4FQTA

Structure of agamobp1 bound to 6-methyl-5-hepten-2-one
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anopheles Gambiae Odorant Binding protein 1
publication title Interactions of Anopheles gambiae Odorant-binding Proteins with a Human-derived Repellent: IMPLICATIONS FOR THE MODE OF ACTION OF N,N-DIETHYL-3-METHYLBENZAMIDE (DEET).
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Odorant-binding protein
total genus 40
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4fqtA01
4OZDA 3NHIA 3PJIA 3R1OA 3S0AA 3S0EA 1DQEA 3D74A 3CZ1A 2WCLA 3D73A 1XFRA 3CABA 3D75A 1GM0A 3RZSA 2WCKA 1OOIX 2P71A 3FE9A 3BFBA 1T14A 3L4AA 4INWA 2JPOA 2P70A 2H8VA 3B88A 4PT1A 3S0GA 3K1EA 2WCHA 3CZ0A 2WCJA 2PQLA 3R72A 3S0BA 2KPHA 2QEOA 2GTEA 3B86A 1OOGA 3VB1A 3BFAA 3DY9A 1ORGA 4JD9A 4F7FA 3L4LA 1LS8A 1P28A 3S0DA 3D78A 2QEHA 3B6XA 3BFHA 3V2LA 5EL2A 1OOFA 2QDIA 2L2CA 3BJHA 3CDNA 3Q8IA 1OOHA 3N7HA 1TWOA 2WC5A 3B7AA 3D76A 3DZTA 3D77A 3NGVA 3L47A 1C3ZA 3R1PA 3S0FA 1TUJA 3NHTA 3CZ2A 3QMEA 2QEVA 2WC6A 2WCMA 3CYZA 3DYEA 2ERBA 3DXLA 2QEBA 4FQTA 2FJYA 1QWVA 5DICA 3B87A 3R1VA 4INXA 3FE6A 3OGNA 1OW4A 1C3YA 3FE8A
chains in the Genus database with same CATH superfamily
1S6CA 4PHNA 2KFGA 3NHIA 1M63B 1GGZA 2M0RA 3R1OA 1QX2A 4C0LA 1EXRA 1V1GA 2MLFC 3KHEA 1V1FA 3CZ1A 3UO9A 2JTTA 1FPWA 2CNPA 2BE4A 2RGIA 3D73A 2CBLA 1TUZA 1KFXL 5I8NA 4NDDA 2JTZA 2BCAA 1IJ6A 1QLSA 2BE6A 2KFFA 2MLEC 4AQIA 1GM0A 1J1DA 1KQMB 5ER5A 4CFQA 4ZCUA 3FE9A 3BFBA 1BR1B 1UWOA 5FI7A 1LA3A 2F3ZA 4INWA 1DC1A 1IIOA 1K9UA 1QJTA 1N65A 3SJSA 1NCYA 3JTDC 1BLQA 4HREE 1F4OA 1TIZA 2JT3A 3K1EA 1CFFA 2M7LA 1RFJA 2OS8B 4ICBA 1K2HA 1SSEB 4YGAA 1QVIY 1OMVA 2Y5IA 1PALA 3S0BA 3SG4A 2NLNA 1B8CA 1UHIA 4M2PA 5BPJA 2QEOA 2EHBA 1RJVA 1NPQA 2GTEA 3SS4A 2LUXA 4Q04A 1ALWA 3B86A 1KWOB 1NCXA 3O4XA 2L98A 3BQ3A 5CPVA 1DF0A 3TZ1A 1J7QA 1W9ZA 2WC8A 1P28A 1YX8A 2M97A 3EVVA 5HLVA 5AXIA 3S0DA 1IQ5A 1DJWA 3D0YA 2ISDA 1Y1XA 1J7OA 3WXAA 4IL1A 1DEKA 4NDBA 1K90D 3TUYB 1K9KA 1GJYA 5I2OA 2EGDA 1B7TY 1BG1A 2MJWB 1QV1A 1CDLA 4PDZA 1OOFA 2M3WA 3DF0B 4QJ3B 2LLTA 3BJHA 1WRZA 1F55A 3Q8IA 3DVKA 3H4SE 1Y1AA 4ETOA 1TNPA 3IQQA 2L5YA 2WORA 1AP4A 1QIWA 1XO5A 4PALA 3I5GC 1L2OC 2F2PA 1EG4A 1QX7A 4DUQA 1KK8C 1C3ZA 2M29A 3PALA 1JSAA 1SMGA 5IBWA 1NX0A 2KAYA 3LK1A 2JT0A 4A4CA 1SR6C 2KQYA 3TS5B 1PVAA 1S26D 2KAXA 4GBAA 5FI2A 2G9BA 2VRGA 2F2OA 2HF5A 2E6WA 1UUSA 3LCPC 3VROA 4DIRA 1BJFA 3TDZA 1Y6WA 2WCMA 1S1EA 2JQ6A 