2BCBA

High-resolution solution structure of calcium-loaded calbindin d9k
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title High-resolution structure of calcium-loaded calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 23
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1993-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bcbA00
1QLKA 3TUYB 1NP8A 3KO0A 5CSNA 3SG2A 1E8AA 1M39A 3I5GB 1SPYA 3F45A 1AJ4A 1K2HA 1QLSA 2WORA 5AEQA 1Y6WA 3BUXB 2KQYA 2EC6B 1Y1XA 2BBNA 1KK7Y 4NDDA 5DKQA 3HCMA 1QS7A 3IQOA 2ZRSA 1Y1AA 2JNXA 2KI4C 2P6BB 4ORBB 3O6BA 2JXLA 1J7QA 1N2DA 3KHEA 5CSJA 1KK8C 1CNPA 1J1EA 1NWDA 1QXPA 1CLLA 2WCFA 4OCIA 2LMVA 3SIAA 1L2OC 1F8HA 3SJSA 2LM5A 3D0YB 2LC5A 3VGOA 2LUXA 3HX4A 2JRFA 2E6WA 5BPJA 2F8PA 1KQMB 3GOFA 2HQ8A 1CM1A 2KI6C 4MRYA 5CSFA 3WHUB 5PALA 1SBJA 2FCEA 3BUNB 1C07A 1CKKA 2MAZA 2PASA 2GGZA 2H61C 4TNCA 1UURA 2M7LA 1KFXL 1PSBA 1QATA 1UHHA 3OHMB 3PSRA 1M45A 2ISDA 2LP3A 4M2OA 1M31A 4OVNF 1DGUA 4P5OE 4ICBA 3EVUA 4JQ0D 1DF0B 2LVIA 2TN4A 4I5NB 1NSHA 5GQQC 4WRIA 1DJYA 1JF0A 1S6JA 1KQMC 3EKHA 3I5HB 3WXAA 1J7RA 1S1EA 4ORAB 1S5GY 2PALA 1AUIB 2JNFA 1WY9A 4OV2A 2KAVA 4MZLA 1IGVA 3D10A 1S6CA 2M29A 5B8IB 4HSZA 3QRXA 2CTNA 3CLNA 3JTDB 5KTYA 1R2UA 5DKNA 1S3PA 3BOWB 4ETOA 1B8RA 4F0ZB 3DF0B 1BODA 3PM8A 3SIBA 1WDCC 3BUWB 1BJFA 1HT9A 1BOCA 2MLEC 2LAPA 1PALA 1YVLA 1JFKA 2KQ6A 1KFUL 2LUCA 3BXKA 5ER4X 4ORCB 3GK2A 1FBVA 1KFUS 2HQWA 1YRTB 1M46A 4AQIA 5IBWA 3DVKA 1TCOB 4M2PA 3EVVA 2K8MB 3IF7A 1CLMA 1EJ3A 3O2PA 3TZ1A 1D1OA 5HKZA 1NUBA 1RROA 1YX7A 5AFPA 2CBLA 4HREE 4FTGA 4N1FA 2KAXA 3OP0A 4USLA 3KF9A 4NDBA 2KGBC 3I5IB 1DJIA 1SR6B 5HLOA 4I5KA 1AJ5A 2I18A 1NX3A 4YRUA 1TRFA 2O5GA 2EGDA 2LHIA 3LCPC 4A4CA 1PK0D 1B7TY 1B8LA 1OZOA 2H61A 2LCPA 3FIAA 1N65A 2JPTA 2MBXA 2JT3A 1LKJA 1EXRA 5K89A 1DMOA 2Y1NA 3JVTC 1DT7B 2F2OA 1N0YA 4BY5A 2LLSA 1FPWA 3VRPA 3CTNA 4M2QA 1XFUO 2KFHA 2LLTA 5JOLA 4QJ4B 1XK4C 4IL1A 3CGAA 2JQ6A 1SCMB 4AOMA 4PCWA 2KBIA 2WCBA 1S36A 1ZMZA 1QTXA 2BKHB 2KFFA 5AERA 1TN4A 2M3WA 1XFXO 1BT6A 4N5XA 2OS8B 2BCXA 2JT0A 4DIRA 1B4CA 1NCXA 1J7OA 3O78A 1KCYA 1F4QA 2AUCA 2L0PA 1QIWA 2JWWA 4PE0A 2M97A 4GGFC 1SKTA 1B9AA 2ZKMX 1YTZC 3DVJA 1JFJA 3VRQA 5CPVA 1TCFA 2FOTA 4PALA 1PRWA 4P2YB 1F70A 2ZRTA 3WHTB 2BCAA 1CDPA 1KK7Z 4R1EA 4I5JA 3SG5A 2KSPA 1A75A 4OR9B 5F6TA 1NPQA 5FYXA 2NLNA 4XJKA 1IJ5A 5TNCA 1WLMA 1F71A 3KPXA 1AHRA 1GGZA 1ZACA 3SG3A 1F55A 3KEVA 2JU0A 2L2EA 1BR1B 3TUYC 2CXJA 2PVBA 1NCYA 3I5GC 1RJVA 4AQJA 2LVKA 2MJWB 3BQ3A 2K61A 4MZKA 4PHMA 1SRAA 2EC6C 4PHNA 2KGRA 1IJ6A 1NX2A 2B1UA 1ALVA 2BKIB 3EK4A 5D7FA 1KFXS 4YGCB 1CFCA 2WC8A 2LMUA 1CFDA 1BU3A 1OQPA 2NCOA 1HQVA 4C0KA 2G9BA 2JT8A 2ZNEA 3A8RA 2V53A 4MEWA 1MQ1A 1K9UA 3PN7B 2L98A 3EK8A 2KFGA 4NQGA 4CIDA 1ALWA 4YGEB 3SG6A 1K95A 3BUMB 1XK4A 1Y1UA 1SL8A 1UHNA 1LVCD 1RFJA 1YR5A 3DD4A 2WCEA 1WRZA 2ZN8A 1GJYA 1SL7A 2RGIA 3A4UB 1CTRA 1XA5A 2QPTA 1TNWA 4I5LB 1U5IA 2COLB 3CWGA 2L4IA 2KOTA 3CZTX 2HPSA 5AXIA 1C7VA 1A2XA 2M7NA 3NSKA 3I5HC 5I2QA 1H8BA 1PSRA 1KWOB 1F54A 1YRUB 1QX5B 2AMIA 5HKYA 1J7PA 5CSIA 3LL8B 1QVIY 1IQ5A 2BE4A 3JTDC 4NDCA 3RM1A 1DJXA 3H4SE 3ZWHA 1BG1A 1SK6D 2BE6A 4ZCVA 1RWYA 2JXCA 3PFVA 4PHKA 5G08A 4CPVA 1XYDA 1EG3A 1KSMA 1SYMA 3OX6A 3CR2A 4PHJA 5D69A 2MLFC 1NX0A 2Q91A 1JBAA 1DJWA 1YX8A 2MHHA 4MN0A 2JZIA 2KAYA 3AKBA 3SG4A 3I5FB 2M1UA 1MXEA 4QJ5B 1GQMA 2LANA 1MF8B 1DJZA 2Y4QA 3OX5A 1FW4A 2JTTA 2KYCA 2K7CA 1MUXA 1Y0VH 2PSRA 3DVMA 1QASA 1CDLA 1SCVA 1ZUZA 2G2BA 2M1KB 3D0YA 1TNPA 3I5IC 1FI5A 1SR6C 1QV0A 2K2FA 2Q4UA 2I7AA 3LLEA 2CNPA 2K7BA 1S26D 3FWCA 1AK8A 1EL4A 4JPZB 2O60A 3TDIA 1ODBA 1CMFA 4JWQA 1DJGA 1TIZA 2OTGB 3IQQA 2K7OA 2KBMA 1BLQA 1J55A 1A03A 1QIVA 3LK1A 2L5XB 3E3RA 1JSAA 1A29A 2BECA 3AAJA 1A4PA 4PE7A 4Q04A 3CS1A 1DF0A 2L50A 3NSOA 4GPLB 1B8CA 1SCMC 2M49B 1XFYO 2Y5IA 1XFZO 3VROA 2M0RA 3GK4X 4GAOA 2JTZA 1CDNA 2OS8C 1QV1A 2OPOA 4DCKA 1OSAA 2LVJA 3FWBA 1KK8B 1K93D 1B47A 1SL9A 1K94A 2CCMA 5J3XA 1DVIA 2NXQA 2LP2A 1L2OB 1OOJA 3OB2B 1G4YR 3PATA 1KSOA 2Y1MA 3PLFB 4DRWA 4YGBB 3AAKA 2JC2A 1PVAA 2M8UA 3BOWA 3DF0A 4YI9A 1BMOA 4HRHA 1WLZA 3TDUA 2K2AA 2JULA 4A4BA 1XFWO 1SY9A 1OZSA 2DOQA 2M9GA 1BR4B 4D1EA 4GGNA 1EG4A 3WNXB 2I94A 1YVHA 1AP4A 1WRLA 1S5GZ 1YURA 4MLWA 2ZNDA 4UPGA 1Q80A 4GUKA 1MR8A 1UWOA 2LNKA 4U8DA 1K90D 1OMRA 1W7IB 4MVFA 5I8NA 1GGWA 1QX2A 2K0JA 3BUOB 1S6IA 1C7WA 4PE1A 2LLUA 2EHBA 2WOSA 3ICBA 3EK7A 4MBEA 2BL0B 1MXLC 3TS5B 1ZOTB 2R2IA 4ZCUA 2KI6D 3TDZA 2D8NA 1DJHA 5HYDA 1TTXA 1WDCB 1L7ZA 2KDHA 2JOJA 1DGVA 4L9MA 1YUTA 3PN7C 1H4BA 1SMGA 4OKHA 1MHOA 1NCZA 1LA0A 1V1GA 1YUUA 1A75B 4GGFA 3ZNIA 1MWNA 1K9KA 1TNQA 1OMDA 1RK9A 2AAOA 2KHNA 2LE9B 4DS7A 4XJKB 4XYNA 1EH2A 2KNEA 5HLVA 1QVIZ 3NSLA 1UP5A 3LK0A 4YGAA 1SW8A 3EVRA 3SG7A 3VRNA 2NZ0A 1NYAA 2LMTA 3BYAA 1DTLA 2CT9A 1CFPA 2BL0C 3TS5C 1JF2A 5HKWA 2BCBA 1R6PA 2MA2A 3OB1B 2F3ZA 1W7JB 2QACA 2ZN9A 2KYFA 3O4YA 2L51A 1LINA 4E68A 1IG5A 4BY4A 1OE9B 4MSPA 1FF1A 2F33A 1PVBA 1KWOC 1X02A 1IWQA 2I2RE 4WQ3A 1JC2A 3CR4X 2GV5A 4C0LA 1IH0A 1JWDA 1G33A 1K8UA 5KU1A 1B7TZ 1B1GA 2LVVA 4GBAA 1PULA 3DVEA 2NCPA 4FQOA 4CFRA 1CFFA 3NSIA 1BF5A 2BBMA 3JVTB 1IRJA 1JUOA 5JJGA 1CDMA 1WRKA 4CFQA 1VRKA 2A4JA 1J1DA 2L4HA 1CMGA 4QJ3B 2PMYA 1CM4A 1ZFSA 2F3YA 3MSEB 5I2LA 4HRGA 1CLBA 3GK1A 2ZFDA 4GNKB 2LV7A 1XFVO 2HF5A 1AVSA 1G8IA 1IQ3A 1K96A 2MRDA 1IKUA 1NX1A 3I5FC 4CLNA 1UHKA 1QJTA 4MRXA 1XVJA 2HETA 1V1FA 3C1VA 2IS9A 2VRGA 1FI6A 1TNXA 1U5IB 1UUSA 5ER5A 3CR5X 1LA3A 2FJUB 2SCPA 1K9PA 1M63B 5KSZA 3NXAA 2E30A 1UHJA 2LHLA 2FCDA 5DKRA 1XO5A 1KQVA 2K7DA 3VRRA 4YGDB 1RTP1 2WNDA 1RECA 1QX7A 5AANA 3EKJA 1OMVA 1NIWA 3RLZA 3AKAA 1F4OA 5I2OA 4YI8A 4GFTA 3M0WA 4MZJA 2KI4B 3FS7A 2OTGC 4PE4A 4YBHB 2PRUA 1YUSA 1SNLA 3PALA 4N1GA 1TOPA 4DUQA 1LXFC 4C0JA 1CB1A 2SASA 2F2PA 2GGMA 4PDZA 3K21A 4WQ2A 1UHIA 2H2KA
