3NXAA

X-ray structure of the apo form of human s100a16
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
100
structure length
100
Chain Sequence
DCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A16
publication title Structural characterization of human S100A16, a low-affinity calcium binder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 32
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nxaA00
2LANA 3VRQA 2LLTA 1EXRA 1XFVO 1BR1B 1F4OA 1JFJA 4OVNF 1PALA 2LHLA 2LNKA 3FS7A 3SJSA 1TTXA 1CFPA 4NDCA 4HREE 2NCPA 3I5HC 4HRHA 2KQ6A 4GNKB 4FQOA 1A03A 2LHIA 3TUYB 1CFDA 2JNXA 1OQPA 1DF0B 1K9KA 1B7TZ 2Q91A 5DKNA 5HKYA 2BKHB 1IH0A 1YVHA 2LUCA 5K89A 1C7WA 2GGZA 2NZ0A 3EK7A 3O6BA 4PHJA 3HCMA 3SIBA 1IQ5A 1NUBA 1SPYA 2KQYA 2KI6C 4QJ3B 1J1DA 3GK1A 2MRDA 2KAVA 1J7OA 4AOMA 1BMOA 1QS7A 3PN7B 1CLMA 2LVJA 1DJGA 5HKWA 2FCDA 2R2IA 2LMVA 2I2RE 1IWQA 1X02A 1ALWA 1DGVA 1YUTA 2KBIA 2LVKA 2Q4UA 5AFPA 3FWBA 1PSBA 4C0LA 1XFWO 4CFRA 2LM5A 2LP2A 1PSRA 5CSFA 1JFKA 2KBMA 1IKUA 3DF0A 1CFCA 3EVVA 3VRRA 1J7QA 4BY4A 3A8RA 1XA5A 1QXPA 3BQ3A 3QRXA 1CLLA 1JF2A 2BCXA 4GGNA 1B8RA 3FWCA 1SY9A 4PHMA 3RLZA 4AQIA 1WLZA 1S6CA 1F70A 2JXCA 3TS5B 2BBMA 1J7RA 3EKJA 3H4SE 3KHEA 3GOFA 4DUQA 1KK7Z 1A2XA 3EKHA 4CFQA 1LINA 5CSJA 1WRLA 1PULA 1JUOA 1UHKA 2L2EA 2FCEA 1K94A 1K2HA 1YRTB 2L5XB 4MLWA 1EJ3A 2G9BA 1OZOA 3E3RA 3O2PA 2JT8A 1AJ4A 1W7IB 2WORA 5I2OA 1LKJA 3NXAA 2BCAA 2H2KA 3TZ1A 2ZKMX 1J1EA 3TUYC 2ZRTA 2M9GA 4GFTA 1F54A 4I5LB 5JOLA 2JZIA 3EK4A 1ZUZA 3SG5A 2JC2A 4M2OA 2K7CA 3NSKA 3LK1A 1S6IA 4XJKB 2GV5A 2MHHA 1YVLA 2AUCA 2FOTA 1EL4A 3KF9A 1YUSA 2LC5A 4GGFA 3JTDB 2H61C 2L4HA 2COLB 2SASA 3NSOA 2JQ6A 5HLOA 1KQVA 3BUMB 1QATA 1Y1AA 1DJXA 1YUUA 2KI4B 1WY9A 3PN7C 4IL1A 4P5OE 1NYAA 1TNQA 1FI6A 1FPWA 2SCPA 4N1FA 2LVVA 1CFFA 2VRGA 4ORAB 4MN0A 4MZJA 1QX2A 1UHHA 4MRXA 1CTRA 4MBEA 2KHNA 3CTNA 1NWDA 2BL0B 4YRUA 1KWOB 2L98A 4C0KA 2HETA 1TOPA 1HT9A 1TIZA 4YGEB 1KCYA 3DVMA 1SMGA 3F45A 2KI6D 2MBXA 1CM4A 2F3ZA 4F0ZB 2WCFA 3DVKA 1AHRA 4C0JA 1JSAA 1IRJA 1BG1A 2A4JA 4ORBB 2JU0A 2LMTA 1ALVA 1BJFA 2HPSA 4E68A 2M49B 1A4PA 2OTGB 4FTGA 4CIDA 1IGVA 3I5GB 1XK4A 1EG4A 3SG4A 1C07A 4WQ3A 1V1GA 1LXFC 1TNWA 4Q04A 1CNPA 1TNPA 2K7OA 1QLKA 5CPVA 3EVRA 1KSOA 3C1VA 5IBWA 2KGRA 1K95A 3CR4X 2L50A 4PALA 1MUXA 4YGDB 3FIAA 1K90D 1RWYA 5G08A 2Y1NA 1DMOA 4HRGA 1NX0A 2ISDA 2KYFA 3PATA 4NDDA 1NX2A 4XJKA 1SRAA 2PALA 2JXLA 3KEVA 3GK4X 4ZCVA 1A29A 3JTDC 1S3PA 1MWNA 1NCXA 2AMIA 1AVSA 2EC6B 2JTTA 2WOSA 1TNXA 1RECA 2KYCA 4U8DA 1BT6A 3CR5X 4ICBA 4USLA 2K2AA 2KOTA 1SCMB 3RM1A 4AQJA 2LUXA 1CMGA 2QACA 4JQ0D 3NSIA 2OPOA 4L9MA 4I5KA 4N1GA 2HQ8A 4QJ4B 1TCOB 3O78A 4YBHB 1XO5A 4YGAA 4M2QA 3BUNB 1BF5A 1KWOC 1M63B 4MZKA 1G8IA 3O4YA 1M45A 1QX5B 1XVJA 1GJYA 1M39A 1CDPA 2LLUA 5F6TA 3AKBA 1QIWA 1UP5A 1K8UA 1RJVA 2K2FA 3GK2A 3TDZA 1NSHA 1NP8A 1SK6D 3AAJA 3OHMB 5AEQA 1B8CA 1CDLA 1UHJA 2L0PA 2OTGC 2V53A 1IQ3A 3I5GC 2JWWA 1BOCA 1NX1A 3JVTB 4R1EA 2CNPA 5JJGA 4PHKA 4PHNA 1DJZA 3IF7A 2M3WA 4DCKA 3OX5A 1CMFA 4ZCUA 2KDHA 3AAKA 1L2OB 1FBVA 1WDCB 2F2OA 1JWDA 3SG3A 2D8NA 1N0YA 1QIVA 2KAXA 2LV7A 4N5XA 1BODA 2K7BA 1WRZA 4UPGA 4OCIA 1RFJA 4ETOA 5AERA 1RTP1 1XYDA 1FF1A 4YI9A 4DRWA 3A4UB 1LA3A 4M2PA 1C7VA 2F3YA 1CDMA 3DVJA 4GUKA 4TNCA 2E30A 1IJ6A 1F4QA 2I94A 2ZNDA 3MSEB 1WRKA 4GAOA 3KPXA 4CPVA 2EC6C 3PFVA 1SR6B 1YR5A 4PE4A 2KFGA 4BY5A 4XYNA 2ZN8A 1SKTA 1DJYA 1SL9A 1SCMC 1XFZO 4GGFC 2G2BA 5D69A 2KNEA 3IQQA 1Y1XA 1QVIZ 3NSLA 1ZOTB 1YX8A 2OS8B 3OB2B 3PM8A 1M46A 1GGWA 3CS1A 4YGBB 2JT0A 1CLBA 1B1GA 2IS9A 4MRYA 2LAPA 2O5GA 5FYXA 4GPLB 3WNXB 1J7PA 4D1EA 1G4YR 1BR4B 1EG3A 1UURA 2FJUB 5DKQA 3HX4A 2I18A 1SW8A 2O60A 3K21A 3VGOA 3BUOB 1QLSA 2PASA 3PSRA 2PRUA 4YGCB 1QV0A 3CLNA 1NPQA 1KK7Y 2TN4A 2RGIA 1QTXA 2WCBA 3DVEA 3TS5C 2PSRA 1PVBA 1PVAA 1V1FA 2GGMA 2L4IA 2M29A 1WDCC 4CLNA 1FI5A 3I5IB 1OMDA 3LL8B 3BXKA 1XK4C 4MSPA 4I5NB 2M7LA 2BE4A 1KSMA 4NQGA 4A4CA 1KK8B 2LP3A 4YI8A 1HQVA 2CBLA 2JPTA 1ZACA 1KFUS 1N2DA 3TDIA 3I5FB 4DS7A 2LVIA 1DVIA 1SCVA 1QV1A 1XFUO 5KSZA 1BU3A 5DKRA 5PALA 5HKZA 1F55A 1SYMA 1S5GY 5D7FA 1QASA 2MLEC 1DJWA 2KAYA 1JBAA 1DJIA 1G33A 1DJHA 2LE9B 3ZNIA 2BCBA 1MHOA 1ODBA 1U5IB 3IQOA 1DGUA 2KI4C 1CM1A 5B8IB 4DIRA 2OS8C 4PDZA 1NCZA 1JF0A 1UUSA 1S6JA 2CTNA 2M8UA 1XFYO 1S26D 1OMVA 3SG2A 2BL0C 3CR2A 4HSZA 1YTZC 5AXIA 5TNCA 4WQ2A 1E8AA 1DT7B 2LCPA 4OV2A 3EVUA 2M1UA 3AKAA 3CZTX 3WHTB 1Q80A 2Y5IA 4ORCB 1H8BA 2ZN9A 3PALA 1NCYA 1SL8A 1XFXO 2KFFA 4PE0A 5BPJA 2M0RA 1OSAA 3ZWHA 1MXLC 1YRUB 1VRKA 2EHBA 4OR9B 5KTYA 2NCOA 1W7JB 2E6WA 1IG5A 3OB1B 5J3XA 2CXJA 1R2UA 2BE6A 1QX7A 2M97A 2F2PA 3I5IC 1S36A 2MA2A 1K96A 2K0JA 2KSPA 1DTLA 1KFUL 1OZSA 2BKIB 4JWQA 2CCMA 1S1EA 3BUWB 1KK8C 1A75B 2L51A 1EH2A 1F8HA 4PE7A 3BOWB 1F71A 2B1UA 2Y1MA 3CWGA 1FW4A 1OOJA 5GQQC 1KQMB 4PE1A 1AUIB 3I5FC 4OKHA 1SNLA 2JTZA 1ZFSA 2BBNA 2BECA 2K61A 4P2YB 1KFXL 2WCEA 2F33A 1B7TY 3BYAA 3DD4A 1B8LA 1QJTA 1AK8A 3KO0A 3LK0A 1B9AA 3D0YB 2DOQA 5CSIA 1WLMA 1H4BA 1AJ5A 2CT9A 4A4BA 2PMYA 1MF8B 2PVBA 1Y1UA 2WC8A 1U5IA 1UWOA 2JT3A 1TRFA 3OX6A 4GBAA 4I5JA 1NX3A 4WRIA 1SBJA 2LMUA 2JNFA 2HF5A 1Y6WA 5I8NA 2K8MB 2ZNEA 4MVFA 1MXEA 5ER5A 1JC2A 3SG6A 1CDNA 1N65A 3CGAA 1M31A 1DF0A 2Y4QA 4MZLA 2I7AA 2WNDA 1J55A 2P6BB 2MAZA 3D10A 1LVCD 3PLFB 3TDUA 1PRWA 1YX7A 4PCWA 1B47A 2NLNA 1Y0VH 3I5HB 2K7DA 3ICBA 2ZFDA 4QJ5B 3VRNA 1R6PA 4MEWA 2M1KB 1OMRA 3BUXB 3SG7A 5HYDA 2H61A 2ZRSA 1RROA 1CKKA 3OP0A 1S5GZ 1OE9B 3WXAA 1GQMA 1MR8A 2KGBC 3JVTC 1K9PA 3M0WA 2AAOA 2EGDA 3SIAA 1UHNA 1D1OA 2QPTA 1L7ZA 1A75A 2JRFA 2JULA 5ER4X 1K93D 1L2OC 3BOWA 1IJ5A 1B4CA 1AP4A 1KQMC 3EK8A 3LLEA 1YURA 5CSNA 3LCPC 1PK0D 3D0YA 3VRPA 1MQ1A 2JOJA 2KFHA 1NIWA 2F8PA 2NXQA 5I2QA 1K9UA 5KU1A 1GGZA 2LLSA 2MJWB 3DF0B 5I2LA 1LA0A 5HLVA 3VROA 2MLFC 1ZMZA 4JPZB 1RK9A 1SR6C 2M7NA 1UHIA 1BLQA 5AANA 1TCFA 4NDBA 1TN4A 1KFXS 2HQWA 1QVIY 1SL7A 3WHUB 1CB1A
