1CLMA 2L4HA 1J55A 2A4JA 2TN4A 1S6IA 3I5HC 2L0PA 2JU0A 1CFFA 2LV7A 3O6BA 1LXFC 1UHHA 2F3YA 3CZTX 1EG4A 1N65A 1NCYA 1WY9A 3LK1A 5HYDA 1CMFA 2WC5A 1CDMA 2SASA 1Y1XA 4MZKA 1YX7A 2M97A 3BYAA 1JBAA 2OPOA 3O4XA 1W7JB 5G08A 1F70A 2B1UA 2JPOA 2OTGC 4MBEA 1PSBA 2YGUA 2LANA 1Y6WA 2I7AA 3SS5A 5PALA 1Y0VH 3I5HB 4IJ7A 2JTTA 5AXIA 3GK4X 1K96A 1S36A 3S0EA 2BCXA 3DF0B 4PHNA 3JTDC 4N1GA 1B4CA 1XFXO 3O4YA 1RFJA
chains in the Genus database with same CATH topology
1BR1B 1QJTA 2LP2A 2BL0C 2LNKA 5D69A 1CLLA 1DJIA 2Y4QA 1SL7A 3DD4A 3IF7A 2OTGB 4P2YB 3WHUB 4MRXA 1NX3A 1F55A 3MSEB 3LK0A 3JTDB 2ZNEA 1M45A 1Y1AA 2KAVA 2LHIA 3KHEA 1XYDA 2M7NA 2PRUA 1MWNA 2BL0B 4BY5A 2H61A 1ZACA 2I2RE 1F8HA 1IG5A 2FOTA 2MJWB 1LA0A 4PE1A 2LE9B 1M39A 1DJXA 1K2HA 1ALWA 2JT3A 4I5KA 2NZ0A 3KPXA 1J7OA 2KI6C 2K0JA 1QASA 2LVJA 1EXRA 1WDCB 3H4SE 5BPJA 1CFCA 1DJZA 2HQ8A 3VRRA 2AMIA 2NXQA 3DVKA 3CLNA 1GJYA 1FI5A 2M3WA 1FW4A 4GGNA 4MRYA 1AK8A 4I5LB 3M0WA 1SL8A 1JF0A 2JULA 1CM4A 4QJ4B 2ZN8A 1V1GA 1IQ5A 4PALA 1NIWA 4QJ3B 3CR5X 1QLSA 3DVJA 1CFPA 1AHRA 1AUIB 1RJVA 1QVIY 1B8RA 2LHLA 1K93D 1OOJA 2O60A 3K21A 1LA3A 2ZRSA 1TOPA 3ZNIA 4A4CA 2L50A 1RK9A 1MUXA 2MLFC 3D10A 3VRNA 1W7IB 3AKAA 4AQIA 1QVIZ 1SCMC 3EK8A 1HQVA 1PSRA 2G9BA 1XFYO 1A29A 3NXAA 1OMRA 1HT9A 4DUQA 3O2PA 1H4BA 4I5NB 4USLA 1G8IA 1QX5B 3TUYC 3PFVA 2JT8A 1UWOA 1J1EA 1CKKA 2CBLA 2L4IA 4MZLA 4OCIA 4R1EA 4C0LA 1TNQA 3RM1A 4XYNA 1NPQA 1TNWA 1SCMB 4ORCB 2BE6A 4CFQA 1RROA 1BT6A 2PSRA 4GGFA 2BKIB 5DKRA 2L5XB 1UHJA 2H2KA 2LAPA 2LLTA 4M2QA 1QIVA 2KYFA 4TNCA 1OZSA 3TUYB 2JXCA 2QACA 2RGIA 3FWBA 2CCMA 1A75A 2M9GA 5DKQA 3BXKA 2KAXA 1BJFA 1CMGA 1OMVA 2I94A 3BUOB 5JOLA 2KFFA 1JF2A 3CR2A 1UHNA 1L7ZA 1JWDA 1NUBA 3BOWA 3BUWB 2LCPA 1FBVA 2LLUA 1XO5A 1U5IA 1YURA 1LINA 3DF0A 4ICBA 3VGOA 3AKBA 1J7PA 1VRKA 4YBHB 2M29A 2LMVA 3FS7A 1N0YA 3E3RA 1KK7Z 2EGDA 2CTNA 1CNPA 5ER4X 1IRJA 1TIZA 3CR4X 5I2LA 2KOTA 1KFXL 1M31A 5AEQA 3TDZA 2M0RA 3LCPC 3OB1B 2CXJA 1B8CA 2MHHA 3SG3A 1AJ4A 1NCZA 2JOJA 2QPTA 3KF9A 4QJ5B 1YRTB 1RECA 1SYMA 2ZKMX 4ORBB 1BOCA 1JFJA 2MAZA 1NX0A 2I18A 4U8DA 2ISDA 3OB2B 2JWWA 1F4QA 4OKHA 2KAYA 4BY4A 1N2DA 1NWDA 2NCOA 1IQ3A 3IQOA 2D8NA 2KYCA 4IL1A 1KFXS 4PHJA 1R2UA 2M49B 2MA2A 4MVFA 2JNFA 3GOFA 4YGEB 2LP3A 1XFZO 3FIAA 2BCAA 4XJKB 1R6PA 2K7DA 1TNPA 2KBMA 1WDCC 2K8MB 2O5GA 1PULA 1CDLA 4YI9A 1XFUO 1QLKA 1FPWA 1NP8A 1QATA 2M1UA 3D0YB 1J7QA 4M2OA 3ICBA 5KU1A 1GGWA 5CPVA 3F45A 1A03A 1K9KA 1KK8C 4GUKA 2LC5A 1KSOA 3TDUA 1SBJA 1L2OC 1WLMA 1DF0B 3CTNA 2KFHA 4NQGA 1B47A 2FCEA 4GPLB 4PDZA 1QX7A 1K95A 1EH2A 1TN4A 2FJUB 3LL8B 3OX5A 5TNCA 4PE7A 1SRAA 3SG2A 1M46A 4UPGA 1PK0D 4AOMA 2ZNDA 2WCFA 2BE4A 1IJ5A 4DS7A 1BMOA 4YI8A 2R2IA 2KI6D 3HX4A 1KK8B 1TRFA 2CT9A 2E30A 1L2OB 1K9PA 2EC6C 3OP0A 1WRKA 2MBXA 5B8IB 3PATA 2BECA 2F3ZA 2JTZA 2LLSA 1LVCD 5J3XA 2AAOA 2H61C 1TNXA 1A4PA 2Y1MA 2KDHA 4P5OE 1LKJA 1QXPA 4WQ2A 4OV2A 3VRPA 2KQYA 1GQMA 4JWQA 2K7BA 5CSNA 1B9AA 1OZOA 2WCEA 2EC6B 2LVVA 1PRWA 5ER5A 1XK4C 1ALVA 4NDCA 3PM8A 2MLEC 1XA5A 3CWGA 1CLBA 1KQVA 1UUSA 5CSIA 1MR8A 1BG1A 3EK4A 1MXLC 1K9UA 3SIAA 4D1EA 1B1GA 4HSZA 1G4YR 1YUSA 4L9MA 2KSPA 2LVKA 3TS5C 2ZFDA 2BBNA 2FCDA 4OVNF 2KNEA 3I5FC 2KI4C 2GV5A 2E6WA 2CNPA 3SG7A 3KEVA 1GGZA 4ETOA 5I2OA 3GK1A 1E8AA 5CSJA 1BU3A 4C0JA 1QV0A 5KTYA 1FI6A 2KFGA 1Q80A 1M63B 1CDPA 1S26D 4E68A 2P6BB 3AAJA 1K90D 1KFUL 4MSPA 4N5XA 4NDBA 3TS5B 3VROA 4YGBB 2HQWA 1BF5A 3I5FB 2KI4B 1YR5A 1DJGA 4DRWA 1KK7Y 3EKHA 1CDNA 1G33A 3VRQA 4MEWA 4NDDA 4PCWA 1B7TY 2F8PA 2KGBC 5HKYA 1XFVO 3AAKA 1QV1A 2KGRA 2JXLA 3SG5A 2K2AA 4I5JA 1B7TZ 1KFUS 4AQJA 2Y5IA 1IGVA 1K8UA 2PALA 1CB1A 3EKJA 3HCMA 4M2PA 2Q4UA 3NSOA 5F6TA 1H8BA 3QRXA 4XJKA 2MRDA 3RLZA 4WQ3A 1NYAA 2HF5A 3OHMB 1KWOC 4ZCUA 2WC8A 1OQPA 2WORA 1J1DA 1YUUA 4MZJA 3D0YA 1SPYA 2GGZA 1DJHA 1SY9A 3NSKA 2AUCA 3PN7C 1RWYA 1F4OA 2K61A 1A75B 1EG3A 4DIRA 1OMDA 1DF0A 1YX8A 2K7CA 1DMOA 4N1FA 3CGAA 4YGDB 1PALA 2PVBA 4CIDA 3ZWHA 2M8UA 5D7FA 4PE4A 1MQ1A 1F54A 1EJ3A 1KWOB 