2BCBA

High-resolution solution structure of calcium-loaded calbindin d9k
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of calcium-loaded calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
total genus 23
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1993-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bcbA00
4CIDA 4L9MA 3LL8B 1QXPA 1DJGA 1JF2A 1DGVA 3OX5A 2BCAA 4UPGA 3TZ1A 1TRFA 1QX7A 1DT7B 1ZUZA 1KWOB 4DIRA 3TS5C 1S3PA 1DF0A 2OTGC 2JQ6A 2JNXA 3PN7C 2VRGA 1SCMB 4PCWA 4PHJA 5HKZA 4HRGA 3FWBA 1B8LA 4P2YB 2ZN8A 4YGEB 1TNQA 2V53A 1S1EA 1AVSA 1A2XA 3KF9A 5AFPA 1UURA 1J7RA 1DGUA 1Y1AA 3IQQA 1EG4A 1GGWA 2K7DA 3K21A 1K90D 4WQ2A 1Q80A 1XFXO 1SCVA 1UHJA 3CR4X 5DKNA 1NP8A 1CTRA 1K96A 4AOMA 2M9GA 2PASA 3LK1A 1G8IA 4CPVA 1B47A 2CTNA 1MQ1A 1YRTB 1KSMA 4MEWA 1NX1A 2KAYA 4F0ZB 1F54A 4AQJA 1JF0A 5HLOA 1AP4A 2NCPA 1LXFC 1HQVA 2JWWA 1NPQA 2Y1NA 1NIWA 4MLWA 2L98A 1XFZO 2KSPA 1SBJA 1TNPA 1SK6D 4MRXA 1SL8A 1Y1XA 1LA0A 2L51A 2M7LA 2EC6C 2K2FA 3D10A 4I5NB 4M2QA 4GGNA 4PALA 3OHMB 2JTTA 5HKYA 2JT8A 3IQOA 1BOCA 3LK0A 1MUXA 3CR2A 2K7OA 2Y1MA 3SJSA 5B8IB 3IF7A 4PHKA 5CSJA 3CTNA 2KGRA 2L5XB 2KI4B 2LM5A 1CMGA 1M46A 3OX6A 5HLVA 4ZCVA 1UHNA 1DTLA 2G2BA 2L4HA 2BE6A 2M3WA 3SIAA 5AEQA 4MVFA 1F70A 3EKHA 1IRJA 2CT9A 1MF8B 1NCYA 2LMTA 3TDZA 1DJIA 2LAPA 5KU1A 1KK8B 3GK4X 1IGVA 4GFTA 3I5GB 4PE1A 5AXIA 1B8CA 1B7TY 2LV7A 2BCBA 1KFUS 2K8MB 3CLNA 1SRAA 2JC2A 2KAXA 2EHBA 1BJFA 3FWCA 1XFVO 4Q04A 2TN4A 3ZNIA 3PLFB 3O2PA 1QLSA 1JUOA 1RECA 5I2OA 5I2QA 1FPWA 1S6IA 3NSOA 4ORBB 2RGIA 1TTXA 1DJWA 1OE9B 1PK0D 3BUWB 1QX2A 2L2EA 3BUOB 2KI6D 1CDLA 3DVEA 3I5FC 1TOPA 3JVTC 4N5XA 1SNLA 1MWNA 1KFXL 1M63B 3NSKA 1UHKA 1OQPA 1KK7Z 1OMDA 5CPVA 1B9AA 1K9KA 1UUSA 1QV1A 2KOTA 3AKAA 3OB1B 2M7NA 4GBAA 5KTYA 3BYAA 2F3ZA 2HQWA 3O6BA 1GGZA 1JWDA 1L2OC 1ZMZA 3KPXA 3TDIA 5ER4X 4CFRA 1VRKA 1BT6A 1DJYA 1ZOTB 1RJVA 1IJ6A 2HQ8A 4YGAA 1R6PA 3DF0B 5D69A 1YUUA 1OSAA 1XO5A 2OS8C 5I8NA 1IJ5A 4MBEA 1PSBA 3CS1A 3FS7A 2I94A 1RWYA 1QVIY 2KFHA 4BY4A 1FW4A 2CNPA 2L4IA 1QS7A 2G9BA 3PATA 3KO0A 3DVKA 1U5IB 3JTDB 1PVAA 5FYXA 2BL0B 2Q91A 1A4PA 4BY5A 1RK9A 3VRRA 1CM1A 2FCEA 2LVKA 1QTXA 3D0YB 4NQGA 2KHNA 1IWQA 1WLMA 1WY9A 2ZFDA 3BUXB 1ALWA 1NX2A 2P6BB 1C7WA 1YR5A 2BBMA 4AQIA 1EH2A 3EVUA 1TIZA 2HETA 1QV0A 4YGBB 1NX0A 4P5OE 4M2PA 2IS9A 1KWOC 4I5JA 1IG5A 1ZACA 1XFUO 1EL4A 2O60A 4MSPA 2LP2A 5TNCA 1XFYO 2AAOA 1BR1B 1LKJA 2OTGB 1UP5A 2JXCA 1F55A 3PN7B 1OMRA 3PALA 4PDZA 3AKBA 2JTZA 3WNXB 2WCEA 5F6TA 1SR6B 1CDNA 4ORAB 3KEVA 4A4BA 2SCPA 1A03A 1F4OA 1YVLA 3TUYC 2LUCA 1RFJA 1WDCB 2JRFA 1CFCA 1EXRA 4JPZB 1GJYA 1CLBA 1MXLC 2ZNEA 2I2RE 4YGCB 1S5GY 2KFGA 2KBMA 1PALA 1SL9A 4R1EA 4MZJA 1YTZC 3AAKA 1NYAA 4DUQA 5GQQC 2LVIA 1KK7Y 4MRYA 1CM4A 4PE4A 2LVJA 1M45A 3LCPC 1OZOA 1KQVA 1CLMA 1SMGA 1B1GA 4QJ4B 3TS5B 1J7OA 2CXJA 1BR4B 2Y4QA 1JFKA 2KQ6A 1KFXS 1DJHA 3VGOA 4WQ3A 2F33A 1CFPA 4CFQA 1SW8A 2LCPA 1QLKA 1UHHA 3ICBA 5J3XA 5DKRA 1TCOB 1YURA 5BPJA 2ZNDA 4MN0A 2M1UA 2M49B 1DF0B 3I5HC 3A4UB 5I2LA 2JPTA 2NLNA 1B8RA 1WRKA 2ZN9A 1F71A 1KCYA 1N2DA 3OB2B 4N1FA 3BOWA 2WORA 2AMIA 2ZRTA 3SG7A 3CGAA 1SY9A 1TCFA 1NX3A 1SL7A 2FJUB 1L7ZA 2K61A 4D1EA 1BLQA 1KK8C 2AUCA 1TNXA 1G33A 2MAZA 4GPLB 3SG4A 4JWQA 1K9UA 1AUIB 3DVMA 1JBAA 1KQMB 1E8AA 1Y0VH 1C07A 4NDCA 1GQMA 4GGFC 4DS7A 1H4BA 2H61A 4NDDA 2O5GA 1BMOA 1S26D 1S6JA 2PVBA 1XVJA 1OOJA 1NWDA 5JJGA 2NZ0A 2QPTA 4ETOA 1J1DA 4N1GA 1FI6A 2Q4UA 1PSRA 4OR9B 4PHMA 4CLNA 1BG1A 3KHEA 1A75A 1JC2A 4HREE 1K9PA 1UHIA 3CZTX 4OKHA 4GNKB 2EC6B 3RLZA 3DF0A 1ALVA 1CB1A 3I5FB 1C7VA 2LLUA 2M8UA 4ZCUA 3BXKA 3SG6A 4HRHA 2KI4C 2JOJA 2WCBA 2PRUA 3EVVA 1OZSA 4PHNA 4WRIA 1L2OB 4USLA 1AJ5A 1PULA 2GV5A 2K7CA 2KDHA 4HSZA 4E68A 5CSNA 2JT0A 3VRQA 1K94A 4YI9A 1NUBA 1V1GA 3H4SE 1M39A 2LMVA 1H8BA 2BKHB 2OS8B 1KFUL 3SG3A 4IL1A 3EK4A 1SCMC 2H61C 3M0WA 4C0LA 1XYDA 4DRWA 3BUMB 1LA3A 3E3RA 3I5IC 1M31A 2FOTA 1OMVA 3WHTB 5CSIA 2KFFA 4QJ5B 1F4QA 4ICBA 1FF1A 1YX8A 1AJ4A 1JSAA 2LVVA 1CDPA 2LE9B 3O4YA 1RTP1 1AHRA 3LLEA 3D0YA 1HT9A 1KSOA 4NDBA 5AERA 2PSRA 5HYDA 3JVTB 5IBWA 4GAOA 1FBVA 1J7PA 1MHOA 4PE0A 2QACA 1G4YR 2KGBC 3GK1A 1WLZA 1S6CA 3FIAA 2NXQA 3OP0A 3F45A 2KBIA 1QATA 5D7FA 3GK2A 2HPSA 2PALA 3SG2A 1QASA 1XFWO 3EKJA 3NSLA 1SR6C 3EK7A 1D1OA 1J7QA 1FI5A 2OPOA 2LP3A 5K89A 2LLTA 1CFFA 1TNWA 1UWOA 2WC8A 1EG3A 2KI6C 4YGDB 2LHLA 2CCMA 2HF5A 3EVRA 3JTDC 4OVNF 1NCXA 1B4CA 1YX7A 1MR8A 3PM8A 1SYMA 1LINA 1CLLA 2D8NA 1CDMA 2K0JA 4C0KA 2EGDA 4A4CA 1IQ3A 3RM1A 1J1EA 3DVJA 2LMUA 2LNKA 4MZKA 3TDUA 1ZFSA 1W7IB 2MHHA 5G08A 3A8RA 1NCZA 1A29A 2I7AA 4YRUA 5KSZA 1K2HA 2A4JA 4GGFA 5CSFA 2K2AA 1IQ5A 4ORCB 1SPYA 1IH0A 2GGMA 5AANA 1Y1UA 1YVHA 1K95A 2F2OA 2WCFA 3WHUB 2SASA 4PE7A 3NXAA 3CWGA 3O78A 2DOQA 2K7BA 4FTGA 4XJKA 4C0JA 1QX5B 1SKTA 2KYFA 2L50A 3I5HB 3QRXA 4YI8A 3VROA 1TN4A 2LUXA 2Y5IA 5PALA 3TUYB 1DJXA 1CMFA 1XK4C 2COLB 3BOWB 3BQ3A 1CNPA 1QVIZ 4TNCA 1K8UA 3PFVA 2LHIA 4QJ3B 2GGZA 2BBNA 4YBHB 1QIVA 3WXAA 2WNDA 2LC5A 1KQMC 5JOLA 2H2KA 1JFJA 3AAJA 1MXEA 1EJ3A 5DKQA 1PRWA 3I5GC 2E6WA 2JXLA 2M0RA 2F3YA 2KQYA 3DD4A 3GOFA 3ZWHA 1ODBA 2MLEC 2I18A 2LANA 2KNEA 1XK4A 2KAVA 4I5LB 2MBXA 2BL0C 2R2IA 3NSIA 2MA2A 2WOSA 2M29A 2M1KB 4MZLA 2LLSA 3HCMA 1AK8A 1YUSA 4FQOA 2F2PA 4M2OA 1BODA 1BU3A 2FCDA 3C1VA 2BE4A 3CR5X 3HX4A 2BECA 4OV2A 2JZIA 1S36A 2JU0A 2F8PA 4OCIA 2PMYA 1YUTA 1LVCD 1R2UA 3MSEB 3SIBA 1Y6WA 1RROA 1CKKA 2ZRSA 1B7TZ 1CFDA 2CBLA 1N65A 4I5KA 1QIWA 4JQ0D 1WRLA 2BKIB 1WRZA 2JNFA 1V1FA 2B1UA 2M97A 3SG5A 1IKUA 2L0PA 2KYCA 3VRNA 3I5IB 3PSRA 1X02A 1NSHA 4U8DA 1BF5A 1QJTA 3BUNB 1S5GZ 5HKWA 1N0YA 2MJWB 3EK8A 3VRPA 1DMOA 1XA5A 2BCXA 2JT3A 2ZKMX 4GUKA 4XJKB 1A75B 4XYNA 2JULA 1DVIA 1U5IA 5ER5A 2NCOA 2ISDA 2E30A 1W7JB 1WDCC 4DCKA 1F8HA 2MRDA 1DJZA 1PVBA 1K93D 1YRUB 2MLFC 1J55A