chains in the Genus database with same CATH superfamily
2LANA 3VRQA 2LLTA 3UNWA 1EXRA 1XFVO 1BR1B 1F4OA 1JFJA 4OVNF 1PALA 2LHLA 2LNKA 3BFBA 3FS7A 3NHTA 3SJSA 1TTXA 1CFPA 4NDCA 4HREE 2NCPA 3I5HC 4HRHA 2KQ6A 4GNKB 2WCHA 4FQOA 1A03A 2LHIA 3TUYB 1CFDA 2JNXA 1OQPA 1DF0B 1K9KA 1B7TZ 2Q91A 5DKNA 5HKYA 2BKHB 1IH0A 1YVHA 2LUCA 5K89A 1C7WA 2GGZA 2NZ0A 3EK7A 3O6BA 2BNXA 4PHJA 3HCMA 3SIBA 1IQ5A 1NUBA 1SPYA 2KQYA 2KI6C 2K60A 4QJ3B 1J1DA 3GK1A 2MRDA 2KAVA 1J7OA 4AOMA 1BMOA 1QS7A 3PN7B 1CLMA 2LVJA 1DJGA 3L4LA 5HKWA 3R1PA 2FCDA 2R2IA 2LMVA 2I2RE 5HL1A 1IWQA 1X02A 1ALWA 1DGVA 1YUTA 2KBIA 2LVKA 2Q4UA 3B86A 5AFPA 3FWBA 1PSBA 4C0LA 1XFWO 4CFRA 2LM5A 2LP2A 3BJHA 1PSRA 5CSFA 1JFKA 2KBMA 1IKUA 3DF0A 1CFCA 3EVVA 3VRRA 1J7QA 4BY4A 3A8RA 1XA5A 1QXPA 1C3YA 3BQ3A 3QRXA 1CLLA 1JF2A 2BCXA 4GGNA 1B8RA 3FWCA 3NGVA 1SY9A 4PHMA 3RLZA 4AQIA 1WLZA 3FE6A 1S6CA 1F70A 2JXCA 3TS5B 2BBMA 1J7RA 3EKJA 3H4SE 3KHEA 3GOFA 4DUQA 1KK7Z 1A2XA 3EKHA 4CFQA 1LINA 3CABA 3RZSA 5CSJA 3DY9A 1WRLA 1PULA 1QWVA 1TWOA 1JUOA 1UHKA 2L2EA 2FCEA 1K94A 1K2HA 1YRTB 2L5XB 4MLWA 1EJ3A 2G9BA 1OZOA 1OOIX 3E3RA 3O2PA 2JT8A 1AJ4A 1W7IB 2L5YA 2WORA 5I2OA 1LKJA 3NXAA 5FI2A 2BCAA 2H2KA 4JKTA 2ZKMX 1J1EA 3TZ1A 3TUYC 2ZRTA 2M9GA 4GFTA 1F54A 4I5LB 3D77A 5JOLA 2JZIA 3EK4A 1ZUZA 3L47A 3SG5A 2JC2A 4M2OA 2K7CA 3NSKA 3LK1A 1S6IA 4XJKB 2GV5A 2MHHA 1YVLA 2AUCA 2FOTA 1EL4A 3KF9A 1YUSA 2LC5A 4GGFA 3JTDB 2H61C 2WCLA 2L4HA 2COLB 2SASA 3NSOA 2JQ6A 5HLOA 1KQVA 3BUMB 1QATA 1Y1AA 1DJXA 1YUUA 2KI4B 1WY9A 3PN7C 4IL1A 4P5OE 1NYAA 1TNQA 1FI6A 1FPWA 2SCPA 4N1FA 2LVVA 1CFFA 2VRGA 3QMEA 4ORAB 3BFHA 4MN0A 4MZJA 2KLDA 1QX2A 1UHHA 4MRXA 1CTRA 4MBEA 2KHNA 3CTNA 1NWDA 2BL0B 4YRUA 1KWOB 2L98A 4C0KA 2HETA 1TOPA 1HT9A 1TIZA 4YGEB 1KCYA 3DVMA 1SMGA 3F45A 2KI6D 2MBXA 1CM4A 2F3ZA 4F0ZB 2WCFA 3DVKA 2KLEA 1AHRA 4C0JA 3S0BA 3B87A 1JSAA 1IRJA 1BG1A 2A4JA 4ORBB 2JU0A 2LMTA 1ALVA 1BJFA 2HPSA 4E68A 2M49B 1DC1A 1A4PA 2OTGB 4FTGA 4CIDA 1IGVA 3I5GB 1XK4A 1EG4A 1T14A 3SG4A 1C07A 4WQ3A 1V1GA 1LXFC 1TNWA 4Q04A 1CNPA 1TNPA 2K7OA 1QLKA 3NHIA 5CPVA 3EVRA 1KSOA 3C1VA 5IBWA 2KGRA 2FJYA 1IIOA 1K95A 3CR4X 2L50A 4PALA 1MUXA 4YGDB 3FIAA 1K90D 1RWYA 3N7HA 5G08A 2Y1NA 1DMOA 1OOFA 4HRGA 1NX0A 2ISDA 2KYFA 3PATA 2QEOA 4NDDA 1NX2A 4XJKA 1SRAA 2PALA 2BAPA 2JXLA 3KEVA 3GK4X 4ZCVA 4OZDA 1A29A 3EG5B 3JTDC 1S3PA 1TUZA 2P71A 1MWNA 1NCXA 1SSEB 2AMIA 1AVSA 1OW4A 2EC6B 2JTTA 1TNXA 1RECA 2KYCA 2WOSA 4U8DA 1BT6A 3CR5X 4ICBA 4USLA 2K2AA 2KOTA 1SCMB 3RM1A 4AQJA 2LUXA 1CMGA 2QACA 4JQ0D 3NSIA 2OPOA 4L9MA 4I5KA 4N1GA 2HQ8A 4QJ4B 1TCOB 3O78A 3S0GA 4YBHB 1XO5A 4YGAA 4M2QA 3BUNB 4PT1A 1BF5A 1KWOC 1M63B 4MZKA 1G8IA 3O4YA 1M45A 3PJIA 1QX5B 1XVJA 1GJYA 1M39A 1CDPA 2LLUA 5F6TA 3R72A 3AKBA 1QIWA 1UP5A 1K8UA 1RJVA 2K2FA 3GK2A 3TDZA 1NSHA 1NP8A 1SK6D 3AAJA 3OHMB 5AEQA 1B8CA 1CDLA 1UHJA 2L0PA 2OTGC 2V53A 1IQ3A 3I5GC 2JWWA 1BOCA 1NX1A 3JVTB 4R1EA 2CNPA 5JJGA 4PHKA 2WCKA 4PHNA 1DJZA 3IF7A 2M3WA 4DCKA 3OX5A 1GM0A 3VB1A 1CMFA 4ZCUA 2KDHA 3AAKA 1LS8A 1L2OB 1FBVA 1WDCB 2F2OA 3CZ2A 1JWDA 3SG3A 3PM2A 2D8NA 1N0YA 1QIVA 2KAXA 2LV7A 4N5XA 1BODA 2K7BA 1WRZA 4UPGA 4OCIA 1RFJA 4ETOA 5AERA 1RTP1 1XYDA 1FF1A 4YI9A 4DRWA 3A4UB 1C3ZA 1LA3A 4M2PA 1C7VA 2F3YA 1CDMA 3DVJA 4GUKA 4TNCA 2E30A 5I94A 1IJ6A 1F4QA 2I94A 2ZNDA 3DXLA 3MSEB 1WRKA 4GAOA 3CYZA 3KPXA 4CPVA 2EC6C 3PFVA 1SR6B 1YR5A 3SS3A 4PE4A 2KFGA 2L2CA 2QEVA 4BY5A 4XYNA 2ZN8A 1SKTA 2WCMA 1DJYA 1SL9A 1SCMC 1XFZO 4GGFC 2G2BA 3IVTA 5D69A 2KNEA 3IQQA 3BFAA 1Y1XA 1QVIZ 3NSLA 1ZOTB 1YX8A 2OS8B 3OB2B 3PM8A 1M46A 3B6XA 1GGWA 3CS1A 4YGBB 2JT0A 1CLBA 1B1GA 2IS9A 4MRYA 2LAPA 2O5GA 5FYXA 4GPLB 3WNXB 1J7PA 4D1EA 2JPOA 1G4YR 1BR4B 1EG3A 1UURA 2FJUB 5DKQA 3HX4A 2I18A 3O4XA 1SW8A 2O60A 3K21A 3VGOA 3BUOB 1QLSA 2PASA 3PSRA 2PRUA 4YGCB 3S0FA 1QV0A 3CLNA 1NPQA 1KK7Y 2TN4A 2RGIA 1QTXA 2WCBA 3DVEA 3TS5C 2PSRA 1PVBA 1PVAA 1V1FA 2GGMA 2L4IA 2M29A 1WDCC 4CLNA 1FI5A 3I5IB 1OMDA 3LL8B 3BXKA 1XK4C 4MSPA 4I5NB 2M7LA 2BE4A 1KSMA 4NQGA 4A4CA 1KK8B 2LP3A 1Z4HA 1DEKA 4YI8A 1HQVA 2CBLA 2JPTA 2WCJA 1ZACA 3FE9A 1KFUS 1N2DA 3TDIA 3I5FB 3DZTA 1OOHA 4DS7A 2LVIA 1DVIA 1SCVA 1QV1A 1XFUO 5KSZA 1BU3A 5DKRA 5PALA 5HKZA 5DICA 1F55A 1SYMA 1S5GY 5D7FA 1TUJA 1QASA 2MLEC 1DJWA 2KAYA 1JBAA 1DJIA 1G33A 1DJHA 2LE9B 3ZNIA 2BCBA 1MHOA 4INWA 1ODBA 1U5IB 3IQOA 1DGUA 2KI4C 1CM1A 5B8IB 4DIRA 2OS8C 3DYEA 4PDZA 1NCZA 1JF0A 1UUSA 3R1VA 3SS5A 1S6JA 2CTNA 2M8UA 1XFYO 3D74A 3CZ0A 1S26D 3S0DA 1OMVA 2H8VA 2BL0C 3SG2A 3CR2A 4HSZA 1YTZC 5AXIA 5TNCA 4WQ2A 1E8AA 1DT7B 2LCPA 4OV2A 3EVUA 2M1UA 3AKAA 3CZTX 3WHTB 1Q80A 2Y5IA 3K1EA 4ORCB 1H8BA 2ZN9A 3PALA 3D76A 1DQEA 1NCYA 1SL8A 1XFXO 1P28A 2KFFA 4PE0A 5BPJA 5EL2A 2M0RA 3FE8A 1OSAA 3ZWHA 1MXLC 1YRUB 1VRKA 2EHBA 4OR9B 2YGUA 2NCOA 5KTYA 1W7JB 2E6WA 1IG5A 3B7AA 2WC6A 3OB1B 3R1OA 5J3XA 2CXJA 1R2UA 2BE6A 1QX7A 2M97A 2F2PA 3I5IC 3CDNA 3OBVA 1XFRA 1S36A 2MA2A 1K96A 3D78A 2K0JA 2KSPA 4KYNA 1DTLA 1KFUL 1OZSA 2BKIB 4JWQA 2CCMA 1S1EA 4IJ7A 3BUWB 1KK8C 1A75B 5D3OA 2L51A 2KPHA 1EH2A 1F8HA 4PE7A 3BOWB 3D73A 2B1UA 