4FQTA

Structure of agamobp1 bound to 6-methyl-5-hepten-2-one
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anopheles Gambiae Odorant Binding protein 1
publication title Interactions of Anopheles gambiae Odorant-binding Proteins with a Human-derived Repellent: IMPLICATIONS FOR THE MODE OF ACTION OF N,N-DIETHYL-3-METHYLBENZAMIDE (DEET).
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Odorant-binding protein
total genus 40
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4fqtA01
3S0AA 1OOFA 3CZ2A 2QEBA 3DY9A 3B86A 3FE9A 2WCKA 3Q8IA 3CABA 2QDIA 2PQLA 1OOIX 3L4AA 3S0BA 1TUJA 3D78A 4FQTA 3R1OA 1ORGA 3D75A 3L47A 4PT1A 2WCHA 2WC6A 2WCLA 3S0FA 2ERBA 2H8VA 2P71A 3CZ1A 3D77A 1QWVA 3CZ0A 1T14A 3B6XA 3S0GA 2L2CA 3D73A 3NHTA 3OGNA 3S0EA 1TWOA 3CDNA 3S0DA 3R72A 3BFAA 1OOGA 1P28A 4JD9A 5DICA 3FE6A 2P70A 3R1VA 4INWA 3V2LA 3D76A 1C3ZA 2QEOA 1OOHA 2QEVA 3B87A 2GTEA 3CYZA 1LS8A 3DYEA 2WCJA 3QMEA 2FJYA 2WCMA 2WC5A 3BFHA 3BJHA 3DZTA 3B7AA 3NHIA 3R1PA 3FE8A 1C3YA 1OW4A 3D74A 4INXA 5EL2A 3NGVA 3VB1A 3PJIA 1DQEA 1XFRA 3BFBA 3DXLA 3N7HA 3RZSA 2JPOA 4F7FA 2KPHA 2QEHA 1GM0A 3L4LA 4OZDA 3K1EA 3B88A
chains in the Genus database with same CATH superfamily
1QV1A 1J1EA 1RECA 3IVTA 1FI6A 1UHJA 4GAOA 3KF9A 3SS4A 1KQVA 4OVNF 2I2RE 2JXLA 3SJSA 5F6TA 3EKJA 2WOSA 3GK1A 2BKIB 1S6CA 1M45A 1N2DA 3FE9A 4ZCUA 2WCKA 1KWOC 1SR6B 1IQ3A 1C7VA 2JZIA 1WRKA 3PM2A 2OPOA 2F3YA 5CSJA 2K7CA 3D78A 2LHIA 2KSPA 1CFPA 2Y1MA 4PHKA 1IG5A 5I2LA 1KK8B 2ZN9A 3O78A 1OMRA 1SCMB 4NDBA 3ICBA 1SBJA 3ZWHA 1DJHA 4DCKA 1UURA 3OB2B 4MBEA 2JT0A 5I2OA 1UWOA 1LA0A 2OTGC 4ORBB 4CFQA 1CFCA 2CCMA 1K9UA 2WC6A 1MXLC 2M9GA 3QRXA 1B7TZ 3OHMB 2I7AA 1CDLA 1S6IA 2V53A 1TUZA 1WLMA 1WY9A 1PVBA 2G9BA 3D77A 3IQQA 1YTZC 1YRUB 3BXKA 1W7JB 1CMGA 3CTNA 3B6XA 3BUWB 4YGEB 5JJGA 3MSEB 3OB1B 2BE6A 1NYAA 1QV0A 2L2CA 1ODBA 4Q04A 1KFXL 1AUIB 3AKAA 2WCFA 1M39A 1BT6A 4KYNA 1QXPA 1AHRA 3NSIA 1CLMA 4GFTA 2LCPA 1J1DA 4XYNA 2MLEC 3BFAA 3JTDB 4MZJA 5CSNA 4DIRA 1QIVA 1YVLA 1PSBA 2ZNDA 1AJ5A 3TS5B 3KO0A 5DICA 5D3OA 1J7PA 1JFJA 5DKQA 2KAYA 1Z2CB 3SIBA 1SKTA 2AAOA 1CM1A 1Y1AA 2BECA 1YUTA 1WRZA 3UNWA 1C3ZA 2NCPA 1OOHA 2BAPA 4AQIA 1PVAA 2QEVA 4E68A 3CZTX 1SL9A 1Y0VH 2K7BA 3I5IB 4PE1A 3B87A 4NDCA 2L4IA 1B4CA 3AKBA 2PYQA 2KBMA 1WDCB 4ZCVA 2YGUA 2JNXA 2EC6B 2WNDA 4P5OE 1RROA 1TNPA 3I5HB 1KK7Y 4FQOA 2BL0C 4TNCA 3DZTA 3B7AA 3PFVA 2M7LA 3H4SE 1R6PA 3TDZA 3IF7A 2LMTA 3FE8A 1PSRA 1SK6D 4INXA 