chains in the Genus database with same CATH superfamily
1QLKA 3TUYB 1NP8A 3KO0A 5CSNA 3SG2A 1E8AA 3DYEA 1M39A 3I5GB 3V2LA 1SPYA 3F45A 1AJ4A 1K2HA 1QLSA 2WORA 5AEQA 1Y6WA 3BUXB 2KQYA 2EC6B 1Y1XA 2BBNA 1KK7Y 4NDDA 3O4XA 3HCMA 1QS7A 3IQOA 2ZRSA 5DKQA 1Y1AA 2JNXA 2KI4C 2P6BB 4ORBB 3O6BA 2JXLA 5FI7A 1N2DA 3KHEA 5CSJA 1KK8C 1CNPA 1J1EA 1NWDA 1QXPA 1CLLA 2WCFA 4OCIA 2LMVA 3SIAA 1L2OC 1F8HA 3SJSA 2LM5A 3D0YB 2LC5A 3VGOA 2LUXA 3HX4A 2JRFA 2E6WA 5BPJA 2F8PA 1KQMB 3GOFA 2HQ8A 3PM2A 1CM1A 2KI6C 4MRYA 5CSFA 3WHUB 4JKTA 5PALA 1SBJA 2FCEA 3BUNB 1C07A 1CKKA 2MAZA 2PASA 3S0DA 2GGZA 2H61C 4TNCA 1UURA 2M7LA 2WCJA 1KFXL 1PSBA 1QATA 1UHHA 3OHMB 3PSRA 1M45A 2ISDA 2LP3A 3D77A 4M2OA 1M31A 3CZ1A 4OVNF 1DGUA 4P5OE 4ICBA 3EVUA 4JQ0D 1DF0B 2LVIA 2PYQA 2TN4A 4I5NB 3S0FA 5FI6A 1NSHA 1J7QA 5GQQC 4WRIA 1DJYA 1JF0A 1S6JA 1KQMC 2QDIA 3EKHA 3I5HB 3WXAA 1J7RA 1S1EA 4ORAB 1S5GY 2PALA 1AUIB 2JNFA 1WY9A 4OV2A 2KAVA 4MZLA 1IGVA 3D10A 1S6CA 2M29A 5B8IB 3DY9A 4HSZA 3QRXA 2CTNA 2WCHA 3CLNA 3JTDB 5KTYA 1R2UA 5DKNA 1S3PA 3BOWB 4ETOA 1B8RA 4F0ZB 3DF0B 1BODA 3PM8A 3SIBA 1WDCC 4PT1A 3BUWB 1BJFA 1HT9A 1BOCA 2MLEC 2LAPA 5HL1A 1PALA 1YVLA 1JFKA 2KQ6A 1KFUL 2LUCA 3BXKA 5ER4X 4ORCB 3GK2A 2ERBA 3D73A 3RZSA 1FBVA 1KFUS 2KLEA 2HQWA 1YRTB 2QEOA 1M46A 4AQIA 5IBWA 3DVKA 1TCOB 4M2PA 3EVVA 2K8MB 3IF7A 1CLMA 1EJ3A 3O2PA 3TZ1A 1D1OA 5HKZA 1NUBA 1RROA 1YX7A 5AFPA 2CBLA 4HREE 4FTGA 4N1FA 3FE6A 2KAXA 3OP0A 4USLA 3KF9A 4NDBA 2KGBC 3I5IB 1DJIA 1P28A 1SR6B 2BAPA 2BNXA 3R1OA 5HLOA 4I5KA 1AJ5A 2I18A 1NX3A 4YRUA 1TRFA 2O5GA 2EGDA 2LHIA 3LCPC 4A4CA 1PK0D 1B7TY 1B8LA 1OZOA 2H61A 2LCPA 3FIAA 1N65A 2JPTA 2MBXA 2JT3A 1LKJA 1EXRA 5K89A 1DMOA 2Y1NA 3JVTC 1DT7B 2F2OA 1N0YA 4BY5A 3OBVA 2LLSA 1FPWA 3VRPA 3CTNA 4M2QA 3S0BA 1XFUO 2KFHA 2LLTA 5JOLA 4QJ4B 1XK4C 4IL1A 3FE8A 3CGAA 2JQ6A 1SCMB 3DZTA 4AOMA 2WCMA 4PCWA 2KBIA 2WCBA 1S36A 1ZMZA 1GM0A 1QTXA 2BKHB 2KFFA 5AERA 1TN4A 2M3WA 1XFXO 1BT6A 4N5XA 2OS8B 3K21A 2BCXA 2JT0A 4DIRA 3L47A 2KPHA 1NCXA 1B4CA 5D3OA 1J7OA 3O78A 1KCYA 1F4QA 2AUCA 2L0PA 1QIWA 2JWWA 4PE0A 2M97A 4GGFC 1SKTA 1B9AA 2ZKMX 1YTZC 3SS3A 3DVJA 1JFJA 2GTEA 2L2CA 3VRQA 1OOFA 5CPVA 1TCFA 2FOTA 4PALA 1PRWA 4P2YB 1F70A 2ZRTA 2PQLA 3WHTB 2BCAA 1CDPA 1KK7Z 4R1EA 4I5JA 3SG5A 2KSPA 1A75A 4OR9B 5F6TA 1NPQA 5FYXA 2NLNA 4XJKA 1IJ5A 5TNCA 1WLMA 2WCLA 1F71A 3KPXA 1AHRA 1GGZA 1ZACA 3SG3A 1F55A 1DEKA 3KEVA 2JU0A 2L2EA 1BR1B 3TUYC 2CXJA 2PVBA 1NCYA 3I5GC 3UNWA 1RJVA 4AQJA 3R72A 2LVKA 2MJWB 3BQ3A 3S0AA 2K61A 4MZKA 4PHMA 1SRAA 2EC6C 4PHNA 2KGRA 1IJ6A 3PJIA 1NX2A 2B1UA 1ALVA 2BKIB 3EK4A 5D7FA 1KFXS 4YGCB 1CFCA 2WC8A 2LMUA 1CFDA 1BU3A 1OQPA 2NCOA 1HQVA 3NHIA 4C0KA 2G9BA 2JT8A 2ZNEA 3A8RA 2V53A 1T14A 4MEWA 1MQ1A 1K9UA 3PN7B 2L98A 3EK8A 3S0EA 2KFGA 4NQGA 4CIDA 1ALWA 4YGEB 3SG6A 1K95A 3BUMB 1XK4A 1Y1UA 1SL8A 1UHNA 1LVCD 1RFJA 1YR5A 3DD4A 2WCEA 1WRZA 2ZN8A 1GJYA 1SL7A 2RGIA 3A4UB 1CTRA 1XA5A 2QPTA 1TNWA 4I5LB 1U5IA 2COLB 3CWGA 2L4IA 2KOTA 3CZTX 2HPSA 5AXIA 1C7VA 3CZ0A 3K1EA 1A2XA 2M7NA 3NSKA 3I5HC 5I2QA 1H8BA 1PSRA 1KWOB 1F54A 1YRUB 3NGVA 1QX5B 2AMIA 3L4LA 5HKYA 1J7PA 4IJ7A 5CSIA 3LL8B 1Z2CB 3D75A 1QVIY 1IQ5A 3NHTA 2BE4A 3JTDC 4NDCA 3RM1A 4OZDA 1DJXA 2L5YA 3H4SE 3ZWHA 1SK6D 1BG1A 2BE6A 4ZCVA 2JPOA 1OOIX 1RWYA 2JXCA 1OOGA 3PFVA 4INXA 4PHKA 5G08A 1XYDA 3VB1A 4CPVA 1EG3A 1KSMA 1SYMA 3OX6A 3CR2A 4PHJA 5D69A 1XFRA 2WCKA 2MLFC 1NX0A 1Z4HA 2Q91A 1JBAA 1DJWA 1YX8A 2MHHA 1TWOA 2JZIA 4MN0A 2KAYA 1OW4A 2K60A 3AKBA 3SG4A 3I5FB 2M1UA 1MXEA 4QJ5B 1ORGA 1GQMA 2LANA 1IIOA 1MF8B 1DJZA 2Y4QA 3OX5A 3BJHA 4INWA 1FW4A 2JTTA 2KYCA 2K7CA 5I94A 3BFHA 1MUXA 1Y0VH 2PSRA 3B88A 3DVMA 1C3ZA 2FJYA 1QASA 1CDLA 1SCVA 1ZUZA 2G2BA 2M1KB 2QEBA 3D0YA 1W9ZA 1TNPA 3I5IC 1FI5A 1SR6C 1QV0A 3D74A 2P71A 2K2FA 2Q4UA 2I7AA 3LLEA 2CNPA 3CYZA 2K7BA 1S26D 3FWCA 1AK8A 1EL4A 4JPZB 2O60A 3TDIA 1ODBA 1CMFA 4JWQA 1DJGA 1TIZA 2OTGB 3IQQA 2K7OA 2KBMA 1BLQA 1J55A 1A03A 1QIVA 3LK1A 3BFAA 4JD9A 2L5XB 3CZ2A 3E3RA 1JSAA 4FQTA 1A29A 2BECA 3AAJA 1A4PA 4PE7A 4Q04A 3CS1A 1DF0A 2L50A 3NSOA 4GPLB 1B8CA 1SCMC 2M49B 1XFYO 1TUJA 2Y5IA 1XFZO 3VROA 2M0RA 3GK4X 2WC5A 4GAOA 2JTZA 1CDNA 2OS8C 1QV1A 2OPOA 4DCKA 1OSAA 2LVJA 3FWBA 1KK8B 1K93D 1B47A 1SL9A 1K94A 2CCMA 5J3XA 1DVIA 2NXQA 2LP2A 1L2OB 1OOJA 3OB2B 1G4YR 3PATA 1KSOA 2Y1MA 3PLFB 4DRWA 4YGBB 3AAKA 2JC2A 1PVAA 2M8UA 3BOWA 3DF0A 1DC1A 4YI9A 1QWVA 1BMOA 4HRHA 1WLZA 3TDUA 2K2AA 2JULA 3N7HA 4A4BA 1XFWO 1SY9A 1OZSA 2DOQA 3L4AA 2M9GA 1BR4B 4D1EA 3B86A 4GGNA 3CABA 1DELA 1EG4A 3WNXB 3B6XA 3B87A 2I94A 4F7FA 1YVHA 1AP4A 1WRLA 1S5GZ 1YURA 4MLWA 2ZNDA 4UPGA 1Q80A 4GUKA 1MR8A 1UWOA 1TUZA 2LNKA 1K90D 1OMRA 1W7IB 4MVFA 4U8DA 5I8NA 1GGWA 1QX2A 2K0JA 3BUOB 1S6IA 1C7WA 4PE1A 5EL2A 2LLUA 2EHBA 2WOSA 3ICBA 3EK7A 3SS5A 3FE9A 2P70A 2BL0B 1MXLC 4MBEA 3TS5B 1ZOTB 2R2IA 4ZCUA 2KI6D 3TDZA 2D8NA 1DJHA 5HYDA 1TTXA 1WDCB 1L7ZA 2KDHA 2JOJA 1DGVA 4L9MA 3SS4A 1YUTA 2KLDA 3PN7C 4KYNA 1H4BA 1SMGA 4OKHA 3OGNA 1MHOA 1NCZA 1LA0A 1V1GA 1YUUA 1A75B 4GGFA 3ZNIA 3UO9A 1MWNA 1K9KA 1TNQA 1OMDA 1RK9A 2AAOA 2KHNA 2LE9B 4DS7A 4XJKB 4XYNA 1EH2A 2KNEA 3Q8IA 