2Y1MA 3CWGA 1FW4A 1F71A 1OOJA 5GQQC 1KQMB 4PE1A 1AUIB 3I5FC 4FQTA 4OKHA 1SNLA 1W9ZA 1ZFSA 2BBNA 2BECA 2JTZA 2K61A 4P2YB 1KFXL 2WCEA 2F33A 3Q8IA 1B7TY 3BYAA 3DD4A 1B8LA 1QJTA 1ORGA 1AK8A 2P70A 3KO0A 3LK0A 1Z2CB 1B9AA 3D0YB 2DOQA 5CSIA 1WLMA 1H4BA 1AJ5A 2CT9A 4A4BA 2PMYA 1MF8B 2PVBA 1Y1UA 2WC8A 1U5IA 1UWOA 4F7FA 2JT3A 1TRFA 3OX6A 4GBAA 4I5JA 1NX3A 3CZ1A 4WRIA 1SBJA 2LMUA 2JNFA 2HF5A 1Y6WA 5I8NA 2K8MB 2ZNEA 2QEBA 4MVFA 1MXEA 5ER5A 1JC2A 3SG6A 1CDNA 1N65A 2PYQA 5FI7A 3CGAA 1M31A 1DF0A 2Y4QA 4MZLA 2I7AA 2WNDA 3V2LA 1J55A 2P6BB 2MAZA 3D10A 1LVCD 3PLFB 3TDUA 1PRWA 1YX7A 4PCWA 1B47A 2NLNA 1Y0VH 3I5HB 3SS4A 2K7DA 3ICBA 2ZFDA 4QJ5B 3VRNA 1R6PA 4JD9A 2M1KB 1OMRA 3BUXB 4MEWA 3SG7A 5HYDA 2H61A 2ZRSA 1RROA 1CKKA 2QDIA 3OP0A 1S5GZ 1OE9B 3WXAA 1GQMA 2ERBA 1MR8A 3L4AA 3S0EA 2KGBC 3JVTC 1K9PA 3M0WA 3B88A 3D75A 2AAOA 2EGDA 3SIAA 1UHNA 3UO9A 1D1OA 2QPTA 1L7ZA 1A75A 2WC5A 2JRFA 2JULA 5ER4X 1K93D 1L2OC 3BOWA 1IJ5A 1B4CA 1AP4A 1KQMC 3EK8A 2PQLA 3LLEA 1YURA 5CSNA 3LCPC 2GTEA 1PK0D 3D0YA 3VRPA 1MQ1A 2JOJA 2KFHA 3OGNA 1NIWA 2F8PA 2NXQA 5I2QA 1K9UA 2QEHA 5KU1A 1GGZA 2LLSA 2MJWB 3DF0B 5I2LA 1LA0A 5HLVA 3VROA 2MLFC 1ZMZA 4INXA 1RK9A 4JPZB 1SR6C 2M7NA 1DELA 1UHIA 5AANA 1OOGA 1BLQA 1TCFA 5FI6A 4NDBA 1TN4A 3S0AA 1KFXS 2HQWA 1QVIY 1SL7A 3WHUB 1CB1A
chains in the Genus database with same CATH topology
2LANA 3VRQA 2LLTA 1EXRA 1XFVO 1BR1B 1F4OA 1JFJA 4OVNF 1PALA 2LHLA 2LNKA 3FS7A 3SJSA 1TTXA 1CFPA 4NDCA 4HREE 2NCPA 3I5HC 4HRHA 2KQ6A 4GNKB 4FQOA 1A03A 2LHIA 3TUYB 1CFDA 2JNXA 1OQPA 1DF0B 1K9KA 1B7TZ 2Q91A 5DKNA 5HKYA 2BKHB 1IH0A 1YVHA 2LUCA 5K89A 1C7WA 2GGZA 2NZ0A 3EK7A 3O6BA 4PHJA 3HCMA 3SIBA 1IQ5A 1NUBA 1SPYA 2KQYA 2KI6C 4QJ3B 1J1DA 3GK1A 2MRDA 2KAVA 1J7OA 4AOMA 1BMOA 1QS7A 3PN7B 1CLMA 2LVJA 1DJGA 5HKWA 2FCDA 2R2IA 2LMVA 2I2RE 1IWQA 1X02A 1ALWA 1DGVA 1YUTA 2KBIA 2LVKA 2Q4UA 5AFPA 3FWBA 1PSBA 4C0LA 1XFWO 4CFRA 2LM5A 2LP2A 1PSRA 5CSFA 1JFKA 2KBMA 1IKUA 3DF0A 1CFCA 3EVVA 3VRRA 1J7QA 4BY4A 3A8RA 1XA5A 1QXPA 3BQ3A 3QRXA 1CLLA 1JF2A 2BCXA 4GGNA 1B8RA 3FWCA 1SY9A 4PHMA 3RLZA 4AQIA 1WLZA 1S6CA 1F70A 2JXCA 3TS5B 2BBMA 1J7RA 3EKJA 3H4SE 3KHEA 3GOFA 4DUQA 1KK7Z 1A2XA 3EKHA 4CFQA 1LINA 5CSJA 1WRLA 1PULA 1JUOA 1UHKA 2L2EA 2FCEA 1K94A 1K2HA 1YRTB 2L5XB 4MLWA 1EJ3A 2G9BA 1OZOA 3E3RA 3O2PA 2JT8A 1AJ4A 1W7IB 2WORA 5I2OA 1LKJA 3NXAA 2BCAA 2H2KA 3TZ1A 2ZKMX 1J1EA 3TUYC 2ZRTA 2M9GA 4GFTA 1F54A 4I5LB 5JOLA 2JZIA 3EK4A 1ZUZA 3SG5A 2JC2A 4M2OA 2K7CA 3NSKA 3LK1A 1S6IA 4XJKB 2GV5A 2MHHA 1YVLA 2AUCA 2FOTA 1EL4A 3KF9A 1YUSA 2LC5A 4GGFA 3JTDB 2H61C 2L4HA 2COLB 2SASA 3NSOA 2JQ6A 5HLOA 1KQVA 3BUMB 1QATA 1Y1AA 1DJXA 1YUUA 2KI4B 1WY9A 3PN7C 4IL1A 4P5OE 1NYAA 1TNQA 1FI6A 1FPWA 2SCPA 4N1FA 2LVVA 1CFFA 2VRGA 4ORAB 4MN0A 4MZJA 1QX2A 1UHHA 4MRXA 1CTRA 4MBEA 2KHNA 3CTNA 1NWDA 2BL0B 4YRUA 1KWOB 2L98A 4C0KA 2HETA 1TOPA 1HT9A 1TIZA 4YGEB 1KCYA 3DVMA 1SMGA 3F45A 2KI6D 2MBXA 1CM4A 2F3ZA 4F0ZB 2WCFA 3DVKA 1AHRA 4C0JA 1JSAA 1IRJA 1BG1A 2A4JA 4ORBB 2JU0A 2LMTA 1ALVA 1BJFA 2HPSA 4E68A 2M49B 1A4PA 2OTGB 4FTGA 4CIDA 1IGVA 3I5GB 1XK4A 1EG4A 3SG4A 1C07A 4WQ3A 1V1GA 1LXFC 1TNWA 4Q04A 1CNPA 1TNPA 2K7OA 1QLKA 5CPVA 3EVRA 1KSOA 3C1VA 5IBWA 2KGRA 1K95A 3CR4X 2L50A 4PALA 1MUXA 4YGDB 3FIAA 1K90D 1RWYA 5G08A 2Y1NA 1DMOA 4HRGA 1NX0A 2ISDA 2KYFA 3PATA 4NDDA 1NX2A 4XJKA 1SRAA 2PALA 2JXLA 3KEVA 3GK4X 4ZCVA 1A29A 3JTDC 1S3PA 1MWNA 1NCXA 2AMIA 1AVSA 2EC6B 2JTTA 2WOSA 1TNXA 1RECA 2KYCA 4U8DA 1BT6A 3CR5X 4ICBA 4USLA 2K2AA 2KOTA 1SCMB 3RM1A 4AQJA 2LUXA 1CMGA 2QACA 4JQ0D 3NSIA 2OPOA 4L9MA 4I5KA 4N1GA 2HQ8A 4QJ4B 1TCOB 3O78A 4YBHB 1XO5A 4YGAA 4M2QA 3BUNB 1BF5A 1KWOC 1M63B 4MZKA 1G8IA 3O4YA 1M45A 1QX5B 1XVJA 1GJYA 1M39A 1CDPA 2LLUA 5F6TA 3AKBA 1QIWA 1UP5A 1K8UA 1RJVA 2K2FA 3GK2A 3TDZA 1NSHA 1NP8A 1SK6D 3AAJA 3OHMB 5AEQA 1B8CA 1CDLA 1UHJA 2L0PA 2OTGC 2V53A 1IQ3A 3I5GC 2JWWA 1BOCA 1NX1A 3JVTB 4R1EA 2CNPA 5JJGA 4PHKA 4PHNA 1DJZA 3IF7A 2M3WA 4DCKA 3OX5A 1CMFA 4ZCUA 2KDHA 3AAKA 1L2OB 1FBVA 1WDCB 2F2OA 1JWDA 3SG3A 2D8NA 1N0YA 1QIVA 2KAXA 2LV7A 4N5XA 1BODA 2K7BA 1WRZA 4UPGA 4OCIA 1RFJA 4ETOA 5AERA 1RTP1 1XYDA 1FF1A 4YI9A 4DRWA 3A4UB 1LA3A 4M2PA 1C7VA 2F3YA 1CDMA 3DVJA 4GUKA 4TNCA 2E30A 1IJ6A 1F4QA 2I94A 2ZNDA 3MSEB 1WRKA 4GAOA 3KPXA 4CPVA 2EC6C 3PFVA 1SR6B 1YR5A 4PE4A 2KFGA 4BY5A 4XYNA 2ZN8A 1SKTA 1DJYA 1SL9A 1SCMC 1XFZO 4GGFC 2G2BA 5D69A 2KNEA 3IQQA 1Y1XA 1QVIZ 3NSLA 1ZOTB 1YX8A 2OS8B 3OB2B 3PM8A 1M46A 1GGWA 3CS1A 4YGBB 2JT0A 1CLBA 1B1GA 2IS9A 4MRYA 2LAPA 2O5GA 5FYXA 4GPLB 3WNXB 1J7PA 4D1EA 1G4YR 1BR4B 1EG3A 1UURA 2FJUB 5DKQA 3HX4A 2I18A 1SW8A 2O60A 3K21A 3VGOA 3BUOB 1QLSA 2PASA 3PSRA 2PRUA 4YGCB 1QV0A 3CLNA 1NPQA 1KK7Y 2TN4A 2RGIA 1QTXA 2WCBA 3DVEA 3TS5C 2PSRA 1PVBA 1PVAA 1V1FA 2GGMA 2L4IA 2M29A 1WDCC 4CLNA 1FI5A 3I5IB 1OMDA 3LL8B 3BXKA 1XK4C 4MSPA 4I5NB 2M7LA 2BE4A 1KSMA 4NQGA 4A4CA 1KK8B 2LP3A 4YI8A 1HQVA 2CBLA 2JPTA 1ZACA 1KFUS 1N2DA 3TDIA 3I5FB 4DS7A 2LVIA 1DVIA 1SCVA 1QV1A 1XFUO 5KSZA 1BU3A 5DKRA 5PALA 5HKZA 1F55A 1SYMA 1S5GY 5D7FA 1QASA 2MLEC 1DJWA 2KAYA 1JBAA 1DJIA 1G33A 1DJHA 2LE9B 3ZNIA 2BCBA 1MHOA 1ODBA 1U5IB 3IQOA 1DGUA 2KI4C 1CM1A 5B8IB 4DIRA 2OS8C 4PDZA 1NCZA 1JF0A 1UUSA 1S6JA 2CTNA 2M8UA 1XFYO 1S26D 1OMVA 3SG2A 2BL0C 3CR2A 4HSZA 1YTZC 5AXIA 5TNCA 4WQ2A 1E8AA 1DT7B 2LCPA 4OV2A 3EVUA 2M1UA 3AKAA 3CZTX 3WHTB 1Q80A 2Y5IA 4ORCB 1H8BA 2ZN9A 3PALA 1NCYA 1SL8A 1XFXO 2KFFA 4PE0A 5BPJA 2M0RA 1OSAA 3ZWHA 1MXLC 1YRUB 1VRKA 2EHBA 4OR9B 