chains in the Genus database with same CATH superfamily
4CIDA 3S0DA 4L9MA 3LL8B 1QXPA 3OBVA 3S0FA 1DJGA 1JF2A 1DGVA 3OX5A 2BCAA 4UPGA 3TZ1A 1TRFA 1QX7A 2L2CA 1DT7B 1ZUZA 1KWOB 4DIRA 3TS5C 1S3PA 2WC5A 1DF0A 2OTGC 2JQ6A 2JNXA 2PQLA 4FQTA 3PN7C 2VRGA 1SCMB 4PCWA 4PHJA 5HKZA 4HRGA 3FWBA 1B8LA 4P2YB 2ZN8A 4YGEB 2KLDA 1TNQA 2V53A 1S1EA 5EL2A 1AVSA 1A2XA 3KF9A 5AFPA 1UURA 3R1PA 1J7RA 1DGUA 1Y1AA 3IQQA 1EG4A 1GGWA 5FI6A 5D3OA 2K7DA 3K21A 1K90D 4WQ2A 1Q80A 1XFXO 1SCVA 1UHJA 3CR4X 5DKNA 1NP8A 1TUJA 2QEBA 1CTRA 3QMEA 1K96A 4AOMA 2M9GA 2PASA 3LK1A 1G8IA 4CPVA 1B47A 2CTNA 1MQ1A 1YRTB 1KSMA 2QDIA 1NX1A 2KAYA 3K1EA 4MEWA 4AQJA 1JF0A 5HLOA 1AP4A 2NCPA 1LXFC 1HQVA 2JWWA 1NPQA 2Y1NA 1NIWA 3D75A 4MLWA 2L98A 1XFZO 2KSPA 3V2LA 1SBJA 1TNPA 1SK6D 4MRXA 1SL8A 1Y1XA 5I94A 1LA0A 2L51A 2M7LA 2EC6C 2K2FA 3D10A 4I5NB 4M2QA 4GGNA 4PALA 3OHMB 2JTTA 3VB1A 2JT8A 3IQOA 1BOCA 3LK0A 1MUXA 3CR2A 2K7OA 2Y1MA 3SJSA 5B8IB 3IF7A 4PHKA 5CSJA 3CTNA 2KGRA 2L5XB 2KI4B 2KPHA 2LM5A 1M46A 3OX6A 5HLVA 3B6XA 2L5YA 4ZCVA 1CMGA 1UHNA 1DTLA 2G2BA 2L4HA 2BE6A 2M3WA 3SIAA 5AEQA 4MVFA 1F70A 3EKHA 1IRJA 3S0BA 2CT9A 3Q8IA 1MF8B 1NCYA 2LMTA 3TDZA 1DJIA 2LAPA 4PT1A 5KU1A 1KK8B 3GK4X 1IGVA 4GFTA 3I5GB 4PE1A 5AXIA 1B8CA 1B7TY 2LV7A 2BCBA 3DYEA 1KFUS 2K8MB 3CLNA 1SRAA 2JC2A 2KAXA 2EHBA 1BJFA 3B86A 3FWCA 1LS8A 1XFVO 4Q04A 2TN4A 3ZNIA 3PLFB 3O2PA 1QLSA 1JUOA 1RECA 5I2OA 5I2QA 1FPWA 3R1OA 1S6IA 3NSOA 4ORBB 2RGIA 1TTXA 1DJWA 3R1VA 1OE9B 3UO9A 1PK0D 2WCLA 3BUWB 1QX2A 2L2EA 3BUOB 2KI6D 1CDLA 3DVEA 3I5FC 1TOPA 3JVTC 4N5XA 1SNLA 1MWNA 1KFXL 1M63B 3NSKA 5DICA 1UHKA 1OQPA 1KK7Z 1OMDA 5CPVA 1B9AA 1K9KA 1UUSA 1QV1A 2KOTA 3AKAA 3OB1B 2M7NA 4GBAA 5KTYA 3BYAA 2F3ZA 2HQWA 3O6BA 5FI7A 1GGZA 1JWDA 1L2OC 1ZMZA 3KPXA 3TDIA 5ER4X 4CFRA 1VRKA 1BT6A 5FI2A 5HL1A 1OW4A 1DJYA 3RZSA 1ZOTB 1RJVA 1IJ6A 2HQ8A 4YGAA 1R6PA 3DF0B 5D69A 1YUUA 1OSAA 3BFBA 1XO5A 2OS8C 5I8NA 1IJ5A 4MBEA 1PSBA 3CS1A 3FS7A 2I94A 1RWYA 1QVIY 2KFHA 4BY4A 1FW4A 2CNPA 1DELA 2L4IA 1QS7A 2G9BA 3PATA 3KO0A 3DVKA 1U5IB 3JTDB 1PVAA 5FYXA 2BL0B 2Q91A 1A4PA 3D78A 3SS5A 1RK9A 2BNXA 4BY5A 3VRRA 1CM1A 1Z4HA 2FCEA 2LVKA 1QTXA 3D0YB 3D76A 2KHNA 4NQGA 2KLEA 1IWQA 1WLMA 1WY9A 2ZFDA 3BUXB 1ALWA 3CZ2A 1NX2A 2P6BB 4F0ZB 1C7WA 1YR5A 2BBMA 4AQIA 1EH2A 3EVUA 1TIZA 2HETA 1QV0A 3DZTA 4YGBB 1NX0A 4P5OE 4M2PA 2IS9A 1KWOC 4I5JA 1IG5A 1ZACA 3UNWA 2JPOA 1XFUO 1EL4A 2O60A 4MSPA 2LP2A 5TNCA 1XFYO 2AAOA 1BR1B 1LKJA 2OTGB 1F54A 1UP5A 2JXCA 1F55A 3PN7B 1C3ZA 1OMRA 3PALA 4PDZA 3AKBA 2JTZA 3WNXB 2WCEA 5F6TA 1SR6B 1CDNA 4ORAB 3KEVA 4A4BA 3NHIA 2SCPA 1A03A 3D74A 1F4OA 1YVLA 3TUYC 2LUCA 1RFJA 1WDCB 2JRFA 1CFCA 1EXRA 4JPZB 1GJYA 2FJYA 1CLBA 1MXLC 2ZNEA 2I2RE 4YGCB 1S5GY 3NGVA 2KFGA 2KBMA 1PALA 2ERBA 1SL9A 4R1EA 4MZJA 1YTZC 3AAKA 1NYAA 4DUQA 5GQQC 2LVIA 1KK7Y 4MRYA 1CM4A 4PE4A 2LVJA 1M45A 3LCPC 3OGNA 1OZOA 3NHTA 1KQVA 1CLMA 1SMGA 1XFRA 4QJ4B 3TS5B 1B1GA 1ORGA 1BR4B 2CXJA 1J7OA 2Y4QA 1JFKA 2KQ6A 1KFXS 1DJHA 3VGOA 4WQ3A 2F33A 1CFPA 4CFQA 1SW8A 2LCPA 1QLKA 1UHHA 3ICBA 5J3XA 3FE6A 5DKRA 1TCOB 3L47A 1YURA 5BPJA 2ZNDA 4MN0A 2M1UA 3B88A 3L4LA 2M49B 1DF0B 3I5HC 3A4UB 3CABA 5I2LA 2JPTA 2NLNA 1B8RA 1WRKA 2ZN9A 1F71A 1KCYA 1N2DA 3OB2B 4N1FA 3BOWA 2WORA 2AMIA 2ZRTA 3SG7A 3CGAA 1SY9A 1TCFA 1NX3A 1SL7A 2FJUB 1L7ZA 2K61A 4D1EA 1BLQA 1KK8C 2AUCA 1TNXA 1G33A 2MAZA 4GPLB 3SG4A 1IIOA 4JWQA 1K9UA 1AUIB 3DVMA 1JBAA 1KQMB 3BFHA 2WCKA 1E8AA 1Y0VH 1C07A 4NDCA 1GQMA 4GGFC 4DS7A 1H4BA 2H61A 4JD9A 4NDDA 2O5GA 1BMOA 1S26D 1S6JA 2PVBA 1XVJA 1OOJA 1NWDA 5JJGA 2NZ0A 2QPTA 4ETOA 1J1DA 3FE8A 4N1GA 1FI6A 1OOHA 1PSRA 2Q4UA 4KYNA 4OR9B 4PHMA 3EG5B 4CLNA 1BG1A 3KHEA 1A75A 1JC2A 4HREE 1K9PA 1UHIA 3CZTX 4OKHA 4GNKB 2EC6B 3RLZA 3DF0A 2BAPA 1ALVA 4IJ7A 1CB1A 3I5FB 1C7VA 3N7HA 2LLUA 2M8UA 4ZCUA 3BXKA 3SG6A 4HRHA 3B87A 2KI4C 2JOJA 2WCBA 2PRUA 3EVVA 1OZSA 4PHNA 4WRIA 1L2OB 2WC6A 3SS3A 4USLA 1AJ5A 1PULA 2GV5A 2K7CA 2KDHA 4HSZA 4INWA 5CSNA 4E68A 2JT0A 3VRQA 1K94A 4YI9A 1NUBA 1V1GA 3H4SE 1M39A 2LMVA 1H8BA 2BKHB 3CZ0A 2YGUA 2OS8B 1KFUL 3SG3A 4IL1A 3EK4A 3L4AA 1SCMC 2H61C 3M0WA 3R72A 4C0LA 1XYDA 4DRWA 3BUMB 1LA3A 3E3RA 3I5IC 1C3YA 1OOGA 1M31A 2FOTA 1OMVA 3BJHA 3WHTB 5CSIA 2KFFA 4QJ5B 1F4QA 4ICBA 1FF1A 1YX8A 1AJ4A 1JSAA 2LVVA 1CDPA 2LE9B 3O4YA 1RTP1 1AHRA 3LLEA 3D0YA 1HT9A 1KSOA 4NDBA 5AERA 2PSRA 5HYDA 3JVTB 5IBWA 4GAOA 1FBVA 1DEKA 1J7PA 3S0EA 3O4XA 1MHOA 4OZDA 4PE0A 2QACA 1G4YR 2KGBC 3GK1A 1OOFA 1WLZA 1S6CA 3FIAA 1TUZA 2NXQA 3OP0A 3F45A 2KBIA 1QATA 5D7FA 3DXLA 2HPSA 3GK2A 2PALA 3SG2A 1QASA 3D73A 1XFWO 3EKJA 3NSLA 1SR6C 2WCJA 3EK7A 1D1OA 1J7QA 1FI5A 2OPOA 2LP3A 1GM0A 5K89A 2LLTA 3CZ1A 1CFFA 1TNWA 1UWOA 2WC8A 1EG3A 2KI6C 1SSEB 2LHLA 2CCMA 2HF5A 3EVRA 3JTDC 4OVNF 1NCXA 4YGDB 1B4CA 1YX7A 1MR8A 3PM8A 1SYMA 1LINA 1DC1A 1CLLA 2D8NA 1CDMA 2K0JA 4C0KA 2EGDA 2PYQA 4A4CA 3DY9A 1T14A 2QEOA 2WCMA 1IQ3A 3RM1A 1J1EA 3DVJA 1W9ZA 1TWOA 2LMUA 2LNKA 4MZKA 3TDUA 1ZFSA 1W7IB 2MHHA 5G08A 2QEHA 3A8RA 1NCZA 1A29A 2I7AA 4YRUA 5KSZA 1K2HA 2A4JA 4GGFA 5CSFA 2K2AA 4INXA 1IQ5A 4ORCB 4F7FA 1SPYA 1IH0A 2GGMA 2QEVA 5AANA 1Y1UA 1YVHA 1K95A 2F2OA 2P71A 