5HLVA 1QVIZ 3NSLA 1UP5A 3LK0A 4YGAA 1SW8A 3EVRA 3SG7A 2YGUA 3VRNA 2NZ0A 1NYAA 2LMTA 3BYAA 1DTLA 2CT9A 1CFPA 3D76A 2BL0C 3TS5C 1JF2A 5HKWA 2BCBA 1R6PA 2MA2A 3OB1B 2F3ZA 1W7JB 2QACA 2ZN9A 2KYFA 3IVTA 1C3YA 3O4YA 2L51A 1LINA 4E68A 1IG5A 4BY4A 3EG5B 1OE9B 4MSPA 1FF1A 2F33A 1PVBA 1KWOC 1X02A 1IWQA 2I2RE 1OOHA 4WQ3A 1JC2A 3CR4X 2GV5A 4C0LA 1IH0A 1JWDA 1G33A 1K8UA 3S0GA 5KU1A 1B7TZ 1B1GA 2LVVA 4GBAA 1PULA 3DVEA 2NCPA 2WC6A 4FQOA 4CFRA 1CFFA 3NSIA 1BF5A 2BBMA 3JVTB 1IRJA 1JUOA 5JJGA 1CDMA 1WRKA 1SSEB 4CFQA 1VRKA 2A4JA 3CDNA 1J1DA 2L4HA 3B7AA 5FI2A 4QJ3B 3BFBA 2PMYA 1CMGA 1CM4A 1ZFSA 2F3YA 3MSEB 5I2LA 4HRGA 1CLBA 2H8VA 3GK1A 2ZFDA 4GNKB 2LV7A 1XFVO 2HF5A 1AVSA 1G8IA 1IQ3A 1K96A 2MRDA 1IKUA 1NX1A 3D78A 3I5FC 4CLNA 1UHKA 1QJTA 4MRXA 1XVJA 2HETA 1V1FA 3C1VA 2IS9A 2VRGA 1FI6A 3DXLA 1TNXA 1U5IB 1UUSA 5ER5A 3CR5X 1LA3A 2FJUB 2SCPA 1K9PA 1M63B 5KSZA 3NXAA 2E30A 1UHJA 2LHLA 2FCDA 3R1VA 5DKRA 1XO5A 1KQVA 2QEHA 2K7DA 3VRRA 4YGDB 1RTP1 2WNDA 1RECA 1QX7A 3QMEA 5AANA 3EKJA 1OMVA 1NIWA 3RLZA 3AKAA 1F4OA 5DICA 5I2OA 1DQEA 4YI8A 4GFTA 3M0WA 4MZJA 2QEVA 3R1PA 2KI4B 3FS7A 2OTGC 4PE4A 4YBHB 2PRUA 1YUSA 1SNLA 3PALA 4N1GA 1TOPA 4DUQA 1LXFC 4C0JA 1CB1A 2SASA 2F2PA 2GGMA 4PDZA 1LS8A 4WQ2A 1UHIA 2H2KA
chains in the Genus database with same CATH topology
1QLKA 3TUYB 1NP8A 3KO0A 5CSNA 3SG2A 1E8AA 1M39A 3I5GB 1SPYA 3F45A 1AJ4A 1K2HA 1QLSA 2WORA 5AEQA 1Y6WA 3BUXB 2KQYA 2EC6B 1Y1XA 2BBNA 1KK7Y 4NDDA 5DKQA 3HCMA 1QS7A 3IQOA 2ZRSA 1Y1AA 2JNXA 2KI4C 2P6BB 4ORBB 3O6BA 2JXLA 1J7QA 1N2DA 3KHEA 5CSJA 1KK8C 1CNPA 1J1EA 1NWDA 1QXPA 1CLLA 2WCFA 4OCIA 2LMVA 3SIAA 1L2OC 1F8HA 3SJSA 2LM5A 3D0YB 2LC5A 3VGOA 2LUXA 3HX4A 2JRFA 2E6WA 5BPJA 2F8PA 1KQMB 3GOFA 2HQ8A 1CM1A 2KI6C 4MRYA 5CSFA 3WHUB 5PALA 1SBJA 2FCEA 3BUNB 1C07A 1CKKA 2MAZA 2PASA 2GGZA 2H61C 4TNCA 1UURA 2M7LA 1KFXL 1PSBA 1QATA 1UHHA 3OHMB 3PSRA 1M45A 2ISDA 2LP3A 4M2OA 1M31A 4OVNF 1DGUA 4P5OE 4ICBA 3EVUA 4JQ0D 1DF0B 2LVIA 2TN4A 4I5NB 1NSHA 5GQQC 4WRIA 1DJYA 1JF0A 1S6JA 1KQMC 3EKHA 3I5HB 3WXAA 1J7RA 1S1EA 4ORAB 1S5GY 2PALA 1AUIB 2JNFA 1WY9A 4OV2A 2KAVA 4MZLA 1IGVA 3D10A 1S6CA 2M29A 5B8IB 4HSZA 3QRXA 2CTNA 3CLNA 3JTDB 5KTYA 1R2UA 5DKNA 1S3PA 3BOWB 4ETOA 1B8RA 4F0ZB 3DF0B 1BODA 3PM8A 3SIBA 1WDCC 3BUWB 1BJFA 1HT9A 1BOCA 2MLEC 2LAPA 1PALA 1YVLA 1JFKA 2KQ6A 1KFUL 2LUCA 3BXKA 5ER4X 4ORCB 3GK2A 1FBVA 1KFUS 2HQWA 1YRTB 1M46A 4AQIA 5IBWA 3DVKA 1TCOB 4M2PA 3EVVA 2K8MB 3IF7A 1CLMA 1EJ3A 3O2PA 3TZ1A 1D1OA 5HKZA 1NUBA 1RROA 1YX7A 5AFPA 2CBLA 4HREE 4FTGA 4N1FA 2KAXA 3OP0A 4USLA 3KF9A 4NDBA 2KGBC 3I5IB 1DJIA 1SR6B 5HLOA 4I5KA 1AJ5A 2I18A 1NX3A 4YRUA 1TRFA 2O5GA 2EGDA 2LHIA 3LCPC 4A4CA 1PK0D 1B7TY 1B8LA 1OZOA 2H61A 2LCPA 3FIAA 1N65A 2JPTA 2MBXA 2JT3A 1LKJA 1EXRA 5K89A 1DMOA 2Y1NA 3JVTC 1DT7B 2F2OA 1N0YA 4BY5A 2LLSA 1FPWA 3VRPA 3CTNA 4M2QA 1XFUO 2KFHA 2LLTA 5JOLA 4QJ4B 1XK4C 4IL1A 3CGAA 2JQ6A 1SCMB 4AOMA 4PCWA 2KBIA 2WCBA 1S36A 1ZMZA 1QTXA 2BKHB 2KFFA 5AERA 1TN4A 2M3WA 1XFXO 1BT6A 4N5XA 2OS8B 2BCXA 2JT0A 4DIRA 1B4CA 1NCXA 1J7OA 3O78A 1KCYA 1F4QA 2AUCA 2L0PA 1QIWA 2JWWA 4PE0A 2M97A 4GGFC 1SKTA 1B9AA 2ZKMX 1YTZC 3DVJA 1JFJA 3VRQA 5CPVA 1TCFA 2FOTA 4PALA 1PRWA 4P2YB 1F70A 2ZRTA 3WHTB 2BCAA 1CDPA 1KK7Z 4R1EA 4I5JA 3SG5A 2KSPA 1A75A 4OR9B 5F6TA 1NPQA 5FYXA 2NLNA 4XJKA 1IJ5A 5TNCA 1WLMA 1F71A 3KPXA 1AHRA 1GGZA 1ZACA 3SG3A 1F55A 3KEVA 2JU0A 2L2EA 1BR1B 3TUYC 2CXJA 2PVBA 1NCYA 3I5GC 1RJVA 4AQJA 2LVKA 2MJWB 3BQ3A 2K61A 4MZKA 4PHMA 1SRAA 2EC6C 4PHNA 2KGRA 1IJ6A 1NX2A 2B1UA 1ALVA 2BKIB 3EK4A 5D7FA 1KFXS 4YGCB 1CFCA 2WC8A 2LMUA 1CFDA 1BU3A 1OQPA 2NCOA 1HQVA 4C0KA 2G9BA 2JT8A 2ZNEA 3A8RA 2V53A 4MEWA 1MQ1A 1K9UA 3PN7B 2L98A 3EK8A 2KFGA 4NQGA 4CIDA 1ALWA 4YGEB 3SG6A 1K95A 3BUMB 1XK4A 1Y1UA 1SL8A 1UHNA 1LVCD 1RFJA 1YR5A 3DD4A 2WCEA 1WRZA 2ZN8A 1GJYA 1SL7A 2RGIA 3A4UB 1CTRA 1XA5A 2QPTA 1TNWA 4I5LB 1U5IA 2COLB 3CWGA 2L4IA 2KOTA 3CZTX 2HPSA 5AXIA 1C7VA 1A2XA 2M7NA 3NSKA 3I5HC 5I2QA 1H8BA 1PSRA 1KWOB 1F54A 1YRUB 1QX5B 2AMIA 5HKYA 1J7PA 5CSIA 3LL8B 1QVIY 1IQ5A 2BE4A 3JTDC 4NDCA 3RM1A 1DJXA 3H4SE 3ZWHA 1BG1A 1SK6D 2BE6A 4ZCVA 1RWYA 2JXCA 3PFVA 4PHKA 5G08A 4CPVA 1XYDA 1EG3A 1KSMA 1SYMA 3OX6A 3CR2A 4PHJA 5D69A 2MLFC 1NX0A 2Q91A 1JBAA 1DJWA 1YX8A 2MHHA 4MN0A 2JZIA 2KAYA 3AKBA 3SG4A 3I5FB 2M1UA 1MXEA 4QJ5B 1GQMA 2LANA 1MF8B 1DJZA 2Y4QA 3OX5A 1FW4A 2JTTA 2KYCA 2K7CA 1MUXA 1Y0VH 2PSRA 3DVMA 1QASA 1CDLA 1SCVA 1ZUZA 2G2BA 2M1KB 3D0YA 1TNPA 3I5IC 1FI5A 1SR6C 1QV0A 2K2FA 2Q4UA 2I7AA 3LLEA 2CNPA 2K7BA 1S26D 3FWCA 1AK8A 1EL4A 4JPZB 2O60A 3TDIA 1ODBA 1CMFA 4JWQA 1DJGA 1TIZA 2OTGB 3IQQA 2K7OA 2KBMA 1BLQA 1J55A 1A03A 1QIVA 3LK1A 2L5XB 3E3RA 1JSAA 1A29A 2BECA 3AAJA 1A4PA 4PE7A 4Q04A 3CS1A 1DF0A 2L50A 3NSOA 4GPLB 1B8CA 1SCMC 2M49B 1XFYO 2Y5IA 1XFZO 3VROA 2M0RA 3GK4X 4GAOA 2JTZA 1CDNA 2OS8C 1QV1A 2OPOA 4DCKA 1OSAA 2LVJA 3FWBA 1KK8B 1K93D 1B47A 1SL9A 1K94A 2CCMA 5J3XA 1DVIA 2NXQA 2LP2A 1L2OB 1OOJA 3OB2B 1G4YR 3PATA 1KSOA 2Y1MA 3PLFB 4DRWA 4YGBB 3AAKA 2JC2A 1PVAA 2M8UA 3BOWA 3DF0A 4YI9A 1BMOA 4HRHA 1WLZA 3TDUA 2K2AA 2JULA 4A4BA 1XFWO 1SY9A 1OZSA 2DOQA 2M9GA 1BR4B 4D1EA 4GGNA 1EG4A 3WNXB 2I94A 1YVHA 1AP4A 1WRLA 1S5GZ 1YURA 4MLWA 2ZNDA 4UPGA 1Q80A 4GUKA 1MR8A 1UWOA 2LNKA 4U8DA 1K90D 1OMRA 1W7IB 4MVFA 5I8NA 1GGWA 1QX2A 2K0JA 3BUOB 1S6IA 1C7WA 4PE1A 2LLUA 2EHBA 2WOSA 3ICBA 3EK7A 4MBEA 2BL0B 1MXLC 3TS5B 1ZOTB 2R2IA 4ZCUA 2KI6D 3TDZA 2D8NA 1DJHA 5HYDA 1TTXA 1WDCB 1L7ZA 2KDHA 2JOJA 