4FQTA

Structure of agamobp1 bound to 6-methyl-5-hepten-2-one
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
b'DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anopheles Gambiae Odorant Binding protein 1
publication title Interactions of Anopheles gambiae Odorant-binding Proteins with a Human-derived Repellent: IMPLICATIONS FOR THE MODE OF ACTION OF N,N-DIETHYL-3-METHYLBENZAMIDE (DEET).
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Odorant-binding protein
total genus 40
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4fqtA01
3CYZA 2P70A 3B87A 3BJHA 3BFAA 4JD9A 2P71A 2WC5A 3B6XA 3B7AA 1DQEA 3B86A 3OGNA 3CZ2A 3L47A 1T14A 2ERBA 2PQLA 2FJYA 2WCKA 1OOFA 1TWOA 3PJIA 1OOIX 2WCJA 3R72A 3S0FA 1C3YA 1GM0A 3BFHA 2QEOA 3VB1A 3S0AA 2JPOA 3K1EA 2QEBA 3DXLA 3CZ0A 3D77A 4OZDA 3QMEA 1TUJA 4FQTA 3FE8A 3S0GA 3S0BA 2WC6A 3CZ1A 1OW4A 3L4LA 1OOGA 4F7FA 3FE9A 3DZTA 5DICA 3S0EA 1XFRA 2QEVA 3R1VA 3BFBA 3S0DA 3CABA 3L4AA 3D76A 4INWA 3D78A 3DYEA 3FE6A 2WCMA 3NHIA 3B88A 4INXA 3D74A 3DY9A 1OOHA 1QWVA 3NGVA 2KPHA 2H8VA 3RZSA 3Q8IA 3D75A 5EL2A 1ORGA 3N7HA 4PT1A 1LS8A 3D73A 3R1OA 1P28A 2QDIA 3NHTA 1C3ZA 2QEHA 2GTEA 2WCHA 3CDNA 3R1PA 2WCLA 3V2LA 2L2CA
chains in the Genus database with same CATH superfamily
3CYZA 4YGAA 2P70A 1LVCD 3B87A 3EK7A 1JUOA 3EG5B 2EC6B 3LK1A 2Q91A 2LVKA 1KFUS 2R2IA 5G08A 5CSIA 5CPVA 1SMGA 4N1GA 4PHKA 1IKUA 2G9BA 4CFRA 3BFAA 3GK1A 1TOPA 1SR6C 3HCMA 4A4BA 2KGRA 2FJUB 4GGFA 4L9MA 3EVUA 4ORAB 2P71A 2K2AA 3B6XA 3OB1B 1TNWA 3DVKA 1NWDA 1RECA 2JNFA 4HRGA 2F3YA 4GAOA 2KAXA 2M0RA 2KHNA 1DJXA 1PRWA 1G33A 4ORBB 1L2OC 2JZIA 4HRHA 2JOJA 3BOWA 1KK7Z 2PQLA 3PM8A 2FJYA 1DJYA 1K95A 3BUWB 3OHMB 1J55A 2PALA 4ZCUA 4N5XA 1YVHA 1DJIA 1VRKA 1TWOA 3JTDB 3PJIA 4OCIA 2OS8B 5AANA 3E3RA 5HL1A 3TS5C 1UP5A 3EKJA 5ER5A 2L4IA 3VROA 3PLFB 3SS4A 4I5LB 1H4BA 1GM0A 1K9KA 3CR4X 1KQMB 5J3XA 2JPOA 2LLUA 5BPJA 1B8CA 1TNPA 3PFVA 1S5GY 4MRYA 1U5IA 2GGMA 3H4SE 5F6TA 1JWDA 2K7BA 1BT6A 1LKJA 4YGEB 1TTXA 1X02A 3CS1A 2BCXA 4FQOA 3QMEA 4YGBB 5D69A 3SS3A 1DGVA 1HQVA 3EVRA 3WXAA 3DVEA 1NUBA 1ODBA 2E30A 2ZN9A 4FQTA 4C0JA 4HSZA 4NQGA 2K8MB 3PSRA 3S0GA 1OE9B 2WC6A 2LNKA 3PALA 4QJ5B 1XFZO 2KAVA 2DOQA 3LK0A 1AP4A 1CLBA 2F2OA 1CMFA 2MLFC 2EGDA 3AAKA 3BUOB 1JFKA 1CDNA 3SIBA 1ZMZA 2JXCA 2HETA 2GV5A 5I2LA 3S0DA 3VRPA 2IS9A 1SCMB 4N1FA 1M46A 3AKAA 1M63B 1FW4A 3D76A 3ICBA 5KTYA 4GBAA 2KI6D 1PSBA 4INWA 3D78A 3DYEA 3SG2A 5I8NA 3FE6A 1G4YR 2L51A 