4FQTA

Structure of agamobp1 bound to 6-methyl-5-hepten-2-one
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant-binding protein
molecule keywords Anopheles Gambiae Odorant Binding protein 1
publication title Interactions of Anopheles gambiae Odorant-binding Proteins with a Human-derived Repellent: IMPLICATIONS FOR THE MODE OF ACTION OF N,N-DIETHYL-3-METHYLBENZAMIDE (DEET).
pubmed doi rcsb
source organism Anopheles gambiae
total genus 40
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4fqtA01
3DXLA 3B86A 2QDIA 3L4AA 5EL2A 3CABA 3BFBA 3S0AA 3R1PA 3B7AA 3D75A 4OZDA 1DQEA 4F7FA 2KPHA 2QEOA 3D77A 2WC6A 1TUJA 2L2CA 3DYEA 3CYZA 2WCJA 2WCLA 3VB1A 3Q8IA 2JPOA 1OOGA 3N7HA 2H8VA 3CDNA 2QEHA 4INWA 3DY9A 1OOHA 3DZTA 2WC5A 2WCHA 3D76A 3L4LA 3FE8A 2PQLA 1GM0A 3S0GA 1OOIX 1C3YA 3R1VA 3S0DA 3L47A 1P28A 1OOFA 3QMEA 3B87A 1OW4A 4JD9A 3BFHA 2FJYA 3CZ1A 5DICA 3S0BA 4INXA 3D78A 1LS8A 2GTEA 3BJHA 2QEBA 2P70A 1T14A 3BFAA 3CZ0A 3V2LA 2WCKA 3OGNA 4PT1A 3K1EA 3PJIA 3D74A 2P71A 1ORGA 3R1OA 1QWVA 3CZ2A 3R72A 3NHIA 3FE6A 2QEVA 2ERBA 1C3ZA 3D73A 3RZSA 1XFRA 1TWOA 3NGVA 3S0FA 2WCMA 3B6XA 3B88A 3FE9A 3S0EA 4FQTA 3NHTA
chains in the Genus database with same CATH superfamily
2BL0C 1QIVA 1DGUA 4DS7A 2Y1MA 1TIZA 2KOTA 2LLSA 3OP0A 4GGNA 3DVJA 2QDIA 5G08A 3IQQA 2BKHB 1ALWA 3BOWA 3OB2B 1ZOTB 3BUNB 4PHJA 2MJWB 1UHIA 3OX6A 1TUZA 3D75A 1DQEA 1D1OA 2K7OA 1UWOA 2QEOA 3D77A 4GAOA 1DGVA 1E8AA 1K9KA 1EH2A 2KQYA 1W9ZA 2L51A 3I5IC 3PN7C 1S6JA 4GPLB 2WCLA 1H8BA 1EG4A 1CFCA 1PVBA 1NSHA 4YBHB 1SPYA 1V1GA 3VB1A 1OZSA 3OX5A 3Q8IA 1DT7B 1OOGA 4HRGA 2KDHA 3BUXB 1FPWA 2CCMA 3TDUA 2KAVA 1KCYA 1DELA 1TNPA 3DY9A 3SJSA 1KQMC 3I5GC 1OOHA 3RLZA 2WC5A 2LANA 4GNKB 1LVCD 3TZ1A 1N2DA 1B8CA 2LAPA 5D7FA 5GQQC 1J7QA 2KQ6A 2M97A 3C1VA 1A4PA 1OSAA 3D10A 5HYDA 2LC5A 2PQLA 1OQPA 3F45A 4FQOA 1YVHA 2DOQA 4YGBB 1C3YA 1J55A 1YX8A 2Q91A 3JTDC 3S0DA 2KFHA 1U5IA 2ISDA 1BU3A 4DRWA 1QV1A 3EVVA 4JPZB 3WXAA 4BY5A 1F71A 1EJ3A 1Y0VH 2FOTA 1C7WA 1OE9B 3I5FC 3JTDB 3SG4A 1AJ4A 1OW4A 4GUKA 2NXQA 2K61A 4YI9A 1B1GA 2KLDA 1ZACA 4MEWA 5DICA 1SR6C 4ORCB 2KGBC 2LV7A 1RTP1 2JULA 2I7AA 1GGWA 4CIDA 1XK4C 1Y1XA 1CLLA 1JWDA 4N1GA 4JKTA 2HQ8A 4GGFC 4QJ4B 1JUOA 2LHIA 3NXAA 4Q04A 4AOMA 1AJ5A 2F2OA 2M29A 1MXLC 1FI6A 1Z2CB 2M0RA 1YTZC 3CZ0A 1BLQA 3CR5X 1TRFA 2BCBA 2MLEC 3SS3A 2PASA 2I18A 2PRUA 2QACA 1TNQA 2OS8B 3KEVA 1U5IB 1CM1A 3LL8B 4HREE 1UHHA 2A4JA 2F33A 5AFPA 2BAPA 3SS5A 2PMYA 