1DGVA 4L9MA 1YUTA 3PN7C 1H4BA 1SMGA 4OKHA 1MHOA 1NCZA 1LA0A 1V1GA 1YUUA 1A75B 4GGFA 3ZNIA 1MWNA 1K9KA 1TNQA 1OMDA 1RK9A 2AAOA 2KHNA 2LE9B 4DS7A 4XJKB 4XYNA 1EH2A 2KNEA 5HLVA 1QVIZ 3NSLA 1UP5A 3LK0A 4YGAA 1SW8A 3EVRA 3SG7A 3VRNA 2NZ0A 1NYAA 2LMTA 3BYAA 1DTLA 2CT9A 1CFPA 2BL0C 3TS5C 1JF2A 5HKWA 2BCBA 1R6PA 2MA2A 3OB1B 2F3ZA 1W7JB 2QACA 2ZN9A 2KYFA 3O4YA 2L51A 1LINA 4E68A 1IG5A 4BY4A 1OE9B 4MSPA 1FF1A 2F33A 1PVBA 1KWOC 1X02A 1IWQA 2I2RE 4WQ3A 1JC2A 3CR4X 2GV5A 4C0LA 1IH0A 1JWDA 1G33A 1K8UA 5KU1A 1B7TZ 1B1GA 2LVVA 4GBAA 1PULA 3DVEA 2NCPA 4FQOA 4CFRA 1CFFA 3NSIA 1BF5A 2BBMA 3JVTB 1IRJA 1JUOA 5JJGA 1CDMA 1WRKA 4CFQA 1VRKA 2A4JA 1J1DA 2L4HA 1CMGA 4QJ3B 2PMYA 1CM4A 1ZFSA 2F3YA 3MSEB 5I2LA 4HRGA 1CLBA 3GK1A 2ZFDA 4GNKB 2LV7A 1XFVO 2HF5A 1AVSA 1G8IA 1IQ3A 1K96A 2MRDA 1IKUA 1NX1A 3I5FC 4CLNA 1UHKA 1QJTA 4MRXA 1XVJA 2HETA 1V1FA 3C1VA 2IS9A 2VRGA 1FI6A 1TNXA 1U5IB 1UUSA 5ER5A 3CR5X 1LA3A 2FJUB 2SCPA 1K9PA 1M63B 5KSZA 3NXAA 2E30A 1UHJA 2LHLA 2FCDA 5DKRA 1XO5A 1KQVA 2K7DA 3VRRA 4YGDB 1RTP1 2WNDA 1RECA 1QX7A 5AANA 3EKJA 1OMVA 1NIWA 3RLZA 3AKAA 1F4OA 5I2OA 4YI8A 4GFTA 3M0WA 4MZJA 2KI4B 3FS7A 2OTGC 4PE4A 4YBHB 2PRUA 1YUSA 1SNLA 3PALA 4N1GA 1TOPA 4DUQA 1LXFC 4C0JA 1CB1A 2SASA 2F2PA 2GGMA 4PDZA 3K21A 4WQ2A 1UHIA 2H2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLK A;  3TUY B;  1NP8 A;  3KO0 A;  5CSN A;  3SG2 A;  1E8A A;  1M39 A;  3I5G B;  1SPY A;  3F45 A;  1AJ4 A;  1K2H A;  1QLS A;  2WOR A;  5AEQ A;  1Y6W A;  3BUX B;  2KQY A;  2EC6 B;  1Y1X A;  2BBN A;  1KK7 Y;  4NDD A;  5DKQ A;  3HCM A;  1QS7 A;  3IQO A;  2ZRS A;  1Y1A A;  2JNX A;  2KI4 C;  2P6B B;  4ORB B;  3O6B A;  2JXL A;  1J7Q A;  1N2D A;  3KHE A;  5CSJ A;  1KK8 C;  1CNP A;  1J1E A;  1NWD A;  1QXP A;  1CLL A;  2WCF A;  4OCI A;  2LMV A;  3SIA A;  1L2O C;  1F8H A;  3SJS A;  2LM5 A;  3D0Y B;  2LC5 A;  3VGO A;  2LUX A;  3HX4 A;  2JRF A;  2E6W A;  5BPJ A;  2F8P A;  1KQM B;  3GOF A;  2HQ8 A;  1CM1 A;  2KI6 C;  4MRY A;  5CSF A;  3WHU B;  5PAL A;  1SBJ A;  2FCE A;  3BUN B;  1C07 A;  1CKK A;  2MAZ A;  2PAS A;  2GGZ A;  2H61 C;  4TNC A;  1UUR A;  2M7L A;  1KFX L;  1PSB A;  1QAT A;  1UHH A;  3OHM B;  3PSR A;  1M45 A;  2ISD A;  2LP3 A;  4M2O A;  1M31 A;  4OVN F;  1DGU A;  4P5O E;  4ICB A;  3EVU A;  4JQ0 D;  1DF0 B;  2LVI A;  2TN4 A;  4I5N B;  1NSH A;  5GQQ C;  4WRI A;  1DJY A;  1JF0 A;  1S6J A;  1KQM C;  3EKH A;  3I5H B;  3WXA A;  1J7R A;  1S1E A;  4ORA B;  1S5G Y;  2PAL A;  1AUI B;  2JNF A;  1WY9 A;  4OV2 A;  2KAV A;  4MZL A;  1IGV A;  3D10 A;  1S6C A;  2M29 A;  5B8I B;  4HSZ A;  3QRX A;  2CTN A;  3CLN A;  3JTD B;  5KTY A;  1R2U A;  5DKN A;  1S3P A;  3BOW B;  4ETO A;  1B8R A;  4F0Z B;  3DF0 B;  1BOD A;  3PM8 A;  3SIB A;  1WDC C;  3BUW B;  1BJF A;  1HT9 A;  1BOC A;  2MLE C;  2LAP A;  1PAL A;  1YVL A;  1JFK A;  2KQ6 A;  1KFU L;  2LUC A;  3BXK A;  5ER4 X;  4ORC B;  3GK2 A;  1FBV A;  1KFU S;  2HQW A;  1YRT B;  1M46 A;  4AQI A;  5IBW A;  3DVK A;  1TCO B;  4M2P A;  3EVV A;  2K8M B;  3IF7 A;  1CLM A;  1EJ3 A;  3O2P A;  3TZ1 A;  1D1O A;  5HKZ A;  1NUB A;  1RRO A;  1YX7 A;  5AFP A;  2CBL A;  4HRE E;  4FTG A;  4N1F A;  2KAX A;  3OP0 A;  4USL A;  3KF9 A;  4NDB A;  2KGB C;  3I5I B;  1DJI A;  1SR6 B;  5HLO A;  4I5K A;  1AJ5 A;  2I18 A;  1NX3 A;  4YRU A;  1TRF A;  2O5G A;  2EGD A;  2LHI A;  3LCP C;  4A4C A;  1PK0 D;  1B7T Y;  1B8L A;  1OZO A;  2H61 A;  2LCP A;  3FIA A;  1N65 A;  2JPT A;  2MBX A;  2JT3 A;  1LKJ A;  1EXR A;  5K89 A;  1DMO A;  2Y1N A;  3JVT C;  1DT7 B;  2F2O A;  1N0Y A;  4BY5 A;  2LLS A;  1FPW A;  3VRP A;  3CTN A;  4M2Q A;  1XFU O;  2KFH A;  2LLT A;  5JOL A;  4QJ4 B;  1XK4 C;  4IL1 A;  3CGA A;  2JQ6 A;  1SCM B;  4AOM A;  4PCW A;  2KBI A;  2WCB A;  1S36 A;  1ZMZ A;  1QTX A;  2BKH B;  2KFF A;  5AER A;  1TN4 A;  2M3W A;  1XFX O;  1BT6 A;  4N5X A;  2OS8 B;  2BCX A;  2JT0 A;  4DIR A;  1B4C A;  1NCX A;  1J7O A;  3O78 A;  1KCY A;  1F4Q A;  2AUC A;  2L0P A;  1QIW A;  2JWW A;  4PE0 A;  2M97 A;  4GGF C;  1SKT A;  1B9A A;  2ZKM X;  1YTZ C;  3DVJ A;  1JFJ A;  3VRQ A;  5CPV A;  1TCF A;  2FOT A;  4PAL A;  1PRW A;  4P2Y B;  1F70 A;  2ZRT A;  3WHT B;  2BCA A;  1CDP A;  1KK7 Z;  4R1E A;  4I5J A;  3SG5 A;  2KSP A;  1A75 A;  4OR9 B;  5F6T A;  1NPQ A;  5FYX A;  2NLN A;  4XJK A;  1IJ5 A;  5TNC A;  1WLM A;  1F71 A;  3KPX A;  1AHR A;  1GGZ A;  1ZAC A;  3SG3 A;  1F55 A;  3KEV A;  2JU0 A;  2L2E A;  1BR1 B;  3TUY C;  2CXJ A;  2PVB A;  1NCY A;  3I5G C;  1RJV A;  4AQJ A;  2LVK A;  2MJW B;  3BQ3 A;  2K61 A;  4MZK A;  4PHM A;  1SRA A;  2EC6 C;  4PHN A;  2KGR A;  1IJ6 A;  1NX2 A;  2B1U A;  1ALV A;  2BKI B;  3EK4 A;  5D7F A;  1KFX S;  4YGC B;  1CFC A;  2WC8 A;  2LMU A;  1CFD A;  1BU3 A;  1OQP A;  2NCO A;  1HQV A;  4C0K A;  2G9B A;  2JT8 A;  2ZNE A;  3A8R A;  2V53 A;  4MEW A;  1MQ1 A;  1K9U A;  3PN7 B;  2L98 A;  3EK8 A;  2KFG A;  4NQG A;  4CID A;  1ALW A;  4YGE B;  3SG6 A;  1K95 A;  3BUM B;  1XK4 A;  1Y1U A;  1SL8 A;  1UHN A;  1LVC D;  1RFJ A;  1YR5 A;  3DD4 A;  2WCE A;  1WRZ A;  2ZN8 A;  1GJY A;  1SL7 A;  2RGI A;  3A4U B;  1CTR A;  1XA5 A;  2QPT A;  1TNW A;  4I5L B;  1U5I A;  2COL B;  3CWG A;  2L4I A;  2KOT A;  3CZT X;  2HPS A;  5AXI A;  1C7V A;  1A2X A;  2M7N A;  3NSK A;  3I5H C;  5I2Q A;  1H8B A;  1PSR A;  1KWO B;  1F54 A;  1YRU B;  1QX5 B;  2AMI A;  5HKY A;  1J7P A;  5CSI A;  3LL8 B;  1QVI Y;  1IQ5 A;  2BE4 A;  3JTD