1EL4A 1EG3A 2I94A 3NHIA 3LLEA 3PM2A 5HKZA 1F4OA 3I5IB 3DY9A 1NX3A 1NSHA 4AQJA 1TCFA 4XYNA 1OZSA 2KPHA 1FI6A 5B8IB 2H2KA 2MJWB 1F70A 1XFYO 1FPWA 1SNLA 2HF5A 3F45A 4OVNF 3UO9A 1F4QA 2LMTA 4PE0A 2L50A 4OV2A 5AFPA 2K0JA 2Y1NA 2LV7A 1SBJA 2CTNA 3VRQA 3I5HC 2JPTA 3AAJA 4GFTA 2LE9B 2M9GA 5CSNA 2LM5A 4YBHB 1KWOB 4CFQA 1W7IB 1CMGA 2LMVA 1IRJA 1YRTB 2I2RE 2BBNA 5TNCA 3SJSA 4M2OA 1WDCB 1YX8A 1QV0A 1P28A 3AKBA 1AK8A 3OBVA 1K8UA 1C3ZA 2MA2A 3IF7A 2GTEA 2ZNDA 2MLEC 3FIAA 4DRWA 2EC6C 1XVJA 2KFGA 4KYNA 2LLTA 1QXPA 1JFJA 1DEKA 1AJ5A 3CR5X 1L7ZA 2LVIA 2L2CA 2LMUA 5JOLA 3SG3A 5CSFA 1SKTA 1C07A 3DF0B 1AJ4A 2M3WA 2JC2A 2M29A 3SG4A 1TNXA 3D0YB 1Q80A 2KQ6A 4USLA 1IJ5A 2CXJA 1SL7A 2LP2A 1K90D 1R6PA 4M2QA 1KK7Y 2WC5A 2LVVA 1N0YA 2JTTA 3BUNB 3JTDC 4ICBA 1Y1AA 2OS8C 3L47A 1C7WA 2NXQA 1EH2A 5KU1A 3WHTB 1DGUA 5ER4X 4XJKA 2WCKA 1PVAA 1A29A 1YR5A 1Y6WA 1KQMC 1UHJA 1B1GA 1QTXA 2KAYA 1KFXL 2WORA 1TNQA 3BUXB 5AXIA 2L98A 5GQQC 3A4UB 3R72A 3S0FA 2FCDA 4MLWA 2BAPA 4D1EA 3VB1A 2KLDA 3DXLA 2F2PA 2KI6C 3CZ0A 2WC8A 1SK6D 4CIDA 1K2HA 3D77A 1XO5A 1E8AA 4MBEA 2ZRTA 3KHEA 1XK4C 4WQ2A 4YGCB 2D8NA 1NIWA 1J7OA 2LANA 1J7QA 3S0BA 4CPVA 2JULA 1F55A 2YGUA 5PALA 2BE6A 2WNDA 1FBVA 1CB1A 2M49B 5HYDA 4GPLB 1SPYA 3S0EA 1A03A 2HQWA 1K94A 1JF0A 1W9ZA 2QEVA 3FWCA 3CABA 3D0YA 3LCPC 3L4AA 2ZKMX 3I5IC 1DC1A 1W7JB 2EHBA 4I5KA 3KF9A 1C7VA 3CR2A 1SSEB 3ZNIA 1S6CA 3DVMA 3D10A 1BLQA 5DKNA 1BU3A 1WLZA 1M45A 1OMRA 2M1UA 4MZKA 4A4CA 3CLNA 4M2PA 5IBWA 2M1KB 1XFXO 2L2EA 5DKRA 1DJWA 5FYXA 2WCEA 3OX5A 1RROA 1QV1A 1GGWA 3WNXB 1A75B 1ALVA 2BCAA 2L4HA 1B9AA 2JWWA 1QIWA 1B8LA 2H8VA 2L5XB 1TCOB 5FI7A 2V53A 1KCYA 3FS7A 1KWOC 2FCEA 2KQYA 3RZSA 2WCFA 2LLSA 1OZOA 4GUKA 1AHRA 1YUUA 3SIAA 5HKWA 1WDCC 1ALWA 2LHLA 2BE4A 3N7HA 4JQ0D 2K60A 1SYMA 1EXRA 3D73A 2MRDA 3EK8A 1OMVA 3GK4X 1GGZA 2JTZA 2P6BB 4BY5A 2BNXA 2QDIA 1OSAA 1KFXS 2HPSA 2KLEA 1QLKA 4DS7A 3CDNA 1QS7A 1KK8B 5AERA 2WCLA 1XFWO 4WRIA 1S3PA 1DF0B 2QACA 1RFJA 3WHUB 2KSPA 3CTNA 1J7RA 4ORCB 2KYCA 1YX7A 4IJ7A 1MF8B 4YI8A 3TUYB 4E68A 3BJHA 4MSPA 3BXKA 1MR8A 4JPZB 4JWQA 3TDIA 4PHMA 1Y1XA 2LHIA 1OMDA 2NLNA 1DT7B 1LINA 1DVIA 3B7AA 2K2FA 1DQEA 2JQ6A 3VRRA 2KOTA 2BKHB 3OGNA 3CZ2A 4NDCA 1QLSA 1S36A 2I18A 2KGBC 3I5GB 3NSIA 4FTGA 5CSJA 1KQVA 3HX4A 2E6WA 5I2QA 2L0PA 3IQOA 2JU0A 1WRZA 1OOIX 1XK4A 2LVJA 1V1GA 4ETOA 1RTP1 3EVVA 3OX6A 4BY4A 4R1EA 1F54A 1Y0VH 2KYFA 2FOTA 1C3YA 3SG5A 2JRFA 2ZNEA 1CDMA 2ZRSA 1A4PA 1CNPA 5FI2A 2QEOA 3S0AA 1DMOA 