2ZN9A 3EVUA 2L51A 2LUXA 2V53A 3BOWB 1SNLA 4F0ZB 5AANA 3PN7B 1TCFA 1AP4A 1U5IB 1DJYA 1DTLA 1Y1UA 4OR9B 1TTXA 3NSLA 5AERA 1PVAA 1C7VA 1S5GY 3TZ1A 3SG4A 4MLWA 1WLZA 4JQ0D 3BUNB 3TDIA 1V1FA 1S6JA 5HKZA 1UURA 5GQQC 2ZRTA 4CLNA 5IBWA 1SK6D 1MXEA 1QIWA 3OX6A 2LMUA 3EK7A 4HRHA 1X02A 2G2BA 1S5GZ 2BBMA 4Q04A 3SJSA 3WNXB 1NSHA 1SW8A 3SIBA 1QX2A 1CM1A 3LLEA 4WRIA 4CFRA 1SCVA 3DVEA 4FTGA 5I2QA 2IS9A 3FWCA 1QTXA 4YGAA 1PVBA 4GAOA 2BCBA 1OSAA 1RTP1 3A4UB 3EVVA 3JVTC 4PHMA 1DT7B 1DGVA 1XVJA 1IJ6A 2DOQA 1K94A 5JJGA 4GBAA 1SMGA 1BR4B 3WXAA 2SCPA 3A8RA 2K7OA 1WRLA 2F2PA 2PASA 3BQ3A 1MF8B 5HKWA 1XK4A 1A2XA 4DCKA 2NCPA 2LUCA 2F33A 1JFKA 2WOSA 3O78A 3JVTB 1FF1A 2JPTA 4C0KA 1YUTA 4GNKB 1KSMA 1NX2A 1J7RA 1ZFSA 1IH0A 2OS8C 1NX1A 1SL9A 1B8LA 1BLQA 1S1EA 1EL4A 1YVHA 4PHKA 1JC2A 4CPVA 1DGUA 3CS1A 3SG6A 1AJ5A 4YRUA 2KQ6A 1BODA 5CSFA 1D1OA 2Q91A 1YTZC 3I5GC 5HLOA 4A4BA 1ODBA 1C7WA 2PMYA 1OE9B 4YGCB 4MN0A 1S6CA 1ZUZA 1UP5A 2L98A 2OS8B 3WHTB 3PLFB 1SKTA 1YVLA 3KO0A 1SR6C 1ZOTB 1F71A 5FYXA 2JRFA 1KQMC 2JQ6A 1QS7A 2K2FA 5DKNA 1NCXA 2LM5A 2EHBA 3BUXB 5HLVA 2JNXA 2M7LA 1KCYA 1YRUB 3I5GB 1MHOA 4PE0A 3I5IC 2F2OA 5KSZA 3PSRA 3IQQA 4HRGA 1C07A 1JSAA 3GK2A 2COLB 2NLNA 1SR6B 2LMTA 1KQMB 3PALA 3BUMB 2L2EA 2Y1NA 3NSIA 5AFPA 1IKUA 2JZIA 2GGMA 4JPZB 2HETA 4GGFC 3I5IB 1DVIA 2JT0A 1AVSA 4ZCVA 3EVRA 1CTRA 5K89A 2KHNA 2BKHB 1TCOB 4GFTA 1IWQA 1UHIA 3C1VA 1JUOA 2KBIA 1CFDA 1XFWO 2HPSA 3DVMA 2WCBA 2LVIA 4ORAB 1S3PA 1UHKA 1ZMZA 2M1KB 5I8NA 2WNDA 2JC2A 4FQOA 1WRZA 2VRGA 4HREE 1DJWA 1CLMA 2L4HA 1J55A 2A4JA 2TN4A 1S6IA 3I5HC 2L0PA 2JU0A 1CFFA 2LV7A 3O6BA 1LXFC 1UHHA 2F3YA 3CZTX 1EG4A 1N65A 1NCYA 1WY9A 3LK1A 5HYDA 1CMFA 1CDMA 2SASA 1Y1XA 4MZKA 1YX7A 2M97A 3BYAA 1JBAA 2OPOA 5G08A 1W7JB 1F70A 2B1UA 2OTGC 4MBEA 1PSBA 2LANA 1Y6WA 2I7AA 5PALA 1Y0VH 3I5HB 2JTTA 5AXIA 3GK4X 1K96A 1S36A 2BCXA 3DF0B 4PHNA 3JTDC 4N1GA 1B4CA 1XFXO 3O4YA 1RFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR1 B;  1QJT A;  2LP2 A;  2BL0 C;  2LNK A;  5D69 A;  1CLL A;  1DJI A;  2Y4Q A;  1SL7 A;  3DD4 A;  3IF7 A;  2OTG B;  4P2Y B;  3WHU B;  4MRX A;  1NX3 A;  1F55 A;  3MSE B;  3LK0 A;  3JTD B;  2ZNE A;  1M45 A;  1Y1A A;  2KAV A;  2LHI A;  3KHE A;  1XYD A;  2M7N A;  2PRU A;  1MWN A;  2BL0 B;  4BY5 A;  2H61 A;  1ZAC A;  2I2R E;  1F8H A;  1IG5 A;  2FOT A;  2MJW B;  1LA0 A;  4PE1 A;  2LE9 B;  1M39 A;  1DJX A;  1K2H A;  1ALW A;  2JT3 A;  4I5K A;  2NZ0 A;  3KPX A;  1J7O A;  2KI6 C;  2K0J A;  1QAS A;  2LVJ A;  1EXR A;  1WDC B;  3H4S E;  5BPJ A;  1CFC A;  1DJZ A;  2HQ8 A;  3VRR A;  2AMI A;  2NXQ A;  3DVK A;  3CLN A;  1GJY A;  1FI5 A;  2M3W A;  1FW4 A;  4GGN A;  4MRY A;  1AK8 A;  4I5L B;  3M0W A;  1SL8 A;  1JF0 A;  2JUL A;  1CM4 A;  4QJ4 B;  2ZN8 A;  1V1G A;  1IQ5 A;  4PAL A;  1NIW A;  4QJ3 B;  3CR5 X;  1QLS A;  3DVJ A;  1CFP A;  1AHR A;  1AUI B;  1RJV A;  1QVI Y;  1B8R A;  2LHL A;  1K93 D;  1OOJ A;  2O60 A;  3K21 A;  1LA3 A;  2ZRS A;  1TOP A;  3ZNI A;  4A4C A;  2L50 A;  1RK9 A;  1MUX A;  2MLF C;  3D10 A;  3VRN A;  1W7I B;  3AKA A;  4AQI A;  1QVI Z;  1SCM C;  3EK8 A;  1HQV A;  1PSR A;  2G9B A;  1XFY O;  1A29 A;  3NXA A;  1OMR A;  1HT9 A;  4DUQ A;  3O2P A;  1H4B A;  4I5N B;  4USL A;  1G8I A;  1QX5 B;  3TUY C;  3PFV A;  2JT8 A;  1UWO A;  1J1E A;  1CKK A;  2CBL A;  2L4I A;  4MZL A;  4OCI A;  4R1E A;  4C0L A;  1TNQ A;  3RM1 A;  4XYN A;  1NPQ A;  1TNW A;  1SCM B;  4ORC B;  2BE6 A;  4CFQ A;  1RRO A;  1BT6 A;  2PSR A;  4GGF A;  2BKI B;  5DKR A;  2L5X B;  1UHJ A;  2H2K A;  2LAP A;  2LLT A;  4M2Q A;  1QIV A;  2KYF A;  4TNC A;  1OZS A;  3TUY B;  2JXC A;  2QAC A;  2RGI A;  3FWB A;  2CCM A;  1A75 A;  2M9G A;  5DKQ A;  3BXK A;  2KAX A;  1BJF A;  1CMG A;  1OMV A;  2I94 A;  3BUO B;  5JOL A;  2KFF A;  1JF2 A;  3CR2 A;  1UHN A;  1L7Z A;  1JWD A;  1NUB A;  3BOW A;  3BUW B;  2LCP A;  1FBV A;  2LLU A;  1XO5 A;  1U5I A;  1YUR A;  1LIN A;  3DF0 A;  4ICB A;  3VGO A;  3AKB A;  1J7P A;  1VRK