1OMDA 2H61A 2MBXA 3BUOB 3ZNIA 1XVJA 3NSOA 4F0ZB 4ORAB 1CDPA 2ERBA 2KYCA 1K96A 3D73A 4DCKA 2CNPA 1DJXA 3RZSA 3FWBA 1IQ5A 1XFRA 1TWOA 1A2XA 1PRWA 2HF5A 1ZFSA 2Y4QA 3NGVA 5I2QA 3S0FA 1SW8A 3TS5C 1OMRA 2OTGC 4I5KA 2WCMA 1JFKA 1SMGA 4JQ0D 1G33A 2LLTA 1L2OC 4FQTA 4MBEA 3FE6A 4MRXA 2CBLA 3D0YA 2WC8A 3DXLA 1X02A 1MXEA 1UURA 2ZRTA 5IBWA 3B86A 1F54A 2FJUB 2PALA 3NSKA 1QS7A 3VROA 2LMUA 1XFWO 2BNXA 2KLEA 1F55A 1NCXA 4PE7A 4P2YB 5AEQA 4OKHA 3CABA 2KI4B 2KAXA 1OZOA 3BFBA 3WNXB 3EK4A 2L5XB 1NP8A 4PE4A 1W7IB 2BCAA 1F4QA 2KSPA 4AQJA 1S3PA 2JT8A 3EK8A 1YUSA 1SCMC 3H4SE 3O78A 1R6PA 4IL1A 4PALA 4YRUA 1TUJA 1TTXA 1NX0A 4CPVA 1DJHA 3LLEA 4I5JA 1IH0A 1TOPA 3O4YA 1M45A 3AKBA 1JF0A 1KFXL 1OOJA 4CFRA 2BCXA 3LK1A 1KFXS 4QJ5B 2JPOA 1WLMA 1CLMA 1PALA 2H8VA 2LVVA 1YX7A 2M9GA 2EGDA 1BR4B 3VRRA 3O6BA 4INWA 2K7DA 1HQVA 3D0YB 2D8NA 1KK7Z 2BL0B 1XFZO 1GQMA 2KBMA 5CSJA 2KFGA 2NZ0A 1Y1UA 3EK7A 1SL8A 3M0WA 1GJYA 5FI2A 2K2FA 4ETOA 1YRTB 2LM5A 2BE6A 3EVUA 1KQVA 1BR1B 3CS1A 1KK8C 1OOIX 1CDMA 1UUSA 5CSIA 1SKTA 1JF2A 5AANA 5K89A 2KHNA 1TNWA 3I5HC 3SG2A 5PALA 1F70A 1CDLA 3LCPC 5F6TA 3BUWB 3I5IB 4YGCB 3KHEA 1OOFA 3AAJA 3PM2A 2GGZA 3PN7B 1CM4A 3QMEA 1CDNA 3GOFA 1NX3A 3BXKA 1K90D 1UHKA 2HPSA 1B8RA 1K94A 5HL1A 1DJZA 4CFQA 2KI6D 1NCZA 2FJYA 1LXFC 2KYFA 4YGEB 1CMFA 2MHHA 3CZ1A 4TNCA 3CTNA 4YI8A 3SG3A 2SASA 1L7ZA 3KF9A 3S0BA 2WORA 2BECA 2JQ6A 2JT0A 4GBAA 3TDZA 1B47A 4INXA 2KBIA 1KQMB 3I5GB 5ER4X 2LNKA 2PYQA 1XK4A 1YUTA 1LS8A 3BJHA 1Y6WA 2JTTA 2LCPA 2QEBA 2P70A 4MVFA 1KWOC 2L0PA 4GGFA 4M2QA 1V1FA 1ZUZA 4E68A 1SL7A 5DKRA 3PSRA 4PT1A 3VRPA 3K1EA 1LKJA 3MSEB 1CB1A 4GFTA 1ODBA 1A29A 1NYAA 2CTNA 3BYAA 2P71A 3DVEA 1ORGA 2JRFA 1YVLA 2I94A 3DD4A 4ICBA 4WQ3A 1BJFA 5J3XA 3I5FB 3NHIA 2QEVA 3EVRA 1QIWA 1J7PA 1CFPA 1C7VA 1W7JB 3EG5B 4NDDA 2JC2A 1SRAA 4M2PA 1SL9A 2L2EA 1J1EA 1OMVA 2WOSA 3B88A 4ORBB 1SR6B 1CKKA 3S0EA 1DMOA 1BT6A 1VRKA 1DF0A 1RWYA 3IQOA 4UPGA 3DVKA 1G4YR 1ZMZA 1F4OA 2Q4UA 4OVNF 2JTZA 3DF0B 2LE9B 1XFVO 2ZFDA 5HLVA 5B8IB 2ZN8A 2M8UA 1DC1A 3EKHA 1QASA 2JPTA 5EL2A 1DTLA 3FWCA 1QVIZ 2F2PA 3O2PA 4PE0A 1K9PA 2JNXA 2GGMA 3B7AA 3R1PA 4P5OE 5BPJA 3NSIA 2JU0A 2EC6C 1MWNA 4F7FA 2JXCA 2KPHA 1WLZA 4USLA 1RROA 1K8UA 2K8MB 3PFVA 2WC6A 2K2AA 3DYEA 2IS9A 3DVMA 5TNCA 2QPTA 2FCDA 2SCPA 5FI7A 1K93D 1NUBA 2OPOA 1FI5A 1KK7Y 2BKIB 4MSPA 5CPVA 2K60A 1FBVA 1A03A 3N7HA 3SG7A 4C0KA 1PK0D 3FIAA 3JVTC 3NSLA 2QEHA 3OHMB 1WRKA 1N65A 3GK4X 3PALA 3TS5B 2OTGB 1DF0B 2M1KB 1PSBA 