2PVBA 2L51A 3CYZA 3ZNIA 1JFKA 1K96A 2JNXA 1TNXA 2ERBA 1ZACA 3DYEA 1ALVA 1CM4A 3GK4X 4MSPA 3EG5B 4N1GA 2FJYA 1LVCD 1QWVA 1ODBA 1JF0A 2KAVA 1YR5A 3R1VA 5HLOA 1BOCA 1F4QA 2BL0C 1DJIA 1QS7A 2LUCA 4UPGA 1W7IB 3C1VA 1J55A 4HSZA 4P5OE 1C3YA 4C0KA 5CSIA 4D1EA 1A4PA 1M31A 3GOFA 3SG5A 3FS7A 4OZDA 1BODA 1OZOA 3PSRA 4PE4A 3S0AA 1WLMA 2K7OA 3BUWB 1J7RA 4MVFA 1RTP1 1K9PA 1UHKA 3OBVA 4GGFA 1DQEA 3JTDB 2JXCA 1NSHA 3D74A 3PM8A 4MZLA 1EG3A 2WCLA 3QRXA 3VRPA 2LVKA 3A4UB 1UP5A 1DF0B 1NUBA 1B47A 3CLNA 2M8UA 1NX3A 4QJ5B 1WLZA 2O60A 1IRJA 1DELA 5J3XA 2M49B 1CFCA 4N5XA 1ZMZA 4PHMA 2KHNA 2PYQA 4XYNA 1IGVA 2LVVA 1NX1A 3RZSA 1FF1A 2WCKA 1OOIX 1S6JA 2P71A 1KSOA 1W7JB 5ER4X 4HRGA 3I5HB 1OQPA 1YVHA 4BY5A 3VRQA 2H8VA 3SS3A 4YGEB 3S0GA 1MWNA 3FWBA 4HRHA 2CT9A 4A4BA 2LHIA 1EH2A 4XJKA 1SCVA 1R2UA 1SCMC 3K21A 3OB1B 4MZKA 4YRUA 2OTGB 1YUUA 1YRTB 2PQLA 2HETA 1EL4A 1OMRA 3PM2A 3PN7C 3I5IC 1ZOTB 2CTNA 2LE9B 1QASA 3SG2A 2K0JA 1OMDA 2JRFA 3BFAA 4C0JA 4JD9A 1TNWA 1X02A 3CR5X 4ZCVA 3L4LA 5AANA 5PALA 1IKUA 4WQ3A 3TDIA 2QEHA 4OR9B 1F8HA 1LKJA 2WCFA 3CR2A 1L2OB 3WHTB 1JFJA 2ZRTA 3V2LA 5DKNA 1QLKA 3SG7A 4PE7A 4OCIA 1K95A 1JBAA 2L0PA 2NZ0A 1CFPA 3NSIA 3O2PA 2LM5A 1SR6B 2JXLA 4ORAB 2CXJA 3KPXA 3LK0A 1B8LA 3AAKA 3CDNA 2KOTA 1DMOA 2LMTA 2LCPA 4CIDA 1CB1A 2JPTA 1KSMA 4F0ZB 4M2OA 1TTXA 2BCXA 2LC5A 2K8MB 3KEVA 2MRDA 3DZTA 2JU0A 1QXPA 3UNWA 2KI4C 3L47A 3VRRA 2IS9A 3JVTC 3R1PA 2LLUA 4IJ7A 3S0FA 2AUCA 1K94A 2L5XB 4I5JA 1DVIA 5DKQA 5TNCA 3MSEB 2I2RE 2G2BA 4DCKA 1GQMA 5JOLA 1KK7Y 1IJ5A 1TCFA 1XK4C 3RLZA 3CZ2A 1JC2A 2BL0B 1NIWA 1MXLC 4JWQA 2KYFA 1KFUS 2Y4QA 2EC6C 3AAJA 3O6BA 2AMIA 1FI5A 1MXEA 4CLNA 3ZWHA 1BR4B 1YURA 1K93D 4P2YB 3RM1A 2K60A 3B87A 4PCWA 1MF8B 1OSAA 3EK7A 2KSPA 2LVJA 1S6IA 2V53A 3O4YA 1TOPA 4YBHB 4XJKB 2M1UA 4R1EA 1QTXA 3EK4A 4OV2A 2ZNDA 5GQQC 3VGOA 3DVEA 1A75A 2L2EA 1H4BA 1IWQA 4YI9A 2H61C 5K89A 5B8IB 3PJIA 1KFXS 5D69A 2E30A 3S0EA 1DGUA 1LINA 1PSRA 3PATA 4JPZB 3NSKA 2SASA 1KQMC 1LA0A 4KYNA 2O5GA 4BY4A 1N2DA 1TRFA 2JULA 3TDUA 2L4HA 4CFRA 1XFRA 3CABA 1D1OA 3IQOA 1SCMB 2MA2A 2Y1NA 2ZN8A 5HYDA 2I18A 2OS8C 3BXKA 3PN7B 2P6BB 1SPYA 3I5IB 2KDHA 4JQ0D 1S5GZ 1OE9B 4CPVA 1WRKA 1IG5A 5AFPA 4GUKA 3I5FC 2FJUB 1Q80A 1QATA 1QVIZ 3BUOB 3L4AA 1AVSA 1SW8A 4MLWA 2GGMA 2JPOA 1YRUB 2GV5A 2P70A 1XFUO 2QPTA 3B88A 4I5KA 3CGAA 3OP0A 4MRYA 1C7VA 2FCEA 2LANA 2HQ8A 2WCHA 4WRIA 3OB2B 5DKRA 1OOJA 1KWOC 1S36A 1SRAA 3BYAA 4N1FA 3CZ0A 2WCJA 3R72A 5HKWA 4ORBB 1B1GA 