3DVJA

Crystal structure of ca2+/cam-cav2.2 iq domain (without cloning artifact, hm to tv) complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
140
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 52
structure length 140
sequence length 144
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvjA00
4N1GA 2KHNA 1BMOA 4N5XA 1J1DA 1A29A 4BY4A 2KGBC 4CLNA 1F4QA 1L7ZA 1KFUL 1OSAA 2L98A 3VRPA 4I5KA 5G08A 1NP8A 2F3YA 3BUOB 3BQ3A 2KDHA 5TNCA 1N65A 3EK4A 1BODA 2FCDA 2BBNA 1CDPA 5B8IB 2K7BA 2I94A 1MHOA 1OZSA 4PE7A 1IQ5A 1K2HA 1SPYA 2BCXA 3FS7A 3BUXB 1ODBA 4GGFC 1KQMC 1SW8A 1SCMB 2MHHA 4GFTA 1CFDA 2R2IA 3CR4X 2COLB 3CZTX 5I2OA 1J7PA 1JSAA 2ZNEA 4N1FA 2HPSA 1AJ5A 2K8MB 4P5OE 2OS8B 1S3PA 1MWNA 2MJWB 1OZOA 3SG4A 1K8UA 3I5GB 1J1EA 2OTGC 1YR5A 5J3XA 1F70A 1S5GY 2Y1NA 1JF0A 1XFYO 3PN7C 4PHMA 1BF5A 3VROA 1K9KA 1TN4A 1WLMA 5JOLA 1TIZA 2LUXA 1BLQA 3GK2A 1X02A 1MXEA 2IS9A 3CTNA 4YGDB 3E3RA 4OCIA 1R6PA 2SASA 4YGAA 1NCYA 4PE0A 5AFPA 3JVTC 1OMDA 1TNPA 4M2PA 1PVAA 2NLNA 1B9AA 4PE4A 1RWYA 1DT7B 1BU3A 2F2OA 1B7TY 2HF5A 2NZ0A 3SG5A 3ZNIA 3SG7A 1YUTA 1TOPA 1C7VA 1UUSA 1M45A 1SNLA 1J7RA 1CLMA 4MZLA 3BUMB 1KK8C 3BUNB 1JBAA 3RM1A 2CXJA 1MF8B 1JF2A 4MBEA 1XFXO 2F8PA 2JC2A 1BT6A 1F54A 2K7DA 2KSPA 2WC8A 1B8CA 1RROA 3BOWB 3IQOA 3PN7B 3AKAA 2JT0A 5BPJA 1C7WA 1S6JA 1XYDA 3ICBA 3JTDB 1J55A 4MN0A 2JPTA 1KWOC 5AXIA 3OB1B 1QX2A 4NDBA 1E8AA 2KI4C 4DS7A 1CMFA 4CPVA 1UHKA 4P2YB 2L50A 1IJ5A 4A4CA 3IF7A 3ZWHA 1PALA 1QASA 4TNCA 3BXKA 2Y4QA 1QLSA 1Y1XA 1DJGA 4ORCB 2PMYA 1YURA 2M7LA 1QATA 2RGIA 4GBAA 2M7NA 1IQ3A 4AOMA 3LL8B 1BR4B 2CT9A 2WCFA 1CFCA 2ZNDA 1LA3A 4GNKB 5CPVA 2LM5A 1GGWA 2KQYA 3EKHA 3EVRA 1K90D 4CFRA 2BE6A 1N0YA 3I5IC 4PHNA 1DF0B 4JQ0D 1ZUZA 1QIVA 3NSKA 4QJ4B 2E30A 1KFUS 3EKJA 2F33A 3SJSA 4OV2A 4MRYA 1OMVA 3WNXB 2L5XB 2KQ6A 1KWOB 1SR6B 1WY9A 3D10A 1ALWA 1ZFSA 4USLA 2KI4B 1GGZA 2KFFA 3LK0A 3DVEA 3TDIA 1NX1A 3VRQA 1DJXA 1R2UA 1SRAA 1VRKA 2M29A 4YGEB 1PVBA 5HYDA 2WCEA 3FWBA 2HETA 1KFXL 4QJ5B 1YTZC 4HSZA 2H61C 1SL8A 5ER5A 1XO5A 3D0YA 1FI6A 1W7IB 1DTLA 3VGOA 3I5HC 1NUBA 1XK4A 1YRUB 1RK9A 1TNWA 4MVFA 4FTGA 4R1EA 5JJGA 1IJ6A 1PRWA 3NSLA 1QVIY 2Y5IA 4QJ3B 1QTXA 2K2AA 2MRDA 3I5IB 3HCMA 1OE9B 3TS5C 2JT3A 1ZMZA 1UP5A 4L9MA 1H4BA 4OVNF 3LK1A 3EVVA 1RTP1 1RFJA 4IL1A 4D1EA 1S36A 2FJUB 2KGRA 1F55A 1Y6WA 2G2BA 2KYFA 3TUYB 4PALA 1AUIB 1QX7A 3M0WA 1H8BA 2PSRA 2ISDA 1C07A 2F2PA 3CLNA 3O2PA 1OQPA 4F0ZB 5KU1A 1M31A 1JUOA 2BE4A 2JXLA 4JPZB 2LVKA 3TDUA 1M63B 1QS7A 2LLTA 1YUSA 3OX5A 3FIAA 2AUCA 2M97A 4YGBB 3NXAA 4NDCA 4ZCUA 2LCPA 3DF0A 2KAXA 4HREE 3I5HB 1WRZA 4ICBA 1KSMA 1OOJA 1Q80A 2BCBA 3KPXA 1LINA 1CMGA 2I2RE 1WDCC 1S5GZ 1TNQA 3RLZA 3H4SE 4WRIA 1NWDA 3OP0A 4YBHB 3AAKA 1EXRA 3CR5X 5KSZA 1DJZA 4YI9A 1LKJA 2JWWA 2LHIA 3CR2A 3PFVA 2LNKA 5HKYA 1NSHA 2KBIA 2LLUA 2ZRSA 4Q04A 1KSOA 2BBMA 2NCPA 3KF9A 1KQMB 1BR1B 1WRLA 4MEWA 5D69A 1YVLA 4GPLB 1QLKA 1V1FA 1B47A 2EC6C 2QPTA 4M2QA 2MBXA 2LV7A 1B7TZ 1JC2A 5D7FA 1SKTA 2OTGB 1SY9A 2I7AA 2CBLA 3CS1A 1SMGA 1TTXA 1XFWO 1L2OC 3FWCA 1S1EA 1QV0A 3OB2B 1XK4C 1QX5B 2LVIA 1K9UA 1YVHA 2VRGA 1YX8A 3PSRA 4U8DA 4ORAB 5I2QA 2A4JA 1U5IB 2H2KA 5FYXA 