4JKTA 2JXCA 5I8NA 2ZNEA 1OMVA 3HX4A 4OV2A 4ETOA 1XFRA 3LK0A 2JT8A 1DEKA 3BFBA 1TN4A 2Q4UA 1S36A 1QS7A 2I94A 3GK2A 2L4HA 1H4BA 1TNXA 5AEQA 3DVKA 4MSPA 4A4CA 4WQ2A 1GM0A 1C7WA 3CR5X 5KU1A 2H2KA 1QIWA 2JQ6A 3O4YA 1NCYA 1GQMA 3TDIA 2TN4A 1TOPA 4WRIA 5I2QA 2M0RA 1J7OA 2BCBA 4USLA 1TCOB 4CLNA 1OOFA 1B47A 1KQMB 1F70A 3O6BA 3I5FB 1UUSA 3CZ2A 3DY9A 1OMDA 1QJTA 4JQ0D 1JBAA 2KYFA 4L9MA 3FWBA 4A4BA 1BOCA 1K8UA 3Q8IA 1NX2A 1Z4HA 1S5GY 2E6WA 1SNLA 1OOIX 2KLEA 1NCXA 3L4AA 1TUJA 1SL8A 4ORAB 1EJ3A 4FQTA 1EL4A 1QLKA 4JPZB 2M29A 1DELA 3DVJA 4M2PA 3CWGA 4AOMA 2FCDA 1EXRA 2O5GA 2BKHB 4PT1A 3LK1A 4PHJA 1NSHA 2LC5A 1DJZA 1NP8A 1CLBA 1TIZA 1DJIA 1QLSA 3FWCA 2A4JA 1DJYA 2KYCA 2LLTA 2LVVA 3PATA 1XYDA 3KEVA 1WRLA 1OOJA 2HPSA 1LINA 1MUXA 5FI7A 5KTYA 2WCLA 1K9PA 4MRXA 1TRFA 2Y1NA 3O4XA 3RLZA 2ZKMX 2ERBA 1N65A 3D0YB 3EG5B 1G8IA 1SPYA 1A75B 1IIOA 1Y1UA 2LE9B 1T14A 1QVIZ 2KI4C 3ZNIA 2G2BA 1CB1A 1JC2A 1M46A 2ZRSA 1FPWA 1ZUZA 3S0EA 2JWWA 3FS7A 1SCVA 1F8HA 2B1UA 3CGAA 4N1FA 1YX8A 3GOFA 2JT3A 1G33A 4GGFA 4PDZA 1P28A 1KWOB 1LVCD 2H61A 1BR1B 2JRFA 2AUCA 3FE6A 2P70A 1B8CA 1F54A 1XK4C 2LAPA 1IRJA 1TTXA 3KHEA 3LL8B 3D0YA 1R2UA 4GBAA 1FI5A 2KFHA 5HYDA 1SCMC 3VRQA 4CIDA 1A75A 3V2LA 4XJKB 2GGMA 3D76A 4DS7A 2LUCA 2PASA 4IL1A 1TNQA 1XFWO 1Q80A 4CPVA 2LM5A 1G4YR 2M49B 4YGDB 5CSIA 3CYZA 2OTGB 1RK9A 2L0PA 1SL7A 1QVIY 1E8AA 5D69A 5DKNA 2LVKA 4QJ5B 1IJ6A 2PRUA 1XVJA 4ICBA 2GV5A 1LA3A 3BFHA 1JWDA 3BJHA 3DVEA 3NXAA 2KFGA 3VGOA 5HLOA 1AK8A 1GGWA 1XFXO 4YGBB 1F71A 2L50A 4QJ3B 4XJKA 1C3YA 1RTP1 1N0YA 1JF0A 5EL2A 4DRWA 1K2HA 1XFUO 1CM4A 2K2AA 3VB1A 1B8RA 2F33A 2JC2A 3PJIA 2L98A 2KGRA 1B7TY 4MN0A 3TS5C 3EK8A 1GJYA 1NCZA 5IBWA 2COLB 1K9KA 4UPGA 5ER4X 1RWYA 4GUKA 1SW8A 4OR9B 5JOLA 2BBNA 1JF2A 1UHNA 1DTLA 1PALA 2KPHA 2Q91A 2QEHA 4F7FA 1KFUS 3K21A 2KHNA 1Y6WA 1QTXA 4DUQA 1OZSA 1DF0B 4CFRA 1MR8A 1IKUA 1A4PA 2L51A 5HL1A 4OZDA 1XFZO 5ER5A 2M7NA 2JU0A 4YGCB 1CFFA 3CR4X 1X02A 3SG5A 3JVTB 4PE7A 5PALA 2PSRA 3S0AA 4PE0A 1BR4B 2QEBA 1HQVA 1EG4A 1PRWA 4HRHA 1TNWA 2Y4QA 3WHUB 2BL0B 2Y5IA 2MRDA 2KAXA 3CS1A 1EG3A 1RJVA 2JNFA 2JULA 2PQLA 2QDIA 3AAJA 3S0BA 1K94A 2KI6D 1XO5A 1DF0A 1ZFSA 3SG7A 1ORGA 5AXIA 3OX6A 3DF0B 1SRAA 1BODA 2ZRTA 2FJUB 2WCHA 3PM8A 1EH2A 4R1EA 3PN7C 3VRPA 1V1GA 3SIAA 1S3PA 1Y1XA 4MZLA 1TCFA 2K7OA 3NSKA 1M31A 2DOQA 3S0FA 5BPJA 4OCIA 4QJ4B 4C0LA 2H8VA 1AP4A 1LKJA 2BBMA 3TZ1A 1AJ4A 3TUYC 5HLVA 1KFUL 3I5GC 2OS8C 5AERA 5D7FA 1F4QA 3S0GA 1FF1A 1KSMA 