A;  4YBH B;  2M29 A;  2LMV A;  3FS7 A;  1N0Y A;  3E3R A;  1KK7 Z;  2EGD A;  2CTN A;  1CNP A;  5ER4 X;  1IRJ A;  1TIZ A;  3CR4 X;  5I2L A;  2KOT A;  1KFX L;  1M31 A;  5AEQ A;  3TDZ A;  2M0R A;  3LCP C;  3OB1 B;  2CXJ A;  1B8C A;  2MHH A;  3SG3 A;  1AJ4 A;  1NCZ A;  2JOJ A;  2QPT A;  3KF9 A;  4QJ5 B;  1YRT B;  1REC A;  1SYM A;  2ZKM X;  4ORB B;  1BOC A;  1JFJ A;  2MAZ A;  1NX0 A;  2I18 A;  4U8D A;  2ISD A;  3OB2 B;  2JWW A;  1F4Q A;  4OKH A;  2KAY A;  4BY4 A;  1N2D A;  1NWD A;  2NCO A;  1IQ3 A;  3IQO A;  2D8N A;  2KYC A;  4IL1 A;  1KFX S;  4PHJ A;  1R2U A;  2M49 B;  2MA2 A;  4MVF A;  2JNF A;  3GOF A;  4YGE B;  2LP3 A;  1XFZ O;  3FIA A;  2BCA A;  4XJK B;  1R6P A;  2K7D A;  1TNP A;  2KBM A;  1WDC C;  2K8M B;  2O5G A;  1PUL A;  1CDL A;  4YI9 A;  1XFU O;  1QLK A;  1FPW A;  1NP8 A;  1QAT A;  2M1U A;  3D0Y B;  1J7Q A;  4M2O A;  3ICB A;  5KU1 A;  1GGW A;  5CPV A;  3F45 A;  1A03 A;  1K9K A;  1KK8 C;  4GUK A;  2LC5 A;  1KSO A;  3TDU A;  1SBJ A;  1L2O C;  1WLM A;  1DF0 B;  3CTN A;  2KFH A;  4NQG A;  1B47 A;  2FCE A;  4GPL B;  4PDZ A;  1QX7 A;  1K95 A;  1EH2 A;  1TN4 A;  2FJU B;  3LL8 B;  3OX5 A;  5TNC A;  4PE7 A;  1SRA A;  3SG2 A;  1M46 A;  4UPG A;  1PK0 D;  4AOM A;  2ZND A;  2WCF A;  2BE4 A;  1IJ5 A;  4DS7 A;  1BMO A;  4YI8 A;  2R2I A;  2KI6 D;  3HX4 A;  1KK8 B;  1TRF A;  2CT9 A;  2E30 A;  1L2O B;  1K9P A;  2EC6 C;  3OP0 A;  1WRK A;  2MBX A;  5B8I B;  3PAT A;  2BEC A;  2F3Z A;  2JTZ A;  2LLS A;  1LVC D;  5J3X A;  2AAO A;  2H61 C;  1TNX A;  1A4P A;  2Y1M A;  2KDH A;  4P5O E;  1LKJ A;  1QXP A;  4WQ2 A;  4OV2 A;  3VRP A;  2KQY A;  1GQM A;  4JWQ A;  2K7B A;  5CSN A;  1B9A A;  1OZO A;  2WCE A;  2EC6 B;  2LVV A;  1PRW A;  5ER5 A;  1XK4 C;  1ALV A;  4NDC A;  3PM8 A;  2MLE C;  1XA5 A;  3CWG A;  1CLB A;  1KQV A;  1UUS A;  5CSI A;  1MR8 A;  1BG1 A;  3EK4 A;  1MXL C;  1K9U A;  3SIA A;  4D1E A;  1B1G A;  4HSZ A;  1G4Y R;  1YUS A;  4L9M A;  2KSP A;  2LVK A;  3TS5 C;  2ZFD A;  2BBN A;  2FCD A;  4OVN F;  2KNE A;  3I5F C;  2KI4 C;  2GV5 A;  2E6W A;  2CNP A;  3SG7 A;  3KEV A;  1GGZ A;  4ETO A;  5I2O A;  3GK1 A;  1E8A A;  5CSJ A;  1BU3 A;  4C0J A;  1QV0 A;  5KTY A;  1FI6 A;  2KFG A;  1Q80 A;  1M63 B;  1CDP A;  1S26 D;  4E68 A;  2P6B B;  3AAJ A;  1K90 D;  1KFU L;  4MSP A;  4N5X A;  4NDB A;  3TS5 B;  3VRO A;  4YGB B;  2HQW A;  1BF5 A;  3I5F B;  2KI4 B;  1YR5 A;  1DJG A;  4DRW A;  1KK7 Y;  3EKH A;  1CDN A;  1G33 A;  3VRQ A;  4MEW A;  4NDD A;  4PCW A;  1B7T Y;  2F8P A;  2KGB C;  5HKY A;  1XFV O;  3AAK A;  1QV1 A;  2KGR A;  2JXL A;  3SG5 A;  2K2A A;  4I5J A;  1B7T Z;  1KFU S;  4AQJ A;  2Y5I A;  1IGV A;  1K8U A;  2PAL A;  1CB1 A;  3EKJ A;  3HCM A;  4M2P A;  2Q4U A;  3NSO A;  5F6T A;  1H8B A;  3QRX A;  4XJK A;  2MRD A;  3RLZ A;  4WQ3 A;  1NYA A;  2HF5 A;  3OHM B;  1KWO C;  4ZCU A;  2WC8 A;  1OQP A;  2WOR A;  1J1D A;  1YUU A;  4MZJ A;  3D0Y A;  1SPY A;  2GGZ A;  1DJH A;  1SY9 A;  3NSK A;  2AUC A;  3PN7 C;  1RWY A;  1F4O A;  2K61 A;  1A75 B;  1EG3 A;  4DIR A;  1OMD A;  1DF0 A;  1YX8 A;  2K7C A;  1DMO A;  4N1F A;  3CGA A;  4YGD B;  1PAL A;  2PVB A;  4CID A;  3ZWH A;  2M8U A;  5D7F A;  4PE4 A;  1MQ1 A;  1F54 A;  1EJ3 A;  1KWO B;  2ZN9 A;  3EVU A;  2L51 A;  2LUX A;  2V53 A;  3BOW B;  1SNL A;  4F0Z B;  5AAN A;  3PN7 B;  1TCF A;  1AP4 A;  1U5I B;  1DJY A;  1DTL A;  1Y1U A;  4OR9 B;  1TTX A;  3NSL A;  5AER A;  1PVA A;  1C7V A;  1S5G Y;  3TZ1 A;  3SG4 A;  4MLW A;  1WLZ A;  4JQ0 D;  3BUN B;  3TDI A;  1V1F A;  1S6J A;  5HKZ A;  1UUR A;  5GQQ C;  2ZRT A;  4CLN A;  5IBW A;  1SK6 D;  1MXE A;  1QIW A;  3OX6 A;  2LMU A;  3EK7 A;  4HRH A;  1X02 A;  2G2B A;  1S5G Z;  2BBM A;  4Q04 A;  3SJS A;  3WNX B;  1NSH A;  1SW8 A;  3SIB A;  1QX2 A;  1CM1 A;  3LLE A;  4WRI A;  4CFR A;  1SCV A;  3DVE A;  4FTG A;  5I2Q A;  2IS9 A;  3FWC A;  1QTX A;  4YGA A;  1PVB A;  4GAO A;  2BCB A;  1OSA A;  1RTP 1;  3A4U B;  3EVV A;  3JVT C;  4PHM A;  