3JVTB 2EGDA 3DVKA 5CSIA 1A75A 2GV5A 4HRHA 1MQ1A 4MRXA 2BCAA 5HLVA 2ZRTA 4OKHA 4AQJA 2B1UA 4MLWA 5HLOA 1BJFA 1BG1A 3VRRA 4YRUA 3CGAA 1KFXS 3I5FC 1DGVA 1KK7Y 1S26D 3GK4X 2JTZA 1UWOA 2ZFDA 1IWQA 3O6BA 4DRWA 4I5LB 1IGVA 1K94A 1KK8B 2BKHB 1B8LA 2MLFC 4MZKA 2CCMA 2Q91A 4AQIA 4XJKB 4PHKA 4HRGA 1PULA 2LP2A 4ETOA 3D0YB 2OPOA 1CLLA 1Y0VH 1L2OB 1PSRA 2BL0C 2LUCA 1AP4A 2KBMA 2Q4UA 2LC5A 1Y1UA 4DCKA 1CNPA 2JTTA 5HKZA 3BOWA 1MXLC 2M49B 1HQVA 1GQMA 5DKNA 1QXPA 1EG4A 2O5GA 5CSNA 1CFPA 2HQ8A 1UHJA 3BUWB 1CLBA 1V1GA 3HX4A 1ZOTB 1S6CA 1B8RA 2M8UA 5ER4X 2Y1MA 1M39A 1XFZO 4BY5A 3PALA 1LVCD 1K95A 2NCOA 3I5FB 1DJYA 1G8IA 1Y1AA 3AAJA 4C0KA 1F4OA 1QV1A 2L4HA 2MAZA 1F71A 4I5JA 1UHHA 2I18A 2GGZA 1ALVA 1JFKA 1OMRA 2G9BA 1LXFC 1A03A 1SCMC 5F6TA 1SL9A 4MZJA 1UHNA 2JOJA 4FQOA 4OR9B 4XYNA 2OS8C 2PRUA 2BKIB 3OHMB 1HT9A 2LANA 4PCWA 1MR8A 2BL0B 2K7CA 2PASA 3I5GC 4MSPA 1QVIZ 1DF0A 2M1UA 1XFVO 2LLSA 2LAPA 4M2OA 3O78A 1SL7A 1PSBA 2JULA 1TNXA 2ZN9A 1JWDA 1WRKA 1BOCA 2M0RA 2QACA 3A8RA 3EK8A 2LP3A 1ZACA 3NSIA 2LMVA 3AKBA 2CNPA 1DJHA 2M9GA 2V53A 4UPGA 4JWQA 1AK8A 5K89A 1SCVA 4DUQA 1IG5A 3OX6A 1AVSA 1J7QA 2FCEA 2BECA 3PLFB 3BYAA 2KI6D 1TCFA 1TRFA 1DGUA 3SIBA 1YX7A 1CKKA 1K93D 3TS5B 4A4BA 1FI5A 2FOTA 2WORA 3VRNA 2DOQA 2F3ZA 1MUXA 1UHIA 2NXQA 4WQ2A 3WHUB 1DMOA 2TN4A 1W7JB 2KOTA 1IH0A 2LHLA 1M46A 3WXAA 1EJ3A 2MA2A 2JQ6A 3K21A 2L4IA 2K2FA 2JU0A 2PVBA 1TCOB 1FBVA 4PDZA 1GJYA 2ZKMX 1IKUA 2WNDA 3JTDC 1A75B 1N2DA 2JXCA 3GOFA 1YUUA 1G33A 1S6IA 1CM1A 1A4PA 1K96A 2O60A 2WCBA 2L0PA 2M3WA 1XFUO 3DVJA 5AANA 1K9PA 3A4UB 1CTRA 3DVMA 2EHBA 1RJVA 3C1VA 4ORBB 2K0JA 2CTNA 2PALA 4GUKA 3F45A 4C0LA 2H61A 2HQWA 2JNFA 3EK7A 1B1GA 1CM4A 4NDDA 1LA0A 1WDCB 2ZN8A 1KCYA 3KHEA 1PK0D 4WQ3A 3PM8A 2KYCA 3PATA 5CSJA 5AEQA 1RECA 3TDZA 2JZIA 5IBWA 1EH2A 1NCXA 3QRXA 2JNXA 4YGCB 4CFQA 2L51A 1FF1A 2LVVA 3LLEA 1EG3A 1NX3A 1UURA 3GK1A 1NX0A 3WHTB 1IRJA 1JFJA 4ZCVA 1A2XA 1XA5A 5AERA 5PALA 2EC6B 3EVUA 2GGMA 4GGFA 1XVJA 3LCPC 1SR6C 1EL4A 3NSOA 1NX2A 1F8HA 1J7OA 2WOSA 1KK7Z 2LMUA 1QJTA 3SIAA 1QIWA 3IQQA 5KTYA 1KQVA 1AJ4A 5I2LA 1CDMA 2KNEA 2JRFA 2MLEC 5GQQC 3O4YA 2P6BB 1SK6D 1WLZA 2AAOA 1B4CA 1D1OA 1NCZA 5DKQA 2K61A 4C0JA 4PHJA 1NIWA 2AMIA 3SG6A 2E6WA 1NPQA 2JT8A 4CIDA 2K7OA 2SCPA 4DIRA 1CDNA 2KI6C 1U5IA 2L2EA 1DJIA 2KAVA 2M1KB 3MSEB 1FPWA 5CSFA 1FW4A 1YRTB 1SBJA 1DVIA 3TUYC 1NYAA 2KAYA 2LE9B 4YI8A 3SG3A 4E68A 4GAOA 4NQGA 1AHRA 1CB1A 3CWGA 4GGNA 1DJWA 1CFFA 2LMTA 4PE1A 1CDLA 5I8NA 4I5NB 2D8NA 3KEVA 1G4YR 3DD4A 5DKRA 3DF0B 5HKWA 3SG2A 3TZ1A 4XJKA 2KFGA 2KFHA 2LVJA 1SYMA 3KO0A
chains in the Genus database with same CATH superfamily
4N1GA 1Z4HA 2KHNA 1BMOA 4N5XA 1J1DA 1A29A 3D73A 4BY4A 2KGBC 4CLNA 1F4QA 1L7ZA 1KFUL 1OSAA 1P28A 2L98A 2WCKA 3VRPA 4I5KA 5G08A 1NP8A 4KYNA 2F3YA 3BUOB 3BQ3A 2KDHA 5TNCA 1N65A 3D77A 3EK4A 1BODA 2FCDA 2BBNA 1CDPA 5B8IB 2K7BA 2I94A 1MHOA 1OZSA 3QMEA 4PE7A 1IQ5A 1K2HA 1SPYA 2BCXA 3FS7A 3BUXB 1ODBA 4GGFC 5FI7A 1KQMC 1SW8A 1SCMB 2MHHA 4GFTA 1CFDA 2R2IA 3CR4X 2COLB 3CZTX 5I2OA 1J7PA 1JSAA 2ZNEA 4N1FA 2HPSA 1AJ5A 2K8MB 4P5OE 2OS8B 1S3PA 1MWNA 2MJWB 1OZOA 3SG4A 1K8UA 3VB1A 3I5GB 1J1EA 2OTGC 1YR5A 