1RJVA 3OB1B 4PDZA 3BQ3A 1AHRA 1L2OB 2JXLA 3TDIA 2JOJA 2WCEA 3HX4A 3D76A 2LMVA 1WRLA 3TUYC 1M31A 5KSZA 4U8DA 1HT9A 1SBJA 3PATA 5D69A 1WDCC 4ZCVA 1SNLA 1B4CA 4ZCUA 3SG6A 2RGIA 1Y1AA 1IRJA 2NLNA 3PLFB 2P6BB 1QV0A 4KYNA 3ZWHA 1S36A 4PE1A 2LP2A 2PVBA 1DJYA 1SCMB 1WDCB 4OV2A 2ZN9A 5HKYA 1J7RA 2H2KA 3LK0A 4JWQA 4OR9B 3RM1A 1XFXO 1YURA 3B87A 5KU1A 2Y5IA 4PHMA 4IJ7A 2L50A 4JD9A 1DEKA 3GK1A 1MQ1A 1CFDA 1RK9A 3SIAA 1TCOB 1JSAA 1UP5A 1CLBA 2YGUA 1PSRA 1PVAA 2ZRSA 3BUMB 3SG5A 4MZLA 1IQ3A 1QX2A 1NPQA 5JJGA 1QATA 1IGVA 2MA2A 4N1FA 2KGRA 1B7TZ 1EG3A 2K7BA 2VRGA 3D78A 2FCEA 5DKQA 2GTEA 4C0JA 4D1EA 1K2HA 1LA3A 2WCFA 1IIOA 1IJ5A 4L9MA 1QLKA 1S6IA 4DIRA 2L5YA 3EKJA 1EL4A 1M39A 1T14A 5DKNA 1NX1A 2TN4A 2M7LA 2ZNDA 3CGAA 1M46A 2GV5A 1RECA 3V2LA 1KK8B 1LINA 1S5GY 2Y1NA 3A8RA 3AAKA 5I2LA 2JZIA 1Q80A 1S26D 1SCVA 3I5HB 1SY9A 2I2RE 3R1OA 4NDCA 1S6CA 1JBAA 4BY4A 5HKZA 2CXJA 4PHKA 2LHLA 1CNPA 1B9AA 1AP4A 3CR4X 1M63B 2K0JA 2EHBA 5JOLA 3CLNA 2L4HA 3UO9A 2LP3A 5D3OA 4MZJA 1C3ZA 1KSOA 3IF7A 1RFJA 3K21A 2HETA 3ICBA 1WY9A 3B6XA 3DF0A 3FE9A 2ZNEA 1DJGA 2JT3A 5FYXA 1KSMA 1F8HA 4QJ3B 1BMOA 1QVIY 4OCIA 3VRQA 2M49B 2MRDA 2O5GA 3UNWA 2LUXA 2MLFC 1PULA 4XYNA 2AMIA 1IJ6A 4I5NB 1KWOB 1WRZA 5I94A 3L4AA 1CMGA 4PCWA 1Z4HA 2CT9A 3S0AA 1G8IA 4OZDA 3VRNA 1A75A 3BOWB 1S5GZ 1N0YA 2E6WA 1B8LA 1QX7A 1SSEB 2L2CA 1XFUO 2F8PA 2HQWA 2WCJA 1S1EA 3CYZA 2BBNA 2MAZA 4C0LA 2R2IA 2AUCA 2E30A 2LVJA 2PSRA 1IKUA 1K9UA 1MHOA 1BOCA 3CDNA 3A4UB 1QTXA 2KI6C 2JWWA 5HKWA 1TN4A 1J1DA 3WHUB 5I2OA 1NWDA 1TNXA 3AKAA 1QX5B 1H4BA 5AERA 3DZTA 5ER5A 2LUCA 2WCHA 3L4LA 1YR5A 2NCOA 3FE8A 4MRYA 1BODA 3CZTX 3WHTB 1AK8A 2KNEA 3FS7A 1SK6D 1JFJA 3GK2A 1GM0A 4XJKA 4NQGA 3O4XA 3S0GA 3CWGA 1A75B 1YRUB 2OS8C 2COLB 3E3RA 2EC6B 2K7CA 2F3YA 3R1VA 2NCPA 1XYDA 3L47A 5KTYA 2L98A 1QXPA 1P28A 1MF8B 1DJWA 4N5XA 4AQIA 1ALVA 2KFFA 4MN0A 1JC2A 2F3ZA 2M3WA 3OBVA 1MUXA 1DJIA 4MLWA 3BFHA 2M1UA 1UHJA 1B7TY 1NIWA 3CR2A 1FF1A 2L4IA 3KO0A 2AAOA 3JVTB 1AUIB 2WCBA 3VGOA 1BF5A 1NCYA 1KFUL 3QRXA 1J7OA 1XO5A 5HLOA 1KFUS 1FW4A 4R1EA 4A4CA 1SYMA 4PHNA 4YGAA 2WNDA 1C07A 1MR8A 4NDBA 3TUYB 5CSNA 4FTGA 1TCFA 4HRHA 4WQ2A 1NX2A 1LA0A 1QLSA 3SS4A 4XJKB 2G2BA 1DVIA 1R2UA 1IWQA 1UHNA 2B1UA 3BFAA 4HSZA 2LVIA 2KI4C 3HCMA 5AXIA 3KPXA 5CSFA 1GGZA 2WCKA 3OGNA 2O60A 2ZKMX 4YGDB 1IG5A 4DUQA 3PJIA 1EXRA 3D74A 4A4BA 4I5LB 2H61C 1K95A 2G9BA 1CTRA 2BBMA 5FI6A 1YUUA 1QWVA 2LMTA 3CZ2A 3PM8A 3R72A 4M2OA 4WRIA 3IVTA 1CFFA 4CLNA 1BG1A 1XA5A 1XFYO 1AVSA 4MZKA 5I8NA 2KAYA 2JNFA 2BE4A 2LVKA 2V53A 3SIBA 2M7NA 2LLUA 1QJTA 3NHTA