2WCFA 3WHUB 2SASA 4PE7A 3NXAA 3CWGA 3BFAA 3O78A 2DOQA 2K7BA 4FTGA 4XJKA 4C0JA 1QX5B 5HKYA 1SKTA 2KYFA 2L50A 3I5HB 3QRXA 4YI8A 3VROA 1TN4A 2LUXA 2Y5IA 5PALA 3TUYB 1DJXA 1CMFA 1XK4C 1P28A 2COLB 3BOWB 3BQ3A 1CNPA 1QVIZ 4TNCA 1K8UA 3PFVA 2LHIA 4QJ3B 2GGZA 2BBNA 4YBHB 1QIVA 3WXAA 2WNDA 3SS4A 2LC5A 1KQMC 5JOLA 3CDNA 2H2KA 1JFJA 3AAJA 1MXEA 1EJ3A 5DKQA 1PRWA 3I5GC 2E6WA 2H8VA 2JXLA 2M0RA 2F3YA 2KQYA 3DD4A 3GOFA 2GTEA 1ODBA 2MLEC 3D77A 3ZWHA 2I18A 2LANA 2KNEA 1XK4A 2KAVA 4I5LB 2MBXA 2BL0C 2R2IA 3NSIA 2MA2A 2WOSA 2M29A 2M1KB 4MZLA 2LLSA 3HCMA 1AK8A 1YUSA 4FQOA 2F2PA 4M2OA 1BODA 1BU3A 2FCDA 3C1VA 3S0AA 2BE4A 3CR5X 3S0GA 3HX4A 2BECA 4OV2A 2JZIA 1S36A 3IVTA 2JU0A 2F8PA 4OCIA 2PMYA 1YUTA 1LVCD 1R2UA 3MSEB 3SIBA 1Y6WA 1RROA 1CKKA 2ZRSA 1B7TZ 1CFDA 2CBLA 1N65A 3FE9A 4I5KA 1QIWA 4JQ0D 1WRLA 2BKIB 1WRZA 1DQEA 2JNFA 1V1FA 2B1UA 2K60A 2M97A 3PJIA 3SG5A 1IKUA 2L0PA 2KYCA 3CYZA 2WCHA 3VRNA 3I5IB 3PSRA 4JKTA 1X02A 1NSHA 4U8DA 1Z2CB 1QJTA 3BUNB 1S5GZ 5HKWA 1BF5A 1N0YA 2MJWB 3EK8A 3PM2A 3VRPA 1QWVA 1XA5A 2BCXA 2JT3A 2ZKMX 4GUKA 1DMOA 4XJKB 1A75B 4XYNA 1OOIX 2JULA 1DVIA 1U5IA 5ER5A 2NCOA 2ISDA 2E30A 2P70A 1W7JB 1WDCC 4DCKA 1F8HA 2MRDA 1DJZA 1PVBA 3B7AA 1K93D 1YRUB 2MLFC 1J55A
chains in the Genus database with same CATH topology
4CIDA 4L9MA 3LL8B 1QXPA 1DJGA 1JF2A 1DGVA 3OX5A 2BCAA 4UPGA 3TZ1A 1TRFA 1QX7A 1DT7B 1ZUZA 1KWOB 4DIRA 3TS5C 1S3PA 1DF0A 2OTGC 2JQ6A 2JNXA 3PN7C 2VRGA 1SCMB 4PCWA 4PHJA 5HKZA 4HRGA 3FWBA 1B8LA 4P2YB 2ZN8A 4YGEB 1TNQA 2V53A 1S1EA 1AVSA 1A2XA 3KF9A 5AFPA 1UURA 1J7RA 1DGUA 1Y1AA 3IQQA 1EG4A 1GGWA 2K7DA 3K21A 1K90D 4WQ2A 1Q80A 1XFXO 1SCVA 1UHJA 3CR4X 5DKNA 1NP8A 1CTRA 1K96A 4AOMA 2M9GA 2PASA 3LK1A 1G8IA 4CPVA 1B47A 2CTNA 1MQ1A 1YRTB 1KSMA 4MEWA 1NX1A 2KAYA 4F0ZB 1F54A 4AQJA 1JF0A 5HLOA 1AP4A 2NCPA 1LXFC 1HQVA 2JWWA 1NPQA 2Y1NA 1NIWA 4MLWA 2L98A 1XFZO 2KSPA 1SBJA 1TNPA 1SK6D 4MRXA 1SL8A 1Y1XA 1LA0A 2L51A 2M7LA 2EC6C 2K2FA 3D10A 4I5NB 4M2QA 4GGNA 4PALA 3OHMB 2JTTA 5HKYA 2JT8A 3IQOA 1BOCA 3LK0A 1MUXA 3CR2A 2K7OA 2Y1MA 3SJSA 5B8IB 3IF7A 4PHKA 5CSJA 3CTNA 2KGRA 2L5XB 2KI4B 2LM5A 1CMGA 1M46A 3OX6A 5HLVA 4ZCVA 1UHNA 1DTLA 2G2BA 2L4HA 2BE6A 2M3WA 3SIAA 5AEQA 4MVFA 1F70A 3EKHA 1IRJA 2CT9A 1MF8B 1NCYA 2LMTA 3TDZA 1DJIA 2LAPA 5KU1A 1KK8B 3GK4X 1IGVA 4GFTA 3I5GB 4PE1A 5AXIA 1B8CA 1B7TY 2LV7A 2BCBA 1KFUS 2K8MB 3CLNA 1SRAA 2JC2A 2KAXA 2EHBA 1BJFA 3FWCA 1XFVO 4Q04A 2TN4A 3ZNIA 3PLFB 3O2PA 1QLSA 1JUOA 1RECA 5I2OA 5I2QA 1FPWA 1S6IA 3NSOA 4ORBB 2RGIA 1TTXA 1DJWA 1OE9B 1PK0D 3BUWB 1QX2A 2L2EA 3BUOB 2KI6D 1CDLA 3DVEA 3I5FC 1TOPA 3JVTC 4N5XA 1SNLA 1MWNA 1KFXL 1M63B 3NSKA 1UHKA 1OQPA 1KK7Z 1OMDA 5CPVA 1B9AA 1K9KA 1UUSA 1QV1A 2KOTA 3AKAA 3OB1B 2M7NA 4GBAA 5KTYA 3BYAA 2F3ZA 2HQWA 3O6BA 1GGZA 1JWDA 1L2OC 1ZMZA 3KPXA 3TDIA 5ER4X 4CFRA 1VRKA 1BT6A 1DJYA 1ZOTB 1RJVA 1IJ6A 2HQ8A 4YGAA 1R6PA 3DF0B 5D69A 1YUUA 1OSAA 1XO5A 2OS8C 5I8NA 1IJ5A 4MBEA 1PSBA 3CS1A 3FS7A 2I94A 1RWYA 1QVIY 2KFHA 4BY4A 1FW4A 2CNPA 2L4IA 1QS7A 2G9BA 3PATA 3KO0A 3DVKA 1U5IB 3JTDB 1PVAA 5FYXA 2BL0B 2Q91A 1A4PA 4BY5A 1RK9A 3VRRA 1CM1A 2FCEA 2LVKA 1QTXA 3D0YB 4NQGA 2KHNA 1IWQA 1WLMA 1WY9A 2ZFDA 3BUXB 1ALWA 1NX2A 2P6BB 1C7WA 1YR5A 2BBMA 4AQIA 1EH2A 3EVUA 1TIZA 2HETA 1QV0A 4YGBB 1NX0A 4P5OE 4M2PA 2IS9A 1KWOC 4I5JA 1IG5A 1ZACA 1XFUO 1EL4A 2O60A 4MSPA 2LP2A 5TNCA 1XFYO 2AAOA 1BR1B 1LKJA 2OTGB 1UP5A 2JXCA 1F55A 3PN7B 1OMRA 3PALA 4PDZA 3AKBA 2JTZA 3WNXB 2WCEA 5F6TA 1SR6B 1CDNA 4ORAB 3KEVA 4A4BA 2SCPA 1A03A 1F4OA 1YVLA 3TUYC 2LUCA 1RFJA 1WDCB 2JRFA 1CFCA 1EXRA 4JPZB 1GJYA 1CLBA 1MXLC 2ZNEA 2I2RE 4YGCB 1S5GY 2KFGA 2KBMA 1PALA 1SL9A 4R1EA 4MZJA 1YTZC 3AAKA 1NYAA 4DUQA 5GQQC 2LVIA 1KK7Y 4MRYA 1CM4A 4PE4A 2LVJA 1M45A 3LCPC 1OZOA 1KQVA 1CLMA 1SMGA 1B1GA 4QJ4B 3TS5B 1J7OA 2CXJA 1BR4B 2Y4QA 1JFKA 2KQ6A 1KFXS 1DJHA 3VGOA 4WQ3A 2F33A 1CFPA 4CFQA 1SW8A 2LCPA 1QLKA 1UHHA 3ICBA 5J3XA 5DKRA 1TCOB 1YURA 5BPJA 2ZNDA 4MN0A 2M1UA 2M49B 1DF0B 3I5HC 3A4UB 5I2LA 2JPTA 2NLNA 1B8RA 1WRKA 2ZN9A 1F71A 1KCYA 1N2DA 3OB2B 4N1FA 3BOWA 2WORA 2AMIA 2ZRTA 3SG7A 3CGAA 1SY9A 1TCFA 1NX3A 1SL7A 2FJUB 1L7ZA 2K61A 4D1EA 1BLQA 1KK8C 2AUCA 1TNXA 1G33A 2MAZA 4GPLB 3SG4A 4JWQA 1K9UA 1AUIB 3DVMA 1JBAA 1KQMB 1E8AA 1Y0VH 1C07A 4NDCA 1GQMA 4GGFC 4DS7A 1H4BA 2H61A 4NDDA 2O5GA 1BMOA 1S26D 1S6JA 2PVBA 1XVJA 1OOJA 1NWDA 5JJGA 2NZ0A 2QPTA 4ETOA 1J1DA 4N1GA 1FI6A 2Q4UA 1PSRA 4OR9B 4PHMA 4CLNA 1BG1A 3KHEA 1A75A 1JC2A 4HREE 1K9PA 1UHIA 3CZTX 4OKHA 4GNKB 2EC6B 3RLZA 3DF0A 1ALVA 1CB1A 3I5FB 1C7VA 2LLUA 2M8UA 4ZCUA 3BXKA 3SG6A 4HRHA 2KI4C 2JOJA 2WCBA 2PRUA 3EVVA 1OZSA 4PHNA 4WRIA 1L2OB 4USLA 1AJ5A 1PULA 2GV5A 2K7CA 2KDHA 4HSZA 4E68A 5CSNA 2JT0A 3VRQA 1K94A 4YI9A 1NUBA 1V1GA 3H4SE 1M39A 2LMVA 1H8BA 2BKHB 2OS8B 1KFUL 3SG3A 4IL1A 3EK4A 1SCMC 2H61C 3M0WA 4C0LA 1XYDA 4DRWA 3BUMB 1LA3A 3E3RA 3I5IC 1M31A 2FOTA 1OMVA 3WHTB 5CSIA 2KFFA 4QJ5B 1F4QA 4ICBA 1FF1A 1YX8A 1AJ4A 1JSAA 2LVVA 1CDPA 2LE9B 3O4YA 1RTP1 1AHRA 3LLEA 3D0YA 1HT9A 1KSOA 4NDBA 5AERA 2PSRA 5HYDA 3JVTB 5IBWA 4GAOA 1FBVA 1J7PA 1MHOA 4PE0A 2QACA 1G4YR 2KGBC 3GK1A 1WLZA 1S6CA 3FIAA 2NXQA 3OP0A 3F45A 2KBIA 1QATA 5D7FA 3GK2A 2HPSA 2PALA 3SG2A 1QASA 1XFWO 3EKJA 3NSLA 1SR6C 3EK7A 1D1OA 1J7QA 1FI5A 2OPOA 2LP3A 5K89A 2LLTA 1CFFA 1TNWA 1UWOA 2WC8A 1EG3A 2KI6C 4YGDB 2LHLA 2CCMA 2HF5A 3EVRA 3JTDC 4OVNF 1NCXA 1B4CA 1YX7A 1MR8A 3PM8A 1SYMA 1LINA 1CLLA 2D8NA 1CDMA 2K0JA 4C0KA 2EGDA 4A4CA 1IQ3A 3RM1A 1J1EA 