5J3XA 1DC1A 1F70A 1S5GY 2Y1NA 1JF0A 1XFYO 3PN7C 4PHMA 1BF5A 3VROA 1K9KA 1TN4A 1WLMA 2K60A 3K1EA 5JOLA 1TIZA 2LUXA 1BLQA 3GK2A 1X02A 1MXEA 2IS9A 3CTNA 3DY9A 4YGDB 3E3RA 4OCIA 1R6PA 2SASA 4YGAA 1NCYA 4PE0A 5AFPA 3JVTC 1OMDA 1TNPA 3DZTA 4M2PA 1PVAA 2NLNA 1B9AA 4PE4A 1RWYA 1DT7B 1BU3A 2F2OA 1B7TY 2HF5A 2NZ0A 3SG5A 2H8VA 3ZNIA 1QWVA 1OOIX 2L2CA 3SG7A 1YUTA 1TOPA 1C7VA 1UUSA 1M45A 1SNLA 1J7RA 1CLMA 4MZLA 3BUMB 1KK8C 3BUNB 3CABA 1JBAA 3RM1A 2CXJA 1MF8B 1JF2A 1TUZA 3CZ0A 1XFXO 2F8PA 2JC2A 4MBEA 1BT6A 1F54A 2K7DA 2KSPA 2WC8A 1B8CA 1RROA 3BOWB 3IQOA 3PN7B 3AKAA 2JT0A 3R72A 5BPJA 1C7WA 1S6JA 1XYDA 3ICBA 3JTDB 1J55A 4MN0A 2JPTA 1KWOC 5AXIA 3OB1B 1QX2A 4NDBA 1E8AA 2KI4C 3NGVA 4DS7A 1CMFA 4CPVA 1T14A 1UHKA 2L50A 1IJ5A 4P2YB 3IF7A 4A4CA 3ZWHA 1PALA 1QASA 4TNCA 3BXKA 2Y4QA 1QLSA 1Y1XA 1DJGA 3D76A 4ORCB 2PMYA 1YURA 3CZ2A 3R1OA 2M7LA 1QATA 2RGIA 4GBAA 2PYQA 2M7NA 5EL2A 1IQ3A 2WCHA 4AOMA 3LL8B 1BR4B 2CT9A 2WCFA 3D75A 1Z2CB 1CFCA 2ZNDA 1LA3A 4GNKB 5CPVA 3RZSA 2LM5A 2QEBA 1GGWA 2KQYA 3EKHA 3EVRA 1K90D 4CFRA 3R1VA 1N0YA 2BE6A 3I5IC 4PHNA 1DF0B 4JQ0D 1ZUZA 1QIVA 1SSEB 3NSKA 2E30A 1KFUS 4QJ4B 3EKJA 1OW4A 2F33A 5I94A 3SJSA 4OV2A 2KLDA 4MRYA 3SS4A 1OMVA 3FE6A 3WNXB 2L5XB 2KQ6A 1KWOB 1SR6B 1WY9A 3D10A 1ALWA 1ZFSA 4USLA 2KI4B 1GGZA 2KFFA 3LK0A 3DVEA 3SS3A 3TDIA 1NX1A 2PQLA 3VRQA 1DJXA 1R2UA 1SRAA 1VRKA 2M29A 4YGEB 1PVBA 1TUJA 5HYDA 2WCEA 3FWBA 2HETA 1KFXL 4QJ5B 1YTZC 4HSZA 2H61C 2JPOA 1SL8A 5ER5A 1XO5A 3BJHA 3D0YA 1C3YA 1FI6A 1W7IB 3CDNA 1DTLA 3VGOA 3I5HC 1NUBA 1XK4A 3FE9A 1YRUB 1RK9A 1TNWA 4MVFA 4FTGA 4R1EA 5JJGA 1IJ6A 1PRWA 3NSLA 1QVIY 2Y5IA 4QJ3B 1QTXA 2K2AA 2MRDA 3I5IB 3HCMA 1OE9B 3TS5C 2JT3A 1ZMZA 1UP5A 4L9MA 1H4BA 4OVNF 3LK1A 3EVVA 1RTP1 1RFJA 4IL1A 4D1EA 1S36A 2FJUB 2KGRA 1F55A 1Y6WA 2G2BA 2KYFA 3TUYB 4PALA 1AUIB 1QX7A 3M0WA 1H8BA 2PSRA 2ISDA 1C07A 2F2PA 3CLNA 3O2PA 1OQPA 3B88A 4F0ZB 5KU1A 2KPHA 1M31A 1JUOA 2BE4A 2JXLA 4JPZB 2LVKA 3TDUA 1M63B 1QS7A 2LLTA 1YUSA 1DELA 3FIAA 3OX5A 2AUCA 2M97A 1W9ZA 4YGBB 2P71A 3NXAA 2BNXA 4NDCA 4ZCUA 2LCPA 3DF0A 2KAXA 4HREE 2QEVA 3I5HB 1WRZA 5D3OA 4ICBA 1KSMA 1OOJA 1Q80A 2BCBA 3KPXA 1LINA 1CMGA 2I2RE 1WDCC 1S5GZ 1TNQA 3RLZA 3CYZA 3H4SE 4WRIA 1NWDA 3OP0A 4YBHB 3AAKA 4F7FA 1EXRA 3CR5X 5KSZA 1DJZA 4YI9A 1LKJA 2JWWA 2LHIA 3CR2A 3PFVA 2LNKA 3FE8A 5HKYA 1NSHA 2KBIA 2LLUA 2ZRSA 1XFRA 4Q04A 3S0EA 1KSOA 2BBMA 1OOHA 2NCPA 3KF9A 1KQMB 4INXA 1BR1B 1WRLA 4MEWA 5D69A 1YVLA 2BAPA 4GPLB 1QLKA 1V1FA 1B47A 2EC6C 2ERBA 2QPTA 4M2QA 2MBXA 2LV7A 1B7TZ 1JC2A 5D7FA 1SKTA 2OTGB 1SY9A 2I7AA 2CBLA 3CS1A 1SMGA 1TTXA 1XFWO 2QDIA 1L2OC 3FWCA 1S1EA 1QV0A 3OB2B 1XK4C 1QX5B 2LVIA 1K9UA 1YVHA 2VRGA 1YX8A 3PSRA 4U8DA 4ORAB 5I2QA 2A4JA 1U5IB 2H2KA 5FYXA 3JVTB 3DXLA 2EGDA 3DVKA 5CSIA 3S0FA 1A75A 2GV5A 4HRHA 1MQ1A 3PM2A 4MRXA 2BCAA 3S0BA 5HLVA 2ZRTA 4OKHA 4AQJA 2B1UA 4MLWA 5HLOA 1BJFA 1BG1A 3VRRA 4YRUA 2GTEA 3CGAA 1KFXS 3D78A 3I5FC 1DGVA 1KK7Y 1S26D 3PJIA 3GK4X 4JKTA 2JTZA 1UWOA 2ZFDA 1IWQA 3O6BA 4DRWA 4I5LB 1IGVA 1K94A 1KK8B 2BKHB 1B8LA 2MLFC 4MZKA 5FI6A 2CCMA 2Q91A 4AQIA 4XJKB 4PHKA 4HRGA 1PULA 2LP2A 3UNWA 4ETOA 3D0YB 4INWA 2OPOA 1CLLA 1Y0VH 