C;  4NDC A;  3RM1 A;  1DJX A;  3H4S E;  3ZWH A;  1BG1 A;  1SK6 D;  2BE6 A;  4ZCV A;  1RWY A;  2JXC A;  3PFV A;  4PHK A;  5G08 A;  4CPV A;  1XYD A;  1EG3 A;  1KSM A;  1SYM A;  3OX6 A;  3CR2 A;  4PHJ A;  5D69 A;  2MLF C;  1NX0 A;  2Q91 A;  1JBA A;  1DJW A;  1YX8 A;  2MHH A;  4MN0 A;  2JZI A;  2KAY A;  3AKB A;  3SG4 A;  3I5F B;  2M1U A;  1MXE A;  4QJ5 B;  1GQM A;  2LAN A;  1MF8 B;  1DJZ A;  2Y4Q A;  3OX5 A;  1FW4 A;  2JTT A;  2KYC A;  2K7C A;  1MUX A;  1Y0V H;  2PSR A;  3DVM A;  1QAS A;  1CDL A;  1SCV A;  1ZUZ A;  2G2B A;  2M1K B;  3D0Y A;  1TNP A;  3I5I C;  1FI5 A;  1SR6 C;  1QV0 A;  2K2F A;  2Q4U A;  2I7A A;  3LLE A;  2CNP A;  2K7B A;  1S26 D;  3FWC A;  1AK8 A;  1EL4 A;  4JPZ B;  2O60 A;  3TDI A;  1ODB A;  1CMF A;  4JWQ A;  1DJG A;  1TIZ A;  2OTG B;  3IQQ A;  2K7O A;  2KBM A;  1BLQ A;  1J55 A;  1A03 A;  1QIV A;  3LK1 A;  2L5X B;  3E3R A;  1JSA A;  1A29 A;  2BEC A;  3AAJ A;  1A4P A;  4PE7 A;  4Q04 A;  3CS1 A;  1DF0 A;  2L50 A;  3NSO A;  4GPL B;  1B8C A;  1SCM C;  2M49 B;  1XFY O;  2Y5I A;  1XFZ O;  3VRO A;  2M0R A;  3GK4 X;  4GAO A;  2JTZ A;  1CDN A;  2OS8 C;  1QV1 A;  2OPO A;  4DCK A;  1OSA A;  2LVJ A;  3FWB A;  1KK8 B;  1K93 D;  1B47 A;  1SL9 A;  1K94 A;  2CCM A;  5J3X A;  1DVI A;  2NXQ A;  2LP2 A;  1L2O B;  1OOJ A;  3OB2 B;  1G4Y R;  3PAT A;  1KSO A;  2Y1M A;  3PLF B;  4DRW A;  4YGB B;  3AAK A;  2JC2 A;  1PVA A;  2M8U A;  3BOW A;  3DF0 A;  4YI9 A;  1BMO A;  4HRH A;  1WLZ A;  3TDU A;  2K2A A;  2JUL A;  4A4B A;  1XFW O;  1SY9 A;  1OZS A;  2DOQ A;  2M9G A;  1BR4 B;  4D1E A;  4GGN A;  1EG4 A;  3WNX B;  2I94 A;  1YVH A;  1AP4 A;  1WRL A;  1S5G Z;  1YUR A;  4MLW A;  2ZND A;  4UPG A;  1Q80 A;  4GUK A;  1MR8 A;  1UWO A;  2LNK A;  4U8D A;  1K90 D;  1OMR A;  1W7I B;  4MVF A;  5I8N A;  1GGW A;  1QX2 A;  2K0J A;  3BUO B;  1S6I A;  1C7W A;  4PE1 A;  2LLU A;  2EHB A;  2WOS A;  3ICB A;  3EK7 A;  4MBE A;  2BL0 B;  1MXL C;  3TS5 B;  1ZOT B;  2R2I A;  4ZCU A;  2KI6 D;  3TDZ A;  2D8N A;  1DJH A;  5HYD A;  1TTX A;  1WDC B;  1L7Z A;  2KDH A;  2JOJ A;  1DGV A;  4L9M A;  1YUT A;  3PN7 C;  1H4B A;  1SMG A;  4OKH A;  1MHO A;  1NCZ A;  1LA0 A;  1V1G A;  1YUU A;  1A75 B;  4GGF A;  3ZNI A;  1MWN A;  1K9K A;  1TNQ A;  1OMD A;  1RK9 A;  2AAO A;  2KHN A;  2LE9 B;  4DS7 A;  4XJK B;  4XYN A;  1EH2 A;  2KNE A;  5HLV A;  1QVI Z;  3NSL A;  1UP5 A;  3LK0 A;  4YGA A;  1SW8 A;  3EVR A;  3SG7 A;  3VRN A;  2NZ0 A;  1NYA A;  2LMT A;  3BYA A;  1DTL A;  2CT9 A;  1CFP A;  2BL0 C;  3TS5 C;  1JF2 A;  5HKW A;  2BCB A;  1R6P A;  2MA2 A;  3OB1 B;  2F3Z A;  1W7J B;  2QAC A;  2ZN9 A;  2KYF A;  3O4Y A;  2L51 A;  1LIN A;  4E68 A;  1IG5 A;  4BY4 A;  1OE9 B;  4MSP A;  1FF1 A;  2F33 A;  1PVB A;  1KWO C;  1X02 A;  1IWQ A;  2I2R E;  4WQ3 A;  1JC2 A;  3CR4 X;  2GV5 A;  4C0L A;  1IH0 A;  1JWD A;  1G33 A;  1K8U A;  5KU1 A;  1B7T Z;  1B1G A;  2LVV A;  4GBA A;  1PUL A;  3DVE A;  2NCP A;  4FQO A;  4CFR A;  1CFF A;  3NSI A;  1BF5 A;  2BBM A;  3JVT B;  1IRJ A;  1JUO A;  5JJG A;  1CDM A;  1WRK A;  4CFQ A;  1VRK A;  2A4J A;  1J1D A;  2L4H A;  1CMG A;  4QJ3 B;  2PMY A;  1CM4 A;  1ZFS A;  2F3Y A;  3MSE B;  5I2L A;  4HRG A;  1CLB A;  3GK1 A;  2ZFD A;  4GNK B;  2LV7 A;  1XFV O;  2HF5 A;  1AVS A;  1G8I A;  1IQ3 A;  1K96 A;  2MRD A;  1IKU A;  1NX1 A;  3I5F C;  4CLN A;  1UHK A;  1QJT A;  4MRX A;  1XVJ A;  2HET A;  1V1F A;  3C1V A;  2IS9 A;  2VRG A;  1FI6 A;  1TNX A;  1U5I B;  1UUS A;  5ER5 A;  3CR5 X;  1LA3 A;  2FJU B;  2SCP A;  1K9P A;  1M63 B;  5KSZ A;  3NXA A;  2E30 A;  1UHJ A;  2LHL A;  2FCD A;  5DKR A;  1XO5 A;  1KQV A;  2K7D A;  3VRR A;  4YGD B;  1RTP 1;  2WND A;  1REC A;  1QX7 A;  5AAN A;  3EKJ A;  1OMV A;  1NIW A;  3RLZ A;  3AKA A;  1F4O A;  5I2O A;  4YI8 A;  4GFT A;  3M0W A;  4MZJ A;  2KI4 B;  3FS7 A;  2OTG C;  4PE4 A;  4YBH B;  2PRU A;  1YUS A;  1SNL A;  3PAL A;  4N1G A;  1TOP A;  4DUQ A;  1LXF C;  4C0J A;  1CB1 A;  2SAS A;  2F2P A;  2GGM A;  4PDZ A;  3K21 A;  4WQ2 A;  1UHI A;  2H2K A; 
#chains in the Genus database with same CATH topology
 1QLK A;  3TUY B;  1NP8 A;  3KO0 A;  5CSN A;  3SG2 A;  1E8A A;  3DYE A;  1M39 A;  3I5G B;  3V2L A;  1SPY A;  3F45 A;  1AJ4 A;  1K2H A;  1QLS A;  2WOR A;  5AEQ A;  1Y6W A;  3BUX B;  2KQY A;  2EC6 B;  1Y1X A;  2BBN A;  1KK7 Y;  4NDD A;  3O4X A;  3HCM A;  1QS7 A;  3IQO A;  2ZRS A;  5DKQ A;  1Y1A A;  2JNX A;  2KI4 C;  2P6B B;  4ORB B;  3O6B A;  2JXL A;  5FI7 A;  1N2D A;  3KHE A;  5CSJ A;  1KK8 C;  1CNP A;  1J1E A;  1NWD A;  1QXP A;  1CLL A;  2WCF A;  4OCI A;  2LMV A;  3SIA A;  1L2O C;  1F8H A;  3SJS A;  2LM5 A;  3D0Y B;  2LC5 A;  3VGO A;  2LUX A;  3HX4 A;  2JRF A;  2E6W A;  5BPJ A;  2F8P A;  1KQM B;  3GOF A;  2HQ8 A;  3PM2 A;  1CM1 A;  2KI6 C;  4MRY A;  5CSF A;  3WHU B;  4JKT A;  5PAL A;  1SBJ A;  2FCE A;  3BUN B;  1C07 A;  1CKK A;  2MAZ A;  2PAS A;  3S0D A;  2GGZ A;  2H61 C;  4TNC A;  1UUR A;  2M7L A;  2WCJ A;  1KFX L;  1PSB A;  1QAT A;  1UHH A;  3OHM B;  3PSR A;  1M45 A;  2ISD A;  2LP3 A;  3D77 A;  4M2O A;  1M31 A;  3CZ1 A;  4OVN F;  1DGU A;  4P5O E;  4ICB A;  3EVU A;  4JQ0 D;  1DF0 B;  2LVI A;  2PYQ A;  2TN4 A;  4I5N B;  3S0F A;  5FI6 A;  1NSH A;  1J7Q A;  5GQQ C;  4WRI A;  1DJY A;  1JF0 A;  1S6J A;  1KQM C;  2QDI A;  3EKH A;  3I5H B;  3WXA A;  1J7R A;  1S1E A;  4ORA B;  1S5G Y;  2PAL A;  1AUI B;  2JNF A;  1WY9 A;  4OV2 A;  2KAV A;  4MZL A;  1IGV A;  