chains in the Genus database with same CATH topology
3DXLA 3B86A 2QDIA 3L4AA 5EL2A 3CABA 3BFBA 3S0AA 3R1PA 3B7AA 3D75A 4OZDA 1DQEA 4F7FA 2KPHA 2QEOA 3D77A 2WC6A 1TUJA 2L2CA 3DYEA 3CYZA 2WCJA 2WCLA 3VB1A 3Q8IA 2JPOA 1OOGA 3N7HA 2H8VA 3CDNA 2QEHA 4INWA 3DY9A 1OOHA 3DZTA 2WC5A 2WCHA 3D76A 3L4LA 3FE8A 2PQLA 1GM0A 3S0GA 1OOIX 1C3YA 3R1VA 3S0DA 3L47A 1P28A 1OOFA 3QMEA 3B87A 1OW4A 4JD9A 3BFHA 2FJYA 3CZ1A 5DICA 3S0BA 4INXA 3D78A 1LS8A 2GTEA 3BJHA 2QEBA 2P70A 1T14A 3BFAA 3CZ0A 3V2LA 2WCKA 3OGNA 4PT1A 3K1EA 3PJIA 3D74A 2P71A 1ORGA 3R1OA 1QWVA 3CZ2A 3R72A 3NHIA 3FE6A 2QEVA 2ERBA 1C3ZA 3D73A 3RZSA 1XFRA 1TWOA 3NGVA 3S0FA 2WCMA 3B6XA 3B88A 3FE9A 3S0EA 4FQTA 3NHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXL A;  3B86 A;  2QDI A;  3L4A A;  5EL2 A;  3CAB A;  3BFB A;  3S0A A;  3R1P A;  3B7A A;  3D75 A;  4OZD A;  1DQE A;  4F7F A;  2KPH A;  2QEO A;  3D77 A;  2WC6 A;  1TUJ A;  2L2C A;  3DYE A;  3CYZ A;  2WCJ A;  2WCL A;  3VB1 A;  3Q8I A;  2JPO A;  1OOG A;  3N7H A;  2H8V A;  3CDN A;  2QEH A;  4INW A;  3DY9 A;  1OOH A;  3DZT A;  2WC5 A;  2WCH A;  3D76 A;  3L4L A;  3FE8 A;  2PQL A;  1GM0 A;  3S0G A;  1OOI X;  1C3Y A;  3R1V A;  3S0D A;  3L47 A;  1P28 A;  1OOF A;  3QME A;  3B87 A;  1OW4 A;  4JD9 A;  3BFH A;  2FJY A;  3CZ1 A;  5DIC A;  3S0B A;  4INX A;  3D78 A;  1LS8 A;  2GTE A;  3BJH A;  2QEB A;  2P70 A;  1T14 A;  3BFA A;  3CZ0 A;  3V2L A;  2WCK A;  3OGN A;  4PT1 A;  3K1E A;  3PJI A;  3D74 A;  2P71 A;  1ORG A;  3R1O A;  1QWV A;  3CZ2 A;  3R72 A;  3NHI A;  3FE6 A;  2QEV A;  2ERB A;  1C3Z A;  3D73 A;  3RZS A;  1XFR A;  1TWO A;  3NGV A;  3S0F A;  2WCM A;  3B6X A;  3B88 A;  3FE9 A;  3S0E A;  4FQT A;  3NHT A; 
#chains in the Genus database with same CATH topology
 2BL0 C;  1QIV A;  1DGU A;  4DS7 A;  2Y1M A;  1TIZ A;  2KOT A;  2LLS A;  3OP0 A;  4GGN A;  3DVJ A;  2QDI A;  5G08 A;  3IQQ A;  2BKH B;  1ALW A;  3BOW A;  3OB2 B;  1ZOT B;  3BUN B;  4PHJ A;  2MJW B;  1UHI A;  3OX6 A;  1TUZ A;  3D75 A;  1DQE A;  1D1O A;  2K7O A;  1UWO A;  2QEO A;  3D77 A;  4GAO A;  1DGV A;  1E8A A;  1K9K A;  1EH2 A;  2KQY A;  1W9Z A;  2L51 A;  3I5I C;  3PN7 C;  1S6J A;  4GPL B;  2WCL A;  1H8B A;  1EG4 A;  1CFC A;  1PVB A;  1NSH A;  4YBH B;  1SPY A;  1V1G A;  3VB1 A;  1OZS A;  3OX5 A;  3Q8I A;  1DT7 B;  1OOG A;  4HRG A;  2KDH A;  3BUX B;  1FPW