1KQMC 2KQYA 1UP5A 2HETA 1J7RA 2MLFC 2SASA 1B9AA 4GPLB 1B8LA 3DF0A 5I94A 1SY9A 2AMIA 1CNPA 1NX1A 2ZFDA 1OE9B 1TWOA 3HCMA 3OBVA 1DT7B 1PULA 2CT9A 1IJ5A 2LMVA 4MLWA 1BF5A 2KOTA 2K2FA 5K89A 3OX5A 4F0ZB 1CFDA 4GNKB 1K96A 4JD9A 1MXEA 3WHTB 4C0KA 3E3RA 1M63B 2JTZA 2M1KB 1YX7A 2WCEA 1DC1A 1XA5A 2QACA 2CXJA 4GGNA 1F4OA 2LHLA 3RZSA 1L2OB 1RFJA 4INWA 1W7IB 2QPTA 1CMFA 1DJGA 1NWDA 1XFVO 1QX5B 3D10A 3B88A 2GTEA 2SCPA 4GGFC 2I18A 2EGDA 2H61C 3VROA 1PK0D 4YI9A 2WCJA 2LP3A 2LLUA 1CDPA 1SSEB 2RGIA 3QMEA 2FJYA 2WC5A 2F3ZA 1ZOTB 4MEWA 1KSOA 1LXFC 1MWNA 1ALWA 1SR6C 3EVUA 5HKZA 4D1EA 5HKYA 3WNXB 3IQOA 3A4UB 3NHIA 2LP2A 4YBHB 1D1OA 1NPQA 3NSOA 2MA2A 1FBVA 2KI4B 1FW4A 3D74A 4PE4A 4HREE 1KK8C 4I5NB 3SG6A 3NGVA 1BG1A 1NIWA 4PHMA 1YVHA 3VRRA 3LLEA 2ZN8A 4U8DA 1QATA 3C1VA 3DXLA 3SS3A 1F55A 3N7HA 1S26D 2MHHA 1IWQA 2JPOA 1BLQA 1CTRA 4HSZA 2KLDA 1B1GA 2JTTA 4ORCB 3CR2A 1IGVA 2PALA 3L4LA 3FIAA 2CNPA 3EKHA 2E30A 4JWQA 1CDMA 2LV7A 4PHNA 2KBIA 2BNXA 4MRYA 1ALVA 2IS9A 2KNEA 1J55A 3LCPC 4FTGA 2R2IA 2BCAA 1DJWA 3KPXA 4OKHA 5CPVA 5AANA 2BE4A 3B86A 3JTDC 1YUUA 1BMOA 1AVSA 1DVIA 3O2PA 3BUOB 1XK4A 4BY4A 1K90D 3CABA 4AQJA 2F8PA 1BU3A 1KK7Z 2KI6C 2M8UA 1XFYO 1MF8B 5TNCA 1BJFA 3BUNB 1JSAA 3R1OA 3TDUA 1CDNA 3GK4X 3D75A 3L47A 5FI6A 2K7DA 2HQWA 1S1EA 3PALA 3PLFB 2JOJA 5AFPA 1YUSA 4HRGA 1SMGA 2KDHA 3I5IC 5HKWA 5J3XA 1MHOA 2L5YA 3BUXB 1WDCC 5KSZA 2HF5A 1YRTB 2EC6C 2WC8A 4YRUA 2JPTA 4PALA 3I5HC 1K93D 2P71A 3CZ1A 1V1FA 2F2OA 1YR5A 5DKRA 1QWVA 3EVRA 3CZ0A 1A29A 2FOTA 1QX7A 3JVTC 1GGZA 4WQ3A 3D73A 2M1UA 2PVBA 3NHTA 1UHKA 1VRKA 4PCWA 1JUOA 1NX3A 3NSLA 5GQQC 1YURA 1NX0A 3OGNA 4N1GA 3CLNA 4MVFA 3CDNA 3S0DA 4I5LB 3DD4A 3R72A 1DGVA 3BOWB 4I5KA 2LUXA 4NQGA 5FI2A 3BQ3A 2MAZA 2LVIA 1OOGA 1S6JA 4P2YB 1CLLA 3AAKA 2PMYA 1JFKA 3RM1A 1H8BA 2P6BB 1IH0A 4YI8A 1ZACA 1SYMA 3R1VA 3EK7A 2M3WA 1NUBA 2K8MB 1QASA 2K0JA 1S5GZ 1A2XA 2M97A 2QEOA 3DVMA 3EVVA 1C07A 5B8IB 4MZKA 2GGZA 2ISDA 2NXQA 2MJWB 1LS8A 3PN7B 1DGUA 2L5XB 3BOWA 2CBLA 3DYEA 4I5JA 2MBXA 2NZ0A 3I5FC 1K95A 1UHIA 2EHBA 1QX2A 2LNKA 3EK4A 3WXAA 2WCMA 5FYXA 1U5IB 2KQ6A 1MQ1A 1HT9A 2K60A 3TUYB 2L2EA 3BYAA 4BY5A 2KGBC 4NDDA 2BCXA 1ZMZA 3I5GB 2O60A 2OS8B 1DJXA 1KCYA 3R1PA 3BUMB 1L7ZA 3A8RA 3SG3A 1OW4A 3OP0A 3M0WA 2NLNA 3UO9A 3PSRA 1A03A 1DQEA 2FCEA 2F2PA 2WORA 4N5XA 2NCOA 4M2QA 3SG4A 2HQ8A 5CSFA 2D8NA 2LANA 2LMUA 3SG2A 3VRNA 2WCBA 3F45A 4IJ7A 1J7QA 1OZOA 2LVJA 1L2OC 1U5IA 2KAVA 5G08A 2CTNA 4M2OA 1OQPA 1CKKA 2K61A 4YGAA 4C0JA 1UHHA 1OSAA 1KFXS 1WLZA 3SS5A 2KFFA 1DMOA 3K1EA 2VRGA 1W9ZA 1IQ5A 2LLSA