3D10 A;  1S6C A;  2M29 A;  5B8I B;  3DY9 A;  4HSZ A;  3QRX A;  2CTN A;  2WCH A;  3CLN A;  3JTD B;  5KTY A;  1R2U A;  5DKN A;  1S3P A;  3BOW B;  4ETO A;  1B8R A;  4F0Z B;  3DF0 B;  1BOD A;  3PM8 A;  3SIB A;  1WDC C;  4PT1 A;  3BUW B;  1BJF A;  1HT9 A;  1BOC A;  2MLE C;  2LAP A;  5HL1 A;  1PAL A;  1YVL A;  1JFK A;  2KQ6 A;  1KFU L;  2LUC A;  3BXK A;  5ER4 X;  4ORC B;  3GK2 A;  2ERB A;  3D73 A;  3RZS A;  1FBV A;  1KFU S;  2KLE A;  2HQW A;  1YRT B;  2QEO A;  1M46 A;  4AQI A;  5IBW A;  3DVK A;  1TCO B;  4M2P A;  3EVV A;  2K8M B;  3IF7 A;  1CLM A;  1EJ3 A;  3O2P A;  3TZ1 A;  1D1O A;  5HKZ A;  1NUB A;  1RRO A;  1YX7 A;  5AFP A;  2CBL A;  4HRE E;  4FTG A;  4N1F A;  3FE6 A;  2KAX A;  3OP0 A;  4USL A;  3KF9 A;  4NDB A;  2KGB C;  3I5I B;  1DJI A;  1P28 A;  1SR6 B;  2BAP A;  2BNX A;  3R1O A;  5HLO A;  4I5K A;  1AJ5 A;  2I18 A;  1NX3 A;  4YRU A;  1TRF A;  2O5G A;  2EGD A;  2LHI A;  3LCP C;  4A4C A;  1PK0 D;  1B7T Y;  1B8L A;  1OZO A;  2H61 A;  2LCP A;  3FIA A;  1N65 A;  2JPT A;  2MBX A;  2JT3 A;  1LKJ A;  1EXR A;  5K89 A;  1DMO A;  2Y1N A;  3JVT C;  1DT7 B;  2F2O A;  1N0Y A;  4BY5 A;  3OBV A;  2LLS A;  1FPW A;  3VRP A;  3CTN A;  4M2Q A;  3S0B A;  1XFU O;  2KFH A;  2LLT A;  5JOL A;  4QJ4 B;  1XK4 C;  4IL1 A;  3FE8 A;  3CGA A;  2JQ6 A;  1SCM B;  3DZT A;  4AOM A;  2WCM A;  4PCW A;  2KBI A;  2WCB A;  1S36 A;  1ZMZ A;  1GM0 A;  1QTX A;  2BKH B;  2KFF A;  5AER A;  1TN4 A;  2M3W A;  1XFX O;  1BT6 A;  4N5X A;  2OS8 B;  3K21 A;  2BCX A;  2JT0 A;  4DIR A;  3L47 A;  2KPH A;  1NCX A;  1B4C A;  5D3O A;  1J7O A;  3O78 A;  1KCY A;  1F4Q A;  2AUC A;  2L0P A;  1QIW A;  2JWW A;  4PE0 A;  2M97 A;  4GGF C;  1SKT A;  1B9A A;  2ZKM X;  1YTZ C;  3SS3 A;  3DVJ A;  1JFJ A;  2GTE A;  2L2C A;  3VRQ A;  1OOF A;  5CPV A;  1TCF A;  2FOT A;  4PAL A;  1PRW A;  4P2Y B;  1F70 A;  2ZRT A;  2PQL A;  3WHT B;  2BCA A;  1CDP A;  1KK7 Z;  4R1E A;  4I5J A;  3SG5 A;  2KSP A;  1A75 A;  4OR9 B;  5F6T A;  1NPQ A;  5FYX A;  2NLN A;  4XJK A;  1IJ5 A;  5TNC A;  1WLM A;  2WCL A;  1F71 A;  3KPX A;  1AHR A;  1GGZ A;  1ZAC A;  3SG3 A;  1F55 A;  1DEK A;  3KEV A;  2JU0 A;  2L2E A;  1BR1 B;  3TUY C;  2CXJ A;  2PVB A;  1NCY A;  3I5G C;  3UNW A;  1RJV A;  4AQJ A;  3R72 A;  2LVK A;  2MJW B;  3BQ3 A;  3S0A A;  2K61 A;  4MZK A;  4PHM A;  1SRA A;  2EC6 C;  4PHN A;  2KGR A;  1IJ6 A;  3PJI A;  1NX2 A;  2B1U A;  1ALV A;  2BKI B;  3EK4 A;  5D7F A;  1KFX S;  4YGC B;  1CFC A;  2WC8 A;  2LMU A;  1CFD A;  1BU3 A;  1OQP A;  2NCO A;  1HQV A;  3NHI A;  4C0K A;  2G9B A;  2JT8 A;  2ZNE A;  3A8R A;  2V53 A;  1T14 A;  4MEW A;  1MQ1 A;  1K9U A;  3PN7 B;  2L98 A;  3EK8 A;  3S0E A;  2KFG A;  4NQG A;  4CID A;  1ALW A;  4YGE B;  3SG6 A;  1K95 A;  3BUM B;  1XK4 A;  1Y1U A;  1SL8 A;  1UHN A;  1LVC D;  1RFJ A;  1YR5 A;  3DD4 A;  2WCE A;  1WRZ A;  2ZN8 A;  1GJY A;  1SL7 A;  2RGI A;  3A4U B;  1CTR A;  1XA5 A;  2QPT A;  1TNW A;  4I5L B;  1U5I A;  2COL B;  3CWG A;  2L4I A;  2KOT A;  3CZT X;  2HPS A;  5AXI A;  1C7V A;  3CZ0 A;  3K1E A;  1A2X A;  2M7N A;  3NSK A;  3I5H C;  5I2Q A;  1H8B A;  1PSR A;  1KWO B;  1F54 A;  1YRU B;  3NGV A;  1QX5 B;  2AMI A;  3L4L A;  5HKY A;  1J7P A;  4IJ7 A;  5CSI A;  3LL8 B;  1Z2C B;  3D75 A;  1QVI Y;  1IQ5 A;  3NHT A;  2BE4 A;  3JTD C;  4NDC A;  3RM1 A;  4OZD A;  1DJX A;  2L5Y A;  3H4S E;  3ZWH A;  1SK6 D;  1BG1 A;  2BE6 A;  4ZCV A;  2JPO A;  1OOI X;  1RWY A;  2JXC A;  1OOG A;  3PFV A;  4INX A;  4PHK A;  5G08 A;  1XYD A;  3VB1 A;  4CPV A;  1EG3 A;  1KSM A;  1SYM A;  3OX6 A;  3CR2 A;  4PHJ A;  5D69 A;  1XFR A;  2WCK A;  2MLF C;  1NX0 A;  1Z4H A;  2Q91 A;  1JBA A;  1DJW A;  1YX8 A;  2MHH A;  1TWO A;  2JZI A;  4MN0 A;  2KAY A;  1OW4 A;  2K60 A;  3AKB A;  3SG4 A;  3I5F B;  2M1U A;  1MXE A;  4QJ5 B;  1ORG A;  1GQM A;  2LAN A;  1IIO A;  1MF8 B;  1DJZ A;  2Y4Q A;  3OX5 A;  3BJH A;  4INW A;  1FW4 A;  2JTT A;  2KYC A;  2K7C A;  5I94 A;  3BFH A;  1MUX A;  1Y0V H;  2PSR A;  3B88 A;  3DVM A;  1C3Z A;  2FJY A;  1QAS A;  1CDL A;  1SCV A;  1ZUZ A;  2G2B A;  2M1K B;  2QEB A;  3D0Y A;  1W9Z A;  1TNP A;  3I5I C;  1FI5 A;  1SR6 C;  1QV0 A;  3D74 A;  2P71 A;  2K2F A;  2Q4U A;  2I7A A;  3LLE A;  2CNP A;  3CYZ A;  2K7B A;  1S26 D;  3FWC A;  1AK8 A;  1EL4 A;  4JPZ B;  2O60 A;  3TDI A;  1ODB A;  1CMF A;  4JWQ A;  1DJG A;  1TIZ A;  2OTG B;  3IQQ A;  2K7O A;  2KBM A;  1BLQ A;  1J55 A;  1A03 A;  1QIV A;  3LK1 A;  3BFA A;  4JD9 A;  2L5X B;  3CZ2 A;  3E3R A;  1JSA A;  4FQT A;  1A29 A;  2BEC A;  3AAJ A;  1A4P A;  4PE7 A;  4Q04 A;  3CS1 A;  1DF0 A;  2L50 A;  3NSO A;  4GPL B;  1B8C A;  1SCM C;  2M49 B;  1XFY O;  1TUJ A;  2Y5I A;  1XFZ O;  3VRO A;  2M0R A;  3GK4 X;  2WC5 A;  4GAO A;  2JTZ A;  1CDN A;  2OS8 C;  1QV1 A;  2OPO A;  4DCK A;  1OSA A;  2LVJ A;  3FWB A;  1KK8 B;  1K93 D;  1B47 A;  1SL9 A;  1K94 A;  2CCM A;  5J3X A;  1DVI A;  2NXQ A;  2LP2 A;  1L2O B;  1OOJ A;  3OB2 B;  1G4Y R;  3PAT A;  1KSO A;  2Y1M A;  3PLF B;  4DRW A;  4YGB B;  3AAK A;  2JC2 A;  1PVA A;  2M8U A;  3BOW A;  3DF0 A;  1DC1 A;  4YI9 A;  1QWV A;  1BMO A;  4HRH A;  1WLZ A;  3TDU A;  2K2A A;  2JUL A;  3N7H A;  4A4B A;  1XFW O;  1SY9 A;  1OZS A;  2DOQ A;  3L4A A;  2M9G A;  1BR4 B;  4D1E A;  3B86 A;  4GGN A;  3CAB A;  1DEL A;  1EG4 A;  3WNX B;  3B6X A;  3B87 A;  2I94 A;  4F7F A;  1YVH A;  1AP4 A;  1WRL A;  1S5G Z;  1YUR A;  4MLW A;  2ZND A;  4UPG A;  1Q80 