1J1EA 1UURA 3BOWB 2ZRSA 2LNKA 2BAPA 1SKTA 2JC2A 1U5IB 1NWDA 3BUNB 5I2QA 1BF5A 4PHKA 3CTNA 2KBIA 1S3PA 1OOGA 1HT9A 1CNPA 1DJXA 3DY9A 4F7FA 3EKHA 4L9MA 1LS8A 3EVUA 3OX5A 3D78A 4I5LB 2K2AA 4YGBB 4PE0A 1DJHA 1DJYA 1XA5A 2WOSA 5G08A 1XFZO 2KBMA 5AEQA 1YUTA 2KYCA 2L50A 1AJ4A 2KI4B 5EL2A 5FI6A 1SL9A 1PK0D 3OX6A 1XFVO 1AJ5A 2QDIA 3EK8A 1GGWA 3SG3A 1QX5B 2HPSA 1CTRA 1G4YR 3DD4A 3EVRA 2JT8A 4QJ4B 2L4IA 3DVMA 1MR8A 1OOHA 2KLDA 2KI6C 3GK1A 1TWOA 3B7AA 3D76A 5KSZA 3GK2A 1A75B 1PVBA 1EJ3A 3NGVA 1G8IA 3F45A 1CMFA 1XFXO 2CCMA 2GGZA 2DOQA 1RROA 4GAOA 4AOMA 1F70A 2JOJA 3ICBA 1LXFC 4AQJA 1AUIB 3I5GB 4YGDB 1CDNA 1WRLA 2ZN9A 1NX2A 4ORCB 2NXQA 1ZFSA 1JF2A 1KK8B 2QEVA 3PLFB 4USLA 2BBMA 4GFTA 1A03A 3NXAA 2TN4A 1J7PA 2KQ6A 1PULA 1RECA 3DXLA 4GGNA 1RK9A 2QEBA 3LL8B 1FW4A 5CSJA 1FI6A 3FIAA 2QACA 5CSFA 1Y0VH 2PALA 1H8BA 2MAZA 3BOWA 4INXA 1AK8A 1IQ3A 1MQ1A 1WDCC 3PFVA 2LP3A 1U5IA 2LMUA 1NYAA 3AKAA 1S5GY 5D3OA 2H2KA 1SK6D 2FCDA 2BNXA 1DTLA 3M0WA 4DS7A 5FYXA 5JJGA 2KNEA 1NP8A 5KU1A 3I5FB 2M7NA 1Z4HA 2PSRA 3E3RA 1TCOB 2JWWA 1RWYA 4OKHA 1YUSA 1C7WA 1F71A 1PSBA 2ZFDA 2I7AA 4FQOA 4E68A 2KLEA 3CWGA 2LV7A 1C07A 2NCOA 1XFWO 3I5HC 3CZTX 5F6TA 4MN0A 2WCEA 2LVIA 4MEWA 2Q91A 3D75A 3NSOA 1A2XA 1YVLA 2KGRA 2JZIA 2B1UA 2BKIB 1BU3A 1OZSA 5I2LA 1JWDA 1BMOA 2SCPA 4PHJA 1XK4A 2MBXA 1DT7B 1T14A 5HKZA 3CR4X 2OTGC 3O78A 2Y1MA 1SYMA 2HQWA 2PASA 3FWCA 4PT1A 2BKHB 2KI6D 2K7BA 3HCMA 1CMGA 1ZUZA 1M46A 2LHLA 1KQVA 4NQGA 1DGVA 5CSNA 1XVJA 5KTYA 2K2FA 1VRKA 1TN4A 2F33A 3WNXB 1Y1UA 3LLEA 4WQ2A 3WHUB 2KPHA 1XYDA 4GNKB 1YTZC 3SS5A 1CKKA 2JNFA 3BUMB 1WY9A 1NCZA 1SY9A 1CLBA 1E8AA 1MUXA 1FBVA 1SBJA 3BUXB 4GPLB 3VB1A 4DRWA 3IF7A 1ORGA 4JKTA 3NSLA 3CS1A 2H61A 1SL7A 3AKBA 1N0YA 2R2IA 3HX4A 2WNDA 5HKYA 2Q4UA 3B6XA 1CDPA 1B4CA 2YGUA 2KGBC 3A8RA 2F3YA 3BFHA 1CFDA 2ZKMX 1IH0A 3OHMB 2KFHA 1AHRA 1Z2CB 1DJGA 3SIBA 2COLB 4M2QA 2L2CA 1A29A 1HQVA 2A4JA 2LLSA 2OPOA 2WCBA 1QV0A 1JUOA 3D10A 4YI8A 3SG6A 1CLLA 2BECA 1SL8A 1TNQA 1UHJA 1M45A 4FTGA 4GGFC 2BBNA 2AAOA 2FOTA 3N7HA 2WC5A 4PE1A 2K7DA 5HL1A 1BT6A 3D77A 3EKJA 4U8DA 3TUYC 1KK7Z 1PRWA 3DVJA 1R6PA 3SIAA 1TUJA 4OVNF 4TNCA 1L7ZA 1B7TZ 3NHTA 1B8RA 2LMVA 3VRNA 2I94A 2M9GA 3QMEA 5D7FA 2LAPA 2BCBA 4MBEA 1WDCB 1UHNA 3JVTB 4MRXA 1MHOA 1UHHA 2WC6A 5I94A 2K61A 1SNLA 1M39A 2K7CA 1CM1A 1QIVA 2ZNEA 1DJZA 1F54A 2F8PA 4MZJA 3KO0A 3D0YB 4FQTA 2NCPA 1KCYA 5AERA 1XFYO 3DF0A 2D8NA 2PRUA 3TS5C 1KFUL 4NDCA 2M1KB 5DICA 2LP2A 2PMYA 2EC6B 3IVTA 1CLMA 1G33A 2MHHA 4I5NB 1B9AA 1YX7A 3FE6A 3KF9A 3OGNA 4YGCB 1OW4A 1CDMA 1K8UA 3FE8A