3O4XA 1L2OB 1C3ZA 1PSRA 2BL0C 2LUCA 3NHTA 2KBMA 1AP4A 2Q4UA 2LC5A 1Y1UA 4DCKA 1CNPA 2JTTA 5HKZA 3BOWA 1MXLC 2M49B 1HQVA 1GQMA 5DKNA 1QXPA 1EG4A 2O5GA 5CSNA 1CFPA 2HQ8A 1UHJA 3BUWB 1CLBA 1V1GA 3HX4A 1ZOTB 1S6CA 1B8RA 3EG5B 2M8UA 3BFHA 5ER4X 2Y1MA 1M39A 1XFZO 4BY5A 3PALA 1LVCD 1K95A 3B87A 2NCOA 3I5FB 1DJYA 1G8IA 1Y1AA 3AAJA 4C0KA 1F4OA 1QV1A 2L4HA 2MAZA 1F71A 4I5JA 1UHHA 3BFBA 2I18A 3OGNA 2GGZA 1ALVA 1JFKA 3CZ1A 1OMRA 2G9BA 1LXFC 3D74A 1A03A 1SCMC 5F6TA 1SL9A 4MZJA 3DYEA 1UHNA 2JOJA 4FQOA 4OR9B 4XYNA 2OS8C 2PRUA 2BKIB 3OHMB 1HT9A 2LANA 5DICA 3S0AA 4PCWA 1MR8A 2BL0B 2K7CA 2PASA 3I5GC 4MSPA 1QVIZ 1DF0A 2M1UA 1XFVO 2LLSA 2LAPA 4M2OA 3O78A 1SL7A 1PSBA 2JULA 1TNXA 2ZN9A 3NHIA 1WRKA 1BOCA 2M0RA 1JWDA 3UO9A 2QACA 3A8RA 3EK8A 2LP3A 1ZACA 3NSIA 2LMVA 3AKBA 2CNPA 1DJHA 2M9GA 2V53A 4UPGA 4JWQA 1AK8A 2WCLA 5K89A 1SCVA 4DUQA 1IG5A 3OX6A 3B86A 3S0DA 1AVSA 1J7QA 2FCEA 2BECA 3PLFB 3BYAA 2KI6D 1TCFA 1TRFA 1DGUA 3OBVA 5HL1A 3SIBA 1YX7A 1CKKA 1K93D 3TS5B 4A4BA 1FI5A 2FOTA 2WORA 3VRNA 2DOQA 2F3ZA 1MUXA 1UHIA 2NXQA 4WQ2A 3WHUB 1DMOA 2TN4A 1W7JB 2KOTA 2QEOA 3R1PA 2KLEA 2LHLA 3L4AA 1M46A 3WXAA 3SS5A 1EJ3A 1IH0A 2MA2A 2JQ6A 3K21A 2L4IA 2WCMA 4JD9A 2K2FA 2JU0A 2PVBA 2QEHA 1TCOB 1FBVA 1LS8A 4PDZA 1GJYA 2ZKMX 3BFAA 5FI2A 1OOGA 1IKUA 2WNDA 3JTDC 1A75B 1N2DA 2JXCA 3GOFA 1YUUA 1G33A 1S6IA 1CM1A 1ORGA 2P70A 1A4PA 1K96A 2O60A 1DEKA 2WCBA 2WC6A 2L0PA 2M3WA 2YGUA 1XFUO 3DVJA 5AANA 1K9PA 3A4UB 1CTRA 3DVMA 2EHBA 1RJVA 3C1VA 4ORBB 2K0JA 2CTNA 2PALA 4GUKA 3F45A 4C0LA 2H61A 2HQWA 2JNFA 3EK7A 1B1GA 1CM4A 4NDDA 1LA0A 1WDCB 2ZN8A 1KCYA 3KHEA 3B6XA 1PK0D 4WQ3A 3PM8A 2KYCA 3PATA 5CSJA 5AEQA 1RECA 3TDZA 2JZIA 5IBWA 1EH2A 1NCXA 3QRXA 2JNXA 4YGCB 4CFQA 3Q8IA 2L51A 3IVTA 1FF1A 2LVVA 3LLEA 3N7HA 1EG3A 1NX3A 1UURA 3GK1A 1NX0A 3WHTB 1IRJA 1JFJA 4ZCVA 1A2XA 1XA5A 5AERA 5PALA 2EC6B 3EVUA 4OZDA 2GGMA 4GGFA 1XVJA 3LCPC 1SR6C 1EL4A 3NSOA 1NX2A 2WC5A 3B7AA 1F8HA 1J7OA 2WOSA 1KK7Z 2LMUA 1QJTA 3SIAA 1QIWA 3IQQA 5KTYA 1KQVA 1AJ4A 5I2LA 1CDMA 4FQTA 2KNEA 2JRFA 2MLEC 5GQQC 3O4YA 1DQEA 2P6BB 1SK6D 1WLZA 2AAOA 1B4CA 4PT1A 1D1OA 1NCZA 3S0GA 5DKQA 2K61A 4C0JA 1IIOA 4PHJA 1NIWA 1OOFA 2AMIA 3SG6A 2L5YA 2E6WA 1NPQA 2JT8A 4CIDA 2K7OA 2FJYA 2SCPA 4DIRA 1CDNA 2KI6C 3L4LA 1U5IA 2L2EA 1DJIA 2KAVA 2M1KB 3MSEB 1FPWA 5CSFA 1FW4A 1YRTB 1SBJA 1DVIA 4IJ7A 1NYAA 3TUYC 2KAYA 2LE9B 4YI8A 3SG3A 4E68A 4GAOA 4NQGA 1AHRA 1CB1A 3CWGA 4GGNA 1DJWA 1CFFA 2LMTA 4PE1A 1CDLA 5I8NA 4I5NB 2D8NA 3KEVA 3L47A 1G4YR 2WCJA 3DD4A 5DKRA 3V2LA 1GM0A 3DF0B 5HKWA 3SG2A 3TZ1A 4XJKA 2KFGA 2KFHA 2LVJA 1TWOA 1SYMA 3KO0A
chains in the Genus database with same CATH topology
4N1GA 2KHNA 1BMOA 4N5XA 1J1DA 1A29A 4BY4A 2KGBC 4CLNA 1F4QA 1L7ZA 1KFUL 1OSAA 2L98A 3VRPA 4I5KA 5G08A 1NP8A 2F3YA 3BUOB 3BQ3A 2KDHA 5TNCA 1N65A 3EK4A 1BODA 2FCDA 2BBNA 1CDPA 5B8IB 2K7BA 2I94A 1MHOA 1OZSA 4PE7A 1IQ5A 1K2HA 1SPYA 2BCXA 3FS7A 3BUXB 1ODBA 4GGFC 1KQMC 1SW8A 1SCMB 2MHHA 4GFTA 1CFDA 2R2IA 3CR4X 2COLB 3CZTX 5I2OA 1J7PA 1JSAA 2ZNEA 4N1FA 2HPSA 1AJ5A 2K8MB 4P5OE 2OS8B 1S3PA 1MWNA 2MJWB 1OZOA 3SG4A 1K8UA 3I5GB 1J1EA 2OTGC 1YR5A 5J3XA 1F70A 1S5GY 2Y1NA 1JF0A 