3DVJA 2LMUA 2LNKA 4MZKA 3TDUA 1ZFSA 1W7IB 2MHHA 5G08A 3A8RA 1NCZA 1A29A 2I7AA 4YRUA 5KSZA 1K2HA 2A4JA 4GGFA 5CSFA 2K2AA 1IQ5A 4ORCB 1SPYA 1IH0A 2GGMA 5AANA 1Y1UA 1YVHA 1K95A 2F2OA 2WCFA 3WHUB 2SASA 4PE7A 3NXAA 3CWGA 3O78A 2DOQA 2K7BA 4FTGA 4XJKA 4C0JA 1QX5B 1SKTA 2KYFA 2L50A 3I5HB 3QRXA 4YI8A 3VROA 1TN4A 2LUXA 2Y5IA 5PALA 3TUYB 1DJXA 1CMFA 1XK4C 2COLB 3BOWB 3BQ3A 1CNPA 1QVIZ 4TNCA 1K8UA 3PFVA 2LHIA 4QJ3B 2GGZA 2BBNA 4YBHB 1QIVA 3WXAA 2WNDA 2LC5A 1KQMC 5JOLA 2H2KA 1JFJA 3AAJA 1MXEA 1EJ3A 5DKQA 1PRWA 3I5GC 2E6WA 2JXLA 2M0RA 2F3YA 2KQYA 3DD4A 3GOFA 3ZWHA 1ODBA 2MLEC 2I18A 2LANA 2KNEA 1XK4A 2KAVA 4I5LB 2MBXA 2BL0C 2R2IA 3NSIA 2MA2A 2WOSA 2M29A 2M1KB 4MZLA 2LLSA 3HCMA 1AK8A 1YUSA 4FQOA 2F2PA 4M2OA 1BODA 1BU3A 2FCDA 3C1VA 2BE4A 3CR5X 3HX4A 2BECA 4OV2A 2JZIA 1S36A 2JU0A 2F8PA 4OCIA 2PMYA 1YUTA 1LVCD 1R2UA 3MSEB 3SIBA 1Y6WA 1RROA 1CKKA 2ZRSA 1B7TZ 1CFDA 2CBLA 1N65A 4I5KA 1QIWA 4JQ0D 1WRLA 2BKIB 1WRZA 2JNFA 1V1FA 2B1UA 2M97A 3SG5A 1IKUA 2L0PA 2KYCA 3VRNA 3I5IB 3PSRA 1X02A 1NSHA 4U8DA 1BF5A 1QJTA 3BUNB 1S5GZ 5HKWA 1N0YA 2MJWB 3EK8A 3VRPA 1DMOA 1XA5A 2BCXA 2JT3A 2ZKMX 4GUKA 4XJKB 1A75B 4XYNA 2JULA 1DVIA 1U5IA 5ER5A 2NCOA 2ISDA 2E30A 1W7JB 1WDCC 4DCKA 1F8HA 2MRDA 1DJZA 1PVBA 1K93D 1YRUB 2MLFC 1J55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CID A;  4L9M A;  3LL8 B;  1QXP A;  1DJG A;  1JF2 A;  1DGV A;  3OX5 A;  2BCA A;  4UPG A;  3TZ1 A;  1TRF A;  1QX7 A;  1DT7 B;  1ZUZ A;  1KWO B;  4DIR A;  3TS5 C;  1S3P A;  1DF0 A;  2OTG C;  2JQ6 A;  2JNX A;  3PN7 C;  2VRG A;  1SCM B;  4PCW A;  4PHJ A;  5HKZ A;  4HRG A;  3FWB A;  1B8L A;  4P2Y B;  2ZN8 A;  4YGE B;  1TNQ A;  2V53 A;  1S1E A;  1AVS A;  1A2X A;  3KF9 A;  5AFP A;  1UUR A;  1J7R A;  1DGU A;  1Y1A A;  3IQQ A;  1EG4 A;  1GGW A;  2K7D A;  3K21 A;  1K90 D;  4WQ2 A;  1Q80 A;  1XFX O;  1SCV A;  1UHJ A;  3CR4 X;  5DKN A;  1NP8 A;  1CTR A;  1K96 A;  4AOM A;  2M9G A;  2PAS A;  3LK1 A;  1G8I A;  4CPV A;  1B47 A;  2CTN A;  1MQ1 A;  1YRT B;  1KSM A;  4MEW A;  1NX1 A;  2KAY A;  4F0Z B;  1F54 A;  4AQJ A;  1JF0 A;  5HLO A;  1AP4 A;  2NCP A;  1LXF C;  1HQV A;  2JWW A;  1NPQ A;  2Y1N A;  1NIW A;  4MLW A;  2L98 A;  1XFZ O;  2KSP A;  1SBJ A;  1TNP A;  1SK6 D;  4MRX A;  1SL8 A;  1Y1X A;  1LA0 A;  2L51 A;  2M7L A;  2EC6 C;  2K2F A;  3D10 A;  4I5N B;  4M2Q A;  4GGN A;  4PAL A;  3OHM B;  2JTT A;  5HKY A;  2JT8 A;  3IQO A;  1BOC A;  3LK0 A;  1MUX A;  3CR2 A;  2K7O A;  2Y1M A;  3SJS A;  5B8I B;  3IF7 A;  4PHK A;  5CSJ A;  3CTN A;  2KGR A;  2L5X B;  2KI4 B;  2LM5 A;  1CMG A;  1M46 A;  3OX6 A;  5HLV A;  4ZCV A;  1UHN A;  1DTL A;  2G2B A;  2L4H A;  2BE6 A;  2M3W A;  3SIA A;  5AEQ A;  4MVF A;  1F70 A;  3EKH A;  1IRJ A;  2CT9 A;  1MF8 B;  1NCY A;  2LMT A;  3TDZ A;  1DJI A;  2LAP A;  5KU1 A;  1KK8 B;  3GK4 X;  1IGV A;  4GFT A;  3I5G B;  4PE1 A;  5AXI A;  1B8C A;  1B7T Y;  2LV7 A;  2BCB A;  1KFU S;  2K8M B;  3CLN A;  1SRA A;  2JC2 A;  2KAX A;  2EHB A;  1BJF A;  3FWC A;  1XFV O;  4Q04 A;  2TN4 A;  3ZNI A;  3PLF B;  3O2P A;  1QLS A;  1JUO A;  1REC A;  5I2O A;  5I2Q A;  1FPW A;  1S6I A;  3NSO A;  4ORB B;  2RGI A;  1TTX A;  1DJW A;  1OE9 B;  1PK0 D;  3BUW B;  1QX2 A;  2L2E A;  3BUO B;  2KI6 D;  1CDL A;  3DVE A;  3I5F C;  1TOP A;  3JVT C;  4N5X A;  1SNL A;  1MWN A;  1KFX L;  1M63 B;  3NSK A;  1UHK A;  1OQP A;  1KK7 Z;  1OMD A;  5CPV A;  1B9A A;  1K9K A;  1UUS A;  1QV1 A;  2KOT A;  3AKA A;  3OB1 B;  2M7N A;  4GBA A;  5KTY A;  3BYA A;  2F3Z A;  2HQW A;  3O6B A;  1GGZ A;  1JWD A;  1L2O C;  1ZMZ A;  3KPX A;  3TDI A;  5ER4 X;  4CFR A;  1VRK A;  1BT6 A;  1DJY A;  1ZOT B;  1RJV A;  1IJ6 A;  2HQ8 A;  4YGA A;  1R6P A;  3DF0 B;  5D69 A;  1YUU A;  1OSA A;  1XO5 A;  2OS8 C;  5I8N A;  1IJ5 A;  4MBE A;  1PSB A;  3CS1 A;  3FS7 A;  2I94 A;  1RWY A;  1QVI Y;  2KFH A;  4BY4 A;  1FW4 A;  2CNP A;  2L4I A;  1QS7 A;  2G9B A;  3PAT A;  3KO0 A;  3DVK A;  1U5I B;  3JTD B;  1PVA A;  5FYX A;  2BL0 B;  2Q91 A;  1A4P A;  4BY5 A;  1RK9 A;  3VRR A;  1CM1 A;  2FCE A;  2LVK A;  1QTX A;  3D0Y B;  4NQG A;  2KHN A;  1IWQ A;  1WLM A;  1WY9 A;  2ZFD A;  3BUX B;  1ALW A;  1NX2 A;  2P6B B;  1C7W A;  1YR5 A;  2BBM A;  4AQI A;  1EH2 A;  3EVU A;  1TIZ A;  2HET A;  1QV0 A;  4YGB B;  1NX0 A;  4P5O E;  4M2P A;  2IS9 A;  1KWO C;  4I5J A;  1IG5 A;  1ZAC A;  1XFU O;  1EL4 A;  2O60 A;  4MSP A;  2LP2 A;  5TNC A;  1XFY O;  2AAO A;  1BR1 B;  1LKJ A;  2OTG B;  1UP5 A;  2JXC A;  1F55 A;  3PN7 B;  1OMR A;  3PAL A;  4PDZ A;  3AKB A;  2JTZ A;  3WNX B;  2WCE A;  5F6T A;  1SR6 B;  1CDN A;  4ORA B;  3KEV A;  4A4B A;  2SCP A;  1A03 A;  1F4O A;  1YVL A;  3TUY C;  2LUC A;  1RFJ A;  1WDC B;  2JRF A;  1CFC A;  1EXR A;  4JPZ B;  1GJY A;  1CLB A;  1MXL C;  2ZNE A;  2I2R E;  4YGC B;  1S5G Y;  2KFG A;  2KBM A;  1PAL A;  1SL9 A;  4R1E A;  4MZJ A;  1YTZ C;  3AAK A;  1NYA A;  4DUQ A;  5GQQ C;  2LVI A;  1KK7 Y;  4MRY A;  1CM4 A;  4PE4 A;  2LVJ A;  1M45 A;  3LCP C;  1OZO A;  1KQV A;  1CLM A;  1SMG A;  1B1G A;  4QJ4 B;  3TS5 B;  1J7O A;  2CXJ A;  1BR4 B;  2Y4Q A;  1JFK A;  2KQ6 A;  1KFX S;  1DJH A;  3VGO A;  4WQ3 A;  2F33 A;  1CFP A;  4CFQ A;  1SW8 A;  2LCP A;  1QLK A;  1UHH A;  3ICB A;  5J3X A;  5DKR A;  1TCO B;  1YUR A;  5BPJ A;  2ZND A;  4MN0 A;  2M1U A;  2M49 B;  1DF0 B;  3I5H C;  3A4U B;  5I2L A;  2JPT A;  2NLN A;  1B8R A;  1WRK A;  2ZN9 A;  1F71 A;  1KCY A;  1N2D A;  3OB2 B;  4N1F A;  