1DT7 B;  1DGV A;  1XVJ A;  1IJ6 A;  2DOQ A;  1K94 A;  5JJG A;  4GBA A;  1SMG A;  1BR4 B;  3WXA A;  2SCP A;  3A8R A;  2K7O A;  1WRL A;  2F2P A;  2PAS A;  3BQ3 A;  1MF8 B;  5HKW A;  1XK4 A;  1A2X A;  4DCK A;  2NCP A;  2LUC A;  2F33 A;  1JFK A;  2WOS A;  3O78 A;  3JVT B;  1FF1 A;  2JPT A;  4C0K A;  1YUT A;  4GNK B;  1KSM A;  1NX2 A;  1J7R A;  1ZFS A;  1IH0 A;  2OS8 C;  1NX1 A;  1SL9 A;  1B8L A;  1BLQ A;  1S1E A;  1EL4 A;  1YVH A;  4PHK A;  1JC2 A;  4CPV A;  1DGU A;  3CS1 A;  3SG6 A;  1AJ5 A;  4YRU A;  2KQ6 A;  1BOD A;  5CSF A;  1D1O A;  2Q91 A;  1YTZ C;  3I5G C;  5HLO A;  4A4B A;  1ODB A;  1C7W A;  2PMY A;  1OE9 B;  4YGC B;  4MN0 A;  1S6C A;  1ZUZ A;  1UP5 A;  2L98 A;  2OS8 B;  3WHT B;  3PLF B;  1SKT A;  1YVL A;  3KO0 A;  1SR6 C;  1ZOT B;  1F71 A;  5FYX A;  2JRF A;  1KQM C;  2JQ6 A;  1QS7 A;  2K2F A;  5DKN A;  1NCX A;  2LM5 A;  2EHB A;  3BUX B;  5HLV A;  2JNX A;  2M7L A;  1KCY A;  1YRU B;  3I5G B;  1MHO A;  4PE0 A;  3I5I C;  2F2O A;  5KSZ A;  3PSR A;  3IQQ A;  4HRG A;  1C07 A;  1JSA A;  3GK2 A;  2COL B;  2NLN A;  1SR6 B;  2LMT A;  1KQM B;  3PAL A;  3BUM B;  2L2E A;  2Y1N A;  3NSI A;  5AFP A;  1IKU A;  2JZI A;  2GGM A;  4JPZ B;  2HET A;  4GGF C;  3I5I B;  1DVI A;  2JT0 A;  1AVS A;  4ZCV A;  3EVR A;  1CTR A;  5K89 A;  2KHN A;  2BKH B;  1TCO B;  4GFT A;  1IWQ A;  1UHI A;  3C1V A;  1JUO A;  2KBI A;  1CFD A;  1XFW O;  2HPS A;  3DVM A;  2WCB A;  2LVI A;  4ORA B;  1S3P A;  1UHK A;  1ZMZ A;  2M1K B;  5I8N A;  2WND A;  2JC2 A;  4FQO A;  1WRZ A;  2VRG A;  4HRE E;  1DJW A;  1CLM A;  2L4H A;  1J55 A;  2A4J A;  2TN4 A;  1S6I A;  3I5H C;  2L0P A;  2JU0 A;  1CFF A;  2LV7 A;  3O6B A;  1LXF C;  1UHH A;  2F3Y A;  3CZT X;  1EG4 A;  1N65 A;  1NCY A;  1WY9 A;  3LK1 A;  5HYD A;  1CMF A;  1CDM A;  2SAS A;  1Y1X A;  4MZK A;  1YX7 A;  2M97 A;  3BYA A;  1JBA A;  2OPO A;  5G08 A;  1W7J B;  1F70 A;  2B1U A;  2OTG C;  4MBE A;  1PSB A;  2LAN A;  1Y6W A;  2I7A A;  5PAL A;  1Y0V H;  3I5H B;  2JTT A;  5AXI A;  3GK4 X;  1K96 A;  1S36 A;  2BCX A;  3DF0 B;  4PHN A;  3JTD C;  4N1G A;  1B4C A;  1XFX O;  3O4Y A;  1RFJ A; 
#chains in the Genus database with same CATH topology
 1BR1 B;  1QJT A;  2LP2 A;  2BL0 C;  2LNK A;  2QEV A;  5D69 A;  2BAP A;  1CLL A;  1DJI A;  2Y4Q A;  1SL7 A;  3DD4 A;  3IF7 A;  2OTG B;  4P2Y B;  3WHU B;  3DY9 A;  4MRX A;  1NX3 A;  1F55 A;  3MSE B;  3CZ1 A;  3LK0 A;  5FI6 A;  3JTD B;  3FE6 A;  2ZNE A;  1M45 A;  1Y1A A;  2KAV A;  1OW4 A;  2LHI A;  3KHE A;  1XYD A;  2M7N A;  2PRU A;  1MWN A;  2BL0 B;  4BY5 A;  1Z4H A;  1ZAC A;  2H61 A;  2I2R E;  3IVT A;  1F8H A;  3FE8 A;  1IG5 A;  2FOT A;  2MJW B;  4INX A;  1LA0 A;  4PE1 A;  2LE9 B;  1M39 A;  1DJX A;  1K2H A;  1ALW A;  2JT3 A;  4I5K A;  2NZ0 A;  3KPX A;  1J7O A;  3SS4 A;  4INW A;  2KI6 C;  2K0J A;  1QAS A;  2LVJ A;  1EXR A;  1WDC B;  3H4S E;  5BPJ A;  1CFC A;  1DJZ A;  2ERB A;  2HQ8 A;  3VRR A;  2AMI A;  2NXQ A;  3DVK A;  3CLN A;  1GJY A;  1FI5 A;  2M3W A;  1FW4 A;  4GGN A;  4MRY A;  1AK8 A;  4I5L B;  3M0W A;  2BNX A;  2KPH A;  1SL8 A;  1JF0 A;  2JUL A;  1CM4 A;  4QJ4 B;  2ZN8 A;  1V1G A;  1IQ5 A;  4PAL A;  1NIW A;  4QJ3 B;  3CR5 X;  1QLS A;  3DVJ A;  1CFP A;  1AHR A;  1AUI B;  1RJV A;  1QVI Y;  1B8R A;  2LHL A;  1K93 D;  1OOJ A;  2O60 A;  3K21 A;  1LA3 A;  2ZRS A;  3R1V A;  1TOP A;  3ZNI A;  4A4C A;  2L50 A;  5I94 A;  1RK9 A;  1QWV A;  1MUX A;  3OBV A;  2MLF C;  3B7A A;  3D10 A;  3VRN A;  1W7I B;  3UO9 A;  3AKA A;  4AQI A;  1QVI Z;  1SCM C;  3EK8 A;  1HQV A;  1PSR A;  2G9B A;  1XFY O;  1A29 A;  3NXA A;  1OMR A;  3R1P A;  2WC6 A;  1HT9 A;  4DUQ A;  3O2P A;  1H4B A;  4I5N B;  4USL A;  1G8I A;  1QX5 B;  3TUY C;  3PFV A;  2JT8 A;  1UWO A;  1J1E A;  1CKK A;  2CBL A;  2L4I A;  4MZL A;  4OCI A;  4R1E A;  4C0L A;  5D3O A;  1TNQ A;  3RM1 A;  4XYN A;  1NPQ A;  1TNW A;  1SCM B;  4ORC B;  2BE6 A;  4CFQ A;  1RRO A;  1BT6 A;  2PSR A;  4GGF A;  2BKI B;  