3K1EA 2LC5A 1TN4A 1MWNA 3LL8B 3O4YA 4PCWA 2KBIA 1WLMA 5KSZA 1F71A 2GGZA 2MHHA 1OQPA 3OP0A 1IJ6A 2Q4UA 2Y1MA 2PYQA 1TUJA 2BL0B 4DCKA 1FI5A 3FE8A 3EKHA 3BOWB 3I5FB 2COLB 4U8DA 3K21A 1PVBA 1OW4A 1WY9A 1Y1UA 3CZ1A 2LUCA 3L4LA 1DJGA 1XYDA 1BJFA 2M97A 2PMYA 2K7DA 3IVTA 4F7FA 1B47A 1TIZA 4AOMA 4HREE 1XFRA 5I2OA 1BR1B 2KI4B 3RLZA 1GJYA 4C0LA 4YRUA 2JT0A 3NSKA 1RJVA 3O2PA 2LAPA 1CFPA 2QPTA 2AMIA 1XFVO 1SW8A 1U5IB 2RGIA 1SY9A 1G8IA 2SASA 3PATA 4MN0A 1SCVA 2A4JA 1NX2A 1PULA 2ZFDA 2LCPA 2OTGB 3B88A 1WRKA 1AUIB 2B1UA 1EJ3A 4YI9A 2M7LA 1B8RA 1CM4A 1K9PA 2MBXA 4DUQA 1BODA 2WCBA 2HQ8A 2K7OA 4WQ3A 1UHIA 2BCBA 5HLOA 1B7TY 3JVTB 3RM1A 3DVJA 4P5OE 3ZWHA 2NCPA 1SCMC 1TUZA 1YTZC 1JC2A 2I7AA 1KSMA 3DF0A 3Q8IA 3D75A 3GK2A 1DTLA 1XFUO 1ZACA 2JT3A 2Y4QA 1H8BA 2WOSA 1LA0A 4PHNA 1J7PA 1ORGA 1CTRA 4Q04A 1J1DA 2F8PA 2SCPA 3EK4A 1NCZA 1KK8C 1RWYA 1NX1A 1DELA 1TRFA 3R1OA 4YGDB 4F0ZB 1SRAA 2ZN8A 1JBAA 1QATA 1NYAA 1SL8A 3OB2B 2H61A 2QEHA 3O6BA 1OOJA 1LXFC 3V2LA 2K61A 3TUYC 1QJTA 3TDZA 5JJGA 1SL9A 1S26D 1Z4HA 1IQ3A 3PN7B 4NDDA 2NCOA 1ZOTB 1UHHA 1UUSA 1B7TZ 3QRXA 1MHOA 2CNPA 4PDZA 1FF1A 2BECA 1UHKA 2Y5IA 4I5NB 4JD9A 1WRLA 2KNEA 1RK9A 1UHNA 3I5GC 1S6IA 2M8UA 2BKIB 1PALA 3GOFA 3B86A 1SR6B 5DKQA 5K89A 1BOCA 1T14A 1JSAA 1DJZA 2ERBA 1EG4A 2AAOA 1DJHA 1MXEA 1OOFA 1F8HA 4MRXA 2TN4A 1YRUB 1CFDA 1L2OB 2LP3A 3A8RA 2PSRA 4GGFC 1K93D 1BG1A 3IQQA 3CZTX 2WCJA 1QX5B 3VGOA 1QIVA 4JKTA 2K7CA 4QJ4B 3SG7A 2KFHA 4PE7A 1IGVA 4MZLA 3BFHA 4GNKB 4UPGA 4OR9B 4CLNA 2BL0C 3TS5B 2KDHA 2QEBA 2CT9A 1QVIY 4PE1A 1PK0D 3I5FC 2JNXA 2G2BA 1BR4B 2H61C 1KFUL 4OZDA 2BBMA 2F33A 4NDBA 1IQ5A 1BF5A 2CBLA 1B4CA 4QJ3B 1S5GZ 3BQ3A 2AUCA 4MEWA 1XA5A 4C0KA 3TZ1A 2ISDA 1MQ1A 1UWOA 2KI4C 1NX0A 1A75A 1HT9A 2O60A 3CGAA 4XJKB 3BYAA 1K96A 3C1VA 2KBMA 1AVSA 1OOGA 3DD4A 3O4XA 4I5JA 1M31A 1Z2CB 3DZTA 3FE9A 3NXAA 5DICA 3SG6A 2VRGA 2MAZA 3M0WA 3NSLA 1UURA 3KO0A 3SS5A 1N65A 3R1VA 3VRNA 3BFBA 1PSRA 1YURA 1V1FA 1YUSA 1A2XA 1CLLA 2OTGC 4OKHA 1CDLA 2CCMA 5D7FA 2WCMA 3JVTC 1NCXA 4GGNA 4INXA 4P2YB 3D74A 4MZJA 3TDUA 1QASA 1OOHA 2JT8A 1IIOA 1CLMA 1NCYA 1QWVA 3NGVA 2PVBA 1BMOA 1QVIZ 1M39A 4AQIA 1YUTA 2M7NA 3CWGA 1DF0A 1IWQA 3UNWA 1CDPA 1NPQA 5FI6A 4ZCVA 1D1OA 2F3ZA 1ZFSA 2LUXA 1CKKA 5AEQA 1QX2A 2PASA 4PHJA 5EL2A 2PRUA 5I94A 1S6JA 2KFFA 4PALA 2L5YA 4PT1A 3MSEB 1R2UA 1YVLA 1LS8A 1CM1A 3FWBA 5HLVA 3I5HB 1NP8A 4IL1A 2O5GA 4DIRA 1LA3A 1MXLC 1CFCA 1IH0A 3KPXA 1K9UA 3NSOA 4TNCA 3NHTA 3PN7C 1JF2A 1N2DA 5HKYA 1KSOA 3O78A 2WCHA 1IG5A 3R1PA 5D3OA 2NZ0A 1S1EA 1J1EA 1ZUZA 1MUXA 2OPOA 4MVFA 1GQMA 3KEVA 4PE4A 2JXLA 3BUMB 1QX7A 1CFFA