3BOW A;  2WOR A;  2AMI A;  2ZRT A;  3SG7 A;  3CGA A;  1SY9 A;  1TCF A;  1NX3 A;  1SL7 A;  2FJU B;  1L7Z A;  2K61 A;  4D1E A;  1BLQ A;  1KK8 C;  2AUC A;  1TNX A;  1G33 A;  2MAZ A;  4GPL B;  3SG4 A;  4JWQ A;  1K9U A;  1AUI B;  3DVM A;  1JBA A;  1KQM B;  1E8A A;  1Y0V H;  1C07 A;  4NDC A;  1GQM A;  4GGF C;  4DS7 A;  1H4B A;  2H61 A;  4NDD A;  2O5G A;  1BMO A;  1S26 D;  1S6J A;  2PVB A;  1XVJ A;  1OOJ A;  1NWD A;  5JJG A;  2NZ0 A;  2QPT A;  4ETO A;  1J1D A;  4N1G A;  1FI6 A;  2Q4U A;  1PSR A;  4OR9 B;  4PHM A;  4CLN A;  1BG1 A;  3KHE A;  1A75 A;  1JC2 A;  4HRE E;  1K9P A;  1UHI A;  3CZT X;  4OKH A;  4GNK B;  2EC6 B;  3RLZ A;  3DF0 A;  1ALV A;  1CB1 A;  3I5F B;  1C7V A;  2LLU A;  2M8U A;  4ZCU A;  3BXK A;  3SG6 A;  4HRH A;  2KI4 C;  2JOJ A;  2WCB A;  2PRU A;  3EVV A;  1OZS A;  4PHN A;  4WRI A;  1L2O B;  4USL A;  1AJ5 A;  1PUL A;  2GV5 A;  2K7C A;  2KDH A;  4HSZ A;  4E68 A;  5CSN A;  2JT0 A;  3VRQ A;  1K94 A;  4YI9 A;  1NUB A;  1V1G A;  3H4S E;  1M39 A;  2LMV A;  1H8B A;  2BKH B;  2OS8 B;  1KFU L;  3SG3 A;  4IL1 A;  3EK4 A;  1SCM C;  2H61 C;  3M0W A;  4C0L A;  1XYD A;  4DRW A;  3BUM B;  1LA3 A;  3E3R A;  3I5I C;  1M31 A;  2FOT A;  1OMV A;  3WHT B;  5CSI A;  2KFF A;  4QJ5 B;  1F4Q A;  4ICB A;  1FF1 A;  1YX8 A;  1AJ4 A;  1JSA A;  2LVV A;  1CDP A;  2LE9 B;  3O4Y A;  1RTP 1;  1AHR A;  3LLE A;  3D0Y A;  1HT9 A;  1KSO A;  4NDB A;  5AER A;  2PSR A;  5HYD A;  3JVT B;  5IBW A;  4GAO A;  1FBV A;  1J7P A;  1MHO A;  4PE0 A;  2QAC A;  1G4Y R;  2KGB C;  3GK1 A;  1WLZ A;  1S6C A;  3FIA A;  2NXQ A;  3OP0 A;  3F45 A;  2KBI A;  1QAT A;  5D7F A;  3GK2 A;  2HPS A;  2PAL A;  3SG2 A;  1QAS A;  1XFW O;  3EKJ A;  3NSL A;  1SR6 C;  3EK7 A;  1D1O A;  1J7Q A;  1FI5 A;  2OPO A;  2LP3 A;  5K89 A;  2LLT A;  1CFF A;  1TNW A;  1UWO A;  2WC8 A;  1EG3 A;  2KI6 C;  4YGD B;  2LHL A;  2CCM A;  2HF5 A;  3EVR A;  3JTD C;  4OVN F;  1NCX A;  1B4C A;  1YX7 A;  1MR8 A;  3PM8 A;  1SYM A;  1LIN A;  1CLL A;  2D8N A;  1CDM A;  2K0J A;  4C0K A;  2EGD A;  4A4C A;  1IQ3 A;  3RM1 A;  1J1E A;  3DVJ A;  2LMU A;  2LNK A;  4MZK A;  3TDU A;  1ZFS A;  1W7I B;  2MHH A;  5G08 A;  3A8R A;  1NCZ A;  1A29 A;  2I7A A;  4YRU A;  5KSZ A;  1K2H A;  2A4J A;  4GGF A;  5CSF A;  2K2A A;  1IQ5 A;  4ORC B;  1SPY A;  1IH0 A;  2GGM A;  5AAN A;  1Y1U A;  1YVH A;  1K95 A;  2F2O A;  2WCF A;  3WHU B;  2SAS A;  4PE7 A;  3NXA A;  3CWG A;  3O78 A;  2DOQ A;  2K7B A;  4FTG A;  4XJK A;  4C0J A;  1QX5 B;  1SKT A;  2KYF A;  2L50 A;  3I5H B;  3QRX A;  4YI8 A;  3VRO A;  1TN4 A;  2LUX A;  2Y5I A;  5PAL A;  3TUY B;  1DJX A;  1CMF A;  1XK4 C;  2COL B;  3BOW B;  3BQ3 A;  1CNP A;  1QVI Z;  4TNC A;  1K8U A;  3PFV A;  2LHI A;  4QJ3 B;  2GGZ A;  2BBN A;  4YBH B;  1QIV A;  3WXA A;  2WND A;  2LC5 A;  1KQM C;  5JOL A;  2H2K A;  1JFJ A;  3AAJ A;  1MXE A;  1EJ3 A;  5DKQ A;  1PRW A;  3I5G C;  2E6W A;  2JXL A;  2M0R A;  2F3Y A;  2KQY A;  3DD4 A;  3GOF A;  3ZWH A;  1ODB A;  2MLE C;  2I18 A;  2LAN A;  2KNE A;  1XK4 A;  2KAV A;  4I5L B;  2MBX A;  2BL0 C;  2R2I A;  3NSI A;  2MA2 A;  2WOS A;  2M29 A;  2M1K B;  4MZL A;  2LLS A;  3HCM A;  1AK8 A;  1YUS A;  4FQO A;  2F2P A;  4M2O A;  1BOD A;  1BU3 A;  2FCD A;  3C1V A;  2BE4 A;  3CR5 X;  3HX4 A;  2BEC A;  4OV2 A;  2JZI A;  1S36 A;  2JU0 A;  2F8P A;  4OCI A;  2PMY A;  1YUT A;  1LVC D;  1R2U A;  3MSE B;  3SIB A;  1Y6W A;  1RRO A;  1CKK A;  2ZRS A;  1B7T Z;  1CFD A;  2CBL A;  1N65 A;  4I5K A;  1QIW A;  4JQ0 D;  1WRL A;  2BKI B;  1WRZ A;  2JNF A;  1V1F A;  2B1U A;  2M97 A;  3SG5 A;  1IKU A;  2L0P A;  2KYC A;  3VRN A;  3I5I B;  3PSR A;  1X02 A;  1NSH A;  4U8D A;  1BF5 A;  1QJT A;  3BUN B;  1S5G Z;  5HKW A;  1N0Y A;  2MJW B;  3EK8 A;  3VRP A;  1DMO A;  1XA5 A;  2BCX A;  2JT3 A;  2ZKM X;  4GUK A;  4XJK B;  1A75 B;  4XYN A;  2JUL A;  1DVI A;  1U5I A;  5ER5 A;  2NCO A;  2ISD A;  2E30 A;  1W7J B;  1WDC C;  4DCK A;  1F8H A;  2MRD A;  1DJZ A;  1PVB A;  1K93 D;  1YRU B;  2MLF C;  1J55 A; 
#chains in the Genus database with same CATH topology
 4CID A;  3S0D A;  4L9M A;  3LL8 B;  1QXP A;  3OBV A;  3S0F A;  1DJG A;  1JF2 A;  1DGV A;  3OX5 A;  2BCA A;  4UPG A;  3TZ1 A;  1TRF A;  1QX7 A;  2L2C A;  1DT7 B;  1ZUZ A;  1KWO B;  4DIR A;  3TS5 C;  1S3P A;  2WC5 A;  1DF0 A;  2OTG C;  2JQ6 A;  2JNX A;  2PQL A;  4FQT A;  3PN7 C;  2VRG A;  1SCM B;  4PCW A;  4PHJ A;  5HKZ A;  4HRG A;  3FWB A;  1B8L A;  4P2Y B;  2ZN8 A;  4YGE B;  2KLD A;  1TNQ A;  2V53 A;  1S1E A;  5EL2 A;  1AVS A;  1A2X A;  3KF9 A;  5AFP A;  1UUR A;  3R1P A;  1J7R A;  1DGU A;  1Y1A A;  3IQQ A;  1EG4 A;  1GGW A;  5FI6 A;  5D3O A;  2K7D A;  3K21 A;  1K90 D;  4WQ2 A;  1Q80 A;  1XFX O;  1SCV A;  1UHJ A;  3CR4 X;  5DKN A;  1NP8 A;  1TUJ A;  2QEB A;  1CTR A;  3QME A;  1K96 A;  4AOM A;  2M9G A;  2PAS A;  3LK1 A;  1G8I A;  4CPV A;  1B47 A;  2CTN A;  1MQ1 A;  1YRT B;  1KSM A;  2QDI A;  1NX1 A;  2KAY A;  3K1E A;  4MEW A;  4AQJ A;  1JF0 A;  5HLO A;  1AP4 A;  2NCP A;  1LXF C;  1HQV A;  2JWW A;  1NPQ A;  2Y1N A;  1NIW A;  3D75 A;  4MLW A;  2L98 A;  1XFZ O;  2KSP A;  3V2L A;  1SBJ A;  1TNP A;  1SK6 D;  4MRX A;  1SL8 A;  1Y1X A;  5I94 A;  1LA0 A;  2L51 A;  2M7L A;  2EC6 C;  2K2F A;  3D10 A;  4I5N B;  4M2Q A;  4GGN A;  4PAL A;  3OHM B;  2JTT A;  3VB1 A;  2JT8 A;  3IQO A;  1BOC A;  3LK0 A;  1MUX A;  3CR2 A;  2K7O A;  2Y1M A;  3SJS A;  5B8I B;  3IF7 A;  4PHK A;  