5KTYA 2NCOA 1W7JB 2E6WA 1IG5A 3OB1B 5J3XA 2CXJA 1R2UA 2BE6A 1QX7A 2M97A 2F2PA 3I5IC 1S36A 2MA2A 1K96A 2K0JA 2KSPA 1DTLA 1KFUL 1OZSA 2BKIB 4JWQA 2CCMA 1S1EA 3BUWB 1KK8C 1A75B 2L51A 1EH2A 1F8HA 4PE7A 3BOWB 1F71A 2B1UA 2Y1MA 3CWGA 1FW4A 1OOJA 5GQQC 1KQMB 4PE1A 1AUIB 3I5FC 4OKHA 1SNLA 2JTZA 1ZFSA 2BBNA 2BECA 2K61A 4P2YB 1KFXL 2WCEA 2F33A 1B7TY 3BYAA 3DD4A 1B8LA 1QJTA 1AK8A 3KO0A 3LK0A 1B9AA 3D0YB 2DOQA 5CSIA 1WLMA 1H4BA 1AJ5A 2CT9A 4A4BA 2PMYA 1MF8B 2PVBA 1Y1UA 2WC8A 1U5IA 1UWOA 2JT3A 1TRFA 3OX6A 4GBAA 4I5JA 1NX3A 4WRIA 1SBJA 2LMUA 2JNFA 2HF5A 1Y6WA 5I8NA 2K8MB 2ZNEA 4MVFA 1MXEA 5ER5A 1JC2A 3SG6A 1CDNA 1N65A 3CGAA 1M31A 1DF0A 2Y4QA 4MZLA 2I7AA 2WNDA 1J55A 2P6BB 2MAZA 3D10A 1LVCD 3PLFB 3TDUA 1PRWA 1YX7A 4PCWA 1B47A 2NLNA 1Y0VH 3I5HB 2K7DA 3ICBA 2ZFDA 4QJ5B 3VRNA 1R6PA 4MEWA 2M1KB 1OMRA 3BUXB 3SG7A 5HYDA 2H61A 2ZRSA 1RROA 1CKKA 3OP0A 1S5GZ 1OE9B 3WXAA 1GQMA 1MR8A 2KGBC 3JVTC 1K9PA 3M0WA 2AAOA 2EGDA 3SIAA 1UHNA 1D1OA 2QPTA 1L7ZA 1A75A 2JRFA 2JULA 5ER4X 1K93D 1L2OC 3BOWA 1IJ5A 1B4CA 1AP4A 1KQMC 3EK8A 3LLEA 1YURA 5CSNA 3LCPC 1PK0D 3D0YA 3VRPA 1MQ1A 2JOJA 2KFHA 1NIWA 2F8PA 2NXQA 5I2QA 1K9UA 5KU1A 1GGZA 2LLSA 2MJWB 3DF0B 5I2LA 1LA0A 5HLVA 3VROA 2MLFC 1ZMZA 4JPZB 1RK9A 1SR6C 2M7NA 1UHIA 1BLQA 5AANA 1TCFA 4NDBA 1TN4A 1KFXS 2HQWA 1QVIY 1SL7A 3WHUB 1CB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAN A;  3VRQ A;  2LLT A;  1EXR A;  1XFV O;  1BR1 B;  1F4O A;  1JFJ A;  4OVN F;  1PAL A;  2LHL A;  2LNK A;  3FS7 A;  3SJS A;  1TTX A;  1CFP A;  4NDC A;  4HRE E;  2NCP A;  3I5H C;  4HRH A;  2KQ6 A;  4GNK B;  4FQO A;  1A03 A;  2LHI A;  3TUY B;  1CFD A;  2JNX A;  1OQP A;  1DF0 B;  1K9K A;  1B7T Z;  2Q91 A;  5DKN A;  5HKY A;  2BKH B;  1IH0 A;  1YVH A;  2LUC A;  5K89 A;  1C7W A;  2GGZ A;  2NZ0 A;  3EK7 A;  3O6B A;  4PHJ A;  3HCM A;  3SIB A;  1IQ5 A;  1NUB A;  1SPY A;  2KQY A;  2KI6 C;  4QJ3 B;  1J1D A;  3GK1 A;  2MRD A;  2KAV A;  1J7O A;  4AOM A;  1BMO A;  1QS7 A;  3PN7 B;  1CLM A;  2LVJ A;  1DJG A;  5HKW A;  2FCD A;  2R2I A;  2LMV A;  2I2R E;  1IWQ A;  1X02 A;  1ALW A;  1DGV A;  1YUT A;  2KBI A;  2LVK A;  2Q4U A;  5AFP A;  3FWB A;  1PSB A;  4C0L A;  1XFW O;  4CFR A;  2LM5 A;  2LP2 A;  1PSR A;  5CSF A;  1JFK A;  2KBM A;  1IKU A;  3DF0 A;  1CFC A;  3EVV A;  3VRR A;  1J7Q A;  4BY4 A;  3A8R A;  1XA5 A;  1QXP A;  3BQ3 A;  3QRX A;  1CLL A;  1JF2 A;  2BCX A;  4GGN A;  1B8R A;  3FWC A;  1SY9 A;  4PHM A;  3RLZ A;  4AQI A;  1WLZ A;  1S6C A;  1F70 A;  2JXC A;  3TS5 B;  2BBM A;  1J7R A;  3EKJ A;  3H4S E;  3KHE A;  3GOF A;  4DUQ A;  1KK7 Z;  1A2X A;  3EKH A;  4CFQ A;  1LIN A;  5CSJ A;  1WRL A;  1PUL A;  1JUO A;  1UHK A;  2L2E A;  2FCE A;  1K94 A;  1K2H A;  1YRT B;  2L5X B;  4MLW A;  1EJ3 A;  2G9B A;  1OZO A;  3E3R A;  3O2P A;  2JT8 A;  1AJ4 A;  1W7I B;  2WOR A;  5I2O A;  1LKJ A;  3NXA A;  2BCA A;  2H2K A;  3TZ1 A;  2ZKM X;  1J1E A;  3TUY C;  2ZRT A;  2M9G A;  4GFT A;  1F54 A;  4I5L B;  5JOL A;  2JZI A;  3EK4 A;  1ZUZ A;  3SG5 A;  2JC2 A;  4M2O A;  2K7C A;  3NSK A;  3LK1 A;  1S6I A;  4XJK B;  2GV5 A;  2MHH A;  1YVL A;  2AUC A;  2FOT A;  1EL4 A;  3KF9 A;  1YUS A;  2LC5 A;  4GGF A;  3JTD B;  2H61 C;  2L4H A;  2COL B;  2SAS A;  3NSO A;  2JQ6 A;  5HLO A;  1KQV A;  3BUM B;  1QAT A;  1Y1A A;  1DJX A;  1YUU A;  2KI4 B;  1WY9 A;  3PN7 C;  4IL1 A;  4P5O E;  1NYA A;  1TNQ A;  1FI6 A;  1FPW A;  2SCP A;  4N1F A;  2LVV A;  1CFF A;  2VRG A;  4ORA B;  4MN0 A;  4MZJ A;  1QX2 A;  1UHH A;  4MRX A;  1CTR A;  4MBE A;  2KHN A;  3CTN A;  1NWD A;  2BL0 B;  4YRU A;  1KWO B;  2L98 A;  4C0K A;  2HET A;  1TOP A;  1HT9 A;  1TIZ A;  4YGE B;  1KCY A;  3DVM A;  1SMG A;  3F45 A;  2KI6 D;  2MBX A;  1CM4 A;  2F3Z A;  4F0Z B;  2WCF A;  3DVK A;  1AHR A;  4C0J A;  1JSA A;  1IRJ A;  1BG1 A;  2A4J A;  4ORB B;  2JU0 A;  2LMT A;  1ALV A;  1BJF A;  2HPS A;  4E68 A;  2M49 B;  1A4P A;  2OTG B;  4FTG A;  4CID A;  1IGV A;  3I5G B;  1XK4 A;  1EG4 A;  3SG4 A;  1C07 A;  4WQ3 A;  1V1G A;  1LXF C;  1TNW A;  4Q04 A;  1CNP A;  1TNP A;  2K7O A;  1QLK A;  5CPV A;  3EVR A;  1KSO A;  3C1V A;  5IBW A;  2KGR A;  1K95 A;  3CR4 X;  2L50 A;  4PAL A;  1MUX A;  4YGD B;  3FIA A;  1K90 D;  1RWY A;  5G08 A;  2Y1N A;  1DMO A;  4HRG A;  1NX0 A;  2ISD A;  2KYF A;  3PAT A;  4NDD A;  1NX2 A;  4XJK A;  1SRA A;  2PAL A;  2JXL A;  3KEV A;  3GK4 X;  4ZCV A;  1A29 A;  3JTD C;  1S3P A;  1MWN A;  1NCX A;  2AMI A;  1AVS A;  2EC6 B;  2JTT A;  2WOS A;  1TNX A;  1REC A;  2KYC A;  4U8D A;  1BT6 A;  3CR5 X;  4ICB A;  4USL A;  2K2A A;  2KOT A;  1SCM B;  3RM1 A;  4AQJ A;  2LUX A;  1CMG A;  2QAC A;  4JQ0 D;  3NSI A;  2OPO A;  4L9M A;  4I5K A;  4N1G A;  2HQ8 A;  4QJ4 B;  1TCO B;  3O78 A;  4YBH B;  1XO5 A;  4YGA A;  4M2Q A;  3BUN B;  1BF5 A;  1KWO C;  1M63 B;  4MZK A;  1G8I A;  3O4Y A;  1M45 A;  1QX5 B;  1XVJ A;  1GJY A;  1M39 A;  1CDP A;  2LLU A;  5F6T A;  3AKB A;  1QIW A;  1UP5 A;  1K8U A;  1RJV A;  2K2F A;  3GK2 A;  3TDZ A;  1NSH A;  1NP8 A;  1SK6 D;  3AAJ A;  3OHM B;  5AEQ A;  1B8C A;  1CDL A;  1UHJ A;  2L0P A;  2OTG C;  2V53 A;  1IQ3 A;  3I5G C;  2JWW A;  1BOC A;  1NX1 A;  3JVT B;  4R1E A;  2CNP A;  5JJG A;  4PHK A;  4PHN A;  1DJZ A;  3IF7 A;  2M3W A;  4DCK A;  3OX5 A;  1CMF A;  4ZCU A;  2KDH A;  3AAK A;  1L2O B;  1FBV A;  1WDC B;  2F2O A;  1JWD A;  3SG3 A;  2D8N A;  1N0Y A;  1QIV A;  2KAX A;  2LV7 A;  4N5X A;  1BOD A;  2K7B A;  1WRZ A;  4UPG A;  