chains in the Genus database with same CATH topology
3CYZA 2P70A 3B87A 3BJHA 3BFAA 4JD9A 2P71A 2WC5A 3B6XA 3B7AA 1DQEA 3B86A 3OGNA 3CZ2A 3L47A 1T14A 2ERBA 2PQLA 2FJYA 2WCKA 1OOFA 1TWOA 3PJIA 1OOIX 2WCJA 3R72A 3S0FA 1C3YA 1GM0A 3BFHA 2QEOA 3VB1A 3S0AA 2JPOA 3K1EA 2QEBA 3DXLA 3CZ0A 3D77A 4OZDA 3QMEA 1TUJA 4FQTA 3FE8A 3S0GA 3S0BA 2WC6A 3CZ1A 1OW4A 3L4LA 1OOGA 4F7FA 3FE9A 3DZTA 5DICA 3S0EA 1XFRA 2QEVA 3R1VA 3BFBA 3S0DA 3CABA 3L4AA 3D76A 4INWA 3D78A 3DYEA 3FE6A 2WCMA 3NHIA 3B88A 4INXA 3D74A 3DY9A 1OOHA 1QWVA 3NGVA 2KPHA 2H8VA 3RZSA 3Q8IA 3D75A 5EL2A 1ORGA 3N7HA 4PT1A 1LS8A 3D73A 3R1OA 1P28A 2QDIA 3NHTA 1C3ZA 2QEHA 2GTEA 2WCHA 3CDNA 3R1PA 2WCLA 3V2LA 2L2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYZ A;  2P70 A;  3B87 A;  3BJH A;  3BFA A;  4JD9 A;  2P71 A;  2WC5 A;  3B6X A;  3B7A A;  1DQE A;  3B86 A;  3OGN A;  3CZ2 A;  3L47 A;  1T14 A;  2ERB A;  2PQL A;  2FJY A;  2WCK A;  1OOF A;  1TWO A;  3PJI A;  1OOI X;  2WCJ A;  3R72 A;  3S0F A;  1C3Y A;  1GM0 A;  3BFH A;  2QEO A;  3VB1 A;  3S0A A;  2JPO A;  3K1E A;  2QEB A;  3DXL A;  3CZ0 A;  3D77 A;  4OZD A;  3QME A;  1TUJ A;  4FQT A;  3FE8 A;  3S0G A;  3S0B A;  2WC6 A;  3CZ1 A;  1OW4 A;  3L4L A;  1OOG A;  4F7F A;  3FE9 A;  3DZT A;  5DIC A;  3S0E A;  1XFR A;  2QEV A;  3R1V A;  3BFB A;  3S0D A;  3CAB A;  3L4A A;  3D76 A;  4INW A;  3D78 A;  3DYE A;  3FE6 A;  2WCM A;  3NHI A;  3B88 A;  4INX A;  3D74 A;  3DY9 A;  1OOH A;  1QWV A;  3NGV A;  2KPH A;  2H8V A;  3RZS A;  3Q8I A;  3D75 A;  5EL2 A;  1ORG A;  3N7H A;  4PT1 A;  1LS8 A;  3D73 A;  3R1O A;  1P28 A;  2QDI A;  3NHT A;  1C3Z A;  2QEH A;  2GTE A;  2WCH A;  3CDN A;  3R1P A;  2WCL A;  3V2L A;  2L2C A; 
#chains in the Genus database with same CATH topology
 3CYZ A;  4YGA A;  2P70 A;  1LVC D;  3B87 A;  3EK7 A;  1JUO A;  3EG5 B;  2EC6 B;  3LK1 A;  2Q91 A;  2LVK A;  1KFU S;  2R2I A;  5G08 A;  5CSI A;  5CPV A;  1SMG A;  4N1G A;  4PHK A;  1IKU A;  2G9B A;  4CFR A;  3BFA A;  3GK1 A;  1TOP A;  1SR6 C;  3HCM A;  4A4B A;  2KGR A;  2FJU B;  4GGF A;  4L9M A;  3EVU A;  4ORA B;  2P71 A;  2K2A A;  3B6X A;  3OB1 B;  1TNW A;  3DVK A;  1NWD A;  1REC A;  2JNF A;  4HRG A;  2F3Y A;  4GAO A;  2KAX A;  2M0R A;  2KHN A;  1DJX A;  1PRW A;  1G33 A;  4ORB B;  1L2O C;  2JZI A;  4HRH A;  2JOJ A;  3BOW A;  1KK7 Z;  