5DKR A;  1ORG A;  2L5X B;  1UHJ A;  2H2K A;  2LAP A;  2LLT A;  1TUZ A;  4M2Q A;  1DQE A;  1QIV A;  2KYF A;  4TNC A;  1OZS A;  3TUY B;  3B87 A;  2FJY A;  2JXC A;  2QAC A;  2RGI A;  1Z2C B;  2CCM A;  3FWB A;  5EL2 A;  1A75 A;  2M9G A;  5DKQ A;  3BXK A;  3V2L A;  2KAX A;  1BJF A;  1CMG A;  1OMV A;  2I94 A;  3BUO B;  5JOL A;  2KFF A;  1JF2 A;  3CR2 A;  1UHN A;  1OOH A;  1L7Z A;  1JWD A;  1NUB A;  3BOW A;  3BUW B;  2LCP A;  1FBV A;  2LLU A;  1XO5 A;  1U5I A;  1YUR A;  1LIN A;  3BFA A;  3DF0 A;  4ICB A;  3VGO A;  3AKB A;  1DEK A;  1J7P A;  1VRK A;  4YBH B;  2M29 A;  2LMV A;  3FS7 A;  4OZD A;  1N0Y A;  3E3R A;  1IIO A;  1KK7 Z;  2EGD A;  2CTN A;  1CNP A;  5ER4 X;  1IRJ A;  3SS3 A;  1TIZ A;  3CR4 X;  5I2L A;  2KOT A;  1KFX L;  1M31 A;  5AEQ A;  3TDZ A;  2M0R A;  3LCP C;  3OB1 B;  2CXJ A;  1B8C A;  2MHH A;  3SG3 A;  1AJ4 A;  1NCZ A;  3S0F A;  2JOJ A;  2QPT A;  4KYN A;  3KF9 A;  4QJ5 B;  1YRT B;  1REC A;  1SYM A;  2ZKM X;  4ORB B;  1BOC A;  1JFJ A;  2MAZ A;  1NX0 A;  2I18 A;  4U8D A;  2ISD A;  3OB2 B;  2JWW A;  1F4Q A;  3PM2 A;  4OKH A;  2KAY A;  4BY4 A;  1N2D A;  3S0G A;  1NWD A;  2NCO A;  2QDI A;  1IQ3 A;  3IQO A;  2D8N A;  2KYC A;  4IL1 A;  3NHI A;  3L47 A;  1KFX S;  2WCH A;  4PHJ A;  1R2U A;  2M49 B;  2MA2 A;  2WCL A;  4MVF A;  2JNF A;  1P28 A;  3GOF A;  3S0A A;  4YGE B;  2LP3 A;  1XFZ O;  3FIA A;  1T14 A;  2BCA A;  1OOI X;  4XJK B;  1R6P A;  2K7D A;  1TNP A;  2K60 A;  3DYE A;  2KBM A;  1WDC C;  2K8M B;  2O5G A;  1PUL A;  1CDL A;  4YI9 A;  1XFU O;  1QLK A;  1FPW A;  1NP8 A;  1QAT A;  2M1U A;  3D0Y B;  1J7Q A;  4M2O A;  3ICB A;  5KU1 A;  1GGW A;  5CPV A;  3F45 A;  1A03 A;  1K9K A;  1KK8 C;  3D77 A;  4GUK A;  2LC5 A;  1KSO A;  3TDU A;  1SBJ A;  1L2O C;  1WLM A;  1DF0 B;  3B86 A;  3CTN A;  2KFH A;  4NQG A;  1B47 A;  2FCE A;  4GPL B;  3R72 A;  4PDZ A;  1QX7 A;  3DXL A;  1K95 A;  1EH2 A;  1TN4 A;  2FJU B;  3LL8 B;  3OX5 A;  5TNC A;  4PE7 A;  1SRA A;  3NGV A;  1GM0 A;  3SG2 A;  1M46 A;  4UPG A;  1PK0 D;  4AOM A;  2ZND A;  2KLE A;  2WCF A;  2BE4 A;  3EG5 B;  1IJ5 A;  4DS7 A;  1BMO A;  4YI8 A;  2R2I A;  2KI6 D;  3HX4 A;  1KK8 B;  1TRF A;  2CT9 A;  2E30 A;  1L2O B;  1K9P A;  2EC6 C;  3OP0 A;  1WRK A;  2MBX A;  2QEH A;  5B8I B;  3PAT A;  2BEC A;  2F3Z A;  2JTZ A;  2LLS A;  1LVC D;  5J3X A;  2AAO A;  2H61 C;  1TNX A;  1A4P A;  2Y1M A;  4F7F A;  2KDH A;  4P5O E;  1LKJ A;  1QXP A;  4WQ2 A;  4OV2 A;  3VRP A;  2KQY A;  1GQM A;  4JWQ A;  3VB1 A;  2K7B A;  5CSN A;  1B9A A;  1OZO A;  2WCE A;  2EC6 B;  2LVV A;  1PRW A;  5ER5 A;  1XK4 C;  1ALV A;  4NDC A;  3PM8 A;  2MLE C;  1XA5 A;  3CWG A;  1CLB A;  1KQV A;  1UUS A;  1DC1 A;  5CSI A;  1MR8 A;  1BG1 A;  3EK4 A;  1MXL C;  1K9U A;  3SIA A;  4D1E A;  1B1G A;  4HSZ A;  1G4Y R;  1YUS A;  4L9M A;  2KSP A;  2LVK A;  3TS5 C;  2ZFD A;  2QEB A;  2BBN A;  2FCD A;  4OVN F;  2KNE A;  3I5F C;  2KI4 C;  2GV5 A;  2E6W A;  2CNP A;  3SG7 A;  3KEV A;  1GGZ A;  4ETO A;  5I2O A;  3GK1 A;  1E8A A;  5CSJ A;  1BU3 A;  4C0J A;  1QV0 A;  5KTY A;  1FI6 A;  2KFG A;  1Q80 A;  1M63 B;  1TUJ A;  1XFR A;  1CDP A;  1S26 D;  4E68 A;  2P6B B;  3AAJ A;  1K90 D;  1KFU L;  4MSP A;  4N5X A;  4NDB A;  3TS5 B;  3VRO A;  4YGB B;  2HQW A;  1BF5 A;  3I5F B;  2KI4 B;  3R1O A;  1YR5 A;  1DJG A;  4DRW A;  3CDN A;  3Q8I A;  1KK7 Y;  3EKH A;  1CDN A;  1G33 A;  3VRQ A;  2QEO A;  3DZT A;  4MEW A;  4NDD A;  4PCW A;  5DIC A;  1B7T Y;  2WCJ A;  3BFB A;  2F8P A;  2KGB C;  3B88 A;  5HKY A;  1XFV O;  3AAK A;  1QV1 A;  2KGR A;  3S0D A;  2JXL A;  3SG5 A;  2K2A A;  4I5J A;  1B7T Z;  1KFU S;  4AQJ A;  2Y5I A;  4JKT A;  1IGV A;  1K8U A;  2PAL A;  1CB1 A;  3EKJ A;  3L4A A;  1OOF A;  3HCM A;  2Q4U A;  3NSO A;  4M2P A;  3B6X A;  5F6T A;  1H8B A;  3QRX A;  4XJK A;  2MRD A;  3RLZ A;  4WQ3 A;  1NYA A;  2HF5 A;  2P71 A;  5FI2 A;  3OHM B;  1KWO C;  4ZCU A;  2WC8 A;  1OQP A;  2WOR A;  1J1D A;  1YUU A;  4FQT A;  3D0Y