4OCI A;  1RFJ A;  4ETO A;  5AER A;  1RTP 1;  1XYD A;  1FF1 A;  4YI9 A;  4DRW A;  3A4U B;  1LA3 A;  4M2P A;  1C7V A;  2F3Y A;  1CDM A;  3DVJ A;  4GUK A;  4TNC A;  2E30 A;  1IJ6 A;  1F4Q A;  2I94 A;  2ZND A;  3MSE B;  1WRK A;  4GAO A;  3KPX A;  4CPV A;  2EC6 C;  3PFV A;  1SR6 B;  1YR5 A;  4PE4 A;  2KFG A;  4BY5 A;  4XYN A;  2ZN8 A;  1SKT A;  1DJY A;  1SL9 A;  1SCM C;  1XFZ O;  4GGF C;  2G2B A;  5D69 A;  2KNE A;  3IQQ A;  1Y1X A;  1QVI Z;  3NSL A;  1ZOT B;  1YX8 A;  2OS8 B;  3OB2 B;  3PM8 A;  1M46 A;  1GGW A;  3CS1 A;  4YGB B;  2JT0 A;  1CLB A;  1B1G A;  2IS9 A;  4MRY A;  2LAP A;  2O5G A;  5FYX A;  4GPL B;  3WNX B;  1J7P A;  4D1E A;  1G4Y R;  1BR4 B;  1EG3 A;  1UUR A;  2FJU B;  5DKQ A;  3HX4 A;  2I18 A;  1SW8 A;  2O60 A;  3K21 A;  3VGO A;  3BUO B;  1QLS A;  2PAS A;  3PSR A;  2PRU A;  4YGC B;  1QV0 A;  3CLN A;  1NPQ A;  1KK7 Y;  2TN4 A;  2RGI A;  1QTX A;  2WCB A;  3DVE A;  3TS5 C;  2PSR A;  1PVB A;  1PVA A;  1V1F A;  2GGM A;  2L4I A;  2M29 A;  1WDC C;  4CLN A;  1FI5 A;  3I5I B;  1OMD A;  3LL8 B;  3BXK A;  1XK4 C;  4MSP A;  4I5N B;  2M7L A;  2BE4 A;  1KSM A;  4NQG A;  4A4C A;  1KK8 B;  2LP3 A;  4YI8 A;  1HQV A;  2CBL A;  2JPT A;  1ZAC A;  1KFU S;  1N2D A;  3TDI A;  3I5F B;  4DS7 A;  2LVI A;  1DVI A;  1SCV A;  1QV1 A;  1XFU O;  5KSZ A;  1BU3 A;  5DKR A;  5PAL A;  5HKZ A;  1F55 A;  1SYM A;  1S5G Y;  5D7F A;  1QAS A;  2MLE C;  1DJW A;  2KAY A;  1JBA A;  1DJI A;  1G33 A;  1DJH A;  2LE9 B;  3ZNI A;  2BCB A;  1MHO A;  1ODB A;  1U5I B;  3IQO A;  1DGU A;  2KI4 C;  1CM1 A;  5B8I B;  4DIR A;  2OS8 C;  4PDZ A;  1NCZ A;  1JF0 A;  1UUS A;  1S6J A;  2CTN A;  2M8U A;  1XFY O;  1S26 D;  1OMV A;  3SG2 A;  2BL0 C;  3CR2 A;  4HSZ A;  1YTZ C;  5AXI A;  5TNC A;  4WQ2 A;  1E8A A;  1DT7 B;  2LCP A;  4OV2 A;  3EVU A;  2M1U A;  3AKA A;  3CZT X;  3WHT B;  1Q80 A;  2Y5I A;  4ORC B;  1H8B A;  2ZN9 A;  3PAL A;  1NCY A;  1SL8 A;  1XFX O;  2KFF A;  4PE0 A;  5BPJ A;  2M0R A;  1OSA A;  3ZWH A;  1MXL C;  1YRU B;  1VRK A;  2EHB A;  4OR9 B;  5KTY A;  2NCO A;  1W7J B;  2E6W A;  1IG5 A;  3OB1 B;  5J3X A;  2CXJ A;  1R2U A;  2BE6 A;  1QX7 A;  2M97 A;  2F2P A;  3I5I C;  1S36 A;  2MA2 A;  1K96 A;  2K0J A;  2KSP A;  1DTL A;  1KFU L;  1OZS A;  2BKI B;  4JWQ A;  2CCM A;  1S1E A;  3BUW B;  1KK8 C;  1A75 B;  2L51 A;  1EH2 A;  1F8H A;  4PE7 A;  3BOW B;  1F71 A;  2B1U A;  2Y1M A;  3CWG A;  1FW4 A;  1OOJ A;  5GQQ C;  1KQM B;  4PE1 A;  1AUI B;  3I5F C;  4OKH A;  1SNL A;  2JTZ A;  1ZFS A;  2BBN A;  2BEC A;  2K61 A;  4P2Y B;  1KFX L;  2WCE A;  2F33 A;  1B7T Y;  3BYA A;  3DD4 A;  1B8L A;  1QJT A;  1AK8 A;  3KO0 A;  3LK0 A;  1B9A A;  3D0Y B;  2DOQ A;  5CSI A;  1WLM A;  1H4B A;  1AJ5 A;  2CT9 A;  4A4B A;  2PMY A;  1MF8 B;  2PVB A;  1Y1U A;  2WC8 A;  1U5I A;  1UWO A;  2JT3 A;  1TRF A;  3OX6 A;  4GBA A;  4I5J A;  1NX3 A;  4WRI A;  1SBJ A;  2LMU A;  2JNF A;  2HF5 A;  1Y6W A;  5I8N A;  2K8M B;  2ZNE A;  4MVF A;  1MXE A;  5ER5 A;  1JC2 A;  3SG6 A;  1CDN A;  1N65 A;  3CGA A;  1M31 A;  1DF0 A;  2Y4Q A;  4MZL A;  2I7A A;  2WND A;  1J55 A;  2P6B B;  2MAZ A;  3D10 A;  1LVC D;  3PLF B;  3TDU A;  1PRW A;  1YX7 A;  4PCW A;  1B47 A;  2NLN A;  1Y0V H;  3I5H B;  2K7D A;  3ICB A;  2ZFD A;  4QJ5 B;  3VRN A;  1R6P A;  4MEW A;  2M1K B;  1OMR A;  3BUX B;  3SG7 A;  5HYD A;  2H61 A;  2ZRS A;  1RRO A;  1CKK A;  3OP0 A;  1S5G Z;  1OE9 B;  3WXA A;  1GQM A;  1MR8 A;  2KGB C;  3JVT C;  1K9P A;  3M0W A;  2AAO A;  2EGD A;  3SIA A;  1UHN A;  1D1O A;  2QPT A;  1L7Z A;  1A75 A;  2JRF A;  2JUL A;  5ER4 X;  1K93 D;  1L2O C;  3BOW A;  1IJ5 A;  1B4C A;  1AP4 A;  1KQM C;  3EK8 A;  3LLE A;  1YUR A;  5CSN A;  3LCP C;  1PK0 D;  3D0Y A;  3VRP A;  1MQ1 A;  2JOJ A;  2KFH A;  1NIW A;  2F8P A;  2NXQ A;  5I2Q A;  1K9U A;  5KU1 A;  1GGZ A;  2LLS A;  2MJW B;  3DF0 B;  5I2L A;  1LA0 A;  5HLV A;  3VRO A;  2MLF C;  1ZMZ A;  4JPZ B;  1RK9 A;  1SR6 C;  2M7N A;  1UHI A;  1BLQ A;  5AAN A;  1TCF A;  4NDB A;  1TN4 A;  1KFX S;  2HQW A;  1QVI Y;  1SL7 A;  3WHU B;  1CB1 A; 
#chains in the Genus database with same CATH topology
 2LAN A;  3VRQ A;  2LLT A;  3UNW A;  1EXR A;  1XFV O;  1BR1 B;  1F4O A;  1JFJ A;  4OVN F;  1PAL A;  2LHL A;  2LNK A;  3BFB A;  3FS7 A;  3NHT A;  3SJS A;  1TTX A;  1CFP A;  4NDC A;  4HRE E;  2NCP A;  3I5H C;  4HRH A;  2KQ6 A;  4GNK B;  2WCH A;  4FQO A;  1A03 A;  2LHI A;  3TUY B;  1CFD A;  2JNX A;  1OQP A;  1DF0 B;  1K9K A;  1B7T Z;  2Q91 A;  5DKN A;  5HKY A;  2BKH B;  1IH0 A;  1YVH A;  2LUC A;  5K89 A;  1C7W A;  2GGZ A;  2NZ0 A;  3EK7 A;  3O6B A;  2BNX A;  4PHJ A;  3HCM A;  3SIB A;  1IQ5 A;  1NUB A;  1SPY A;  2KQY A;  2KI6 C;  2K60 A;  4QJ3 B;  1J1D A;  3GK1 A;  2MRD A;  2KAV A;  1J7O A;  4AOM A;  1BMO A;  1QS7 A;  3PN7 B;  1CLM A;  2LVJ A;  1DJG A;  3L4L A;  5HKW A;  3R1P A;  2FCD A;  2R2I A;  2LMV A;  2I2R E;  5HL1 A;  1IWQ A;  1X02 A;  1ALW A;  1DGV A;  1YUT A;  2KBI A;  2LVK A;  2Q4U A;  3B86 A;  5AFP A;  3FWB A;  1PSB A;  4C0L A;  1XFW O;  4CFR A;  2LM5 A;  2LP2 A;  3BJH A;  1PSR A;  5CSF A;  1JFK A;  2KBM A;  1IKU A;  3DF0 A;  1CFC A;  3EVV A;  3VRR A;  1J7Q A;  4BY4 A;  3A8R A;  1XA5 A;  1QXP A;  1C3Y A;  3BQ3 A;  3QRX A;  1CLL A;  1JF2 A;  2BCX A;  4GGN A;  1B8R A;  3FWC A;  3NGV A;  1SY9 A;  4PHM A;  3RLZ A;  4AQI A;  1WLZ A;  3FE6 A;  1S6C A;  1F70 A;  2JXC A;  3TS5 B;  2BBM A;  1J7R A;  3EKJ A;  3H4S E;  3KHE A;  3GOF