A;  4GUK A;  1MR8 A;  1UWO A;  1TUZ A;  2LNK A;  1K90 D;  1OMR A;  1W7I B;  4MVF A;  4U8D A;  5I8N A;  1GGW A;  1QX2 A;  2K0J A;  3BUO B;  1S6I A;  1C7W A;  4PE1 A;  5EL2 A;  2LLU A;  2EHB A;  2WOS A;  3ICB A;  3EK7 A;  3SS5 A;  3FE9 A;  2P70 A;  2BL0 B;  1MXL C;  4MBE A;  3TS5 B;  1ZOT B;  2R2I A;  4ZCU A;  2KI6 D;  3TDZ A;  2D8N A;  1DJH A;  5HYD A;  1TTX A;  1WDC B;  1L7Z A;  2KDH A;  2JOJ A;  1DGV A;  4L9M A;  3SS4 A;  1YUT A;  2KLD A;  3PN7 C;  4KYN A;  1H4B A;  1SMG A;  4OKH A;  3OGN A;  1MHO A;  1NCZ A;  1LA0 A;  1V1G A;  1YUU A;  1A75 B;  4GGF A;  3ZNI A;  3UO9 A;  1MWN A;  1K9K A;  1TNQ A;  1OMD A;  1RK9 A;  2AAO A;  2KHN A;  2LE9 B;  4DS7 A;  4XJK B;  4XYN A;  1EH2 A;  2KNE A;  3Q8I A;  5HLV A;  1QVI Z;  3NSL A;  1UP5 A;  3LK0 A;  4YGA A;  1SW8 A;  3EVR A;  3SG7 A;  2YGU A;  3VRN A;  2NZ0 A;  1NYA A;  2LMT A;  3BYA A;  1DTL A;  2CT9 A;  1CFP A;  3D76 A;  2BL0 C;  3TS5 C;  1JF2 A;  5HKW A;  2BCB A;  1R6P A;  2MA2 A;  3OB1 B;  2F3Z A;  1W7J B;  2QAC A;  2ZN9 A;  2KYF A;  3IVT A;  1C3Y A;  3O4Y A;  2L51 A;  1LIN A;  4E68 A;  1IG5 A;  4BY4 A;  3EG5 B;  1OE9 B;  4MSP A;  1FF1 A;  2F33 A;  1PVB A;  1KWO C;  1X02 A;  1IWQ A;  2I2R E;  1OOH A;  4WQ3 A;  1JC2 A;  3CR4 X;  2GV5 A;  4C0L A;  1IH0 A;  1JWD A;  1G33 A;  1K8U A;  3S0G A;  5KU1 A;  1B7T Z;  1B1G A;  2LVV A;  4GBA A;  1PUL A;  3DVE A;  2NCP A;  2WC6 A;  4FQO A;  4CFR A;  1CFF A;  3NSI A;  1BF5 A;  2BBM A;  3JVT B;  1IRJ A;  1JUO A;  5JJG A;  1CDM A;  1WRK A;  1SSE B;  4CFQ A;  1VRK A;  2A4J A;  3CDN A;  1J1D A;  2L4H A;  3B7A A;  5FI2 A;  4QJ3 B;  3BFB A;  2PMY A;  1CMG A;  1CM4 A;  1ZFS A;  2F3Y A;  3MSE B;  5I2L A;  4HRG A;  1CLB A;  2H8V A;  3GK1 A;  2ZFD A;  4GNK B;  2LV7 A;  1XFV O;  2HF5 A;  1AVS A;  1G8I A;  1IQ3 A;  1K96 A;  2MRD A;  1IKU A;  1NX1 A;  3D78 A;  3I5F C;  4CLN A;  1UHK A;  1QJT A;  4MRX A;  1XVJ A;  2HET A;  1V1F A;  3C1V A;  2IS9 A;  2VRG A;  1FI6 A;  3DXL A;  1TNX A;  1U5I B;  1UUS A;  5ER5 A;  3CR5 X;  1LA3 A;  2FJU B;  2SCP A;  1K9P A;  1M63 B;  5KSZ A;  3NXA A;  2E30 A;  1UHJ A;  2LHL A;  2FCD A;  3R1V A;  5DKR A;  1XO5 A;  1KQV A;  2QEH A;  2K7D A;  3VRR A;  4YGD B;  1RTP 1;  2WND A;  1REC A;  1QX7 A;  3QME A;  5AAN A;  3EKJ A;  1OMV A;  1NIW A;  3RLZ A;  3AKA A;  1F4O A;  5DIC A;  5I2O A;  1DQE A;  4YI8 A;  4GFT A;  3M0W A;  4MZJ A;  2QEV A;  3R1P A;  2KI4 B;  3FS7 A;  2OTG C;  4PE4 A;  4YBH B;  2PRU A;  1YUS A;  1SNL A;  3PAL A;  4N1G A;  1TOP A;  4DUQ A;  1LXF C;  4C0J A;  1CB1 A;  2SAS A;  2F2P A;  2GGM A;  4PDZ A;  1LS8 A;  4WQ2 A;  1UHI A;  2H2K A; 
#chains in the Genus database with same CATH homology
 1QLK A;  3TUY B;  1NP8 A;  3KO0 A;  5CSN A;  3SG2 A;  1E8A A;  1M39 A;  3I5G B;  1SPY A;  3F45 A;  1AJ4 A;  1K2H A;  1QLS A;  2WOR A;  5AEQ A;  1Y6W A;  3BUX B;  2KQY A;  2EC6 B;  1Y1X A;  2BBN A;  1KK7 Y;  4NDD A;  5DKQ A;  3HCM A;  1QS7 A;  3IQO A;  2ZRS A;  1Y1A A;  2JNX A;  2KI4 C;  2P6B B;  4ORB B;  3O6B A;  2JXL A;  1J7Q A;  1N2D A;  3KHE A;  5CSJ A;  1KK8 C;  1CNP A;  1J1E A;  1NWD A;  1QXP A;  1CLL A;  2WCF A;  4OCI A;  2LMV A;  3SIA A;  1L2O C;  1F8H A;  3SJS A;  2LM5 A;  3D0Y B;  2LC5 A;  3VGO A;  2LUX A;  3HX4 A;  2JRF A;  2E6W A;  5BPJ A;  2F8P A;  1KQM B;  3GOF A;  2HQ8 A;  1CM1 A;  2KI6 C;  4MRY A;  5CSF A;  3WHU B;  5PAL A;  1SBJ A;  2FCE A;  3BUN B;  1C07 A;  1CKK A;  2MAZ A;  2PAS A;  2GGZ A;  2H61 C;  4TNC A;  1UUR A;  2M7L A;  1KFX L;  1PSB A;  1QAT A;  1UHH A;  3OHM B;  3PSR A;  1M45 A;  2ISD A;  2LP3 A;  4M2O A;  1M31 A;  4OVN F;  1DGU A;  4P5O E;  4ICB A;  3EVU A;  4JQ0 D;  1DF0 B;  2LVI A;  2TN4 A;  4I5N B;  1NSH A;  5GQQ C;  4WRI A;  1DJY A;  1JF0 A;  1S6J A;  1KQM C;  3EKH A;  3I5H B;  3WXA A;  1J7R A;  1S1E A;  4ORA B;  1S5G Y;  2PAL A;  1AUI B;  2JNF A;  1WY9 A;  4OV2 A;  2KAV A;  4MZL A;  1IGV A;  3D10 A;  1S6C A;  2M29 A;  5B8I B;  4HSZ A;  3QRX A;  2CTN A;  3CLN A;  3JTD B;  5KTY A;  1R2U A;  5DKN A;  1S3P A;  3BOW B;  4ETO A;  1B8R A;  4F0Z B;  3DF0 B;  1BOD A;  3PM8 A;  3SIB A;  1WDC C;  3BUW B;  1BJF A;  1HT9 A;  1BOC A;  2MLE C;  2LAP A;  1PAL A;  1YVL A;  1JFK A;  2KQ6 A;  1KFU L;  2LUC A;  3BXK A;  5ER4 X;  4ORC B;  3GK2 A;  1FBV A;  1KFU S;  2HQW A;  1YRT B;  1M46 A;  4AQI A;  5IBW A;  3DVK A;  1TCO B;  4M2P A;  3EVV A;  2K8M B;  3IF7 A;  1CLM A;  1EJ3 A;  3O2P A;  3TZ1 A;  1D1O A;  5HKZ A;  1NUB A;  1RRO A;  1YX7 A;  5AFP A;  2CBL A;  4HRE E;  4FTG A;  4N1F A;  2KAX A;  3OP0 A;  4USL A;  3KF9 A;  4NDB A;  2KGB C;  3I5I B;  1DJI A;  1SR6 B;  5HLO A;  4I5K A;  1AJ5 A;  2I18 A;  1NX3 A;  4YRU A;  1TRF A;  2O5G A;  2EGD A;  2LHI A;  3LCP C;  4A4C A;  1PK0 D;  1B7T Y;  1B8L A;  1OZO A;  2H61 A;  2LCP A;  3FIA A;  1N65 A;  2JPT A;  2MBX A;  2JT3 A;  1LKJ A;  1EXR A;  5K89 A;  1DMO A;  2Y1N A;  3JVT C;  1DT7 B;  2F2O A;  1N0Y A;  4BY5 A;  2LLS A;  1FPW A;  3VRP A;  3CTN A;  4M2Q A;  1XFU O;  2KFH A;  2LLT A;  5JOL A;  4QJ4 B;  1XK4 C;  4IL1 A;  3CGA A;  2JQ6 A;  1SCM B;  4AOM A;  4PCW A;  2KBI A;  2WCB A;  1S36 A;  1ZMZ A;  1QTX A;  2BKH B;  2KFF A;  5AER A;  1TN4 A;  2M3W A;  1XFX O;  1BT6 A;  4N5X A;  2OS8 B;  2BCX A;  2JT0 A;  4DIR A;  1B4C A;  1NCX A;  1J7O A;  3O78 A;  1KCY A;  1F4Q A;  2AUC A;  2L0P A;  1QIW A;  2JWW A;  4PE0 A;  2M97 A;  4GGF C;  1SKT A;  1B9A A;  2ZKM X;  1YTZ C;  3DVJ A;  