1XFYO 3PN7C 4PHMA 1BF5A 3VROA 1K9KA 1TN4A 1WLMA 5JOLA 1TIZA 2LUXA 1BLQA 3GK2A 1X02A 1MXEA 2IS9A 3CTNA 4YGDB 3E3RA 4OCIA 1R6PA 2SASA 4YGAA 1NCYA 4PE0A 5AFPA 3JVTC 1OMDA 1TNPA 4M2PA 1PVAA 2NLNA 1B9AA 4PE4A 1RWYA 1DT7B 1BU3A 2F2OA 1B7TY 2HF5A 2NZ0A 3SG5A 3ZNIA 3SG7A 1YUTA 1TOPA 1C7VA 1UUSA 1M45A 1SNLA 1J7RA 1CLMA 4MZLA 3BUMB 1KK8C 3BUNB 1JBAA 3RM1A 2CXJA 1MF8B 1JF2A 4MBEA 1XFXO 2F8PA 2JC2A 1BT6A 1F54A 2K7DA 2KSPA 2WC8A 1B8CA 1RROA 3BOWB 3IQOA 3PN7B 3AKAA 2JT0A 5BPJA 1C7WA 1S6JA 1XYDA 3ICBA 3JTDB 1J55A 4MN0A 2JPTA 1KWOC 5AXIA 3OB1B 1QX2A 4NDBA 1E8AA 2KI4C 4DS7A 1CMFA 4CPVA 1UHKA 4P2YB 2L50A 1IJ5A 4A4CA 3IF7A 3ZWHA 1PALA 1QASA 4TNCA 3BXKA 2Y4QA 1QLSA 1Y1XA 1DJGA 4ORCB 2PMYA 1YURA 2M7LA 1QATA 2RGIA 4GBAA 2M7NA 1IQ3A 4AOMA 3LL8B 1BR4B 2CT9A 2WCFA 1CFCA 2ZNDA 1LA3A 4GNKB 5CPVA 2LM5A 1GGWA 2KQYA 3EKHA 3EVRA 1K90D 4CFRA 2BE6A 1N0YA 3I5IC 4PHNA 1DF0B 4JQ0D 1ZUZA 1QIVA 3NSKA 4QJ4B 2E30A 1KFUS 3EKJA 2F33A 3SJSA 4OV2A 4MRYA 1OMVA 3WNXB 2L5XB 2KQ6A 1KWOB 1SR6B 1WY9A 3D10A 1ALWA 1ZFSA 4USLA 2KI4B 1GGZA 2KFFA 3LK0A 3DVEA 3TDIA 1NX1A 3VRQA 1DJXA 1R2UA 1SRAA 1VRKA 2M29A 4YGEB 1PVBA 5HYDA 2WCEA 3FWBA 2HETA 1KFXL 4QJ5B 1YTZC 4HSZA 2H61C 1SL8A 5ER5A 1XO5A 3D0YA 1FI6A 1W7IB 1DTLA 3VGOA 3I5HC 1NUBA 1XK4A 1YRUB 1RK9A 1TNWA 4MVFA 4FTGA 4R1EA 5JJGA 1IJ6A 1PRWA 3NSLA 1QVIY 2Y5IA 4QJ3B 1QTXA 2K2AA 2MRDA 3I5IB 3HCMA 1OE9B 3TS5C 2JT3A 1ZMZA 1UP5A 4L9MA 1H4BA 4OVNF 3LK1A 3EVVA 1RTP1 1RFJA 4IL1A 4D1EA 1S36A 2FJUB 2KGRA 1F55A 1Y6WA 2G2BA 2KYFA 3TUYB 4PALA 1AUIB 1QX7A 3M0WA 1H8BA 2PSRA 2ISDA 1C07A 2F2PA 3CLNA 3O2PA 1OQPA 4F0ZB 5KU1A 1M31A 1JUOA 2BE4A 2JXLA 4JPZB 2LVKA 3TDUA 1M63B 1QS7A 2LLTA 1YUSA 3OX5A 3FIAA 2AUCA 2M97A 4YGBB 3NXAA 4NDCA 4ZCUA 2LCPA 3DF0A 2KAXA 4HREE 3I5HB 1WRZA 4ICBA 1KSMA 1OOJA 1Q80A 2BCBA 3KPXA 1LINA 1CMGA 2I2RE 1WDCC 1S5GZ 1TNQA 3RLZA 3H4SE 4WRIA 1NWDA 3OP0A 4YBHB 3AAKA 1EXRA 3CR5X 5KSZA 1DJZA 4YI9A 1LKJA 2JWWA 2LHIA 3CR2A 3PFVA 2LNKA 5HKYA 1NSHA 2KBIA 2LLUA 2ZRSA 4Q04A 1KSOA 2BBMA 2NCPA 3KF9A 1KQMB 1BR1B 1WRLA 4MEWA 5D69A 1YVLA 4GPLB 1QLKA 1V1FA 1B47A 2EC6C 2QPTA 4M2QA 2MBXA 2LV7A 1B7TZ 1JC2A 5D7FA 1SKTA 2OTGB 1SY9A 2I7AA 2CBLA 3CS1A 1SMGA 1TTXA 1XFWO 1L2OC 3FWCA 1S1EA 1QV0A 3OB2B 1XK4C 1QX5B 2LVIA 1K9UA 1YVHA 2VRGA 1YX8A 3PSRA 4U8DA 4ORAB 5I2QA 2A4JA 1U5IB 2H2KA 5FYXA 3JVTB 2EGDA 3DVKA 5CSIA 1A75A 2GV5A 4HRHA 1MQ1A 4MRXA 2BCAA 5HLVA 2ZRTA 4OKHA 4AQJA 2B1UA 4MLWA 5HLOA 1BJFA 1BG1A 3VRRA 4YRUA 3CGAA 1KFXS 3I5FC 1DGVA 1KK7Y 1S26D 3GK4X 2JTZA 1UWOA 2ZFDA 1IWQA 3O6BA 4DRWA 4I5LB 1IGVA 1K94A 1KK8B 2BKHB 1B8LA 2MLFC 4MZKA 2CCMA 2Q91A 4AQIA 4XJKB 4PHKA 4HRGA 1PULA 2LP2A 4ETOA 3D0YB 2OPOA 1CLLA 1Y0VH 1L2OB 1PSRA 2BL0C 2LUCA 1AP4A 2KBMA 2Q4UA 2LC5A 1Y1UA 4DCKA 1CNPA 2JTTA 5HKZA 3BOWA 1MXLC 2M49B 1HQVA 1GQMA 5DKNA 1QXPA 1EG4A 2O5GA 5CSNA 1CFPA 2HQ8A 1UHJA 3BUWB 1CLBA 1V1GA 3HX4A 1ZOTB 1S6CA 1B8RA 2M8UA 5ER4X 2Y1MA 1M39A 1XFZO 4BY5A 3PALA 1LVCD 1K95A 2NCOA 3I5FB 1DJYA 1G8IA 1Y1AA 3AAJA 4C0KA 1F4OA 1QV1A 2L4HA 2MAZA 1F71A 4I5JA 1UHHA 2I18A 2GGZA 1ALVA 1JFKA 1OMRA 2G9BA 1LXFC 1A03A 1SCMC 5F6TA 1SL9A 4MZJA 1UHNA 2JOJA 4FQOA 4OR9B 4XYNA 2OS8C 2PRUA 