2PQL A;  3PM8 A;  2FJY A;  1DJY A;  1K95 A;  3BUW B;  3OHM B;  1J55 A;  2PAL A;  4ZCU A;  4N5X A;  1YVH A;  1DJI A;  1VRK A;  1TWO A;  3JTD B;  3PJI A;  4OCI A;  2OS8 B;  5AAN A;  3E3R A;  5HL1 A;  3TS5 C;  1UP5 A;  3EKJ A;  5ER5 A;  2L4I A;  3VRO A;  3PLF B;  3SS4 A;  4I5L B;  1H4B A;  1GM0 A;  1K9K A;  3CR4 X;  1KQM B;  5J3X A;  2JPO A;  2LLU A;  5BPJ A;  1B8C A;  1TNP A;  3PFV A;  1S5G Y;  4MRY A;  1U5I A;  2GGM A;  3H4S E;  5F6T A;  1JWD A;  2K7B A;  1BT6 A;  1LKJ A;  4YGE B;  1TTX A;  1X02 A;  3CS1 A;  2BCX A;  4FQO A;  3QME A;  4YGB B;  5D69 A;  3SS3 A;  1DGV A;  1HQV A;  3EVR A;  3WXA A;  3DVE A;  1NUB A;  1ODB A;  2E30 A;  2ZN9 A;  4FQT A;  4C0J A;  4HSZ A;  4NQG A;  2K8M B;  3PSR A;  3S0G A;  1OE9 B;  2WC6 A;  2LNK A;  3PAL A;  4QJ5 B;  1XFZ O;  2KAV A;  2DOQ A;  3LK0 A;  1AP4 A;  1CLB A;  2F2O A;  1CMF A;  2MLF C;  2EGD A;  3AAK A;  3BUO B;  1JFK A;  1CDN A;  3SIB A;  1ZMZ A;  2JXC A;  2HET A;  2GV5 A;  5I2L A;  3S0D A;  3VRP A;  2IS9 A;  1SCM B;  4N1F A;  1M46 A;  3AKA A;  1M63 B;  1FW4 A;  3D76 A;  3ICB A;  5KTY A;  4GBA A;  2KI6 D;  1PSB A;  4INW A;  3D78 A;  3DYE A;  3SG2 A;  5I8N A;  3FE6 A;  1G4Y R;  2L51 A;  1EL4 A;  1EG3 A;  2I94 A;  3NHI A;  3LLE A;  3PM2 A;  5HKZ A;  1F4O A;  3I5I B;  3DY9 A;  1NX3 A;  1NSH A;  4AQJ A;  1TCF A;  4XYN A;  1OZS A;  2KPH A;  1FI6 A;  5B8I B;  2H2K A;  2MJW B;  1F70 A;  1XFY O;  1FPW A;  1SNL A;  2HF5 A;  3F45 A;  4OVN F;  3UO9 A;  1F4Q A;  2LMT A;  4PE0 A;  2L50 A;  4OV2 A;  5AFP A;  2K0J A;  2Y1N A;  2LV7 A;  1SBJ A;  2CTN A;  3VRQ A;  3I5H C;  2JPT A;  3AAJ A;  4GFT A;  2LE9 B;  2M9G A;  5CSN A;  2LM5 A;  4YBH B;  1KWO B;  4CFQ A;  1W7I B;  1CMG A;  2LMV A;  1IRJ A;  1YRT B;  2I2R E;  2BBN A;  5TNC A;  3SJS A;  4M2O A;  1WDC B;  1YX8 A;  1QV0 A;  1P28 A;  3AKB A;  1AK8 A;  3OBV A;  1K8U A;  1C3Z A;  2MA2 A;  3IF7 A;  2GTE A;  2ZND A;  2MLE C;  3FIA A;  4DRW A;  2EC6 C;  1XVJ A;  2KFG A;  4KYN A;  2LLT A;  1QXP A;  1JFJ A;  1DEK A;  1AJ5 A;  3CR5 X;  1L7Z A;  2LVI A;  2L2C A;  2LMU A;  5JOL A;  3SG3 A;  5CSF A;  1SKT A;  1C07 A;  3DF0 B;  1AJ4 A;  2M3W A;  2JC2 A;  2M29 A;  3SG4 A;  1TNX A;  3D0Y B;  1Q80 A;  2KQ6 A;  4USL A;  1IJ5 A;  2CXJ A;  1SL7 A;  2LP2 A;  1K90 D;  1R6P A;  4M2Q A;  1KK7 Y;  2WC5 A;  2LVV A;  1N0Y A;  2JTT A;  3BUN B;  3JTD C;  4ICB A;  1Y1A A;  2OS8 C;  3L47 A;  1C7W A;  2NXQ A;  1EH2 A;  5KU1 A;  3WHT B;  1DGU A;  5ER4 X;  