1JFJ A;  3VRQ A;  5CPV A;  1TCF A;  2FOT A;  4PAL A;  1PRW A;  4P2Y B;  1F70 A;  2ZRT A;  3WHT B;  2BCA A;  1CDP A;  1KK7 Z;  4R1E A;  4I5J A;  3SG5 A;  2KSP A;  1A75 A;  4OR9 B;  5F6T A;  1NPQ A;  5FYX A;  2NLN A;  4XJK A;  1IJ5 A;  5TNC A;  1WLM A;  1F71 A;  3KPX A;  1AHR A;  1GGZ A;  1ZAC A;  3SG3 A;  1F55 A;  3KEV A;  2JU0 A;  2L2E A;  1BR1 B;  3TUY C;  2CXJ A;  2PVB A;  1NCY A;  3I5G C;  1RJV A;  4AQJ A;  2LVK A;  2MJW B;  3BQ3 A;  2K61 A;  4MZK A;  4PHM A;  1SRA A;  2EC6 C;  4PHN A;  2KGR A;  1IJ6 A;  1NX2 A;  2B1U A;  1ALV A;  2BKI B;  3EK4 A;  5D7F A;  1KFX S;  4YGC B;  1CFC A;  2WC8 A;  2LMU A;  1CFD A;  1BU3 A;  1OQP A;  2NCO A;  1HQV A;  4C0K A;  2G9B A;  2JT8 A;  2ZNE A;  3A8R A;  2V53 A;  4MEW A;  1MQ1 A;  1K9U A;  3PN7 B;  2L98 A;  3EK8 A;  2KFG A;  4NQG A;  4CID A;  1ALW A;  4YGE B;  3SG6 A;  1K95 A;  3BUM B;  1XK4 A;  1Y1U A;  1SL8 A;  1UHN A;  1LVC D;  1RFJ A;  1YR5 A;  3DD4 A;  2WCE A;  1WRZ A;  2ZN8 A;  1GJY A;  1SL7 A;  2RGI A;  3A4U B;  1CTR A;  1XA5 A;  2QPT A;  1TNW A;  4I5L B;  1U5I A;  2COL B;  3CWG A;  2L4I A;  2KOT A;  3CZT X;  2HPS A;  5AXI A;  1C7V A;  1A2X A;  2M7N A;  3NSK A;  3I5H C;  5I2Q A;  1H8B A;  1PSR A;  1KWO B;  1F54 A;  1YRU B;  1QX5 B;  2AMI A;  5HKY A;  1J7P A;  5CSI A;  3LL8 B;  1QVI Y;  1IQ5 A;  2BE4 A;  3JTD C;  4NDC A;  3RM1 A;  1DJX A;  3H4S E;  3ZWH A;  1BG1 A;  1SK6 D;  2BE6 A;  4ZCV A;  1RWY A;  2JXC A;  3PFV A;  4PHK A;  5G08 A;  4CPV A;  1XYD A;  1EG3 A;  1KSM A;  1SYM A;  3OX6 A;  3CR2 A;  4PHJ A;  5D69 A;  2MLF C;  1NX0 A;  2Q91 A;  1JBA A;  1DJW A;  1YX8 A;  2MHH A;  4MN0 A;  2JZI A;  2KAY A;  3AKB A;  3SG4 A;  3I5F B;  2M1U A;  1MXE A;  4QJ5 B;  1GQM A;  2LAN A;  1MF8 B;  1DJZ A;  2Y4Q A;  3OX5 A;  1FW4 A;  2JTT A;  2KYC A;  2K7C A;  1MUX A;  1Y0V H;  2PSR A;  3DVM A;  1QAS A;  1CDL A;  1SCV A;  1ZUZ A;  2G2B A;  2M1K B;  3D0Y A;  1TNP A;  3I5I C;  1FI5 A;  1SR6 C;  1QV0 A;  2K2F A;  2Q4U A;  2I7A A;  3LLE A;  2CNP A;  2K7B A;  1S26 D;  3FWC A;  1AK8 A;  1EL4 A;  4JPZ B;  2O60 A;  3TDI A;  1ODB A;  1CMF A;  4JWQ A;  1DJG A;  1TIZ A;  2OTG B;  3IQQ A;  2K7O A;  2KBM A;  1BLQ A;  1J55 A;  1A03 A;  1QIV A;  3LK1 A;  2L5X B;  3E3R A;  1JSA A;  1A29 A;  2BEC A;  3AAJ A;  1A4P A;  4PE7 A;  4Q04 A;  3CS1 A;  1DF0 A;  2L50 A;  3NSO A;  4GPL B;  1B8C A;  1SCM C;  2M49 B;  1XFY O;  2Y5I A;  1XFZ O;  3VRO A;  2M0R A;  3GK4 X;  4GAO A;  2JTZ A;  1CDN A;  2OS8 C;  1QV1 A;  2OPO A;  4DCK A;  1OSA A;  2LVJ A;  3FWB A;  1KK8 B;  1K93 D;  1B47 A;  1SL9 A;  1K94 A;  2CCM A;  5J3X A;  1DVI A;  2NXQ A;  2LP2 A;  1L2O B;  1OOJ A;  3OB2 B;  1G4Y R;  3PAT A;  1KSO A;  2Y1M A;  3PLF B;  4DRW A;  4YGB B;  3AAK A;  2JC2 A;  1PVA A;  2M8U A;  3BOW A;  3DF0 A;  4YI9 A;  1BMO A;  4HRH A;  1WLZ A;  3TDU A;  2K2A A;  2JUL A;  4A4B A;  1XFW O;  1SY9 A;  1OZS A;  2DOQ A;  2M9G A;  1BR4 B;  4D1E A;  4GGN A;  1EG4 A;  3WNX B;  2I94 A;  1YVH A;  1AP4 A;  1WRL A;  1S5G Z;  1YUR A;  4MLW A;  2ZND A;  4UPG A;  1Q80 A;  4GUK A;  1MR8 A;  1UWO A;  2LNK A;  4U8D A;  1K90 D;  1OMR A;  1W7I B;  4MVF A;  5I8N A;  1GGW A;  1QX2 A;  2K0J A;  3BUO B;  1S6I A;  1C7W A;  4PE1 A;  2LLU A;  2EHB A;  2WOS A;  3ICB A;  3EK7 A;  4MBE A;  2BL0 B;  1MXL C;  3TS5 B;  1ZOT B;  2R2I A;  4ZCU A;  2KI6 D;  3TDZ A;  2D8N A;  1DJH A;  5HYD A;  1TTX A;  1WDC B;  1L7Z A;  2KDH A;  2JOJ A;  1DGV A;  4L9M A;  1YUT A;  3PN7 C;  1H4B A;  1SMG A;  4OKH A;  1MHO A;  1NCZ A;  1LA0 A;  1V1G A;  1YUU A;  1A75 B;  4GGF A;  3ZNI A;  1MWN A;  1K9K A;  1TNQ A;  1OMD A;  1RK9 A;  2AAO A;  2KHN A;  2LE9 B;  4DS7 A;  4XJK B;  4XYN A;  1EH2 A;  2KNE A;  5HLV A;  1QVI Z;  3NSL A;  1UP5 A;  3LK0 A;  4YGA A;  1SW8 A;  3EVR A;  3SG7 A;  3VRN A;  2NZ0 A;  1NYA A;  2LMT A;  3BYA A;  1DTL A;  2CT9 A;  1CFP A;  2BL0 C;  3TS5 C;  1JF2 A;  5HKW A;  2BCB A;  1R6P A;  2MA2 A;  3OB1 B;  2F3Z A;  1W7J B;  2QAC A;  2ZN9 A;  2KYF A;  3O4Y A;  2L51 A;  1LIN A;  4E68 A;  1IG5 A;  4BY4 A;  1OE9 B;  4MSP A;  1FF1 A;  2F33 A;  1PVB A;  1KWO C;  1X02 A;  1IWQ A;  2I2R E;  4WQ3 A;  1JC2 A;  3CR4 X;  2GV5 A;  4C0L A;  1IH0 A;  1JWD A;  1G33 A;  1K8U A;  5KU1 A;  1B7T Z;  1B1G A;  2LVV A;  4GBA A;  1PUL A;  3DVE A;  2NCP A;  4FQO A;  4CFR A;  1CFF A;  3NSI A;  1BF5 A;  2BBM A;  3JVT B;  1IRJ A;  1JUO A;  5JJG A;  1CDM A;  1WRK A;  4CFQ A;  1VRK A;  2A4J A;  1J1D A;  2L4H A;  1CMG A;  4QJ3 B;  2PMY A;  1CM4 A;  1ZFS A;  2F3Y A;  3MSE B;  5I2L A;  4HRG A;  1CLB A;  3GK1 A;  2ZFD A;  4GNK B;  2LV7 A;  1XFV O;  2HF5 A;  1AVS A;  1G8I A;  1IQ3 A;  1K96 A;  2MRD A;  1IKU A;  1NX1 A;  3I5F C;  4CLN A;  1UHK A;  1QJT A;  4MRX A;  1XVJ A;  2HET A;  1V1F A;  3C1V A;  2IS9 A;  2VRG A;  1FI6 A;  1TNX A;  1U5I B;  1UUS A;  5ER5 A;  3CR5 X;  1LA3 A;  2FJU B;  2SCP A;  1K9P A;  1M63 B;  5KSZ A;  3NXA A;  2E30 A;  1UHJ A;  2LHL A;  2FCD A;  5DKR A;  1XO5 A;  1KQV A;  2K7D A;  3VRR A;  4YGD B;  1RTP 1;  2WND A;  1REC A;  1QX7 A;  5AAN A;  3EKJ A;  1OMV A;  1NIW A;  3RLZ A;  3AKA A;  1F4O A;  5I2O A;  4YI8 A;  4GFT A;  3M0W A;  4MZJ A;  2KI4 B;  3FS7 A;  2OTG C;  4PE4 A;  4YBH B;  2PRU A;  1YUS A;  1SNL A;  3PAL A;  4N1G A;  1TOP A;  4DUQ A;  1LXF C;  4C0J A;  1CB1 A;  2SAS A;  2F2P A;  2GGM A;  4PDZ A;  3K21 A;  4WQ2 A;  1UHI A;  2H2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...