2BKIB 3OHMB 1HT9A 2LANA 4PCWA 1MR8A 2BL0B 2K7CA 2PASA 3I5GC 4MSPA 1QVIZ 1DF0A 2M1UA 1XFVO 2LLSA 2LAPA 4M2OA 3O78A 1SL7A 1PSBA 2JULA 1TNXA 2ZN9A 1JWDA 1WRKA 1BOCA 2M0RA 2QACA 3A8RA 3EK8A 2LP3A 1ZACA 3NSIA 2LMVA 3AKBA 2CNPA 1DJHA 2M9GA 2V53A 4UPGA 4JWQA 1AK8A 5K89A 1SCVA 4DUQA 1IG5A 3OX6A 1AVSA 1J7QA 2FCEA 2BECA 3PLFB 3BYAA 2KI6D 1TCFA 1TRFA 1DGUA 3SIBA 1YX7A 1CKKA 1K93D 3TS5B 4A4BA 1FI5A 2FOTA 2WORA 3VRNA 2DOQA 2F3ZA 1MUXA 1UHIA 2NXQA 4WQ2A 3WHUB 1DMOA 2TN4A 1W7JB 2KOTA 1IH0A 2LHLA 1M46A 3WXAA 1EJ3A 2MA2A 2JQ6A 3K21A 2L4IA 2K2FA 2JU0A 2PVBA 1TCOB 1FBVA 4PDZA 1GJYA 2ZKMX 1IKUA 2WNDA 3JTDC 1A75B 1N2DA 2JXCA 3GOFA 1YUUA 1G33A 1S6IA 1CM1A 1A4PA 1K96A 2O60A 2WCBA 2L0PA 2M3WA 1XFUO 3DVJA 5AANA 1K9PA 3A4UB 1CTRA 3DVMA 2EHBA 1RJVA 3C1VA 4ORBB 2K0JA 2CTNA 2PALA 4GUKA 3F45A 4C0LA 2H61A 2HQWA 2JNFA 3EK7A 1B1GA 1CM4A 4NDDA 1LA0A 1WDCB 2ZN8A 1KCYA 3KHEA 1PK0D 4WQ3A 3PM8A 2KYCA 3PATA 5CSJA 5AEQA 1RECA 3TDZA 2JZIA 5IBWA 1EH2A 1NCXA 3QRXA 2JNXA 4YGCB 4CFQA 2L51A 1FF1A 2LVVA 3LLEA 1EG3A 1NX3A 1UURA 3GK1A 1NX0A 3WHTB 1IRJA 1JFJA 4ZCVA 1A2XA 1XA5A 5AERA 5PALA 2EC6B 3EVUA 2GGMA 4GGFA 1XVJA 3LCPC 1SR6C 1EL4A 3NSOA 1NX2A 1F8HA 1J7OA 2WOSA 1KK7Z 2LMUA 1QJTA 3SIAA 1QIWA 3IQQA 5KTYA 1KQVA 1AJ4A 5I2LA 1CDMA 2KNEA 2JRFA 2MLEC 5GQQC 3O4YA 2P6BB 1SK6D 1WLZA 2AAOA 1B4CA 1D1OA 1NCZA 5DKQA 2K61A 4C0JA 4PHJA 1NIWA 2AMIA 3SG6A 2E6WA 1NPQA 2JT8A 4CIDA 2K7OA 2SCPA 4DIRA 1CDNA 2KI6C 1U5IA 2L2EA 1DJIA 2KAVA 2M1KB 3MSEB 1FPWA 5CSFA 1FW4A 1YRTB 1SBJA 1DVIA 3TUYC 1NYAA 2KAYA 2LE9B 4YI8A 3SG3A 4E68A 4GAOA 4NQGA 1AHRA 1CB1A 3CWGA 4GGNA 1DJWA 1CFFA 2LMTA 4PE1A 1CDLA 5I8NA 4I5NB 2D8NA 3KEVA 1G4YR 3DD4A 5DKRA 3DF0B 5HKWA 3SG2A 3TZ1A 4XJKA 2KFGA 2KFHA 2LVJA 1SYMA 3KO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1G A;  2KHN A;  1BMO A;  4N5X A;  1J1D A;  1A29 A;  4BY4 A;  2KGB C;  4CLN A;  1F4Q A;  1L7Z A;  1KFU L;  1OSA A;  2L98 A;  3VRP A;  4I5K A;  5G08 A;  1NP8 A;  2F3Y A;  3BUO B;  3BQ3 A;  2KDH A;  5TNC A;  1N65 A;  3EK4 A;  1BOD A;  2FCD A;  2BBN A;  1CDP A;  5B8I B;  2K7B A;  2I94 A;  1MHO A;  1OZS A;  4PE7 A;  1IQ5 A;  1K2H A;  1SPY A;  2BCX A;  3FS7 A;  3BUX B;  1ODB A;  4GGF C;  1KQM C;  1SW8 A;  1SCM B;  2MHH A;  4GFT A;  1CFD A;  2R2I A;  3CR4 X;  2COL B;  3CZT X;  5I2O A;  1J7P A;  1JSA A;  2ZNE A;  4N1F A;  2HPS A;  1AJ5 A;  2K8M B;  4P5O E;  2OS8 B;  1S3P A;  1MWN A;  2MJW B;  1OZO A;  3SG4 A;  1K8U A;  3I5G B;  1J1E A;  2OTG C;  1YR5 A;  5J3X A;  1F70 A;  1S5G Y;  2Y1N A;  1JF0 A;  1XFY O;  3PN7 C;  4PHM A;  1BF5 A;  3VRO A;  1K9K A;  1TN4 A;  1WLM A;  5JOL A;  1TIZ A;  2LUX A;  1BLQ A;  3GK2 A;  1X02 A;  1MXE A;  2IS9 A;  3CTN A;  4YGD B;  3E3R A;  4OCI A;  1R6P A;  2SAS A;  4YGA A;  1NCY A;  4PE0 A;  5AFP A;  3JVT C;  1OMD A;  1TNP A;  4M2P A;  1PVA A;  2NLN A;  1B9A A;  4PE4 A;  1RWY A;  1DT7 B;  1BU3 A;  2F2O A;  1B7T Y;  2HF5 A;  2NZ0 A;  3SG5 A;  3ZNI A;  3SG7 A;  1YUT A;  1TOP A;  1C7V A;  1UUS A;  1M45 A;  1SNL A;  1J7R A;  1CLM A;  4MZL A;  3BUM B;  1KK8 C;  3BUN B;  1JBA A;  3RM1 A;  2CXJ A;  1MF8 B;  1JF2 A;  4MBE A;  1XFX O;  2F8P A;  