4XJK A;  2WCK A;  1PVA A;  1A29 A;  1YR5 A;  1Y6W A;  1KQM C;  1UHJ A;  1B1G A;  1QTX A;  2KAY A;  1KFX L;  2WOR A;  1TNQ A;  3BUX B;  5AXI A;  2L98 A;  5GQQ C;  3A4U B;  3R72 A;  3S0F A;  2FCD A;  4MLW A;  2BAP A;  4D1E A;  3VB1 A;  2KLD A;  3DXL A;  2F2P A;  2KI6 C;  3CZ0 A;  2WC8 A;  1SK6 D;  4CID A;  1K2H A;  3D77 A;  1XO5 A;  1E8A A;  4MBE A;  2ZRT A;  3KHE A;  1XK4 C;  4WQ2 A;  4YGC B;  2D8N A;  1NIW A;  1J7O A;  2LAN A;  1J7Q A;  3S0B A;  4CPV A;  2JUL A;  1F55 A;  2YGU A;  5PAL A;  2BE6 A;  2WND A;  1FBV A;  1CB1 A;  2M49 B;  5HYD A;  4GPL B;  1SPY A;  3S0E A;  1A03 A;  2HQW A;  1K94 A;  1JF0 A;  1W9Z A;  2QEV A;  3FWC A;  3CAB A;  3D0Y A;  3LCP C;  3L4A A;  2ZKM X;  3I5I C;  1DC1 A;  1W7J B;  2EHB A;  4I5K A;  3KF9 A;  1C7V A;  3CR2 A;  1SSE B;  3ZNI A;  1S6C A;  3DVM A;  3D10 A;  1BLQ A;  5DKN A;  1BU3 A;  1WLZ A;  1M45 A;  1OMR A;  2M1U A;  4MZK A;  4A4C A;  3CLN A;  4M2P A;  5IBW A;  2M1K B;  1XFX O;  2L2E A;  5DKR A;  1DJW A;  5FYX A;  2WCE A;  3OX5 A;  1RRO A;  1QV1 A;  1GGW A;  3WNX B;  1A75 B;  1ALV A;  2BCA A;  2L4H A;  1B9A A;  2JWW A;  1QIW A;  1B8L A;  2H8V A;  2L5X B;  1TCO B;  5FI7 A;  2V53 A;  1KCY A;  3FS7 A;  1KWO C;  2FCE A;  2KQY A;  3RZS A;  2WCF A;  2LLS A;  1OZO A;  4GUK A;  1AHR A;  1YUU A;  3SIA A;  5HKW A;  1WDC C;  1ALW A;  2LHL A;  2BE4 A;  3N7H A;  4JQ0 D;  2K60 A;  1SYM A;  1EXR A;  3D73 A;  2MRD A;  3EK8 A;  1OMV A;  3GK4 X;  1GGZ A;  2JTZ A;  2P6B B;  4BY5 A;  2BNX A;  2QDI A;  1OSA A;  1KFX S;  2HPS A;  2KLE A;  1QLK A;  4DS7 A;  3CDN A;  1QS7 A;  1KK8 B;  5AER A;  2WCL A;  1XFW O;  4WRI A;  1S3P A;  1DF0 B;  2QAC A;  1RFJ A;  3WHU B;  2KSP A;  3CTN A;  1J7R A;  4ORC B;  2KYC A;  1YX7 A;  4IJ7 A;  1MF8 B;  4YI8 A;  3TUY B;  4E68 A;  3BJH A;  4MSP A;  3BXK A;  1MR8 A;  4JPZ B;  4JWQ A;  3TDI A;  4PHM A;  1Y1X A;  2LHI A;  1OMD A;  2NLN A;  1DT7 B;  1LIN A;  1DVI A;  3B7A A;  2K2F A;  1DQE A;  2JQ6 A;  3VRR A;  2KOT A;  2BKH B;  3OGN A;  3CZ2 A;  4NDC A;  1QLS A;  1S36 A;  2I18 A;  2KGB C;  3I5G B;  3NSI A;  4FTG A;  5CSJ A;  1KQV A;  3HX4 A;  2E6W A;  5I2Q A;  2L0P A;  3IQO A;  2JU0 A;  1WRZ A;  1OOI X;  1XK4 A;  2LVJ A;  1V1G A;  4ETO A;  1RTP 1;  3EVV A;  3OX6 A;  4BY4 A;  4R1E A;  1F54 A;  1Y0V H;  2KYF A;  2FOT A;  1C3Y A;  3SG5 A;  2JRF A;  2ZNE A;  1CDM A;  2ZRS A;  1A4P A;  1CNP A;  5FI2 A;  2QEO A;  3S0A A;  1DMO A;  3K1E A;  2LC5 A;  1TN4 A;  1MWN