chains in the Genus database with same CATH topology
3S0AA 1OOFA 3CZ2A 2QEBA 3DY9A 3B86A 3FE9A 2WCKA 3Q8IA 3CABA 2QDIA 2PQLA 1OOIX 3L4AA 3S0BA 1TUJA 3D78A 4FQTA 3R1OA 1ORGA 3D75A 3L47A 4PT1A 2WCHA 2WC6A 2WCLA 3S0FA 2ERBA 2H8VA 2P71A 3CZ1A 3D77A 1QWVA 3CZ0A 1T14A 3B6XA 3S0GA 2L2CA 3D73A 3NHTA 3OGNA 3S0EA 1TWOA 3CDNA 3S0DA 3R72A 3BFAA 1OOGA 1P28A 4JD9A 5DICA 3FE6A 2P70A 3R1VA 4INWA 3V2LA 3D76A 1C3ZA 2QEOA 1OOHA 2QEVA 3B87A 2GTEA 3CYZA 1LS8A 3DYEA 2WCJA 3QMEA 2FJYA 2WCMA 2WC5A 3BFHA 3BJHA 3DZTA 3B7AA 3NHIA 3R1PA 3FE8A 1C3YA 1OW4A 3D74A 4INXA 5EL2A 3NGVA 3VB1A 3PJIA 1DQEA 1XFRA 3BFBA 3DXLA 3N7HA 3RZSA 2JPOA 4F7FA 2KPHA 2QEHA 1GM0A 3L4LA 4OZDA 3K1EA 3B88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0A A;  1OOF A;  3CZ2 A;  2QEB A;  3DY9 A;  3B86 A;  3FE9 A;  2WCK A;  3Q8I A;  3CAB A;  2QDI A;  2PQL A;  1OOI X;  3L4A A;  3S0B A;  1TUJ A;  3D78 A;  4FQT A;  3R1O A;  1ORG A;  3D75 A;  3L47 A;  4PT1 A;  2WCH A;  2WC6 A;  2WCL A;  3S0F A;  2ERB A;  2H8V A;  2P71 A;  3CZ1 A;  3D77 A;  1QWV A;  3CZ0 A;  1T14 A;  3B6X A;  3S0G A;  2L2C A;  3D73 A;  3NHT A;  3OGN A;  3S0E A;  1TWO A;  3CDN A;  3S0D A;  3R72 A;  3BFA A;  1OOG A;  1P28 A;  4JD9 A;  5DIC A;  3FE6 A;  2P70 A;  3R1V A;  4INW A;  3V2L A;  3D76 A;  1C3Z A;  2QEO A;  1OOH A;  2QEV A;  3B87 A;  2GTE A;  3CYZ A;  1LS8 A;  3DYE A;  2WCJ A;  3QME A;  2FJY A;  2WCM A;  2WC5 A;  3BFH A;  3BJH A;  3DZT A;  3B7A A;  3NHI A;  3R1P A;  3FE8 A;  1C3Y A;  1OW4 A;  3D74 A;  4INX A;  5EL2 A;  3NGV A;  3VB1 A;  3PJI A;  1DQE A;  1XFR A;  3BFB A;  3DXL A;  3N7H A;  3RZS A;  2JPO A;  4F7F A;  2KPH A;  2QEH A;  1GM0 A;  3L4L A;  4OZD A;  3K1E A;  3B88 A; 
#chains in the Genus database with same CATH topology
 1QV1 A;  1J1E A;  1REC A;  3IVT A;  1FI6 A;  1UHJ A;  4GAO A;  3KF9 A;  3SS4 A;  1KQV A;  4OVN F;  2I2R E;  2JXL A;  3SJS A;  5F6T A;  3EKJ A;  2WOS A;  3GK1 A;  2BKI B;  1S6C A;  1M45 A;  1N2D A;  3FE9 A;  4ZCU A;  2WCK A;  1KWO C;  1SR6 B;  1IQ3 A;  1C7V A;  2JZI A;  1WRK A;  3PM2 A;  2OPO A;  2F3Y A;  5CSJ A;  2K7C A;  3D78 A;  2LHI A;  2KSP A;  1CFP A;  2Y1M A;  4PHK A;  1IG5 A;  5I2L A;  1KK8 B;  2ZN9 A;  3O78 A;  1OMR A;  1SCM B;  4NDB A;  3ICB A;  1SBJ A;  3ZWH A;  1DJH A;  4DCK A;  1UUR A;  3OB2 B;  4MBE A;  2JT0 A;  5I2O A;  1UWO A;  1LA0 A;  2OTG C;  4ORB