A;  1SPY A;  4MZJ A;  2GGZ A;  1DJH A;  1SY9 A;  3NSK A;  2AUC A;  3PN7 C;  3CAB A;  1RWY A;  1F4O A;  2L5Y A;  2K61 A;  3D78 A;  1A75 B;  1EG3 A;  4DIR A;  1OMD A;  1DF0 A;  1YX8 A;  2K7C A;  1DMO A;  4N1F A;  3CGA A;  4YGD B;  1PAL A;  2PVB A;  4CID A;  3ZWH A;  2M8U A;  5D7F A;  4PE4 A;  1MQ1 A;  1F54 A;  1EJ3 A;  1KWO B;  2ZN9 A;  3EVU A;  2L51 A;  2LUX A;  2V53 A;  3RZS A;  3BOW B;  1SNL A;  4F0Z B;  5AAN A;  3PN7 B;  1TCF A;  2WCK A;  1AP4 A;  1U5I B;  1DJY A;  1DTL A;  3D73 A;  1Y1U A;  4OR9 B;  1TTX A;  3NSL A;  3PJI A;  1PVA A;  5AER A;  1C7V A;  1S5G Y;  3TZ1 A;  3SG4 A;  4MLW A;  1WLZ A;  4JQ0 D;  3BUN B;  3TDI A;  1V1F A;  1S6J A;  5HKZ A;  1UUR A;  3D74 A;  2ZRT A;  5GQQ C;  4CLN A;  5IBW A;  1SK6 D;  1MXE A;  1QIW A;  3K1E A;  3OX6 A;  2P70 A;  2LMU A;  3EK7 A;  4HRH A;  1X02 A;  2G2B A;  2PQL A;  1S5G Z;  2BBM A;  4Q04 A;  3SJS A;  3WNX B;  1NSH A;  1SW8 A;  3SIB A;  1QX2 A;  1CM1 A;  3LLE A;  4WRI A;  4CFR A;  1SCV A;  3DVE A;  4FTG A;  5I2Q A;  2IS9 A;  3FWC A;  1QTX A;  5FI7 A;  4YGA A;  1C3Y A;  1PVB A;  4GAO A;  2BCB A;  1LS8 A;  1OSA A;  1RTP 1;  3A4U B;  3EVV A;  3JVT C;  4PHM A;  1DT7 B;  1DGV A;  1XVJ A;  3CZ0 A;  3CZ2 A;  1IJ6 A;  2DOQ A;  1K94 A;  5JJG A;  2H8V A;  1SMG A;  4GBA A;  1BR4 B;  3WXA A;  3S0B A;  2SCP A;  3A8R A;  2K7O A;  1WRL A;  2F2P A;  2PAS A;  3BQ3 A;  1MF8 B;  5HKW A;  1XK4 A;  1A2X A;  4DCK A;  2NCP A;  3D76 A;  2WCM A;  2LUC A;  3OGN A;  2F33 A;  1JFK A;  2WOS A;  3O78 A;  3JVT B;  1FF1 A;  2JPT A;  4C0K A;  1YUT A;  4GNK B;  1KSM A;  1NX2 A;  1J7R A;  1ZFS A;  1IH0 A;  2OS8 C;  1NX1 A;  1SL9 A;  1B8L A;  1BLQ A;  1S1E A;  3CYZ A;  1EL4 A;  1YVH A;  4PHK A;  1JC2 A;  4CPV A;  1DGU A;  3CS1 A;  3SG6 A;  5HL1 A;  1AJ5 A;  4YRU A;  2KQ6 A;  1BOD A;  5CSF A;  1D1O A;  3L4L A;  2Q91 A;  1YTZ C;  3I5G C;  5HLO A;  4A4B A;  1ODB A;  1C7W A;  2PMY A;  1OE9 B;  4YGC B;  1C3Z A;  4MN0 A;  1S6C A;  1ZUZ A;  3N7H A;  1UP5 A;  2L98 A;  4JD9 A;  2OS8 B;  3WHT B;  3PLF B;  1SKT A;  1YVL A;  3BFH A;  3KO0 A;  1SR6 C;  1ZOT B;  1F71 A;  5FYX A;  2JRF A;  1KQM C;  2JQ6 A;  1QS7 A;  2K2F A;  5DKN A;  3FE9 A;  1NCX A;  2LM5 A;  2EHB A;  3BUX B;  1SSE B;  5HLV A;  2JNX A;  2M7L A;  1KCY A;  1YRU B;  3I5G B;  1MHO A;  4PE0 A;  3I5I C;  1TWO A;  2F2O A;  5KSZ A;  3PSR A;  3IQQ A;  4HRG A;  2GTE A;  1C07 A;  3GK2 A;  1JSA A;  2COL B;  2NLN A;  3UNW A;  3BJH A;  1SR6 B;  2LMT A;  2PYQ A;  1KQM B;  3PAL A;  3BUM B;  2L2E A;  2Y1N A;  3NSI A;  4PT1 A;  5AFP A;  1IKU A;  1OOG A;  3QME A;  2JZI A;  2GGM A;  1DEL A;  4JPZ B;  2L2C A;  2HET A;  4GGF C;  3I5I B;  1DVI A;  2JT0 A;  1AVS A;  4ZCV A;  3EVR A;  1CTR A;  2KLD A;  5K89 A;  2KHN A;  2BKH B;  1TCO B;  4GFT A;  1IWQ A;  1UHI A;  3C1V A;  1JUO A;  2KBI A;  1CFD A;  1XFW O;  2HPS A;  3DVM A;  2WCB A;  2LVI A;  3NHT A;  4ORA B;  1S3P A;  1W9Z A;  3D75 A;  1UHK A;  1ZMZ A;  2M1K B;  5I8N A;  2WND A;  2JC2 A;  4FQO A;  1WRZ A;  2VRG A;  4HRE E;  1DJW A;  1CLM A;  2L4H A;  1J55 A;  2A4J A;  2TN4 A;  1S6I A;  3I5H C;  2L0P A;  2JU0 A;  1CFF A;  2LV7 A;  3O6B A;  1LXF C;  1UHH A;  2F3Y A;  3CZT X;  1EG4 A;  1N65 A;  1NCY A;  1WY9 A;  3LK1 A;  5HYD A;  1CMF A;  2WC5 A;  1CDM A;  2SAS A;  1Y1X A;  4MZK A;  1YX7 A;  2M97 A;  3BYA A;  1JBA A;  2OPO A;  3O4X A;  1W7J B;  5G08 A;  1F70 A;  2B1U A;  2JPO A;  2OTG C;  4MBE A;  1PSB A;  2YGU A;  2LAN A;  1Y6W A;  2I7A A;  3SS5 A;  5PAL A;  1Y0V H;  3I5H B;  4IJ7 A;  2JTT A;  5AXI A;  3GK4 X;  1K96 A;  1S36 A;  3S0E A;  2BCX A;  3DF0 B;  4PHN A;  3JTD C;  4N1G A;  1B4C A;  1XFX O;  3O4Y A;  1RFJ A; 
#chains in the Genus database with same CATH homology