5CSJ A;  3CTN A;  2KGR A;  2L5X B;  2KI4 B;  2KPH A;  2LM5 A;  1M46 A;  3OX6 A;  5HLV A;  3B6X A;  2L5Y A;  4ZCV A;  1CMG A;  1UHN A;  1DTL A;  2G2B A;  2L4H A;  2BE6 A;  2M3W A;  3SIA A;  5AEQ A;  4MVF A;  1F70 A;  3EKH A;  1IRJ A;  3S0B A;  2CT9 A;  3Q8I A;  1MF8 B;  1NCY A;  2LMT A;  3TDZ A;  1DJI A;  2LAP A;  4PT1 A;  5KU1 A;  1KK8 B;  3GK4 X;  1IGV A;  4GFT A;  3I5G B;  4PE1 A;  5AXI A;  1B8C A;  1B7T Y;  2LV7 A;  2BCB A;  3DYE A;  1KFU S;  2K8M B;  3CLN A;  1SRA A;  2JC2 A;  2KAX A;  2EHB A;  1BJF A;  3B86 A;  3FWC A;  1LS8 A;  1XFV O;  4Q04 A;  2TN4 A;  3ZNI A;  3PLF B;  3O2P A;  1QLS A;  1JUO A;  1REC A;  5I2O A;  5I2Q A;  1FPW A;  3R1O A;  1S6I A;  3NSO A;  4ORB B;  2RGI A;  1TTX A;  1DJW A;  3R1V A;  1OE9 B;  3UO9 A;  1PK0 D;  2WCL A;  3BUW B;  1QX2 A;  2L2E A;  3BUO B;  2KI6 D;  1CDL A;  3DVE A;  3I5F C;  1TOP A;  3JVT C;  4N5X A;  1SNL A;  1MWN A;  1KFX L;  1M63 B;  3NSK A;  5DIC A;  1UHK A;  1OQP A;  1KK7 Z;  1OMD A;  5CPV A;  1B9A A;  1K9K A;  1UUS A;  1QV1 A;  2KOT A;  3AKA A;  3OB1 B;  2M7N A;  4GBA A;  5KTY A;  3BYA A;  2F3Z A;  2HQW A;  3O6B A;  5FI7 A;  1GGZ A;  1JWD A;  1L2O C;  1ZMZ A;  3KPX A;  3TDI A;  5ER4 X;  4CFR A;  1VRK A;  1BT6 A;  5FI2 A;  5HL1 A;  1OW4 A;  1DJY A;  3RZS A;  1ZOT B;  1RJV A;  1IJ6 A;  2HQ8 A;  4YGA A;  1R6P A;  3DF0 B;  5D69 A;  1YUU A;  1OSA A;  3BFB A;  1XO5 A;  2OS8 C;  5I8N A;  1IJ5 A;  4MBE A;  1PSB A;  3CS1 A;  3FS7 A;  2I94 A;  1RWY A;  1QVI Y;  2KFH A;  4BY4 A;  1FW4 A;  2CNP A;  1DEL A;  2L4I A;  1QS7 A;  2G9B A;  3PAT A;  3KO0 A;  3DVK A;  1U5I B;  3JTD B;  1PVA A;  5FYX A;  2BL0 B;  2Q91 A;  1A4P A;  3D78 A;  3SS5 A;  1RK9 A;  2BNX A;  4BY5 A;  3VRR A;  1CM1 A;  1Z4H A;  2FCE A;  2LVK A;  1QTX A;  3D0Y B;  3D76 A;  2KHN A;  4NQG A;  2KLE A;  1IWQ A;  1WLM A;  1WY9 A;  2ZFD A;  3BUX B;  1ALW A;  3CZ2 A;  1NX2 A;  2P6B B;  4F0Z B;  1C7W A;  1YR5 A;  2BBM A;  4AQI A;  1EH2 A;  3EVU A;  1TIZ A;  2HET A;  1QV0 A;  3DZT A;  4YGB B;  1NX0 A;  4P5O E;  4M2P A;  2IS9 A;  1KWO C;  4I5J A;  1IG5 A;  1ZAC A;  3UNW A;  2JPO A;  1XFU O;  1EL4 A;  2O60 A;  4MSP A;  2LP2 A;  5TNC A;  1XFY O;  2AAO A;  1BR1 B;  1LKJ A;  2OTG B;  1F54 A;  1UP5 A;  2JXC A;  1F55 A;  3PN7 B;  1C3Z A;  1OMR A;  3PAL A;  4PDZ A;  3AKB A;  2JTZ A;  3WNX B;  2WCE A;  5F6T A;  1SR6 B;  1CDN A;  4ORA B;  3KEV A;  4A4B A;  3NHI A;  2SCP A;  1A03 A;  3D74 A;  1F4O A;  1YVL A;  3TUY C;  2LUC A;  1RFJ A;  1WDC B;  2JRF A;  1CFC A;  1EXR A;  4JPZ B;  1GJY A;  2FJY A;  1CLB A;  1MXL C;  2ZNE A;  2I2R E;  4YGC B;  1S5G Y;  3NGV A;  2KFG A;  2KBM A;  1PAL A;  2ERB A;  1SL9 A;  4R1E A;  4MZJ A;  1YTZ C;  3AAK A;  1NYA A;  4DUQ A;  5GQQ C;  2LVI A;  1KK7 Y;  4MRY A;  1CM4 A;  4PE4 A;  2LVJ A;  1M45 A;  3LCP C;  3OGN A;  1OZO A;  3NHT A;  1KQV A;  1CLM A;  1SMG A;  1XFR A;  4QJ4 B;  3TS5 B;  1B1G A;  1ORG A;  1BR4 B;  2CXJ A;  1J7O A;  2Y4Q A;  1JFK A;  2KQ6 A;  1KFX S;  1DJH A;  3VGO A;  4WQ3 A;  2F33 A;  1CFP A;  4CFQ A;  1SW8 A;  2LCP A;  1QLK A;  1UHH A;  3ICB A;  5J3X A;  3FE6 A;  5DKR A;  1TCO B;  3L47 A;  1YUR A;  5BPJ A;  2ZND A;  4MN0 A;  2M1U A;  3B88 A;  3L4L A;  2M49 B;  1DF0 B;  3I5H C;  3A4U B;  3CAB A;  5I2L A;  2JPT A;  2NLN A;  1B8R A;  1WRK A;  2ZN9 A;  1F71 A;  1KCY A;  1N2D A;  3OB2 B;  4N1F A;  3BOW A;  2WOR A;  2AMI A;  2ZRT A;  3SG7 A;  3CGA A;  1SY9 A;  1TCF A;  1NX3 A;  1SL7 A;  2FJU B;  1L7Z A;  2K61 A;  4D1E A;  1BLQ A;  1KK8 C;  2AUC A;  1TNX A;  1G33 A;  2MAZ A;  4GPL B;  3SG4 A;  1IIO A;  4JWQ A;  1K9U A;  1AUI B;  3DVM A;  1JBA A;  1KQM B;  3BFH A;  2WCK A;  1E8A A;  1Y0V H;  1C07 A;  4NDC A;  1GQM A;  4GGF C;  4DS7 A;  1H4B A;  2H61 A;  4JD9 A;  4NDD A;  2O5G A;  1BMO A;  1S26 D;  1S6J A;  2PVB A;  1XVJ A;  1OOJ A;  1NWD A;  5JJG A;  2NZ0 A;  2QPT A;  4ETO A;  1J1D A;  3FE8 A;  4N1G A;  1FI6 A;  1OOH A;  1PSR A;  2Q4U A;  4KYN A;  4OR9 B;  4PHM A;  3EG5 B;  4CLN A;  1BG1 A;  3KHE A;  1A75 A;  1JC2 A;  4HRE E;  1K9P A;  1UHI A;  3CZT X;  4OKH A;  4GNK B;  2EC6 B;  3RLZ A;  3DF0 A;  2BAP A;  1ALV A;  4IJ7 A;  1CB1 A;  3I5F B;  1C7V A;  3N7H A;  2LLU A;  2M8U A;  4ZCU A;  3BXK A;  3SG6 A;  4HRH A;  3B87 A;  2KI4 C;  2JOJ A;  2WCB A;  2PRU A;  3EVV A;  1OZS A;  4PHN A;  4WRI A;  1L2O B;  2WC6 A;  3SS3 A;  4USL A;  1AJ5 A;  1PUL A;  2GV5 A;  2K7C A;  2KDH A;  4HSZ A;  4INW A;  5CSN A;  4E68 A;  2JT0 A;  3VRQ A;  1K94 A;  4YI9 A;  1NUB A;  1V1G A;  3H4S E;  1M39 A;  2LMV A;  1H8B A;  2BKH B;  3CZ0 A;  2YGU A;  2OS8 B;  1KFU L;  3SG3 A;  4IL1 A;  3EK4 A;  3L4A A;  1SCM C;  2H61 C;  3M0W A;  3R72 A;  4C0L A;  1XYD A;  4DRW A;  3BUM B;  1LA3 A;  3E3R A;  3I5I C;  1C3Y A;  1OOG A;  1M31 A;  2FOT A;  1OMV A;  3BJH A;  3WHT B;  5CSI A;  2KFF A;  4QJ5 B;  1F4Q A;  4ICB A;  1FF1 A;  1YX8 A;  1AJ4 A;  1JSA A;  2LVV A;  1CDP A;  2LE9 B;  3O4Y A;  1RTP 1;  1AHR A;  3LLE A;  3D0Y A;  1HT9 A;  1KSO A;  4NDB A;  5AER A;  2PSR A;  5HYD A;  3JVT B;  5IBW A;  4GAO A;  1FBV A;  1DEK A;  1J7P A;  3S0E A;  3O4X A;  1MHO A;  4OZD A;  4PE0 A;  2QAC A;  1G4Y R;  2KGB C;  3GK1 A;  1OOF A;  1WLZ A;  1S6C A;  3FIA A;  1TUZ A;  2NXQ A;  3OP0 A;  3F45 A;  2KBI A;  1QAT A;  5D7F A;  3DXL A;  2HPS A;  3GK2 A;  2PAL A;  3SG2 A;  1QAS A;  3D73 A;  1XFW O;  3EKJ A;  3NSL A;  1SR6 C;  2WCJ A;  3EK7 A;  1D1O A;  1J7Q A;  