B;  4CFQ A;  1CFC A;  2CCM A;  1K9U A;  2WC6 A;  1MXL C;  2M9G A;  3QRX A;  1B7T Z;  3OHM B;  2I7A A;  1CDL A;  1S6I A;  2V53 A;  1TUZ A;  1WLM A;  1WY9 A;  1PVB A;  2G9B A;  3D77 A;  3IQQ A;  1YTZ C;  1YRU B;  3BXK A;  1W7J B;  1CMG A;  3CTN A;  3B6X A;  3BUW B;  4YGE B;  5JJG A;  3MSE B;  3OB1 B;  2BE6 A;  1NYA A;  1QV0 A;  2L2C A;  1ODB A;  4Q04 A;  1KFX L;  1AUI B;  3AKA A;  2WCF A;  1M39 A;  1BT6 A;  4KYN A;  1QXP A;  1AHR A;  3NSI A;  1CLM A;  4GFT A;  2LCP A;  1J1D A;  4XYN A;  2MLE C;  3BFA A;  3JTD B;  4MZJ A;  5CSN A;  4DIR A;  1QIV A;  1YVL A;  1PSB A;  2ZND A;  1AJ5 A;  3TS5 B;  3KO0 A;  5DIC A;  5D3O A;  1J7P A;  1JFJ A;  5DKQ A;  2KAY A;  1Z2C B;  3SIB A;  1SKT A;  2AAO A;  1CM1 A;  1Y1A A;  2BEC A;  1YUT A;  1WRZ A;  3UNW A;  1C3Z A;  2NCP A;  1OOH A;  2BAP A;  4AQI A;  1PVA A;  2QEV A;  4E68 A;  3CZT X;  1SL9 A;  1Y0V H;  2K7B A;  3I5I B;  4PE1 A;  3B87 A;  4NDC A;  2L4I A;  1B4C A;  3AKB A;  2PYQ A;  2KBM A;  1WDC B;  4ZCV A;  2YGU A;  2JNX A;  2EC6 B;  2WND A;  4P5O E;  1RRO A;  1TNP A;  3I5H B;  1KK7 Y;  4FQO A;  2BL0 C;  4TNC A;  3DZT A;  3B7A A;  3PFV A;  2M7L A;  3H4S E;  1R6P A;  3TDZ A;  3IF7 A;  2LMT A;  3FE8 A;  1PSR A;  1SK6 D;  4INX A;  4JKT A;  2JXC A;  5I8N A;  2ZNE A;  1OMV A;  3HX4 A;  4OV2 A;  4ETO A;  1XFR A;  3LK0 A;  2JT8 A;  1DEK A;  3BFB A;  1TN4 A;  2Q4U A;  1S36 A;  1QS7 A;  2I94 A;  3GK2 A;  2L4H A;  1H4B A;  1TNX A;  5AEQ A;  3DVK A;  4MSP A;  4A4C A;  4WQ2 A;  1GM0 A;  1C7W A;  3CR5 X;  5KU1 A;  2H2K A;  1QIW A;  2JQ6 A;  3O4Y A;  1NCY A;  1GQM A;  3TDI A;  2TN4 A;  1TOP A;  4WRI A;  5I2Q A;  2M0R A;  1J7O A;  2BCB A;  4USL A;  1TCO B;  4CLN A;  1OOF A;  1B47 A;  1KQM B;  1F70 A;  3O6B A;  3I5F B;  1UUS A;  3CZ2 A;  3DY9 A;  1OMD A;  1QJT A;  4JQ0 D;  1JBA A;  2KYF A;  4L9M A;  3FWB A;  4A4B A;  1BOC A;  1K8U A;  3Q8I A;  1NX2 A;  1Z4H A;  1S5G Y;  2E6W A;  1SNL A;  1OOI X;  2KLE A;  1NCX A;  3L4A A;  1TUJ A;  1SL8 A;  4ORA B;  1EJ3 A;  4FQT A;  1EL4 A;  1QLK A;  4JPZ B;  2M29 A;  1DEL A;  3DVJ A;  4M2P A;  3CWG A;  4AOM A;  2FCD A;  1EXR A;  2O5G A;  2BKH B;  4PT1 A;  3LK1 A;  4PHJ A;  1NSH A;  2LC5 A;  1DJZ A;  1NP8 A;  1CLB A;  1TIZ A;  1DJI A;  1QLS A;  3FWC A;  2A4J A;  1DJY A;  2KYC A;  2LLT A;  2LVV A;  3PAT A;  1XYD A;  3KEV A;  1WRL A;  1OOJ A;  2HPS A;  1LIN A;  1MUX A;  5FI7 A;  5KTY A;  2WCL A;  1K9P A;  4MRX A;  1TRF A;  2Y1N A;  