 1BR1 B;  1QJT A;  2LP2 A;  2BL0 C;  2LNK A;  5D69 A;  1CLL A;  1DJI A;  2Y4Q A;  1SL7 A;  3DD4 A;  3IF7 A;  2OTG B;  4P2Y B;  3WHU B;  4MRX A;  1NX3 A;  1F55 A;  3MSE B;  3LK0 A;  3JTD B;  2ZNE A;  1M45 A;  1Y1A A;  2KAV A;  2LHI A;  3KHE A;  1XYD A;  2M7N A;  2PRU A;  1MWN A;  2BL0 B;  4BY5 A;  2H61 A;  1ZAC A;  2I2R E;  1F8H A;  1IG5 A;  2FOT A;  2MJW B;  1LA0 A;  4PE1 A;  2LE9 B;  1M39 A;  1DJX A;  1K2H A;  1ALW A;  2JT3 A;  4I5K A;  2NZ0 A;  3KPX A;  1J7O A;  2KI6 C;  2K0J A;  1QAS A;  2LVJ A;  1EXR A;  1WDC B;  3H4S E;  5BPJ A;  1CFC A;  1DJZ A;  2HQ8 A;  3VRR A;  2AMI A;  2NXQ A;  3DVK A;  3CLN A;  1GJY A;  1FI5 A;  2M3W A;  1FW4 A;  4GGN A;  4MRY A;  1AK8 A;  4I5L B;  3M0W A;  1SL8 A;  1JF0 A;  2JUL A;  1CM4 A;  4QJ4 B;  2ZN8 A;  1V1G A;  1IQ5 A;  4PAL A;  1NIW A;  4QJ3 B;  3CR5 X;  1QLS A;  3DVJ A;  1CFP A;  1AHR A;  1AUI B;  1RJV A;  1QVI Y;  1B8R A;  2LHL A;  1K93 D;  1OOJ A;  2O60 A;  3K21 A;  1LA3 A;  2ZRS A;  1TOP A;  3ZNI A;  4A4C A;  2L50 A;  1RK9 A;  1MUX A;  2MLF C;  3D10 A;  3VRN A;  1W7I B;  3AKA A;  4AQI A;  1QVI Z;  1SCM C;  3EK8 A;  1HQV A;  1PSR A;  2G9B A;  1XFY O;  1A29 A;  3NXA A;  1OMR A;  1HT9 A;  4DUQ A;  3O2P A;  1H4B A;  4I5N B;  4USL A;  1G8I A;  1QX5 B;  3TUY C;  3PFV A;  2JT8 A;  1UWO A;  1J1E A;  1CKK A;  2CBL A;  2L4I A;  4MZL A;  4OCI A;  4R1E A;  4C0L A;  1TNQ A;  3RM1 A;  4XYN A;  1NPQ A;  1TNW A;  1SCM B;  4ORC B;  2BE6 A;  4CFQ A;  1RRO A;  1BT6 A;  2PSR A;  4GGF A;  2BKI B;  5DKR A;  2L5X B;  1UHJ A;  2H2K A;  2LAP A;  2LLT A;  4M2Q A;  1QIV A;  2KYF A;  4TNC A;  1OZS A;  3TUY B;  2JXC A;  2QAC A;  2RGI A;  3FWB A;  2CCM A;  1A75 A;  2M9G A;  5DKQ A;  3BXK A;  2KAX A;  1BJF A;  1CMG A;  1OMV A;  2I94 A;  3BUO B;  5JOL A;  2KFF A;  1JF2 A;  3CR2 A;  1UHN A;  1L7Z A;  1JWD A;  1NUB A;  3BOW A;  3BUW B;  2LCP A;  1FBV A;  2LLU A;  1XO5 A;  1U5I A;  1YUR A;  1LIN A;  3DF0 A;  4ICB A;  3VGO A;  3AKB A;  1J7P A;  1VRK A;  4YBH B;  2M29 A;  2LMV A;  3FS7 A;  1N0Y A;  3E3R A;  1KK7 Z;  2EGD A;  2CTN A;  1CNP A;  5ER4 X;  1IRJ A;  1TIZ A;  3CR4 X;  5I2L A;  2KOT A;  1KFX L;  1M31 A;  5AEQ A;  3TDZ A;  2M0R A;  3LCP C;  3OB1 B;  2CXJ A;  1B8C A;  2MHH A;  3SG3 A;  1AJ4 A;  1NCZ A;  2JOJ A;  2QPT A;  3KF9 A;  4QJ5 B;  1YRT B;  1REC A;  1SYM A;  2ZKM X;  4ORB B;  1BOC A;  1JFJ A;  2MAZ A;  1NX0 A;  2I18 A;  4U8D A;  2ISD A;  3OB2 B;  2JWW A;  1F4Q A;  4OKH A;  2KAY A;  4BY4 A;  1N2D A;  1NWD A;  2NCO A;  1IQ3 A;  3IQO A;  2D8N A;  2KYC A;  4IL1 A;  1KFX S;  4PHJ A;  1R2U A;  2M49 B;  2MA2 A;  4MVF A;  2JNF A;  3GOF A;  4YGE B;  2LP3 A;  1XFZ O;  3FIA A;  2BCA A;  4XJK B;  1R6P A;  2K7D A;  1TNP A;  2KBM A;  1WDC C;  2K8M B;  2O5G A;  1PUL A;  1CDL A;  4YI9 A;  1XFU O;  1QLK A;  1FPW A;  1NP8 A;  1QAT A;  2M1U A;  3D0Y B;  1J7Q A;  4M2O A;  3ICB A;  5KU1 A;  1GGW A;  5CPV A;  3F45 A;  1A03 A;  1K9K A;  1KK8 C;  4GUK A;  2LC5 A;  1KSO A;  3TDU A;  1SBJ A;  1L2O C;  1WLM A;  1DF0 B;  3CTN A;  2KFH A;  4NQG A;  1B47 A;  2FCE A;  4GPL B;  4PDZ A;  1QX7 A;  1K95 A;  1EH2 A;  1TN4 A;  2FJU B;  3LL8 B;  3OX5 A;  5TNC A;  4PE7 A;  1SRA A;  3SG2 A;  1M46 A;  4UPG A;  1PK0 D;  4AOM A;  2ZND A;  2WCF A;  2BE4 A;  1IJ5 A;  4DS7 A;  1BMO A;  4YI8 A;  2R2I A;  2KI6 D;  3HX4 A;  1KK8 B;  1TRF A;  2CT9 A;  2E30 A;  1L2O B;  1K9P A;  2EC6 C;  3OP0 A;  1WRK A;  2MBX A;  5B8I B;  3PAT A;  2BEC A;  2F3Z A;  2JTZ A;  2LLS A;  1LVC D;  5J3X A;  2AAO A;  2H61 C;  1TNX A;  1A4P A;  2Y1M A;  2KDH A;  4P5O E;  1LKJ A;  1QXP A;  4WQ2 A;  4OV2 A;  3VRP A;  2KQY A;  1GQM A;  4JWQ A;  2K7B A;  5CSN A;  1B9A A;  1OZO A;  2WCE A;  2EC6 B;  2LVV A;  1PRW A;  5ER5 A;  1XK4 C;  1ALV A;  4NDC A;  3PM8 A;  2MLE C;  1XA5 A;  3CWG A;  1CLB A;  1KQV A;  1UUS A;  5CSI A;  1MR8 A;  1BG1 A;  3EK4 A;  1MXL C;  1K9U A;  3SIA A;  4D1E A;  1B1G A;  4HSZ A;  1G4Y R;  1YUS A;  4L9M A;  2KSP A;  2LVK A;  3TS5 C;  2ZFD A;  2BBN A;  2FCD A;  4OVN F;  2KNE A;  3I5F C;  2KI4 C;  2GV5 A;  2E6W A;  2CNP A;  3SG7 A;  3KEV A;  1GGZ A;  4ETO A;  5I2O A;  3GK1 A;  1E8A A;  5CSJ A;  1BU3 A;  4C0J A;  1QV0 A;  