A;  2CCM A;  3TDU A;  2KAV A;  1KCY A;  1DEL A;  1TNP A;  3DY9 A;  3SJS A;  1KQM C;  3I5G C;  1OOH A;  3RLZ A;  2WC5 A;  2LAN A;  4GNK B;  1LVC D;  3TZ1 A;  1N2D A;  1B8C A;  2LAP A;  5D7F A;  5GQQ C;  1J7Q A;  2KQ6 A;  2M97 A;  3C1V A;  1A4P A;  1OSA A;  3D10 A;  5HYD A;  2LC5 A;  2PQL A;  1OQP A;  3F45 A;  4FQO A;  1YVH A;  2DOQ A;  4YGB B;  1C3Y A;  1J55 A;  1YX8 A;  2Q91 A;  3JTD C;  3S0D A;  2KFH A;  1U5I A;  2ISD A;  1BU3 A;  4DRW A;  1QV1 A;  3EVV A;  4JPZ B;  3WXA A;  4BY5 A;  1F71 A;  1EJ3 A;  1Y0V H;  2FOT A;  1C7W A;  1OE9 B;  3I5F C;  3JTD B;  3SG4 A;  1AJ4 A;  1OW4 A;  4GUK A;  2NXQ A;  2K61 A;  4YI9 A;  1B1G A;  2KLD A;  1ZAC A;  4MEW A;  5DIC A;  1SR6 C;  4ORC B;  2KGB C;  2LV7 A;  1RTP 1;  2JUL A;  2I7A A;  1GGW A;  4CID A;  1XK4 C;  1Y1X A;  1CLL A;  1JWD A;  4N1G A;  4JKT A;  2HQ8 A;  4GGF C;  4QJ4 B;  1JUO A;  2LHI A;  3NXA A;  4Q04 A;  4AOM A;  1AJ5 A;  2F2O A;  2M29 A;  1MXL C;  1FI6 A;  1Z2C B;  2M0R A;  1YTZ C;  3CZ0 A;  1BLQ A;  3CR5 X;  1TRF A;  2BCB A;  2MLE C;  3SS3 A;  2PAS A;  2I18 A;  2PRU A;  2QAC A;  1TNQ A;  2OS8 B;  3KEV A;  1U5I B;  1CM1 A;  3LL8 B;  4HRE E;  1UHH A;  2A4J A;  2F33 A;  5AFP A;  2BAP A;  3SS5 A;  2PMY A;  1OMD A;  2H61 A;  2MBX A;  3BUO B;  3ZNI A;  1XVJ A;  3NSO A;  4F0Z B;  4ORA B;  1CDP A;  2ERB A;  2KYC A;  1K96 A;  3D73 A;  4DCK A;  2CNP A;  1DJX A;  3RZS A;  3FWB A;  1IQ5 A;  1XFR A;  1TWO A;  1A2X A;  1PRW A;  2HF5 A;  1ZFS A;  2Y4Q A;  3NGV A;  5I2Q A;  3S0F A;  1SW8 A;  3TS5 C;  1OMR A;  2OTG C;  4I5K A;  2WCM A;  1JFK A;  1SMG A;  4JQ0 D;  1G33 A;  2LLT A;  1L2O C;  4FQT A;  4MBE A;  3FE6 A;  4MRX A;  2CBL A;  3D0Y A;  2WC8 A;  3DXL A;  1X02 A;  1MXE A;  1UUR A;  2ZRT A;  5IBW A;  3B86 A;  1F54 A;  2FJU B;  2PAL A;  3NSK A;  1QS7 A;  3VRO A;  2LMU A;  1XFW O;  2BNX A;  2KLE A;  1F55 A;  1NCX A;  4PE7 A;  4P2Y B;  5AEQ A;  4OKH A;  3CAB A;  2KI4 B;  2KAX A;  1OZO A;  3BFB A;  3WNX B;  3EK4 A;  2L5X B;  1NP8 A;  4PE4 A;  1W7I B;  2BCA A;  1F4Q A;  2KSP A;  4AQJ A;  1S3P A;  2JT8 A;  3EK8 A;  1YUS A;  1SCM C;  3H4S E;  3O78 A;  1R6P A;  4IL1 A;  4PAL A;  4YRU A;  1TUJ A;  1TTX A;  1NX0 A;  4CPV A;  1DJH A;  3LLE A;  4I5J A;  1IH0 A;  1TOP A;  3O4Y A;  1M45 A;  3AKB A;  1JF0 A;  1KFX L;  1OOJ A;  4CFR A;  2BCX A;  3LK1 A;  1KFX S;  4QJ5 B;  2JPO A;  1WLM A;  1CLM A;  1PAL A;  2H8V A;  2LVV A;  1YX7 A;  2M9G A;  2EGD A;  1BR4 B;  3VRR