3O4X A;  3RLZ A;  2ZKM X;  2ERB A;  1N65 A;  3D0Y B;  3EG5 B;  1G8I A;  1SPY A;  1A75 B;  1IIO A;  1Y1U A;  2LE9 B;  1T14 A;  1QVI Z;  2KI4 C;  3ZNI A;  2G2B A;  1CB1 A;  1JC2 A;  1M46 A;  2ZRS A;  1FPW A;  1ZUZ A;  3S0E A;  2JWW A;  3FS7 A;  1SCV A;  1F8H A;  2B1U A;  3CGA A;  4N1F A;  1YX8 A;  3GOF A;  2JT3 A;  1G33 A;  4GGF A;  4PDZ A;  1P28 A;  1KWO B;  1LVC D;  2H61 A;  1BR1 B;  2JRF A;  2AUC A;  3FE6 A;  2P70 A;  1B8C A;  1F54 A;  1XK4 C;  2LAP A;  1IRJ A;  1TTX A;  3KHE A;  3LL8 B;  3D0Y A;  1R2U A;  4GBA A;  1FI5 A;  2KFH A;  5HYD A;  1SCM C;  3VRQ A;  4CID A;  1A75 A;  3V2L A;  4XJK B;  2GGM A;  3D76 A;  4DS7 A;  2LUC A;  2PAS A;  4IL1 A;  1TNQ A;  1XFW O;  1Q80 A;  4CPV A;  2LM5 A;  1G4Y R;  2M49 B;  4YGD B;  5CSI A;  3CYZ A;  2OTG B;  1RK9 A;  2L0P A;  1SL7 A;  1QVI Y;  1E8A A;  5D69 A;  5DKN A;  2LVK A;  4QJ5 B;  1IJ6 A;  2PRU A;  1XVJ A;  4ICB A;  2GV5 A;  1LA3 A;  3BFH A;  1JWD A;  3BJH A;  3DVE A;  3NXA A;  2KFG A;  3VGO A;  5HLO A;  1AK8 A;  1GGW A;  1XFX O;  4YGB B;  1F71 A;  2L50 A;  4QJ3 B;  4XJK A;  1C3Y A;  1RTP 1;  1N0Y A;  1JF0 A;  5EL2 A;  4DRW A;  1K2H A;  1XFU O;  1CM4 A;  2K2A A;  3VB1 A;  1B8R A;  2F33 A;  2JC2 A;  3PJI A;  2L98 A;  2KGR A;  1B7T Y;  4MN0 A;  3TS5 C;  3EK8 A;  1GJY A;  1NCZ A;  5IBW A;  2COL B;  1K9K A;  4UPG A;  5ER4 X;  1RWY A;  4GUK A;  1SW8 A;  4OR9 B;  5JOL A;  2BBN A;  1JF2 A;  1UHN A;  1DTL A;  1PAL A;  2KPH A;  2Q91 A;  2QEH A;  4F7F A;  1KFU S;  3K21 A;  2KHN A;  1Y6W A;  1QTX A;  4DUQ A;  1OZS A;  1DF0 B;  4CFR A;  1MR8 A;  1IKU A;  1A4P A;  2L51 A;  5HL1 A;  4OZD A;  1XFZ O;  5ER5 A;  2M7N A;  2JU0 A;  4YGC B;  1CFF A;  3CR4 X;  1X02 A;  3SG5 A;  3JVT B;  4PE7 A;  5PAL A;  2PSR A;  3S0A A;  4PE0 A;  1BR4 B;  2QEB A;  1HQV A;  1EG4 A;  1PRW A;  4HRH A;  1TNW A;  2Y4Q A;  3WHU B;  2BL0 B;  2Y5I A;  2MRD A;  2KAX A;  3CS1 A;  1EG3 A;  1RJV A;  2JNF A;  2JUL A;  2PQL A;  2QDI A;  3AAJ A;  3S0B A;  1K94 A;  2KI6 D;  1XO5 A;  1DF0 A;  1ZFS A;  3SG7 A;  1ORG A;  5AXI A;  3OX6 A;  3DF0 B;  1SRA A;  1BOD A;  2ZRT A;  2FJU B;  2WCH A;  3PM8 A;  1EH2 A;  4R1E A;  3PN7 C;  3VRP A;  1V1G A;  3SIA A;  1S3P A;  1Y1X A;  4MZL A;  1TCF A;  2K7O A;  3NSK A;  1M31 A;  2DOQ A;  3S0F A;  5BPJ A;  4OCI A;  4QJ4 B;  4C0L A;  2H8V A;  1AP4 A;  1LKJ A;  2BBM A;  3TZ1 A;  1AJ4 A;  3TUY C;  5HLV A;  1KFU L;  3I5G C;  2OS8 C;  5AER A;  5D7F A;  1F4Q A;  3S0G A;  