A;  4DUQ A;  1KK7 Z;  1A2X A;  3EKH A;  4CFQ A;  1LIN A;  3CAB A;  3RZS A;  5CSJ A;  3DY9 A;  1WRL A;  1PUL A;  1QWV A;  1TWO A;  1JUO A;  1UHK A;  2L2E A;  2FCE A;  1K94 A;  1K2H A;  1YRT B;  2L5X B;  4MLW A;  1EJ3 A;  2G9B A;  1OZO A;  1OOI X;  3E3R A;  3O2P A;  2JT8 A;  1AJ4 A;  1W7I B;  2L5Y A;  2WOR A;  5I2O A;  1LKJ A;  3NXA A;  5FI2 A;  2BCA A;  2H2K A;  4JKT A;  2ZKM X;  1J1E A;  3TZ1 A;  3TUY C;  2ZRT A;  2M9G A;  4GFT A;  1F54 A;  4I5L B;  3D77 A;  5JOL A;  2JZI A;  3EK4 A;  1ZUZ A;  3L47 A;  3SG5 A;  2JC2 A;  4M2O A;  2K7C A;  3NSK A;  3LK1 A;  1S6I A;  4XJK B;  2GV5 A;  2MHH A;  1YVL A;  2AUC A;  2FOT A;  1EL4 A;  3KF9 A;  1YUS A;  2LC5 A;  4GGF A;  3JTD B;  2H61 C;  2WCL A;  2L4H A;  2COL B;  2SAS A;  3NSO A;  2JQ6 A;  5HLO A;  1KQV A;  3BUM B;  1QAT A;  1Y1A A;  1DJX A;  1YUU A;  2KI4 B;  1WY9 A;  3PN7 C;  4IL1 A;  4P5O E;  1NYA A;  1TNQ A;  1FI6 A;  1FPW A;  2SCP A;  4N1F A;  2LVV A;  1CFF A;  2VRG A;  3QME A;  4ORA B;  3BFH A;  4MN0 A;  4MZJ A;  2KLD A;  1QX2 A;  1UHH A;  4MRX A;  1CTR A;  4MBE A;  2KHN A;  3CTN A;  1NWD A;  2BL0 B;  4YRU A;  1KWO B;  2L98 A;  4C0K A;  2HET A;  1TOP A;  1HT9 A;  1TIZ A;  4YGE B;  1KCY A;  3DVM A;  1SMG A;  3F45 A;  2KI6 D;  2MBX A;  1CM4 A;  2F3Z A;  4F0Z B;  2WCF A;  3DVK A;  2KLE A;  1AHR A;  4C0J A;  3S0B A;  3B87 A;  1JSA A;  1IRJ A;  1BG1 A;  2A4J A;  4ORB B;  2JU0 A;  2LMT A;  1ALV A;  1BJF A;  2HPS A;  4E68 A;  2M49 B;  1DC1 A;  1A4P A;  2OTG B;  4FTG A;  4CID A;  1IGV A;  3I5G B;  1XK4 A;  1EG4 A;  1T14 A;  3SG4 A;  1C07 A;  4WQ3 A;  1V1G A;  1LXF C;  1TNW A;  4Q04 A;  1CNP A;  1TNP A;  2K7O A;  1QLK A;  3NHI A;  5CPV A;  3EVR A;  1KSO A;  3C1V A;  5IBW A;  2KGR A;  2FJY A;  1IIO A;  1K95 A;  3CR4 X;  2L50 A;  4PAL A;  1MUX A;  4YGD B;  3FIA A;  1K90 D;  1RWY A;  3N7H A;  5G08 A;  2Y1N A;  1DMO A;  1OOF A;  4HRG A;  1NX0 A;  2ISD A;  2KYF A;  3PAT A;  2QEO A;  4NDD A;  1NX2 A;  4XJK A;  1SRA A;  2PAL A;  2BAP A;  2JXL A;  3KEV A;  3GK4 X;  4ZCV A;  4OZD A;  1A29 A;  3EG5 B;  3JTD C;  1S3P A;  1TUZ A;  2P71 A;  1MWN A;  1NCX A;  1SSE B;  2AMI A;  1AVS A;  1OW4 A;  2EC6 B;  2JTT A;  1TNX A;  1REC A;  2KYC A;  2WOS A;  4U8D A;  1BT6 A;  3CR5 X;  4ICB A;  4USL A;  2K2A A;  2KOT A;  1SCM B;  3RM1 A;  4AQJ A;  2LUX A;  1CMG A;  2QAC A;  4JQ0 D;  3NSI A;  2OPO A;  4L9M A;  4I5K A;  4N1G A;  2HQ8 A;  4QJ4 B;  1TCO B;  3O78 A;  3S0G A;  4YBH B;  1XO5 A;  4YGA A;  4M2Q A;  3BUN B;  4PT1 A;  1BF5 A;  1KWO C;  1M63 B;  4MZK A;  1G8I A;  3O4Y A;  1M45 A;  3PJI A;  1QX5 B;  1XVJ A;  1GJY A;  1M39 A;  1CDP A;  2LLU A;  5F6T A;  3R72 A;  3AKB A;  1QIW A;  1UP5 A;  1K8U A;  1RJV A;  2K2F A;  3GK2 A;  3TDZ A;  1NSH A;  1NP8 A;  1SK6 D;  3AAJ A;  3OHM B;  5AEQ A;  1B8C A;  1CDL A;  1UHJ A;  2L0P A;  2OTG C;  2V53 A;  1IQ3 A;  3I5G C;  2JWW A;  1BOC A;  1NX1 A;  3JVT B;  4R1E A;  2CNP A;  5JJG A;  4PHK A;  2WCK A;  4PHN A;  1DJZ A;  3IF7 A;  2M3W A;  4DCK A;  3OX5 A;  1GM0 A;  3VB1 A;  1CMF A;  4ZCU A;  2KDH A;  3AAK A;  1LS8 A;  1L2O B;  1FBV A;  1WDC B;  2F2O A;  3CZ2 A;  1JWD A;  3SG3 A;  3PM2 A;  2D8N A;  1N0Y A;  1QIV A;  2KAX A;  2LV7 A;  4N5X A;  1BOD A;  2K7B A;  1WRZ A;  4UPG A;  4OCI A;  1RFJ A;  4ETO A;  5AER A;  1RTP 1;  1XYD A;  1FF1 A;  4YI9 A;  4DRW A;  3A4U B;  1C3Z A;  1LA3 A;  4M2P A;  1C7V A;  2F3Y A;  1CDM A;  3DVJ A;  4GUK A;  4TNC A;  2E30 A;  5I94 A;  1IJ6 A;  1F4Q A;  2I94 A;  2ZND A;  3DXL A;  3MSE B;  1WRK A;  4GAO A;  3CYZ A;  3KPX A;  4CPV A;  2EC6 C;  3PFV A;  1SR6 B;  1YR5 A;  3SS3 A;  4PE4 A;  2KFG A;  2L2C A;  2QEV A;  4BY5 A;  4XYN A;  2ZN8 A;  1SKT A;  2WCM A;  1DJY A;  1SL9 A;  1SCM C;  1XFZ O;  4GGF C;  2G2B A;  3IVT A;  5D69 A;  2KNE A;  3IQQ A;  3BFA A;  1Y1X A;  1QVI Z;  3NSL A;  1ZOT B;  1YX8 A;  2OS8 B;  3OB2 B;  3PM8 A;  1M46 A;  3B6X A;  1GGW A;  3CS1 A;  4YGB B;  2JT0 A;  1CLB A;  1B1G A;  2IS9 A;  4MRY A;  2LAP A;  2O5G A;  5FYX A;  4GPL B;  3WNX B;  1J7P A;  4D1E A;  2JPO A;  1G4Y R;  1BR4 B;  1EG3 A;  1UUR A;  2FJU B;  5DKQ A;  3HX4 A;  2I18 A;  3O4X A;  1SW8 A;  2O60 A;  3K21 A;  3VGO A;  3BUO B;  1QLS A;  2PAS A;  3PSR A;  2PRU A;  4YGC B;  3S0F A;  1QV0 A;  3CLN A;  1NPQ A;  1KK7 Y;  2TN4 A;  2RGI A;  1QTX A;  2WCB A;  3DVE A;  3TS5 C;  2PSR A;  1PVB A;  1PVA A;  1V1F A;  2GGM A;  2L4I A;  2M29 A;  1WDC C;  4CLN A;  1FI5 A;  3I5I B;  1OMD A;  3LL8 B;  3BXK A;  1XK4 C;  4MSP A;  4I5N B;  2M7L A;  2BE4 A;  1KSM A;  4NQG A;  4A4C A;  1KK8 B;  2LP3 A;  1Z4H A;  1DEK A;  4YI8 A;  1HQV A;  2CBL A;  2JPT A;  2WCJ A;  1ZAC A;  3FE9 A;  1KFU S;  1N2D A;  3TDI A;  3I5F B;  3DZT A;  1OOH A;  4DS7 A;  2LVI A;  1DVI A;  1SCV A;  1QV1 A;  1XFU O;  5KSZ A;  1BU3 A;  5DKR A;  5PAL A;  5HKZ A;  5DIC A;  1F55 A;  1SYM A;  1S5G Y;  5D7F A;  1TUJ A;  1QAS A;  2MLE C;  1DJW A;  2KAY A;  1JBA A;  1DJI A;  1G33 A;  1DJH A;  2LE9 B;  3ZNI A;  2BCB A;  1MHO A;  4INW A;  1ODB A;  1U5I B;  3IQO A;  1DGU A;  2KI4 C;  1CM1 A;  5B8I B;  4DIR A;  2OS8 C;  3DYE A;  4PDZ A;  1NCZ A;  1JF0 A;  1UUS A;  3R1V A;  3SS5 A;  1S6J A;  2CTN A;  2M8U A;  1XFY O;  3D74 A;  3CZ0 A;  1S26 D;  3S0D A;  1OMV A;  2H8V A;  2BL0 C;  3SG2 A;  3CR2 A;  4HSZ A;  1YTZ C;  5AXI A;  5TNC A;  4WQ2 A;  1E8A A;  1DT7 B;  2LCP A;  4OV2 A;  3EVU A;  2M1U A;  3AKA A;  3CZT X;  3WHT B;  1Q80 A;  2Y5I A;  