5KTY A;  1FI6 A;  2KFG A;  1Q80 A;  1M63 B;  1CDP A;  1S26 D;  4E68 A;  2P6B B;  3AAJ A;  1K90 D;  1KFU L;  4MSP A;  4N5X A;  4NDB A;  3TS5 B;  3VRO A;  4YGB B;  2HQW A;  1BF5 A;  3I5F B;  2KI4 B;  1YR5 A;  1DJG A;  4DRW A;  1KK7 Y;  3EKH A;  1CDN A;  1G33 A;  3VRQ A;  4MEW A;  4NDD A;  4PCW A;  1B7T Y;  2F8P A;  2KGB C;  5HKY A;  1XFV O;  3AAK A;  1QV1 A;  2KGR A;  2JXL A;  3SG5 A;  2K2A A;  4I5J A;  1B7T Z;  1KFU S;  4AQJ A;  2Y5I A;  1IGV A;  1K8U A;  2PAL A;  1CB1 A;  3EKJ A;  3HCM A;  4M2P A;  2Q4U A;  3NSO A;  5F6T A;  1H8B A;  3QRX A;  4XJK A;  2MRD A;  3RLZ A;  4WQ3 A;  1NYA A;  2HF5 A;  3OHM B;  1KWO C;  4ZCU A;  2WC8 A;  1OQP A;  2WOR A;  1J1D A;  1YUU A;  4MZJ A;  3D0Y A;  1SPY A;  2GGZ A;  1DJH A;  1SY9 A;  3NSK A;  2AUC A;  3PN7 C;  1RWY A;  1F4O A;  2K61 A;  1A75 B;  1EG3 A;  4DIR A;  1OMD A;  1DF0 A;  1YX8 A;  2K7C A;  1DMO A;  4N1F A;  3CGA A;  4YGD B;  1PAL A;  2PVB A;  4CID A;  3ZWH A;  2M8U A;  5D7F A;  4PE4 A;  1MQ1 A;  1F54 A;  1EJ3 A;  1KWO B;  2ZN9 A;  3EVU A;  2L51 A;  2LUX A;  2V53 A;  3BOW B;  1SNL A;  4F0Z B;  5AAN A;  3PN7 B;  1TCF A;  1AP4 A;  1U5I B;  1DJY A;  1DTL A;  1Y1U A;  4OR9 B;  1TTX A;  3NSL A;  5AER A;  1PVA A;  1C7V A;  1S5G Y;  3TZ1 A;  3SG4 A;  4MLW A;  1WLZ A;  4JQ0 D;  3BUN B;  3TDI A;  1V1F A;  1S6J A;  5HKZ A;  1UUR A;  5GQQ C;  2ZRT A;  4CLN A;  5IBW A;  1SK6 D;  1MXE A;  1QIW A;  3OX6 A;  2LMU A;  3EK7 A;  4HRH A;  1X02 A;  2G2B A;  1S5G Z;  2BBM A;  4Q04 A;  3SJS A;  3WNX B;  1NSH A;  1SW8 A;  3SIB A;  1QX2 A;  1CM1 A;  3LLE A;  4WRI A;  4CFR A;  1SCV A;  3DVE A;  4FTG A;  5I2Q A;  2IS9 A;  3FWC A;  1QTX A;  4YGA A;  1PVB A;  4GAO A;  2BCB A;  1OSA A;  1RTP 1;  3A4U B;  3EVV A;  3JVT C;  4PHM A;  1DT7 B;  1DGV A;  1XVJ A;  1IJ6 A;  2DOQ A;  1K94 A;  5JJG A;  4GBA A;  1SMG A;  1BR4 B;  3WXA A;  2SCP A;  3A8R A;  2K7O A;  1WRL A;  2F2P A;  2PAS A;  3BQ3 A;  1MF8 B;  5HKW A;  1XK4 A;  1A2X A;  4DCK A;  2NCP A;  2LUC A;  2F33 A;  1JFK A;  2WOS A;  3O78 A;  3JVT B;  1FF1 A;  2JPT A;  4C0K A;  1YUT A;  4GNK B;  1KSM A;  1NX2 A;  1J7R A;  1ZFS A;  1IH0 A;  2OS8 C;  1NX1 A;  1SL9 A;  1B8L A;  1BLQ A;  1S1E A;  1EL4 A;  1YVH A;  4PHK A;  1JC2 A;  4CPV A;  1DGU A;  3CS1 A;  3SG6 A;  1AJ5 A;  4YRU A;  2KQ6 A;  1BOD A;  5CSF A;  1D1O A;  2Q91 A;  1YTZ C;  3I5G C;  5HLO A;  4A4B A;  1ODB A;  1C7W A;  2PMY A;  1OE9 B;  4YGC B;  4MN0 A;  1S6C A;  1ZUZ A;  1UP5 A;  2L98 A;  2OS8 B;  3WHT B;  3PLF B;  1SKT A;  1YVL A;  3KO0 A;  1SR6 C;  1ZOT B;  1F71 A;  5FYX A;  2JRF A;  1KQM C;  2JQ6 A;  1QS7 A;  2K2F A;  5DKN A;  1NCX A;  2LM5 A;  2EHB A;  3BUX B;  5HLV A;  2JNX A;  2M7L A;  1KCY A;  1YRU B;  3I5G B;  1MHO A;  4PE0 A;  3I5I C;  2F2O A;  5KSZ A;  3PSR A;  3IQQ A;  4HRG A;  1C07 A;  1JSA A;  3GK2 A;  2COL B;  2NLN A;  1SR6 B;  2LMT A;  1KQM B;  3PAL A;  3BUM B;  2L2E A;  2Y1N A;  3NSI A;  5AFP A;  1IKU A;  2JZI A;  2GGM A;  4JPZ B;  2HET A;  4GGF C;  3I5I B;  1DVI A;  2JT0 A;  1AVS A;  4ZCV A;  3EVR A;  1CTR A;  5K89 A;  2KHN A;  2BKH B;  1TCO B;  4GFT A;  1IWQ A;  1UHI A;  3C1V A;  1JUO A;  2KBI A;  1CFD A;  1XFW O;  2HPS A;  3DVM A;  2WCB A;  2LVI A;  4ORA B;  1S3P A;  1UHK A;  1ZMZ A;  2M1K B;  5I8N A;  2WND A;  2JC2 A;  4FQO A;  1WRZ A;  2VRG A;  4HRE E;  1DJW A;  1CLM A;  2L4H A;  1J55 A;  2A4J A;  2TN4 A;  1S6I A;  3I5H C;  2L0P A;  2JU0 A;  1CFF A;  2LV7 A;  3O6B A;  1LXF C;  1UHH A;  2F3Y A;  3CZT X;  1EG4 A;  1N65 A;  1NCY A;  1WY9 A;  3LK1 A;  5HYD A;  1CMF A;  1CDM A;  2SAS A;  1Y1X A;  4MZK A;  1YX7 A;  2M97 A;  3BYA A;  1JBA A;  2OPO A;  5G08 A;  1W7J B;  1F70 A;  2B1U A;  2OTG C;  4MBE A;  1PSB A;  2LAN A;  1Y6W A;  2I7A A;  5PAL A;  1Y0V H;  3I5H B;  2JTT A;  5AXI A;  3GK4 X;  1K96 A;  1S36 A;  2BCX A;  3DF0 B;  4PHN A;  3JTD C;  4N1G A;  1B4C A;  1XFX O;  3O4Y A;  1RFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...