1FI5 A;  2OPO A;  2LP3 A;  1GM0 A;  5K89 A;  2LLT A;  3CZ1 A;  1CFF A;  1TNW A;  1UWO A;  2WC8 A;  1EG3 A;  2KI6 C;  1SSE B;  2LHL A;  2CCM A;  2HF5 A;  3EVR A;  3JTD C;  4OVN F;  1NCX A;  4YGD B;  1B4C A;  1YX7 A;  1MR8 A;  3PM8 A;  1SYM A;  1LIN A;  1DC1 A;  1CLL A;  2D8N A;  1CDM A;  2K0J A;  4C0K A;  2EGD A;  2PYQ A;  4A4C A;  3DY9 A;  1T14 A;  2QEO A;  2WCM A;  1IQ3 A;  3RM1 A;  1J1E A;  3DVJ A;  1W9Z A;  1TWO A;  2LMU A;  2LNK A;  4MZK A;  3TDU A;  1ZFS A;  1W7I B;  2MHH A;  5G08 A;  2QEH A;  3A8R A;  1NCZ A;  1A29 A;  2I7A A;  4YRU A;  5KSZ A;  1K2H A;  2A4J A;  4GGF A;  5CSF A;  2K2A A;  4INX A;  1IQ5 A;  4ORC B;  4F7F A;  1SPY A;  1IH0 A;  2GGM A;  2QEV A;  5AAN A;  1Y1U A;  1YVH A;  1K95 A;  2F2O A;  2P71 A;  2WCF A;  3WHU B;  2SAS A;  4PE7 A;  3NXA A;  3CWG A;  3BFA A;  3O78 A;  2DOQ A;  2K7B A;  4FTG A;  4XJK A;  4C0J A;  1QX5 B;  5HKY A;  1SKT A;  2KYF A;  2L50 A;  3I5H B;  3QRX A;  4YI8 A;  3VRO A;  1TN4 A;  2LUX A;  2Y5I A;  5PAL A;  3TUY B;  1DJX A;  1CMF A;  1XK4 C;  1P28 A;  2COL B;  3BOW B;  3BQ3 A;  1CNP A;  1QVI Z;  4TNC A;  1K8U A;  3PFV A;  2LHI A;  4QJ3 B;  2GGZ A;  2BBN A;  4YBH B;  1QIV A;  3WXA A;  2WND A;  3SS4 A;  2LC5 A;  1KQM C;  5JOL A;  3CDN A;  2H2K A;  1JFJ A;  3AAJ A;  1MXE A;  1EJ3 A;  5DKQ A;  1PRW A;  3I5G C;  2E6W A;  2H8V A;  2JXL A;  2M0R A;  2F3Y A;  2KQY A;  3DD4 A;  3GOF A;  2GTE A;  1ODB A;  2MLE C;  3D77 A;  3ZWH A;  2I18 A;  2LAN A;  2KNE A;  1XK4 A;  2KAV A;  4I5L B;  2MBX A;  2BL0 C;  2R2I A;  3NSI A;  2MA2 A;  2WOS A;  2M29 A;  2M1K B;  4MZL A;  2LLS A;  3HCM A;  1AK8 A;  1YUS A;  4FQO A;  2F2P A;  4M2O A;  1BOD A;  1BU3 A;  2FCD A;  3C1V A;  3S0A A;  2BE4 A;  3CR5 X;  3S0G A;  3HX4 A;  2BEC A;  4OV2 A;  2JZI A;  1S36 A;  3IVT A;  2JU0 A;  2F8P A;  4OCI A;  2PMY A;  1YUT A;  1LVC D;  1R2U A;  3MSE B;  3SIB A;  1Y6W A;  1RRO A;  1CKK A;  2ZRS A;  1B7T Z;  1CFD A;  2CBL A;  1N65 A;  3FE9 A;  4I5K A;  1QIW A;  4JQ0 D;  1WRL A;  2BKI B;  1WRZ A;  1DQE A;  2JNF A;  1V1F A;  2B1U A;  2K60 A;  2M97 A;  3PJI A;  3SG5 A;  1IKU A;  2L0P A;  2KYC A;  3CYZ A;  2WCH A;  3VRN A;  3I5I B;  3PSR A;  4JKT A;  1X02 A;  1NSH A;  4U8D A;  1Z2C B;  1QJT A;  3BUN B;  1S5G Z;  5HKW A;  1BF5 A;  1N0Y A;  2MJW B;  3EK8 A;  3PM2 A;  3VRP A;  1QWV A;  1XA5 A;  2BCX A;  2JT3 A;  2ZKM X;  4GUK A;  1DMO A;  4XJK B;  1A75 B;  4XYN A;  1OOI X;  2JUL A;  1DVI A;  1U5I A;  5ER5 A;  2NCO A;  2ISD A;  2E30 A;  2P70 A;  1W7J B;  1WDC C;  4DCK A;  1F8H A;  2MRD A;  1DJZ A;  1PVB A;  3B7A A;  1K93 D;  1YRU B;  2MLF C;  1J55 A; 
#chains in the Genus database with same CATH homology
 4CID A;  4L9M A;  3LL8 B;  1QXP A;  1DJG A;  1JF2 A;  1DGV A;  3OX5 A;  2BCA A;  4UPG A;  3TZ1 A;  1TRF A;  1QX7 A;  1DT7 B;  1ZUZ A;  1KWO B;  4DIR A;  3TS5 C;  1S3P A;  1DF0 A;  2OTG C;  2JQ6 A;  2JNX A;  3PN7 C;  2VRG A;  1SCM B;  4PCW A;  4PHJ A;  5HKZ A;  4HRG A;  3FWB A;  1B8L A;  4P2Y B;  2ZN8 A;  4YGE B;  1TNQ A;  2V53 A;  1S1E A;  1AVS A;  1A2X A;  3KF9 A;  5AFP A;  1UUR A;  1J7R A;  1DGU A;  1Y1A A;  3IQQ A;  1EG4 A;  1GGW A;  2K7D A;  3K21 A;  1K90 D;  4WQ2 A;  1Q80 A;  1XFX O;  1SCV A;  1UHJ A;  3CR4 X;  5DKN A;  1NP8 A;  1CTR A;  1K96 A;  4AOM A;  2M9G A;  2PAS A;  3LK1 A;  1G8I A;  4CPV A;  1B47 A;  2CTN A;  1MQ1 A;  1YRT B;  1KSM A;  4MEW A;  1NX1 A;  2KAY A;  4F0Z B;  1F54 A;  4AQJ A;  1JF0 A;  5HLO A;  1AP4 A;  2NCP A;  1LXF C;  1HQV A;  2JWW A;  1NPQ A;  2Y1N A;  1NIW A;  4MLW A;  2L98 A;  1XFZ O;  2KSP A;  1SBJ A;  1TNP A;  1SK6 D;  4MRX A;  1SL8 A;  1Y1X A;  1LA0 A;  2L51 A;  2M7L A;  2EC6 C;  2K2F A;  3D10 A;  4I5N B;  4M2Q A;  4GGN A;  4PAL A;  3OHM B;  2JTT A;  5HKY A;  2JT8 A;  3IQO A;  1BOC A;  3LK0 A;  1MUX A;  3CR2 A;  2K7O A;  2Y1M A;  3SJS A;  5B8I B;  3IF7 A;  4PHK A;  5CSJ A;  3CTN A;  2KGR A;  2L5X B;  2KI4 B;  2LM5 A;  1CMG A;  1M46 A;  3OX6 A;  5HLV A;  4ZCV A;  1UHN A;  1DTL A;  2G2B A;  2L4H A;  2BE6 A;  2M3W A;  3SIA A;  5AEQ A;  4MVF A;  1F70 A;  3EKH A;  1IRJ A;  2CT9 A;  1MF8 B;  1NCY A;  2LMT A;  3TDZ A;  1DJI A;  2LAP A;  5KU1 A;  1KK8 B;  3GK4 X;  1IGV A;  4GFT A;  3I5G B;  4PE1 A;  5AXI A;  1B8C A;  1B7T Y;  2LV7 A;  2BCB A;  1KFU S;  2K8M B;  3CLN A;  1SRA A;  2JC2 A;  2KAX A;  2EHB A;  1BJF A;  3FWC A;  1XFV O;  4Q04 A;  2TN4 A;  3ZNI A;  3PLF B;  3O2P A;  1QLS A;  1JUO A;  1REC A;  5I2O A;  5I2Q A;  1FPW A;  1S6I A;  3NSO A;  4ORB B;  2RGI A;  1TTX A;  1DJW A;  1OE9 B;  1PK0 D;  3BUW B;  1QX2 A;  2L2E A;  3BUO B;  2KI6 D;  1CDL A;  3DVE A;  3I5F C;  1TOP A;  3JVT C;  4N5X A;  1SNL A;  1MWN A;  1KFX L;  1M63 B;  3NSK A;  1UHK A;  1OQP A;  1KK7 Z;  1OMD A;  5CPV A;  1B9A A;  1K9K A;  1UUS A;  1QV1 A;  2KOT A;  3AKA A;  3OB1 B;  2M7N A;  4GBA A;  5KTY A;  3BYA A;  2F3Z A;  2HQW A;  3O6B A;  1GGZ A;  1JWD A;  1L2O C;  1ZMZ A;  3KPX A;  3TDI A;  5ER4 X;  4CFR A;  1VRK A;  1BT6 A;  1DJY A;  1ZOT B;  1RJV A;  1IJ6 A;  2HQ8 A;  4YGA A;  1R6P A;  3DF0 B;  5D69 A;  1YUU A;  1OSA A;  1XO5 A;  2OS8 C;  5I8N A;  1IJ5 A;  4MBE A;  1PSB A;  3CS1 A;  3FS7 A;  2I94 A;  1RWY A;  1QVI Y;  2KFH A;  4BY4 A;  1FW4 A;  2CNP A;  2L4I A;  1QS7 A;  2G9B A;  3PAT A;  3KO0 A;  3DVK A;  1U5I B;  3JTD B;  1PVA A;  5FYX A;  2BL0 B;  2Q91 A;  1A4P A;  4BY5 A;  1RK9 A;  3VRR A;  1CM1 A;  2FCE A;  2LVK A;  1QTX A;  3D0Y