chains in the Genus database with same CATH topology
4OZDA 3NHIA 3PJIA 3R1OA 3S0AA 3S0EA 1DQEA 3D74A 3CZ1A 2WCLA 3D73A 1XFRA 3CABA 3D75A 1GM0A 3RZSA 2WCKA 1OOIX 2P71A 3FE9A 3BFBA 1T14A 3L4AA 4INWA 2JPOA 2P70A 2H8VA 3B88A 4PT1A 3S0GA 3K1EA 2WCHA 3CZ0A 2WCJA 2PQLA 3R72A 3S0BA 2KPHA 2QEOA 2GTEA 3B86A 1OOGA 3VB1A 3BFAA 3DY9A 1ORGA 4JD9A 4F7FA 3L4LA 1LS8A 1P28A 3S0DA 3D78A 2QEHA 3B6XA 3BFHA 3V2LA 5EL2A 1OOFA 2QDIA 2L2CA 3BJHA 3CDNA 3Q8IA 1OOHA 3N7HA 1TWOA 2WC5A 3B7AA 3D76A 3DZTA 3D77A 3NGVA 3L47A 1C3ZA 3R1PA 3S0FA 1TUJA 3NHTA 3CZ2A 3QMEA 2QEVA 2WC6A 2WCMA 3CYZA 3DYEA 2ERBA 3DXLA 2QEBA 4FQTA 2FJYA 1QWVA 5DICA 3B87A 3R1VA 4INXA 3FE6A 3OGNA 1OW4A 1C3YA 3FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZD A;  3NHI A;  3PJI A;  3R1O A;  3S0A A;  3S0E A;  1DQE A;  3D74 A;  3CZ1 A;  2WCL A;  3D73 A;  1XFR A;  3CAB A;  3D75 A;  1GM0 A;  3RZS A;  2WCK A;  1OOI X;  2P71 A;  3FE9 A;  3BFB A;  1T14 A;  3L4A A;  4INW A;  2JPO A;  2P70 A;  2H8V A;  3B88 A;  4PT1 A;  3S0G A;  3K1E A;  2WCH A;  3CZ0 A;  2WCJ A;  2PQL A;  3R72 A;  3S0B A;  2KPH A;  2QEO A;  2GTE A;  3B86 A;  1OOG A;  3VB1 A;  3BFA A;  3DY9 A;  1ORG A;  4JD9 A;  4F7F A;  3L4L A;  1LS8 A;  1P28 A;  3S0D A;  3D78 A;  2QEH A;  3B6X A;  3BFH A;  3V2L A;  5EL2 A;  1OOF A;  2QDI A;  2L2C A;  3BJH A;  3CDN A;  3Q8I A;  1OOH A;  3N7H A;  1TWO A;  2WC5 A;  3B7A A;  3D76 A;  3DZT A;  3D77 A;  3NGV A;  3L47 A;  1C3Z A;  3R1P A;  3S0F A;  1TUJ A;  3NHT A;  3CZ2 A;  3QME A;  2QEV A;  2WC6 A;  2WCM A;  3CYZ A;  3DYE A;  2ERB A;  3DXL A;  2QEB A;  4FQT A;  2FJY A;  1QWV A;  5DIC A;  3B87 A;  3R1V A;  4INX A;  3FE6 A;  3OGN A;  1OW4 A;  1C3Y A;  3FE8 A; 
#chains in the Genus database with same CATH topology
 1S6C A;  4PHN A;  2KFG A;  3NHI A;  1M63 B;  1GGZ A;  2M0R A;  3R1O A;  1QX2 A;  4C0L A;  1EXR A;  1V1G A;  2MLF C;  3KHE A;  1V1F A;  3CZ1 A;  3UO9 A;  2JTT A;  1FPW A;  2CNP A;  2BE4 A;  2RGI A;  3D73 A;  2CBL A;  1TUZ A;  1KFX L;  5I8N A;  4NDD A;  2JTZ A;  2BCA A;  1IJ6 A;  1QLS A;  2BE6 A;  2KFF A;  2MLE C;  4AQI A;  1GM0 A;  1J1D A;  1KQM B;  5ER5 A;  4CFQ A;  4ZCU A;  3FE9 A;  3BFB A;  1BR1 B;  1UWO A;  5FI7 A;  1LA3 A;  2F3Z A;  4INW A;  1DC1 A;  1IIO A;  1K9U A;  1QJT A;  1N65 A;  3SJS A;  1NCY A;  3JTD C;  1BLQ A;  4HRE E;  1F4O A;  1TIZ A;  2JT3 A;  3K1E