1FF1 A;  1KSM A;  1KQM C;  2KQY A;  1UP5 A;  2HET A;  1J7R A;  2MLF C;  2SAS A;  1B9A A;  4GPL B;  1B8L A;  3DF0 A;  5I94 A;  1SY9 A;  2AMI A;  1CNP A;  1NX1 A;  2ZFD A;  1OE9 B;  1TWO A;  3HCM A;  3OBV A;  1DT7 B;  1PUL A;  2CT9 A;  1IJ5 A;  2LMV A;  4MLW A;  1BF5 A;  2KOT A;  2K2F A;  5K89 A;  3OX5 A;  4F0Z B;  1CFD A;  4GNK B;  1K96 A;  4JD9 A;  1MXE A;  3WHT B;  4C0K A;  3E3R A;  1M63 B;  2JTZ A;  2M1K B;  1YX7 A;  2WCE A;  1DC1 A;  1XA5 A;  2QAC A;  2CXJ A;  4GGN A;  1F4O A;  2LHL A;  3RZS A;  1L2O B;  1RFJ A;  4INW A;  1W7I B;  2QPT A;  1CMF A;  1DJG A;  1NWD A;  1XFV O;  1QX5 B;  3D10 A;  3B88 A;  2GTE A;  2SCP A;  4GGF C;  2I18 A;  2EGD A;  2H61 C;  3VRO A;  1PK0 D;  4YI9 A;  2WCJ A;  2LP3 A;  2LLU A;  1CDP A;  1SSE B;  2RGI A;  3QME A;  2FJY A;  2WC5 A;  2F3Z A;  1ZOT B;  4MEW A;  1KSO A;  1LXF C;  1MWN A;  1ALW A;  1SR6 C;  3EVU A;  5HKZ A;  4D1E A;  5HKY A;  3WNX B;  3IQO A;  3A4U B;  3NHI A;  2LP2 A;  4YBH B;  1D1O A;  1NPQ A;  3NSO A;  2MA2 A;  1FBV A;  2KI4 B;  1FW4 A;  3D74 A;  4PE4 A;  4HRE E;  1KK8 C;  4I5N B;  3SG6 A;  3NGV A;  1BG1 A;  1NIW A;  4PHM A;  1YVH A;  3VRR A;  3LLE A;  2ZN8 A;  4U8D A;  1QAT A;  3C1V A;  3DXL A;  3SS3 A;  1F55 A;  3N7H A;  1S26 D;  2MHH A;  1IWQ A;  2JPO A;  1BLQ A;  1CTR A;  4HSZ A;  2KLD A;  1B1G A;  2JTT A;  4ORC B;  3CR2 A;  1IGV A;  2PAL A;  3L4L A;  3FIA A;  2CNP A;  3EKH A;  2E30 A;  4JWQ A;  1CDM A;  2LV7 A;  4PHN A;  2KBI A;  2BNX A;  4MRY A;  1ALV A;  2IS9 A;  2KNE A;  1J55 A;  3LCP C;  4FTG A;  2R2I A;  2BCA A;  1DJW A;  3KPX A;  4OKH A;  5CPV A;  5AAN A;  2BE4 A;  3B86 A;  3JTD C;  1YUU A;  1BMO A;  1AVS A;  1DVI A;  3O2P A;  3BUO B;  1XK4 A;  4BY4 A;  1K90 D;  3CAB A;  4AQJ A;  2F8P A;  1BU3 A;  1KK7 Z;  2KI6 C;  2M8U A;  1XFY O;  1MF8 B;  5TNC A;  1BJF A;  3BUN B;  1JSA A;  3R1O A;  3TDU A;  1CDN A;  3GK4 X;  3D75 A;  3L47 A;  5FI6 A;  2K7D A;  2HQW A;  1S1E A;  3PAL A;  3PLF B;  2JOJ A;  5AFP A;  1YUS A;  4HRG A;  1SMG A;  2KDH A;  3I5I C;  5HKW A;  5J3X A;  1MHO A;  2L5Y A;  3BUX B;  1WDC C;  5KSZ A;  2HF5 A;  1YRT B;  2EC6 C;  2WC8 A;  4YRU A;  2JPT A;  4PAL A;  3I5H C;  1K93 D;  2P71 A;  3CZ1 A;  1V1F A;  2F2O A;  1YR5 A;  5DKR A;  1QWV A;  3EVR A;  3CZ0 A;  1A29 A;  2FOT A;  1QX7 A;  3JVT C;  1GGZ A;  4WQ3 A;  3D73 A;  2M1U A;  2PVB A;  3NHT A;  1UHK A;  1VRK A;  4PCW A;  1JUO A;  1NX3 A;  3NSL A;  5GQQ C;  1YUR A;  1NX0 A;  