B;  4NQG A;  2KHN A;  1IWQ A;  1WLM A;  1WY9 A;  2ZFD A;  3BUX B;  1ALW A;  1NX2 A;  2P6B B;  1C7W A;  1YR5 A;  2BBM A;  4AQI A;  1EH2 A;  3EVU A;  1TIZ A;  2HET A;  1QV0 A;  4YGB B;  1NX0 A;  4P5O E;  4M2P A;  2IS9 A;  1KWO C;  4I5J A;  1IG5 A;  1ZAC A;  1XFU O;  1EL4 A;  2O60 A;  4MSP A;  2LP2 A;  5TNC A;  1XFY O;  2AAO A;  1BR1 B;  1LKJ A;  2OTG B;  1UP5 A;  2JXC A;  1F55 A;  3PN7 B;  1OMR A;  3PAL A;  4PDZ A;  3AKB A;  2JTZ A;  3WNX B;  2WCE A;  5F6T A;  1SR6 B;  1CDN A;  4ORA B;  3KEV A;  4A4B A;  2SCP A;  1A03 A;  1F4O A;  1YVL A;  3TUY C;  2LUC A;  1RFJ A;  1WDC B;  2JRF A;  1CFC A;  1EXR A;  4JPZ B;  1GJY A;  1CLB A;  1MXL C;  2ZNE A;  2I2R E;  4YGC B;  1S5G Y;  2KFG A;  2KBM A;  1PAL A;  1SL9 A;  4R1E A;  4MZJ A;  1YTZ C;  3AAK A;  1NYA A;  4DUQ A;  5GQQ C;  2LVI A;  1KK7 Y;  4MRY A;  1CM4 A;  4PE4 A;  2LVJ A;  1M45 A;  3LCP C;  1OZO A;  1KQV A;  1CLM A;  1SMG A;  1B1G A;  4QJ4 B;  3TS5 B;  1J7O A;  2CXJ A;  1BR4 B;  2Y4Q A;  1JFK A;  2KQ6 A;  1KFX S;  1DJH A;  3VGO A;  4WQ3 A;  2F33 A;  1CFP A;  4CFQ A;  1SW8 A;  2LCP A;  1QLK A;  1UHH A;  3ICB A;  5J3X A;  5DKR A;  1TCO B;  1YUR A;  5BPJ A;  2ZND A;  4MN0 A;  2M1U A;  2M49 B;  1DF0 B;  3I5H C;  3A4U B;  5I2L A;  2JPT A;  2NLN A;  1B8R A;  1WRK A;  2ZN9 A;  1F71 A;  1KCY A;  1N2D A;  3OB2 B;  4N1F A;  3BOW A;  2WOR A;  2AMI A;  2ZRT A;  3SG7 A;  3CGA A;  1SY9 A;  1TCF A;  1NX3 A;  1SL7 A;  2FJU B;  1L7Z A;  2K61 A;  4D1E A;  1BLQ A;  1KK8 C;  2AUC A;  1TNX A;  1G33 A;  2MAZ A;  4GPL B;  3SG4 A;  4JWQ A;  1K9U A;  1AUI B;  3DVM A;  1JBA A;  1KQM B;  1E8A A;  1Y0V H;  1C07 A;  4NDC A;  1GQM A;  4GGF C;  4DS7 A;  1H4B A;  2H61 A;  4NDD A;  2O5G A;  1BMO A;  1S26 D;  1S6J A;  2PVB A;  1XVJ A;  1OOJ A;  1NWD A;  5JJG A;  2NZ0 A;  2QPT A;  4ETO A;  1J1D A;  4N1G A;  1FI6 A;  2Q4U A;  1PSR A;  4OR9 B;  4PHM A;  4CLN A;  1BG1 A;  3KHE A;  1A75 A;  1JC2 A;  4HRE E;  1K9P A;  1UHI A;  3CZT X;  4OKH A;  4GNK B;  2EC6 B;  3RLZ A;  3DF0 A;  1ALV A;  1CB1 A;  3I5F B;  1C7V A;  2LLU A;  2M8U A;  4ZCU A;  3BXK A;  3SG6 A;  4HRH A;  2KI4 C;  2JOJ A;  2WCB A;  2PRU A;  3EVV A;  1OZS A;  4PHN A;  4WRI A;  1L2O B;  4USL A;  1AJ5 A;  1PUL A;  2GV5 A;  2K7C A;  2KDH A;  4HSZ A;  4E68 A;  5CSN A;  2JT0 A;  3VRQ A;  1K94 A;  4YI9 A;  1NUB A;  1V1G A;  3H4S E;  1M39 A;  2LMV A;  1H8B A;  2BKH B;  2OS8 B;  1KFU L;  3SG3 A;  4IL1 A;  3EK4 A;  1SCM C;  2H61 C;  3M0W A;  4C0L A;  1XYD A;  4DRW A;  3BUM B;  1LA3 A;  3E3R A;  3I5I C;  1M31 A;  2FOT A;  1OMV A;  3WHT B;  5CSI A;  2KFF A;  4QJ5 B;  1F4Q A;  4ICB A;  1FF1 A;  1YX8 A;  1AJ4 A;  1JSA A;  2LVV A;  1CDP A;  2LE9 B;  3O4Y A;  1RTP 1;  1AHR A;  3LLE A;  3D0Y A;  1HT9 A;  1KSO A;  4NDB A;  5AER A;  2PSR A;  5HYD A;  3JVT B;  5IBW A;  4GAO A;  1FBV A;  1J7P A;  1MHO A;  4PE0 A;  2QAC A;  1G4Y R;  2KGB C;  3GK1 A;  1WLZ A;  1S6C A;  3FIA A;  2NXQ A;  3OP0 A;  3F45 A;  2KBI A;  1QAT A;  5D7F A;  3GK2 A;  2HPS A;  2PAL A;  3SG2 A;  1QAS A;  1XFW O;  3EKJ A;  3NSL A;  1SR6 C;  3EK7 A;  1D1O A;  1J7Q A;  1FI5 A;  2OPO A;  2LP3 A;  5K89 A;  2LLT A;  1CFF A;  1TNW A;  1UWO A;  2WC8 A;  1EG3 A;  2KI6 C;  4YGD B;  2LHL A;  2CCM A;  2HF5 A;  3EVR A;  3JTD C;  4OVN F;  1NCX A;  1B4C A;  1YX7 A;  1MR8 A;  3PM8 A;  1SYM A;  1LIN A;  1CLL A;  2D8N A;  1CDM A;  2K0J A;  4C0K A;  2EGD A;  4A4C A;  1IQ3 A;  3RM1 A;  1J1E A;  3DVJ A;  2LMU A;  2LNK A;  4MZK A;  3TDU A;  1ZFS A;  1W7I B;  2MHH A;  5G08 A;  3A8R A;  1NCZ A;  1A29 A;  2I7A A;  4YRU A;  5KSZ A;  1K2H A;  2A4J A;  4GGF A;  5CSF A;  2K2A A;  1IQ5 A;  4ORC B;  1SPY A;  1IH0 A;  2GGM A;  5AAN A;  1Y1U A;  1YVH A;  1K95 A;  2F2O A;  2WCF A;  3WHU B;  2SAS A;  4PE7 A;  3NXA A;  3CWG A;  3O78 A;  2DOQ A;  2K7B A;  4FTG A;  4XJK A;  4C0J A;  1QX5 B;  1SKT A;  2KYF A;  2L50 A;  3I5H B;  3QRX A;  4YI8 A;  3VRO A;  1TN4 A;  2LUX A;  2Y5I A;  5PAL A;  3TUY B;  1DJX A;  1CMF A;  1XK4 C;  2COL B;  3BOW B;  3BQ3 A;  1CNP A;  1QVI Z;  4TNC A;  1K8U A;  3PFV A;  2LHI A;  4QJ3 B;  2GGZ A;  2BBN A;  4YBH B;  1QIV A;  3WXA A;  2WND A;  2LC5 A;  1KQM C;  5JOL A;  2H2K A;  1JFJ A;  3AAJ A;  1MXE A;  1EJ3 A;  5DKQ A;  1PRW A;  3I5G C;  2E6W A;  2JXL A;  2M0R A;  2F3Y A;  2KQY A;  3DD4 A;  3GOF A;  3ZWH A;  1ODB A;  2MLE C;  2I18 A;  2LAN A;  2KNE A;  1XK4 A;  2KAV A;  4I5L B;  2MBX A;  2BL0 C;  2R2I A;  3NSI A;  2MA2 A;  2WOS A;  2M29 A;  2M1K B;  4MZL A;  2LLS A;  3HCM A;  1AK8 A;  1YUS A;  4FQO A;  2F2P A;  4M2O A;  1BOD A;  1BU3 A;  2FCD A;  3C1V A;  2BE4 A;  3CR5 X;  3HX4 A;  2BEC A;  4OV2 A;  2JZI A;  1S36 A;  2JU0 A;  2F8P A;  4OCI A;  2PMY A;  1YUT A;  1LVC D;  1R2U A;  3MSE B;  3SIB A;  1Y6W A;  1RRO A;  1CKK A;  2ZRS A;  1B7T Z;  1CFD A;  2CBL A;  1N65 A;  4I5K A;  1QIW A;  4JQ0 D;  1WRL A;  2BKI B;  1WRZ A;  2JNF A;  1V1F A;  2B1U A;  2M97 A;  3SG5 A;  1IKU A;  2L0P A;  2KYC A;  3VRN A;  3I5I B;  3PSR A;  1X02 A;  1NSH A;  4U8D A;  1BF5 A;  1QJT A;  3BUN B;  1S5G Z;  5HKW A;  1N0Y A;  2MJW B;  3EK8 A;  3VRP A;  1DMO A;  1XA5 A;  2BCX A;  2JT3 A;  2ZKM X;  4GUK A;  4XJK B;  1A75 B;  4XYN A;  2JUL A;  1DVI A;  1U5I A;  5ER5 A;  2NCO A;  2ISD A;  2E30 A;  1W7J B;  1WDC C;  4DCK A;  1F8H A;  2MRD A;  1DJZ A;  1PVB A;  1K93 D;  1YRU B;  2MLF C;  1J55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...