A;  1CFF A;  2M7L A;  1RFJ A;  2OS8 B;  4ICB A;  1K2H A;  1SSE B;  4YGA A;  1QVI Y;  1OMV A;  2Y5I A;  1PAL A;  3S0B A;  3SG4 A;  2NLN A;  1B8C A;  1UHI A;  4M2P A;  5BPJ A;  2QEO A;  2EHB A;  1RJV A;  1NPQ A;  2GTE A;  3SS4 A;  2LUX A;  4Q04 A;  1ALW A;  3B86 A;  1KWO B;  1NCX A;  3O4X A;  2L98 A;  3BQ3 A;  5CPV A;  1DF0 A;  3TZ1 A;  1J7Q A;  1W9Z A;  2WC8 A;  1P28 A;  1YX8 A;  2M97 A;  3EVV A;  5HLV A;  5AXI A;  3S0D A;  1IQ5 A;  1DJW A;  3D0Y A;  2ISD A;  1Y1X A;  1J7O A;  3WXA A;  4IL1 A;  1DEK A;  4NDB A;  1K90 D;  3TUY B;  1K9K A;  1GJY A;  5I2O A;  2EGD A;  1B7T Y;  1BG1 A;  2MJW B;  1QV1 A;  1CDL A;  4PDZ A;  1OOF A;  2M3W A;  3DF0 B;  4QJ3 B;  2LLT A;  3BJH A;  1WRZ A;  1F55 A;  3Q8I A;  3DVK A;  3H4S E;  1Y1A A;  4ETO A;  1TNP A;  3IQQ A;  2L5Y A;  2WOR A;  1AP4 A;  1QIW A;  1XO5 A;  4PAL A;  3I5G C;  1L2O C;  2F2P A;  1EG4 A;  1QX7 A;  4DUQ A;  1KK8 C;  1C3Z A;  2M29 A;  3PAL A;  1JSA A;  1SMG A;  5IBW A;  1NX0 A;  2KAY A;  3LK1 A;  2JT0 A;  4A4C A;  1SR6 C;  2KQY A;  3TS5 B;  1PVA A;  1S26 D;  2KAX A;  4GBA A;  5FI2 A;  2G9B A;  2VRG A;  2F2O A;  2HF5 A;  2E6W A;  1UUS A;  3LCP C;  3VRO A;  4DIR A;  1BJF A;  3TDZ A;  1Y6W A;  2WCM A;  1S1E A;  2JQ6 A;  2PVB A;  2L51 A;  3CYZ A;  3ZNI A;  1JFK A;  1K96 A;  2JNX A;  1TNX A;  2ERB A;  1ZAC A;  3DYE A;  1ALV A;  1CM4 A;  3GK4 X;  4MSP A;  3EG5 B;  4N1G A;  2FJY A;  1LVC D;  1QWV A;  1ODB A;  1JF0 A;  2KAV A;  1YR5 A;  3R1V A;  5HLO A;  1BOC A;  1F4Q A;  2BL0 C;  1DJI A;  1QS7 A;  2LUC A;  4UPG A;  1W7I B;  3C1V A;  1J55 A;  4HSZ A;  4P5O E;  1C3Y A;  4C0K A;  5CSI A;  4D1E A;  1A4P A;  1M31 A;  3GOF A;  3SG5 A;  3FS7 A;  4OZD A;  1BOD A;  1OZO A;  3PSR A;  4PE4 A;  3S0A A;  1WLM A;  2K7O A;  3BUW B;  1J7R A;  4MVF A;  1RTP 1;  1K9P A;  1UHK A;  3OBV A;  4GGF A;  1DQE A;  3JTD B;  2JXC A;  1NSH A;  3D74 A;  3PM8 A;  4MZL A;  1EG3 A;  2WCL A;  3QRX A;  3VRP A;  2LVK A;  3A4U B;  1UP5 A;  1DF0 B;  1NUB A;  1B47 A;  3CLN A;  2M8U A;  1NX3 A;  4QJ5 B;  1WLZ A;  2O60 A;  1IRJ A;  1DEL A;  5J3X A;  2M49 B;  1CFC A;  4N5X A;  1ZMZ A;  4PHM A;  2KHN A;  2PYQ A;  4XYN A;  1IGV A;  2LVV A;  1NX1 A;  3RZS A;  1FF1 A;  2WCK A;  1OOI X;  1S6J A;  2P71 A;  1KSO A;  1W7J B;  5ER4 X;  4HRG A;  3I5H B;  1OQP A;  1YVH A;  4BY5 A;  3VRQ A;  2H8V A;  3SS3 A;  4YGE B;  3S0G A;  1MWN A;  3FWB A;  4HRH A;  2CT9 A;  4A4B A;  2LHI A;  1EH2 A;  4XJK A;  1SCV A;  1R2U A;  1SCM C;  3K21 A;  3OB1 B;  4MZK A;  4YRU A;  2OTG B;  1YUU A;  1YRT B;  2PQL A;  2HET A;  1EL4 A;  1OMR A;  3PM2 A;  3PN7 C;  3I5I C;  1ZOT B;  2CTN A;  2LE9 B;  1QAS A;  3SG2 A;  2K0J A;  1OMD A;  2JRF A;  3BFA A;  4C0J A;  4JD9 A;  1TNW A;  1X02 A;  3CR5 X;  4ZCV A;  3L4L A;  5AAN A;  5PAL A;  1IKU A;  4WQ3 A;  3TDI A;  2QEH A;  4OR9 B;  1F8H A;  1LKJ A;  2WCF A;  3CR2 A;  1L2O B;  3WHT B;  1JFJ A;  2ZRT A;  3V2L A;  5DKN A;  1QLK A;  3SG7 A;  4PE7 A;  4OCI A;  1K95 A;  1JBA A;  2L0P A;  2NZ0 A;  1CFP A;  3NSI A;  3O2P A;  2LM5 A;  1SR6 B;  2JXL A;  4ORA B;  2CXJ A;  3KPX A;  3LK0 A;  1B8L A;  3AAK A;  3CDN A;  2KOT A;  1DMO A;  2LMT A;  2LCP A;  4CID A;  1CB1 A;  2JPT A;  1KSM A;  4F0Z B;  4M2O A;  1TTX A;  2BCX A;  2LC5 A;  2K8M B;  3KEV A;  2MRD A;  3DZT A;  2JU0 A;  1QXP A;  3UNW A;  2KI4 C;  3L47 A;  3VRR A;  2IS9 A;  3JVT C;  3R1P A;  2LLU A;  4IJ7 A;  3S0F A;  2AUC A;  1K94 A;  2L5X B;  4I5J A;  1DVI A;  5DKQ A;  5TNC A;  3MSE B;  2I2R E;  2G2B A;  4DCK A;  1GQM A;  5JOL A;  1KK7 Y;  1IJ5 A;  1TCF A;  1XK4 C;  3RLZ A;  3CZ2 A;  1JC2 A;  2BL0 B;  1NIW A;  1MXL C;  4JWQ A;  2KYF A;  1KFU S;  2Y4Q A;  2EC6 C;  3AAJ A;  3O6B A;  2AMI A;  1FI5 A;  1MXE A;  4CLN A;  3ZWH A;  1BR4 B;  1YUR A;  1K93 D;  4P2Y B;  3RM1 A;  2K60 A;  3B87 A;  4PCW A;  1MF8 B;  1OSA A;  3EK7 A;  2KSP A;  2LVJ A;  1S6I A;  2V53 A;  3O4Y A;  1TOP A;  4YBH B;  4XJK B;  2M1U A;  4R1E A;  1QTX A;  3EK4 A;  4OV2 A;  2ZND A;  5GQQ C;  3VGO A;  3DVE A;  1A75 A;  2L2E A;  1H4B A;  1IWQ A;  4YI9 A;  2H61 C;  5K89 A;  5B8I B;  3PJI A;  1KFX S;  5D69 A;  2E30 A;  3S0E A;  1DGU A;  1LIN A;  1PSR A;  3PAT A;  4JPZ B;  3NSK A;  2SAS A;  1KQM C;  1LA0 A;  4KYN A;  2O5G A;  4BY4 A;  1N2D A;  1TRF A;  2JUL A;  3TDU A;  2L4H A;  4CFR A;  1XFR A;  3CAB A;  1D1O A;  3IQO A;  1SCM B;  2MA2 A;  2Y1N A;  2ZN8 A;  5HYD A;  2I18 A;  2OS8 C;  3BXK A;  3PN7 B;  2P6B B;  1SPY A;  3I5I B;  2KDH A;  4JQ0 D;  1S5G Z;  1OE9 B;  4CPV A;  1WRK A;  1IG5 A;  5AFP A;  4GUK A;  3I5F C;  2FJU B;  1Q80 A;  1QAT A;  1QVI Z;  3BUO B;  3L4A A;  1AVS A;  1SW8 A;  4MLW A;  2GGM A;  2JPO A;  1YRU B;  2GV5 A;  2P70 A;  1XFU O;  2QPT A;  3B88 A;  4I5K A;  3CGA A;  3OP0 A;  4MRY A;  1C7V A;  2FCE A;  2LAN A;  2HQ8 A;  2WCH A;  4WRI A;  3OB2 B;  5DKR A;  1OOJ A;  1KWO C;  1S36 A;  1SRA A;  3BYA A;  4N1F A;  3CZ0 A;  2WCJ A;  3R72 A;  5HKW A;  