3OGN A;  4N1G A;  3CLN A;  4MVF A;  3CDN A;  3S0D A;  4I5L B;  3DD4 A;  3R72 A;  1DGV A;  3BOW B;  4I5K A;  2LUX A;  4NQG A;  5FI2 A;  3BQ3 A;  2MAZ A;  2LVI A;  1OOG A;  1S6J A;  4P2Y B;  1CLL A;  3AAK A;  2PMY A;  1JFK A;  3RM1 A;  1H8B A;  2P6B B;  1IH0 A;  4YI8 A;  1ZAC A;  1SYM A;  3R1V A;  3EK7 A;  2M3W A;  1NUB A;  2K8M B;  1QAS A;  2K0J A;  1S5G Z;  1A2X A;  2M97 A;  2QEO A;  3DVM A;  3EVV A;  1C07 A;  5B8I B;  4MZK A;  2GGZ A;  2ISD A;  2NXQ A;  2MJW B;  1LS8 A;  3PN7 B;  1DGU A;  2L5X B;  3BOW A;  2CBL A;  3DYE A;  4I5J A;  2MBX A;  2NZ0 A;  3I5F C;  1K95 A;  1UHI A;  2EHB A;  1QX2 A;  2LNK A;  3EK4 A;  3WXA A;  2WCM A;  5FYX A;  1U5I B;  2KQ6 A;  1MQ1 A;  1HT9 A;  2K60 A;  3TUY B;  2L2E A;  3BYA A;  4BY5 A;  2KGB C;  4NDD A;  2BCX A;  1ZMZ A;  3I5G B;  2O60 A;  2OS8 B;  1DJX A;  1KCY A;  3R1P A;  3BUM B;  1L7Z A;  3A8R A;  3SG3 A;  1OW4 A;  3OP0 A;  3M0W A;  2NLN A;  3UO9 A;  3PSR A;  1A03 A;  1DQE A;  2FCE A;  2F2P A;  2WOR A;  4N5X A;  2NCO A;  4M2Q A;  3SG4 A;  2HQ8 A;  5CSF A;  2D8N A;  2LAN A;  2LMU A;  3SG2 A;  3VRN A;  2WCB A;  3F45 A;  4IJ7 A;  1J7Q A;  1OZO A;  2LVJ A;  1L2O C;  1U5I A;  2KAV A;  5G08 A;  2CTN A;  4M2O A;  1OQP A;  1CKK A;  2K61 A;  4YGA A;  4C0J A;  1UHH A;  1OSA A;  1KFX S;  1WLZ A;  3SS5 A;  2KFF A;  1DMO A;  3K1E A;  2VRG A;  1W9Z A;  1IQ5 A;  2LLS A; 
#chains in the Genus database with same CATH homology
 3S0A A;  1OOF A;  3CZ2 A;  2QEB A;  3DY9 A;  3B86 A;  3FE9 A;  2WCK A;  3Q8I A;  3CAB A;  2QDI A;  2PQL A;  1OOI X;  3L4A A;  3S0B A;  1TUJ A;  3D78 A;  4FQT A;  3R1O A;  1ORG A;  3D75 A;  3L47 A;  4PT1 A;  2WCH A;  2WC6 A;  2WCL A;  3S0F A;  2ERB A;  2H8V A;  2P71 A;  3CZ1 A;  3D77 A;  1QWV A;  3CZ0 A;  1T14 A;  3B6X A;  3S0G A;  2L2C A;  3D73 A;  3NHT A;  3OGN A;  3S0E A;  1TWO A;  3CDN A;  3S0D A;  3R72 A;  3BFA A;  1OOG A;  1P28 A;  4JD9 A;  5DIC A;  3FE6 A;  2P70 A;  3R1V A;  4INW A;  3V2L A;  3D76 A;  1C3Z A;  2QEO A;  1OOH A;  2QEV A;  3B87 A;  2GTE A;  3CYZ A;  1LS8 A;  3DYE A;  2WCJ A;  3QME A;  2FJY A;  2WCM A;  2WC5 A;  3BFH A;  3BJH A;  3DZT A;  3B7A A;  3NHI A;  3R1P A;  3FE8 A;  1C3Y A;  1OW4 A;  3D74 A;  4INX A;  5EL2 A;  3NGV A;  3VB1 A;  3PJI A;  1DQE A;  1XFR A;  3BFB A;  3DXL A;  3N7H A;  3RZS A;  2JPO A;  4F7F A;  2KPH A;  2QEH A;  1GM0 A;  3L4L A;  4OZD A;  3K1E A;  3B88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...