A;  3O6B A;  4INW A;  2K7D A;  1HQV A;  3D0Y B;  2D8N A;  1KK7 Z;  2BL0 B;  1XFZ O;  1GQM A;  2KBM A;  5CSJ A;  2KFG A;  2NZ0 A;  1Y1U A;  3EK7 A;  1SL8 A;  3M0W A;  1GJY A;  5FI2 A;  2K2F A;  4ETO A;  1YRT B;  2LM5 A;  2BE6 A;  3EVU A;  1KQV A;  1BR1 B;  3CS1 A;  1KK8 C;  1OOI X;  1CDM A;  1UUS A;  5CSI A;  1SKT A;  1JF2 A;  5AAN A;  5K89 A;  2KHN A;  1TNW A;  3I5H C;  3SG2 A;  5PAL A;  1F70 A;  1CDL A;  3LCP C;  5F6T A;  3BUW B;  3I5I B;  4YGC B;  3KHE A;  1OOF A;  3AAJ A;  3PM2 A;  2GGZ A;  3PN7 B;  1CM4 A;  3QME A;  1CDN A;  3GOF A;  1NX3 A;  3BXK A;  1K90 D;  1UHK A;  2HPS A;  1B8R A;  1K94 A;  5HL1 A;  1DJZ A;  4CFQ A;  2KI6 D;  1NCZ A;  2FJY A;  1LXF C;  2KYF A;  4YGE B;  1CMF A;  2MHH A;  3CZ1 A;  4TNC A;  3CTN A;  4YI8 A;  3SG3 A;  2SAS A;  1L7Z A;  3KF9 A;  3S0B A;  2WOR A;  2BEC A;  2JQ6 A;  2JT0 A;  4GBA A;  3TDZ A;  1B47 A;  4INX A;  2KBI A;  1KQM B;  3I5G B;  5ER4 X;  2LNK A;  2PYQ A;  1XK4 A;  1YUT A;  1LS8 A;  3BJH A;  1Y6W A;  2JTT A;  2LCP A;  2QEB A;  2P70 A;  4MVF A;  1KWO C;  2L0P A;  4GGF A;  4M2Q A;  1V1F A;  1ZUZ A;  4E68 A;  1SL7 A;  5DKR A;  3PSR A;  4PT1 A;  3VRP A;  3K1E A;  1LKJ A;  3MSE B;  1CB1 A;  4GFT A;  1ODB A;  1A29 A;  1NYA A;  2CTN A;  3BYA A;  2P71 A;  3DVE A;  1ORG A;  2JRF A;  1YVL A;  2I94 A;  3DD4 A;  4ICB A;  4WQ3 A;  1BJF A;  5J3X A;  3I5F B;  3NHI A;  2QEV A;  3EVR A;  1QIW A;  1J7P A;  1CFP A;  1C7V A;  1W7J B;  3EG5 B;  4NDD A;  2JC2 A;  1SRA A;  4M2P A;  1SL9 A;  2L2E A;  1J1E A;  1OMV A;  2WOS A;  3B88 A;  4ORB B;  1SR6 B;  1CKK A;  3S0E A;  1DMO A;  1BT6 A;  1VRK A;  1DF0 A;  1RWY A;  3IQO A;  4UPG A;  3DVK A;  1G4Y R;  1ZMZ A;  1F4O A;  2Q4U A;  4OVN F;  2JTZ A;  3DF0 B;  2LE9 B;  1XFV O;  2ZFD A;  5HLV A;  5B8I B;  2ZN8 A;  2M8U A;  1DC1 A;  3EKH A;  1QAS A;  2JPT A;  5EL2 A;  1DTL A;  3FWC A;  1QVI Z;  2F2P A;  3O2P A;  4PE0 A;  1K9P A;  2JNX A;  2GGM A;  3B7A A;  3R1P A;  4P5O E;  5BPJ A;  3NSI A;  2JU0 A;  2EC6 C;  1MWN A;  4F7F A;  2JXC A;  2KPH A;  1WLZ A;  4USL A;  1RRO A;  1K8U A;  2K8M B;  3PFV A;  2WC6 A;  2K2A A;  3DYE A;  2IS9 A;  3DVM A;  5TNC A;  2QPT A;  2FCD A;  2SCP A;  5FI7 A;  1K93 D;  1NUB A;  2OPO A;  1FI5 A;  1KK7 Y;  2BKI B;  4MSP A;  5CPV A;  2K60 A;  1FBV A;  1A03 A;  3N7H A;  3SG7 A;  4C0K A;  1PK0 D;  3FIA A;  3JVT C;  3NSL A;  2QEH A;  3OHM B;  1WRK A;  1N65 A;  3GK4 X;  3PAL A;  3TS5 B;  2OTG B;  1DF0 B;  2M1K