3K1E A;  4ORC B;  1H8B A;  2ZN9 A;  3PAL A;  3D76 A;  1DQE A;  1NCY A;  1SL8 A;  1XFX O;  1P28 A;  2KFF A;  4PE0 A;  5BPJ A;  5EL2 A;  2M0R A;  3FE8 A;  1OSA A;  3ZWH A;  1MXL C;  1YRU B;  1VRK A;  2EHB A;  4OR9 B;  2YGU A;  2NCO A;  5KTY A;  1W7J B;  2E6W A;  1IG5 A;  3B7A A;  2WC6 A;  3OB1 B;  3R1O A;  5J3X A;  2CXJ A;  1R2U A;  2BE6 A;  1QX7 A;  2M97 A;  2F2P A;  3I5I C;  3CDN A;  3OBV A;  1XFR A;  1S36 A;  2MA2 A;  1K96 A;  3D78 A;  2K0J A;  2KSP A;  4KYN A;  1DTL A;  1KFU L;  1OZS A;  2BKI B;  4JWQ A;  2CCM A;  1S1E A;  4IJ7 A;  3BUW B;  1KK8 C;  1A75 B;  5D3O A;  2L51 A;  2KPH A;  1EH2 A;  1F8H A;  4PE7 A;  3BOW B;  3D73 A;  2B1U A;  2Y1M A;  3CWG A;  1FW4 A;  1F71 A;  1OOJ A;  5GQQ C;  1KQM B;  4PE1 A;  1AUI B;  3I5F C;  4FQT A;  4OKH A;  1SNL A;  1W9Z A;  1ZFS A;  2BBN A;  2BEC A;  2JTZ A;  2K61 A;  4P2Y B;  1KFX L;  2WCE A;  2F33 A;  3Q8I A;  1B7T Y;  3BYA A;  3DD4 A;  1B8L A;  1QJT A;  1ORG A;  1AK8 A;  2P70 A;  3KO0 A;  3LK0 A;  1Z2C B;  1B9A A;  3D0Y B;  2DOQ A;  5CSI A;  1WLM A;  1H4B A;  1AJ5 A;  2CT9 A;  4A4B A;  2PMY A;  1MF8 B;  2PVB A;  1Y1U A;  2WC8 A;  1U5I A;  1UWO A;  4F7F A;  2JT3 A;  1TRF A;  3OX6 A;  4GBA A;  4I5J A;  1NX3 A;  3CZ1 A;  4WRI A;  1SBJ A;  2LMU A;  2JNF A;  2HF5 A;  1Y6W A;  5I8N A;  2K8M B;  2ZNE A;  2QEB A;  4MVF A;  1MXE A;  5ER5 A;  1JC2 A;  3SG6 A;  1CDN A;  1N65 A;  2PYQ A;  5FI7 A;  3CGA A;  1M31 A;  1DF0 A;  2Y4Q A;  4MZL A;  2I7A A;  2WND A;  3V2L A;  1J55 A;  2P6B B;  2MAZ A;  3D10 A;  1LVC D;  3PLF B;  3TDU A;  1PRW A;  1YX7 A;  4PCW A;  1B47 A;  2NLN A;  1Y0V H;  3I5H B;  3SS4 A;  2K7D A;  3ICB A;  2ZFD A;  4QJ5 B;  3VRN A;  1R6P A;  4JD9 A;  2M1K B;  1OMR A;  3BUX B;  4MEW A;  3SG7 A;  5HYD A;  2H61 A;  2ZRS A;  1RRO A;  1CKK A;  2QDI A;  3OP0 A;  1S5G Z;  1OE9 B;  3WXA A;  1GQM A;  2ERB A;  1MR8 A;  3L4A A;  3S0E A;  2KGB C;  3JVT C;  1K9P A;  3M0W A;  3B88 A;  3D75 A;  2AAO A;  2EGD A;  3SIA A;  1UHN A;  3UO9 A;  1D1O A;  2QPT A;  1L7Z A;  1A75 A;  2WC5 A;  2JRF A;  2JUL A;  5ER4 X;  1K93 D;  1L2O C;  3BOW A;  1IJ5 A;  1B4C A;  1AP4 A;  1KQM C;  3EK8 A;  2PQL A;  3LLE A;  1YUR A;  5CSN A;  3LCP C;  2GTE A;  1PK0 D;  3D0Y A;  3VRP A;  1MQ1 A;  2JOJ A;  2KFH A;  3OGN A;  1NIW A;  2F8P A;  2NXQ A;  5I2Q A;  1K9U A;  2QEH A;  5KU1 A;  1GGZ A;  2LLS A;  2MJW B;  3DF0 B;  5I2L A;  1LA0 A;  5HLV A;  3VRO A;  2MLF C;  1ZMZ A;  4INX A;  1RK9 A;  4JPZ B;  1SR6 C;  2M7N A;  1DEL A;  1UHI A;  5AAN A;  1OOG A;  1BLQ A;  1TCF A;  5FI6 A;  4NDB A;  1TN4 A;  3S0A A;  1KFX S;  2HQW A;  1QVI Y;  1SL7 A;  3WHU B;  1CB1 A; 
#chains in the Genus database with same CATH homology
 2LAN A;  3VRQ A;  2LLT A;  1EXR A;  1XFV O;  1BR1 B;  1F4O A;  1JFJ A;  4OVN F;  1PAL A;  2LHL A;  2LNK A;  3FS7 A;  3SJS A;  1TTX A;  1CFP A;  4NDC A;  4HRE E;  2NCP A;  3I5H C;  4HRH A;  2KQ6 A;  4GNK B;  4FQO A;  1A03 A;  2LHI A;  3TUY B;  1CFD A;  2JNX A;  1OQP A;  1DF0 B;  1K9K A;  1B7T Z;  2Q91 A;  5DKN A;  5HKY A;  2BKH B;  1IH0 A;  1YVH A;  2LUC A;  5K89 A;  1C7W A;  2GGZ A;  2NZ0 A;  3EK7 A;  3O6B A;  4PHJ A;  3HCM A;  3SIB A;  1IQ5 A;  1NUB A;  1SPY A;  2KQY A;  2KI6 C;  4QJ3 B;  1J1D A;  3GK1 A;  2MRD A;  2KAV A;  1J7O A;  4AOM A;  1BMO A;  1QS7 A;  3PN7 B;  1CLM A;  2LVJ A;  1DJG A;  5HKW A;  2FCD A;  2R2I A;  2LMV A;  2I2R E;  1IWQ A;  1X02 A;  1ALW A;  1DGV A;  1YUT A;  2KBI A;  2LVK A;  2Q4U A;  5AFP A;  3FWB A;  1PSB A;  4C0L A;  1XFW O;  4CFR A;  2LM5 A;  2LP2 A;  1PSR A;  5CSF A;  1JFK A;  2KBM A;  1IKU A;  3DF0 A;  1CFC A;  3EVV A;  3VRR A;  1J7Q A;  4BY4 A;  3A8R A;  1XA5 A;  1QXP A;  3BQ3 A;  3QRX A;  1CLL A;  1JF2 A;  2BCX A;  4GGN A;  1B8R A;  3FWC A;  1SY9 A;  4PHM A;  3RLZ A;  4AQI A;  1WLZ A;  1S6C A;  1F70 A;  2JXC A;  3TS5 B;  2BBM A;  1J7R A;  3EKJ A;  3H4S E;  3KHE A;  3GOF A;  4DUQ A;  1KK7 Z;  1A2X A;  3EKH A;  4CFQ A;  1LIN A;  5CSJ A;  1WRL A;  1PUL A;  1JUO A;  1UHK A;  2L2E A;  2FCE A;  1K94 A;  1K2H A;  1YRT B;  2L5X B;  4MLW A;  1EJ3 A;  2G9B A;  1OZO A;  3E3R A;  3O2P A;  2JT8 A;  1AJ4 A;  1W7I B;  2WOR A;  5I2O A;  1LKJ A;  3NXA A;  2BCA A;  2H2K A;  3TZ1 A;  2ZKM X;  1J1E A;  3TUY C;  2ZRT A;  2M9G A;  4GFT A;  1F54 A;  4I5L B;  5JOL A;  2JZI A;  3EK4 A;  1ZUZ A;  3SG5 A;  2JC2 A;  4M2O A;  2K7C A;  3NSK A;  3LK1 A;  1S6I A;  4XJK B;  2GV5 A;  2MHH A;  1YVL A;  2AUC A;  2FOT A;  1EL4 A;  3KF9 A;  1YUS A;  2LC5 A;  4GGF A;  3JTD B;  2H61 C;  2L4H A;  2COL B;  2SAS A;  3NSO A;  2JQ6 A;  5HLO A;  1KQV A;  3BUM B;  1QAT A;  1Y1A A;  1DJX A;  1YUU A;  2KI4 B;  1WY9 A;  3PN7 C;  4IL1 A;  4P5O E;  1NYA A;  1TNQ A;  1FI6 A;  1FPW A;  2SCP A;  4N1F A;  2LVV A;  1CFF A;  2VRG A;  4ORA B;  4MN0 A;  4MZJ A;  1QX2 A;  1UHH A;  4MRX A;  1CTR A;  4MBE A;  2KHN A;  3CTN A;  1NWD A;  2BL0 B;  4YRU A;  1KWO B;  2L98 A;  4C0K A;  2HET A;  1TOP A;  1HT9 A;  1TIZ A;  4YGE B;  1KCY A;  3DVM A;  1SMG A;  3F45 A;  2KI6 D;  2MBX A;  1CM4 A;  2F3Z A;  4F0Z B;  2WCF A;  3DVK A;  1AHR A;  4C0J A;  1JSA A;  1IRJ A;  1BG1 A;  2A4J A;  4ORB B;  2JU0 A;  2LMT A;  1ALV A;  1BJF A;  2HPS A;  4E68 A;  2M49 B;  1A4P A;  2OTG B;  4FTG A;  4CID A;  1IGV A;  3I5G B;  1XK4 A;  1EG4 A;  3SG4 A;  1C07 A;  4WQ3 A;  1V1G A;  1LXF C;  1TNW A;  4Q04 A;  1CNP A;  1TNP A;  2K7O A;  1QLK A;  5CPV A;  3EVR A;  1KSO A;  3C1V A;  