A;  3LL8 B;  3O4Y A;  4PCW A;  2KBI A;  1WLM A;  5KSZ A;  1F71 A;  2GGZ A;  2MHH A;  1OQP A;  3OP0 A;  1IJ6 A;  2Q4U A;  2Y1M A;  2PYQ A;  1TUJ A;  2BL0 B;  4DCK A;  1FI5 A;  3FE8 A;  3EKH A;  3BOW B;  3I5F B;  2COL B;  4U8D A;  3K21 A;  1PVB A;  1OW4 A;  1WY9 A;  1Y1U A;  3CZ1 A;  2LUC A;  3L4L A;  1DJG A;  1XYD A;  1BJF A;  2M97 A;  2PMY A;  2K7D A;  3IVT A;  4F7F A;  1B47 A;  1TIZ A;  4AOM A;  4HRE E;  1XFR A;  5I2O A;  1BR1 B;  2KI4 B;  3RLZ A;  1GJY A;  4C0L A;  4YRU A;  2JT0 A;  3NSK A;  1RJV A;  3O2P A;  2LAP A;  1CFP A;  2QPT A;  2AMI A;  1XFV O;  1SW8 A;  1U5I B;  2RGI A;  1SY9 A;  1G8I A;  2SAS A;  3PAT A;  4MN0 A;  1SCV A;  2A4J A;  1NX2 A;  1PUL A;  2ZFD A;  2LCP A;  2OTG B;  3B88 A;  1WRK A;  1AUI B;  2B1U A;  1EJ3 A;  4YI9 A;  2M7L A;  1B8R A;  1CM4 A;  1K9P A;  2MBX A;  4DUQ A;  1BOD A;  2WCB A;  2HQ8 A;  2K7O A;  4WQ3 A;  1UHI A;  2BCB A;  5HLO A;  1B7T Y;  3JVT B;  3RM1 A;  3DVJ A;  4P5O E;  3ZWH A;  2NCP A;  1SCM C;  1TUZ A;  1YTZ C;  1JC2 A;  2I7A A;  1KSM A;  3DF0 A;  3Q8I A;  3D75 A;  3GK2 A;  1DTL A;  1XFU O;  1ZAC A;  2JT3 A;  2Y4Q A;  1H8B A;  2WOS A;  1LA0 A;  4PHN A;  1J7P A;  1ORG A;  1CTR A;  4Q04 A;  1J1D A;  2F8P A;  2SCP A;  3EK4 A;  1NCZ A;  1KK8 C;  1RWY A;  1NX1 A;  1DEL A;  1TRF A;  3R1O A;  4YGD B;  4F0Z B;  1SRA A;  2ZN8 A;  1JBA A;  1QAT A;  1NYA A;  1SL8 A;  3OB2 B;  2H61 A;  2QEH A;  3O6B A;  1OOJ A;  1LXF C;  3V2L A;  2K61 A;  3TUY C;  1QJT A;  3TDZ A;  5JJG A;  1SL9 A;  1S26 D;  1Z4H A;  1IQ3 A;  3PN7 B;  4NDD A;  2NCO A;  1ZOT B;  1UHH A;  1UUS A;  1B7T Z;  3QRX A;  1MHO A;  2CNP A;  4PDZ A;  1FF1 A;  2BEC A;  1UHK A;  2Y5I A;  4I5N B;  4JD9 A;  1WRL A;  2KNE A;  1RK9 A;  1UHN A;  3I5G C;  1S6I A;  2M8U A;  2BKI B;  1PAL A;  3GOF A;  3B86 A;  1SR6 B;  5DKQ A;  5K89 A;  1BOC A;  1T14 A;  1JSA A;  1DJZ A;  2ERB A;  1EG4 A;  2AAO A;  1DJH A;  1MXE A;  1OOF A;  1F8H A;  4MRX A;  2TN4 A;  1YRU B;  1CFD A;  1L2O B;  2LP3 A;  3A8R A;  2PSR A;  4GGF C;  1K93 D;  1BG1 A;  3IQQ A;  3CZT X;  2WCJ A;  1QX5 B;  3VGO A;  1QIV A;  4JKT A;  2K7C A;  4QJ4 B;  3SG7 A;  2KFH A;  4PE7 A;  1IGV A;  4MZL A;  3BFH A;  4GNK B;  4UPG A;  4OR9 B;  4CLN A;  2BL0 C;  3TS5 B;  2KDH A;  2QEB A;  2CT9 A;  1QVI Y;  4PE1 A;  1PK0 D;  3I5F C;  2JNX A;  2G2B A;  1BR4 B;  2H61 C;  1KFU L;  4OZD A;  2BBM A;  2F33 A;  4NDB A;  1IQ5 A;  1BF5 A;  2CBL A;  1B4C A;  4QJ3 B;  1S5G Z;  3BQ3 A;  