B;  1PSB A;  1RJV A;  3OB1 B;  4PDZ A;  3BQ3 A;  1AHR A;  1L2O B;  2JXL A;  3TDI A;  2JOJ A;  2WCE A;  3HX4 A;  3D76 A;  2LMV A;  1WRL A;  3TUY C;  1M31 A;  5KSZ A;  4U8D A;  1HT9 A;  1SBJ A;  3PAT A;  5D69 A;  1WDC C;  4ZCV A;  1SNL A;  1B4C A;  4ZCU A;  3SG6 A;  2RGI A;  1Y1A A;  1IRJ A;  2NLN A;  3PLF B;  2P6B B;  1QV0 A;  4KYN A;  3ZWH A;  1S36 A;  4PE1 A;  2LP2 A;  2PVB A;  1DJY A;  1SCM B;  1WDC B;  4OV2 A;  2ZN9 A;  5HKY A;  1J7R A;  2H2K A;  3LK0 A;  4JWQ A;  4OR9 B;  3RM1 A;  1XFX O;  1YUR A;  3B87 A;  5KU1 A;  2Y5I A;  4PHM A;  4IJ7 A;  2L50 A;  4JD9 A;  1DEK A;  3GK1 A;  1MQ1 A;  1CFD A;  1RK9 A;  3SIA A;  1TCO B;  1JSA A;  1UP5 A;  1CLB A;  2YGU A;  1PSR A;  1PVA A;  2ZRS A;  3BUM B;  3SG5 A;  4MZL A;  1IQ3 A;  1QX2 A;  1NPQ A;  5JJG A;  1QAT A;  1IGV A;  2MA2 A;  4N1F A;  2KGR A;  1B7T Z;  1EG3 A;  2K7B A;  2VRG A;  3D78 A;  2FCE A;  5DKQ A;  2GTE A;  4C0J A;  4D1E A;  1K2H A;  1LA3 A;  2WCF A;  1IIO A;  1IJ5 A;  4L9M A;  1QLK A;  1S6I A;  4DIR A;  2L5Y A;  3EKJ A;  1EL4 A;  1M39 A;  1T14 A;  5DKN A;  1NX1 A;  2TN4 A;  2M7L A;  2ZND A;  3CGA A;  1M46 A;  2GV5 A;  1REC A;  3V2L A;  1KK8 B;  1LIN A;  1S5G Y;  2Y1N A;  3A8R A;  3AAK A;  5I2L A;  2JZI A;  1Q80 A;  1S26 D;  1SCV A;  3I5H B;  1SY9 A;  2I2R E;  3R1O A;  4NDC A;  1S6C A;  1JBA A;  4BY4 A;  5HKZ A;  2CXJ A;  4PHK A;  2LHL A;  1CNP A;  1B9A A;  1AP4 A;  3CR4 X;  1M63 B;  2K0J A;  2EHB A;  5JOL A;  3CLN A;  2L4H A;  3UO9 A;  2LP3 A;  5D3O A;  4MZJ A;  1C3Z A;  1KSO A;  3IF7 A;  1RFJ A;  3K21 A;  2HET A;  3ICB A;  1WY9 A;  3B6X A;  3DF0 A;  3FE9 A;  2ZNE A;  1DJG A;  2JT3 A;  5FYX A;  1KSM A;  1F8H A;  4QJ3 B;  1BMO A;  1QVI Y;  4OCI A;  3VRQ A;  2M49 B;  2MRD A;  2O5G A;  3UNW A;  2LUX A;  2MLF C;  1PUL A;  4XYN A;  2AMI A;  1IJ6 A;  4I5N B;  1KWO B;  1WRZ A;  5I94 A;  3L4A A;  1CMG A;  4PCW A;  1Z4H A;  2CT9 A;  3S0A A;  1G8I A;  4OZD A;  3VRN A;  1A75 A;  3BOW B;  1S5G Z;  1N0Y A;  2E6W A;  1B8L A;  1QX7 A;  1SSE B;  2L2C A;  1XFU O;  2F8P A;  2HQW A;  2WCJ A;  1S1E A;  3CYZ A;  2BBN A;  2MAZ A;  4C0L A;  2R2I A;  2AUC A;  2E30 A;  2LVJ A;  2PSR A;  1IKU A;  1K9U A;  1MHO A;  1BOC A;  3CDN A;  3A4U B;  1QTX A;  2KI6 C;  2JWW A;  5HKW A;  1TN4 A;  1J1D A;  3WHU B;  5I2O A;  1NWD A;  1TNX A;  3AKA A;  1QX5 B;  1H4B A;  5AER A;  3DZT A;  5ER5 A;  2LUC A;  2WCH A;  3L4L A;  1YR5 A;  2NCO A;  3FE8 A;  4MRY A;  1BOD A;  3CZT