5IBW A;  2KGR A;  1K95 A;  3CR4 X;  2L50 A;  4PAL A;  1MUX A;  4YGD B;  3FIA A;  1K90 D;  1RWY A;  5G08 A;  2Y1N A;  1DMO A;  4HRG A;  1NX0 A;  2ISD A;  2KYF A;  3PAT A;  4NDD A;  1NX2 A;  4XJK A;  1SRA A;  2PAL A;  2JXL A;  3KEV A;  3GK4 X;  4ZCV A;  1A29 A;  3JTD C;  1S3P A;  1MWN A;  1NCX A;  2AMI A;  1AVS A;  2EC6 B;  2JTT A;  2WOS A;  1TNX A;  1REC A;  2KYC A;  4U8D A;  1BT6 A;  3CR5 X;  4ICB A;  4USL A;  2K2A A;  2KOT A;  1SCM B;  3RM1 A;  4AQJ A;  2LUX A;  1CMG A;  2QAC A;  4JQ0 D;  3NSI A;  2OPO A;  4L9M A;  4I5K A;  4N1G A;  2HQ8 A;  4QJ4 B;  1TCO B;  3O78 A;  4YBH B;  1XO5 A;  4YGA A;  4M2Q A;  3BUN B;  1BF5 A;  1KWO C;  1M63 B;  4MZK A;  1G8I A;  3O4Y A;  1M45 A;  1QX5 B;  1XVJ A;  1GJY A;  1M39 A;  1CDP A;  2LLU A;  5F6T A;  3AKB A;  1QIW A;  1UP5 A;  1K8U A;  1RJV A;  2K2F A;  3GK2 A;  3TDZ A;  1NSH A;  1NP8 A;  1SK6 D;  3AAJ A;  3OHM B;  5AEQ A;  1B8C A;  1CDL A;  1UHJ A;  2L0P A;  2OTG C;  2V53 A;  1IQ3 A;  3I5G C;  2JWW A;  1BOC A;  1NX1 A;  3JVT B;  4R1E A;  2CNP A;  5JJG A;  4PHK A;  4PHN A;  1DJZ A;  3IF7 A;  2M3W A;  4DCK A;  3OX5 A;  1CMF A;  4ZCU A;  2KDH A;  3AAK A;  1L2O B;  1FBV A;  1WDC B;  2F2O A;  1JWD A;  3SG3 A;  2D8N A;  1N0Y A;  1QIV A;  2KAX A;  2LV7 A;  4N5X A;  1BOD A;  2K7B A;  1WRZ A;  4UPG A;  4OCI A;  1RFJ A;  4ETO A;  5AER A;  1RTP 1;  1XYD A;  1FF1 A;  4YI9 A;  4DRW A;  3A4U B;  1LA3 A;  4M2P A;  1C7V A;  2F3Y A;  1CDM A;  3DVJ A;  4GUK A;  4TNC A;  2E30 A;  1IJ6 A;  1F4Q A;  2I94 A;  2ZND A;  3MSE B;  1WRK A;  4GAO A;  3KPX A;  4CPV A;  2EC6 C;  3PFV A;  1SR6 B;  1YR5 A;  4PE4 A;  2KFG A;  4BY5 A;  4XYN A;  2ZN8 A;  1SKT A;  1DJY A;  1SL9 A;  1SCM C;  1XFZ O;  4GGF C;  2G2B A;  5D69 A;  2KNE A;  3IQQ A;  1Y1X A;  1QVI Z;  3NSL A;  1ZOT B;  1YX8 A;  2OS8 B;  3OB2 B;  3PM8 A;  1M46 A;  1GGW A;  3CS1 A;  4YGB B;  2JT0 A;  1CLB A;  1B1G A;  2IS9 A;  4MRY A;  2LAP A;  2O5G A;  5FYX A;  4GPL B;  3WNX B;  1J7P A;  4D1E A;  1G4Y R;  1BR4 B;  1EG3 A;  1UUR A;  2FJU B;  5DKQ A;  3HX4 A;  2I18 A;  1SW8 A;  2O60 A;  3K21 A;  3VGO A;  3BUO B;  1QLS A;  2PAS A;  3PSR A;  2PRU A;  4YGC B;  1QV0 A;  3CLN A;  1NPQ A;  1KK7 Y;  2TN4 A;  2RGI A;  1QTX A;  2WCB A;  3DVE A;  3TS5 C;  2PSR A;  1PVB A;  1PVA A;  1V1F A;  2GGM A;  2L4I A;  2M29 A;  1WDC C;  4CLN A;  1FI5 A;  3I5I B;  1OMD A;  3LL8 B;  3BXK A;  1XK4 C;  4MSP A;  4I5N B;  2M7L A;  2BE4 A;  1KSM A;  4NQG A;  4A4C A;  1KK8 B;  2LP3 A;  4YI8 A;  1HQV A;  2CBL A;  2JPT A;  1ZAC A;  1KFU S;  1N2D A;  3TDI A;  3I5F B;  4DS7 A;  2LVI A;  1DVI A;  1SCV A;  1QV1 A;  1XFU O;  5KSZ A;  1BU3 A;  5DKR A;  5PAL A;  5HKZ A;  1F55 A;  1SYM A;  1S5G Y;  5D7F A;  1QAS A;  2MLE C;  1DJW A;  2KAY A;  1JBA A;  1DJI A;  1G33 A;  1DJH A;  2LE9 B;  3ZNI A;  2BCB A;  1MHO A;  1ODB A;  1U5I B;  3IQO A;  1DGU A;  2KI4 C;  1CM1 A;  5B8I B;  4DIR A;  2OS8 C;  4PDZ A;  1NCZ A;  1JF0 A;  1UUS A;  1S6J A;  2CTN A;  2M8U A;  1XFY O;  1S26 D;  1OMV A;  3SG2 A;  2BL0 C;  3CR2 A;  4HSZ A;  1YTZ C;  5AXI A;  5TNC A;  4WQ2 A;  1E8A A;  1DT7 B;  2LCP A;  4OV2 A;  3EVU A;  2M1U A;  3AKA A;  3CZT X;  3WHT B;  1Q80 A;  2Y5I A;  4ORC B;  1H8B A;  2ZN9 A;  3PAL A;  1NCY A;  1SL8 A;  1XFX O;  2KFF A;  4PE0 A;  5BPJ A;  2M0R A;  1OSA A;  3ZWH A;  1MXL C;  1YRU B;  1VRK A;  2EHB A;  4OR9 B;  5KTY A;  2NCO A;  1W7J B;  2E6W A;  1IG5 A;  3OB1 B;  5J3X A;  2CXJ A;  1R2U A;  2BE6 A;  1QX7 A;  2M97 A;  2F2P A;  3I5I C;  1S36 A;  2MA2 A;  1K96 A;  2K0J A;  2KSP A;  1DTL A;  1KFU L;  1OZS A;  2BKI B;  4JWQ A;  2CCM A;  1S1E A;  3BUW B;  1KK8 C;  1A75 B;  2L51 A;  1EH2 A;  1F8H A;  4PE7 A;  3BOW B;  1F71 A;  2B1U A;  2Y1M A;  3CWG A;  1FW4 A;  1OOJ A;  5GQQ C;  1KQM B;  4PE1 A;  1AUI B;  3I5F C;  4OKH A;  1SNL A;  2JTZ A;  1ZFS A;  2BBN A;  2BEC A;  2K61 A;  4P2Y B;  1KFX L;  2WCE A;  2F33 A;  1B7T Y;  3BYA A;  3DD4 A;  1B8L A;  1QJT A;  1AK8 A;  3KO0 A;  3LK0 A;  1B9A A;  3D0Y B;  2DOQ A;  5CSI A;  1WLM A;  1H4B A;  1AJ5 A;  2CT9 A;  4A4B A;  2PMY A;  1MF8 B;  2PVB A;  1Y1U A;  2WC8 A;  1U5I A;  1UWO A;  2JT3 A;  1TRF A;  3OX6 A;  4GBA A;  4I5J A;  1NX3 A;  4WRI A;  1SBJ A;  2LMU A;  2JNF A;  2HF5 A;  1Y6W A;  5I8N A;  2K8M B;  2ZNE A;  4MVF A;  1MXE A;  5ER5 A;  1JC2 A;  3SG6 A;  1CDN A;  1N65 A;  3CGA A;  1M31 A;  1DF0 A;  2Y4Q A;  4MZL A;  2I7A A;  2WND A;  1J55 A;  2P6B B;  2MAZ A;  3D10 A;  1LVC D;  3PLF B;  3TDU A;  1PRW A;  1YX7 A;  4PCW A;  1B47 A;  2NLN A;  1Y0V H;  3I5H B;  2K7D A;  3ICB A;  2ZFD A;  4QJ5 B;  3VRN A;  1R6P A;  4MEW A;  2M1K B;  1OMR A;  3BUX B;  3SG7 A;  5HYD A;  2H61 A;  2ZRS A;  1RRO A;  1CKK A;  3OP0 A;  1S5G Z;  1OE9 B;  3WXA A;  1GQM A;  1MR8 A;  2KGB C;  3JVT C;  1K9P A;  3M0W A;  2AAO A;  2EGD A;  3SIA A;  1UHN A;  1D1O A;  2QPT A;  1L7Z A;  1A75 A;  2JRF A;  2JUL A;  5ER4 X;  1K93 D;  1L2O C;  3BOW A;  1IJ5 A;  1B4C A;  1AP4 A;  1KQM C;  3EK8 A;  3LLE A;  1YUR A;  5CSN A;  3LCP C;  1PK0 D;  3D0Y A;  3VRP A;  1MQ1 A;  2JOJ A;  2KFH A;  1NIW A;  2F8P A;  2NXQ A;  5I2Q A;  1K9U A;  5KU1 A;  1GGZ A;  2LLS A;  2MJW B;  3DF0 B;  5I2L A;  1LA0 A;  5HLV A;  3VRO A;  2MLF C;  1ZMZ A;  4JPZ B;  1RK9 A;  1SR6 C;  2M7N A;  1UHI A;  1BLQ A;  5AAN A;  1TCF A;  4NDB A;  1TN4 A;  1KFX S;  2HQW A;  1QVI Y;  1SL7 A;  3WHU B;  1CB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...