2AUC A;  4MEW A;  1XA5 A;  4C0K A;  3TZ1 A;  2ISD A;  1MQ1 A;  1UWO A;  2KI4 C;  1NX0 A;  1A75 A;  1HT9 A;  2O60 A;  3CGA A;  4XJK B;  3BYA A;  1K96 A;  3C1V A;  2KBM A;  1AVS A;  1OOG A;  3DD4 A;  3O4X A;  4I5J A;  1M31 A;  1Z2C B;  3DZT A;  3FE9 A;  3NXA A;  5DIC A;  3SG6 A;  2VRG A;  2MAZ A;  3M0W A;  3NSL A;  1UUR A;  3KO0 A;  3SS5 A;  1N65 A;  3R1V A;  3VRN A;  3BFB A;  1PSR A;  1YUR A;  1V1F A;  1YUS A;  1A2X A;  1CLL A;  2OTG C;  4OKH A;  1CDL A;  2CCM A;  5D7F A;  2WCM A;  3JVT C;  1NCX A;  4GGN A;  4INX A;  4P2Y B;  3D74 A;  4MZJ A;  3TDU A;  1QAS A;  1OOH A;  2JT8 A;  1IIO A;  1CLM A;  1NCY A;  1QWV A;  3NGV A;  2PVB A;  1BMO A;  1QVI Z;  1M39 A;  4AQI A;  1YUT A;  2M7N A;  3CWG A;  1DF0 A;  1IWQ A;  3UNW A;  1CDP A;  1NPQ A;  5FI6 A;  4ZCV A;  1D1O A;  2F3Z A;  1ZFS A;  2LUX A;  1CKK A;  5AEQ A;  1QX2 A;  2PAS A;  4PHJ A;  5EL2 A;  2PRU A;  5I94 A;  1S6J A;  2KFF A;  4PAL A;  2L5Y A;  4PT1 A;  3MSE B;  1R2U A;  1YVL A;  1LS8 A;  1CM1 A;  3FWB A;  5HLV A;  3I5H B;  1NP8 A;  4IL1 A;  2O5G A;  4DIR A;  1LA3 A;  1MXL C;  1CFC A;  1IH0 A;  3KPX A;  1K9U A;  3NSO A;  4TNC A;  3NHT A;  3PN7 C;  1JF2 A;  1N2D A;  5HKY A;  1KSO A;  3O78 A;  2WCH A;  1IG5 A;  3R1P A;  5D3O A;  2NZ0 A;  1S1E A;  1J1E A;  1ZUZ A;  1MUX A;  2OPO A;  4MVF A;  1GQM A;  3KEV A;  4PE4 A;  2JXL A;  3BUM B;  1QX7 A;  1CFF A; 
#chains in the Genus database with same CATH homology
 3CYZ A;  2P70 A;  3B87 A;  3BJH A;  3BFA A;  4JD9 A;  2P71 A;  2WC5 A;  3B6X A;  3B7A A;  1DQE A;  3B86 A;  3OGN A;  3CZ2 A;  3L47 A;  1T14 A;  2ERB A;  2PQL A;  2FJY A;  2WCK A;  1OOF A;  1TWO A;  3PJI A;  1OOI X;  2WCJ A;  3R72 A;  3S0F A;  1C3Y A;  1GM0 A;  3BFH A;  2QEO A;  3VB1 A;  3S0A A;  2JPO A;  3K1E A;  2QEB A;  3DXL A;  3CZ0 A;  3D77 A;  4OZD A;  3QME A;  1TUJ A;  4FQT A;  3FE8 A;  3S0G A;  3S0B A;  2WC6 A;  3CZ1 A;  1OW4 A;  3L4L A;  1OOG A;  4F7F A;  3FE9 A;  3DZT A;  5DIC A;  3S0E A;  1XFR A;  2QEV A;  3R1V A;  3BFB A;  3S0D A;  3CAB A;  3L4A A;  3D76 A;  4INW A;  3D78 A;  3DYE A;  3FE6 A;  2WCM A;  3NHI A;  3B88 A;  4INX A;  3D74 A;  3DY9 A;  1OOH A;  1QWV A;  3NGV A;  2KPH A;  2H8V A;  3RZS A;  3Q8I A;  3D75 A;  5EL2 A;  1ORG A;  3N7H A;  4PT1 A;  1LS8 A;  3D73 A;  3R1O A;  1P28 A;  2QDI A;  3NHT A;  1C3Z A;  2QEH A;  2GTE A;  2WCH A;  3CDN A;  3R1P A;  2WCL A;  3V2L A;  2L2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...