X;  3WHT B;  1AK8 A;  2KNE A;  3FS7 A;  1SK6 D;  1JFJ A;  3GK2 A;  1GM0 A;  4XJK A;  4NQG A;  3O4X A;  3S0G A;  3CWG A;  1A75 B;  1YRU B;  2OS8 C;  2COL B;  3E3R A;  2EC6 B;  2K7C A;  2F3Y A;  3R1V A;  2NCP A;  1XYD A;  3L47 A;  5KTY A;  2L98 A;  1QXP A;  1P28 A;  1MF8 B;  1DJW A;  4N5X A;  4AQI A;  1ALV A;  2KFF A;  4MN0 A;  1JC2 A;  2F3Z A;  2M3W A;  3OBV A;  1MUX A;  1DJI A;  4MLW A;  3BFH A;  2M1U A;  1UHJ A;  1B7T Y;  1NIW A;  3CR2 A;  1FF1 A;  2L4I A;  3KO0 A;  2AAO A;  3JVT B;  1AUI B;  2WCB A;  3VGO A;  1BF5 A;  1NCY A;  1KFU L;  3QRX A;  1J7O A;  1XO5 A;  5HLO A;  1KFU S;  1FW4 A;  4R1E A;  4A4C A;  1SYM A;  4PHN A;  4YGA A;  2WND A;  1C07 A;  1MR8 A;  4NDB A;  3TUY B;  5CSN A;  4FTG A;  1TCF A;  4HRH A;  4WQ2 A;  1NX2 A;  1LA0 A;  1QLS A;  3SS4 A;  4XJK B;  2G2B A;  1DVI A;  1R2U A;  1IWQ A;  1UHN A;  2B1U A;  3BFA A;  4HSZ A;  2LVI A;  2KI4 C;  3HCM A;  5AXI A;  3KPX A;  5CSF A;  1GGZ A;  2WCK A;  3OGN A;  2O60 A;  2ZKM X;  4YGD B;  1IG5 A;  4DUQ A;  3PJI A;  1EXR A;  3D74 A;  4A4B A;  4I5L B;  2H61 C;  1K95 A;  2G9B A;  1CTR A;  2BBM A;  5FI6 A;  1YUU A;  1QWV A;  2LMT A;  3CZ2 A;  3PM8 A;  3R72 A;  4M2O A;  4WRI A;  3IVT A;  1CFF A;  4CLN A;  1BG1 A;  1XA5 A;  1XFY O;  1AVS A;  4MZK A;  5I8N A;  2KAY A;  2JNF A;  2BE4 A;  2LVK A;  2V53 A;  3SIB A;  2M7N A;  2LLU A;  1QJT A;  3NHT A; 
#chains in the Genus database with same CATH homology
 3DXL A;  3B86 A;  2QDI A;  3L4A A;  5EL2 A;  3CAB A;  3BFB A;  3S0A A;  3R1P A;  3B7A A;  3D75 A;  4OZD A;  1DQE A;  4F7F A;  2KPH A;  2QEO A;  3D77 A;  2WC6 A;  1TUJ A;  2L2C A;  3DYE A;  3CYZ A;  2WCJ A;  2WCL A;  3VB1 A;  3Q8I A;  2JPO A;  1OOG A;  3N7H A;  2H8V A;  3CDN A;  2QEH A;  4INW A;  3DY9 A;  1OOH A;  3DZT A;  2WC5 A;  2WCH A;  3D76 A;  3L4L A;  3FE8 A;  2PQL A;  1GM0 A;  3S0G A;  1OOI X;  1C3Y A;  3R1V A;  3S0D A;  3L47 A;  1P28 A;  1OOF A;  3QME A;  3B87 A;  1OW4 A;  4JD9 A;  3BFH A;  2FJY A;  3CZ1 A;  5DIC A;  3S0B A;  4INX A;  3D78 A;  1LS8 A;  2GTE A;  3BJH A;  2QEB A;  2P70 A;  1T14 A;  3BFA A;  3CZ0 A;  3V2L A;  2WCK A;  3OGN A;  4PT1 A;  3K1E A;  3PJI A;  3D74 A;  2P71 A;  1ORG A;  3R1O A;  1QWV A;  3CZ2 A;  3R72 A;  3NHI A;  3FE6 A;  2QEV A;  2ERB A;  1C3Z A;  3D73 A;  3RZS A;  1XFR A;  1TWO A;  3NGV A;  3S0F A;  2WCM A;  3B6X A;  3B88 A;  3FE9 A;  3S0E A;  4FQT A;  3NHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...