4ORB B;  1B1G A;  1J1E A;  1UUR A;  3BOW B;  2ZRS A;  2LNK A;  2BAP A;  1SKT A;  2JC2 A;  1U5I B;  1NWD A;  3BUN B;  5I2Q A;  1BF5 A;  4PHK A;  3CTN A;  2KBI A;  1S3P A;  1OOG A;  1HT9 A;  1CNP A;  1DJX A;  3DY9 A;  4F7F A;  3EKH A;  4L9M A;  1LS8 A;  3EVU A;  3OX5 A;  3D78 A;  4I5L B;  2K2A A;  4YGB B;  4PE0 A;  1DJH A;  1DJY A;  1XA5 A;  2WOS A;  5G08 A;  1XFZ O;  2KBM A;  5AEQ A;  1YUT A;  2KYC A;  2L50 A;  1AJ4 A;  2KI4 B;  5EL2 A;  5FI6 A;  1SL9 A;  1PK0 D;  3OX6 A;  1XFV O;  1AJ5 A;  2QDI A;  3EK8 A;  1GGW A;  3SG3 A;  1QX5 B;  2HPS A;  1CTR A;  1G4Y R;  3DD4 A;  3EVR A;  2JT8 A;  4QJ4 B;  2L4I A;  3DVM A;  1MR8 A;  1OOH A;  2KLD A;  2KI6 C;  3GK1 A;  1TWO A;  3B7A A;  3D76 A;  5KSZ A;  3GK2 A;  1A75 B;  1PVB A;  1EJ3 A;  3NGV A;  1G8I A;  3F45 A;  1CMF A;  1XFX O;  2CCM A;  2GGZ A;  2DOQ A;  1RRO A;  4GAO A;  4AOM A;  1F70 A;  2JOJ A;  3ICB A;  1LXF C;  4AQJ A;  1AUI B;  3I5G B;  4YGD B;  1CDN A;  1WRL A;  2ZN9 A;  1NX2 A;  4ORC B;  2NXQ A;  1ZFS A;  1JF2 A;  1KK8 B;  2QEV A;  3PLF B;  4USL A;  2BBM A;  4GFT A;  1A03 A;  3NXA A;  2TN4 A;  1J7P A;  2KQ6 A;  1PUL A;  1REC A;  3DXL A;  4GGN A;  1RK9 A;  2QEB A;  3LL8 B;  1FW4 A;  5CSJ A;  1FI6 A;  3FIA A;  2QAC A;  5CSF A;  1Y0V H;  2PAL A;  1H8B A;  2MAZ A;  3BOW A;  4INX A;  1AK8 A;  1IQ3 A;  1MQ1 A;  1WDC C;  3PFV A;  2LP3 A;  1U5I A;  2LMU A;  1NYA A;  3AKA A;  1S5G Y;  5D3O A;  2H2K A;  1SK6 D;  2FCD A;  2BNX A;  1DTL A;  3M0W A;  4DS7 A;  5FYX A;  5JJG A;  2KNE A;  1NP8 A;  5KU1 A;  3I5F B;  2M7N A;  1Z4H A;  2PSR A;  3E3R A;  1TCO B;  2JWW A;  1RWY A;  4OKH A;  1YUS A;  1C7W A;  1F71 A;  1PSB A;  2ZFD A;  2I7A A;  4FQO A;  4E68 A;  2KLE A;  3CWG A;  2LV7 A;  1C07 A;  2NCO A;  1XFW O;  3I5H C;  3CZT X;  5F6T A;  4MN0 A;  2WCE A;  2LVI A;  4MEW A;  2Q91 A;  3D75 A;  3NSO A;  1A2X A;  1YVL A;  2KGR A;  2JZI A;  2B1U A;  2BKI B;  1BU3 A;  1OZS A;  5I2L A;  1JWD A;  1BMO A;  2SCP A;  4PHJ A;  1XK4 A;  2MBX A;  1DT7 B;  1T14 A;  5HKZ A;  3CR4 X;  2OTG C;  3O78 A;  2Y1M A;  1SYM A;  2HQW A;  2PAS A;  3FWC A;  4PT1 A;  2BKH B;  2KI6 D;  2K7B A;  3HCM A;  1CMG A;  1ZUZ A;  1M46 A;  2LHL A;  1KQV A;  4NQG A;  1DGV A;  5CSN A;  1XVJ A;  5KTY A;  2K2F A;  1VRK A;  1TN4 A;  2F33 A;  3WNX B;  1Y1U A;  3LLE A;  4WQ2 A;  3WHU B;  2KPH A;  1XYD A;  4GNK B;  1YTZ C;  3SS5 A;  1CKK A;  2JNF A;  3BUM B;  1WY9 A;  1NCZ A;  1SY9 A;  1CLB A;  1E8A A;  1MUX A;  1FBV A;  1SBJ A;  3BUX B;  4GPL B;  3VB1 A;  4DRW A;  3IF7 A;  1ORG A;  4JKT A;  3NSL A;  3CS1 A;  2H61 A;  1SL7 A;  3AKB A;  1N0Y A;  2R2I A;  3HX4 A;  2WND A;  5HKY A;  2Q4U A;  3B6X A;  1CDP A;  1B4C A;  2YGU A;  2KGB C;  3A8R A;  2F3Y A;  3BFH A;  1CFD A;  2ZKM X;  1IH0 A;  3OHM B;  2KFH A;  1AHR A;  1Z2C B;  1DJG A;  3SIB A;  2COL B;  4M2Q A;  2L2C A;  1A29 A;  1HQV A;  2A4J A;  2LLS A;  2OPO A;  2WCB A;  1QV0 A;  1JUO A;  3D10 A;  4YI8 A;  3SG6 A;  1CLL A;  2BEC A;  1SL8 A;  1TNQ A;  1UHJ A;  1M45 A;  4FTG A;  4GGF C;  2BBN A;  2AAO A;  2FOT A;  3N7H A;  2WC5 A;  4PE1 A;  2K7D A;  5HL1 A;  1BT6 A;  3D77 A;  3EKJ A;  4U8D A;  3TUY C;  1KK7 Z;  1PRW A;  3DVJ A;  1R6P A;  3SIA A;  1TUJ A;  4OVN F;  4TNC A;  1L7Z A;  1B7T Z;  3NHT A;  1B8R A;  2LMV A;  3VRN A;  2I94 A;  2M9G A;  3QME A;  5D7F A;  2LAP A;  2BCB A;  4MBE A;  1WDC B;  1UHN A;  3JVT B;  4MRX A;  1MHO A;  1UHH A;  2WC6 A;  5I94 A;  2K61 A;  1SNL A;  1M39 A;  2K7C A;  1CM1 A;  1QIV A;  2ZNE A;  1DJZ A;  1F54 A;  2F8P A;  4MZJ A;  3KO0 A;  3D0Y B;  4FQT A;  2NCP A;  1KCY A;  5AER A;  1XFY O;  3DF0 A;  2D8N A;  2PRU A;  3TS5 C;  1KFU L;  4NDC A;  2M1K B;  5DIC A;  2LP2 A;  2PMY A;  2EC6 B;  3IVT A;  1CLM A;  1G33 A;  2MHH A;  4I5N B;  1B9A A;  1YX7 A;  3FE6 A;  3KF9 A;  3OGN A;  4YGC B;  1OW4 A;  1CDM A;  1K8U A;  3FE8 A; 
#chains in the Genus database with same CATH homology
 4OZD A;  3NHI A;  3PJI A;  3R1O A;  3S0A A;  3S0E A;  1DQE A;  3D74 A;  3CZ1 A;  2WCL A;  3D73 A;  1XFR A;  3CAB A;  3D75 A;  1GM0 A;  3RZS A;  2WCK A;  1OOI X;  2P71 A;  3FE9 A;  3BFB A;  1T14 A;  3L4A A;  4INW A;  2JPO A;  2P70 A;  2H8V A;  3B88 A;  4PT1 A;  3S0G A;  3K1E A;  2WCH A;  3CZ0 A;  2WCJ A;  2PQL A;  3R72 A;  3S0B A;  2KPH A;  2QEO A;  2GTE A;  3B86 A;  1OOG A;  3VB1 A;  3BFA A;  3DY9 A;  1ORG A;  4JD9 A;  4F7F A;  3L4L A;  1LS8 A;  1P28 A;  3S0D A;  3D78 A;  2QEH A;  3B6X A;  3BFH A;  3V2L A;  5EL2 A;  1OOF A;  2QDI A;  2L2C A;  3BJH A;  3CDN A;  3Q8I A;  1OOH A;  3N7H A;  1TWO A;  2WC5 A;  3B7A A;  3D76 A;  3DZT A;  3D77 A;  3NGV A;  3L47 A;  1C3Z A;  3R1P A;  3S0F A;  1TUJ A;  3NHT A;  3CZ2 A;  3QME A;  2QEV A;  2WC6 A;  2WCM A;  3CYZ A;  3DYE A;  2ERB A;  3DXL A;  2QEB A;  4FQT A;  2FJY A;  1QWV A;  5DIC A;  3B87 A;  3R1V A;  4INX A;  3FE6 A;  3OGN A;  1OW4 A;  1C3Y A;  3FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...