2JC2 A;  1BT6 A;  1F54 A;  2K7D A;  2KSP A;  2WC8 A;  1B8C A;  1RRO A;  3BOW B;  3IQO A;  3PN7 B;  3AKA A;  2JT0 A;  5BPJ A;  1C7W A;  1S6J A;  1XYD A;  3ICB A;  3JTD B;  1J55 A;  4MN0 A;  2JPT A;  1KWO C;  5AXI A;  3OB1 B;  1QX2 A;  4NDB A;  1E8A A;  2KI4 C;  4DS7 A;  1CMF A;  4CPV A;  1UHK A;  4P2Y B;  2L50 A;  1IJ5 A;  4A4C A;  3IF7 A;  3ZWH A;  1PAL A;  1QAS A;  4TNC A;  3BXK A;  2Y4Q A;  1QLS A;  1Y1X A;  1DJG A;  4ORC B;  2PMY A;  1YUR A;  2M7L A;  1QAT A;  2RGI A;  4GBA A;  2M7N A;  1IQ3 A;  4AOM A;  3LL8 B;  1BR4 B;  2CT9 A;  2WCF A;  1CFC A;  2ZND A;  1LA3 A;  4GNK B;  5CPV A;  2LM5 A;  1GGW A;  2KQY A;  3EKH A;  3EVR A;  1K90 D;  4CFR A;  2BE6 A;  1N0Y A;  3I5I C;  4PHN A;  1DF0 B;  4JQ0 D;  1ZUZ A;  1QIV A;  3NSK A;  4QJ4 B;  2E30 A;  1KFU S;  3EKJ A;  2F33 A;  3SJS A;  4OV2 A;  4MRY A;  1OMV A;  3WNX B;  2L5X B;  2KQ6 A;  1KWO B;  1SR6 B;  1WY9 A;  3D10 A;  1ALW A;  1ZFS A;  4USL A;  2KI4 B;  1GGZ A;  2KFF A;  3LK0 A;  3DVE A;  3TDI A;  1NX1 A;  3VRQ A;  1DJX A;  1R2U A;  1SRA A;  1VRK A;  2M29 A;  4YGE B;  1PVB A;  5HYD A;  2WCE A;  3FWB A;  2HET A;  1KFX L;  4QJ5 B;  1YTZ C;  4HSZ A;  2H61 C;  1SL8 A;  5ER5 A;  1XO5 A;  3D0Y A;  1FI6 A;  1W7I B;  1DTL A;  3VGO A;  3I5H C;  1NUB A;  1XK4 A;  1YRU B;  1RK9 A;  1TNW A;  4MVF A;  4FTG A;  4R1E A;  5JJG A;  1IJ6 A;  1PRW A;  3NSL A;  1QVI Y;  2Y5I A;  4QJ3 B;  1QTX A;  2K2A A;  2MRD A;  3I5I B;  3HCM A;  1OE9 B;  3TS5 C;  2JT3 A;  1ZMZ A;  1UP5 A;  4L9M A;  1H4B A;  4OVN F;  3LK1 A;  3EVV A;  1RTP 1;  1RFJ A;  4IL1 A;  4D1E A;  1S36 A;  2FJU B;  2KGR A;  1F55 A;  1Y6W A;  2G2B A;  2KYF A;  3TUY B;  4PAL A;  1AUI B;  1QX7 A;  3M0W A;  1H8B A;  2PSR A;  2ISD A;  1C07 A;  2F2P A;  3CLN A;  3O2P A;  1OQP A;  4F0Z B;  5KU1 A;  1M31 A;  1JUO A;  2BE4 A;  2JXL A;  4JPZ B;  2LVK A;  3TDU A;  1M63 B;  1QS7 A;  2LLT A;  1YUS A;  3OX5 A;  3FIA A;  2AUC A;  2M97 A;  4YGB B;  3NXA A;  4NDC A;  4ZCU A;  2LCP A;  3DF0 A;  2KAX A;  4HRE E;  3I5H B;  1WRZ A;  4ICB A;  1KSM A;  1OOJ A;  1Q80 A;  2BCB A;  3KPX A;  1LIN A;  1CMG A;  2I2R E;  1WDC C;  1S5G Z;  1TNQ A;  3RLZ A;  3H4S E;  4WRI A;  1NWD A;  3OP0 A;  4YBH B;  3AAK A;  1EXR A;  3CR5 X;  5KSZ A;  1DJZ A;  4YI9 A;  1LKJ A;  2JWW A;  2LHI A;  3CR2 A;  3PFV A;  2LNK A;  5HKY A;  1NSH A;  2KBI A;  2LLU A;  2ZRS A;  4Q04 A;  1KSO A;  2BBM A;  2NCP A;  3KF9 A;  1KQM B;  1BR1 B;  1WRL A;  4MEW A;  5D69 A;  1YVL A;  4GPL B;  1QLK A;  1V1F A;  1B47 A;  2EC6 C;  2QPT A;  4M2Q A;  2MBX A;  2LV7 A;  1B7T Z;  1JC2 A;  5D7F A;  1SKT A;  2OTG B;  1SY9 A;  2I7A A;  2CBL A;  3CS1 A;  1SMG A;  1TTX A;  1XFW O;  1L2O C;  3FWC A;  1S1E A;  1QV0 A;  3OB2 B;  1XK4 C;  1QX5 B;  2LVI A;  1K9U A;  1YVH A;  2VRG A;  1YX8 A;  3PSR A;  4U8D A;  4ORA B;  5I2Q A;  2A4J A;  1U5I B;  2H2K A;  5FYX A;  3JVT B;  2EGD A;  3DVK A;  5CSI A;  1A75 A;  2GV5 A;  4HRH A;  1MQ1 A;  4MRX A;  2BCA A;  5HLV A;  2ZRT A;  4OKH A;  4AQJ A;  2B1U A;  4MLW A;  5HLO A;  1BJF A;  1BG1 A;  3VRR A;  4YRU A;  3CGA A;  1KFX S;  3I5F C;  1DGV A;  1KK7 Y;  1S26 D;  3GK4 X;  2JTZ A;  1UWO A;  2ZFD A;  1IWQ A;  3O6B A;  4DRW A;  4I5L B;  1IGV A;  1K94 A;  1KK8 B;  2BKH B;  1B8L A;  2MLF C;  4MZK A;  2CCM A;  2Q91 A;  4AQI A;  4XJK B;  4PHK A;  4HRG A;  1PUL A;  2LP2 A;  4ETO A;  3D0Y B;  2OPO A;  1CLL A;  1Y0V H;  1L2O B;  1PSR A;  2BL0 C;  2LUC A;  1AP4 A;  2KBM A;  2Q4U A;  2LC5 A;  1Y1U A;  4DCK A;  1CNP A;  2JTT A;  5HKZ A;  3BOW A;  1MXL C;  2M49 B;  1HQV A;  1GQM A;  5DKN A;  1QXP A;  1EG4 A;  2O5G A;  5CSN A;  1CFP A;  2HQ8 A;  1UHJ A;  3BUW B;  1CLB A;  1V1G A;  3HX4 A;  1ZOT B;  1S6C A;  1B8R A;  2M8U A;  5ER4 X;  2Y1M A;  1M39 A;  1XFZ O;  4BY5 A;  3PAL A;  1LVC D;  1K95 A;  2NCO A;  3I5F B;  1DJY A;  1G8I A;  1Y1A A;  3AAJ A;  4C0K A;  1F4O A;  1QV1 A;  2L4H A;  2MAZ A;  1F71 A;  4I5J A;  1UHH A;  2I18 A;  2GGZ A;  1ALV A;  1JFK A;  1OMR A;  2G9B A;  1LXF C;  1A03 A;  1SCM C;  5F6T A;  1SL9 A;  4MZJ A;  1UHN A;  2JOJ A;  4FQO A;  4OR9 B;  4XYN A;  2OS8 C;  2PRU A;  2BKI B;  3OHM B;  1HT9 A;  2LAN A;  4PCW A;  1MR8 A;  2BL0 B;  2K7C A;  2PAS A;  3I5G C;  4MSP A;  1QVI Z;  1DF0 A;  2M1U A;  1XFV O;  2LLS A;  2LAP A;  4M2O A;  3O78 A;  1SL7 A;  1PSB A;  2JUL A;  1TNX A;  2ZN9 A;  1JWD A;  1WRK A;  1BOC A;  2M0R A;  2QAC A;  3A8R A;  3EK8 A;  2LP3 A;  1ZAC A;  3NSI A;  2LMV A;  3AKB A;  2CNP A;  1DJH A;  2M9G A;  2V53 A;  4UPG A;  4JWQ A;  1AK8 A;  5K89 A;  1SCV A;  4DUQ A;  1IG5 A;  3OX6 A;  1AVS A;  1J7Q A;  2FCE A;  2BEC A;  3PLF B;  3BYA A;  2KI6 D;  1TCF A;  1TRF A;  1DGU A;  3SIB A;  1YX7 A;  1CKK A;  1K93 D;  3TS5 B;  4A4B A;  1FI5 A;  2FOT A;  2WOR A;  3VRN A;  2DOQ A;  2F3Z A;  1MUX A;  1UHI A;  2NXQ A;  4WQ2 A;  3WHU B;  1DMO A;  2TN4 A;  1W7J B;  2KOT A;  1IH0 A;  2LHL A;  1M46 A;  3WXA A;  1EJ3 A;  2MA2 A;  2JQ6 A;  3K21 A;  2L4I A;  2K2F A;  2JU0 A;  2PVB A;  1TCO B;  1FBV A;  4PDZ A;  1GJY A;  2ZKM X;  1IKU A;  2WND A;  3JTD C;  1A75 B;  1N2D A;  2JXC A;  3GOF A;  1YUU A;  1G33 A;  1S6I A;  1CM1 A;  1A4P A;  1K96 A;  2O60 A;  2WCB A;  2L0P A;  2M3W A;  1XFU O;  3DVJ A;  5AAN A;  1K9P A;  3A4U B;  1CTR A;  3DVM A;  2EHB A;  1RJV A;  3C1V A;  4ORB B;  2K0J A;  2CTN A;  2PAL A;  4GUK A;  3F45 A;  4C0L A;  2H61 A;  2HQW A;  2JNF A;  3EK7 A;  1B1G A;  1CM4 A;  4NDD A;  1LA0 A;  1WDC B;  2ZN8 A;  1KCY A;  3KHE A;  1PK0 D;  4WQ3 A;  3PM8 A;  2KYC A;  3PAT A;  5CSJ A;  5AEQ A;  1REC A;  3TDZ A;  2JZI A;  5IBW A;  1EH2 A;  1NCX A;  3QRX A;  2JNX A;  4YGC B;  4CFQ A;  2L51 A;  1FF1 A;  2LVV A;  3LLE A;  1EG3 A;  1NX3 A;  1UUR A;  3GK1 A;  1NX0 A;  3WHT B;  1IRJ A;  1JFJ A;  4ZCV A;  1A2X A;  1XA5 A;  5AER A;  5PAL A;  2EC6 B;  3EVU A;  2GGM A;  4GGF A;  1XVJ A;  3LCP C;  1SR6 C;  1EL4 A;  3NSO A;  1NX2 A;  1F8H A;  1J7O A;  2WOS A;  1KK7 Z;  2LMU A;  1QJT A;  3SIA A;  1QIW A;  3IQQ A;  5KTY A;  1KQV A;  1AJ4 A;  5I2L A;  1CDM A;  2KNE A;  2JRF A;  2MLE C;  5GQQ C;  3O4Y A;  2P6B B;  1SK6 D;  1WLZ A;  2AAO A;  1B4C A;  1D1O A;  1NCZ A;  5DKQ A;  2K61 A;  4C0J A;  4PHJ A;  1NIW A;  2AMI A;  3SG6 A;  2E6W A;  1NPQ A;  2JT8 A;  4CID A;  2K7O A;  2SCP A;  4DIR A;  1CDN A;  2KI6 C;  1U5I A;  2L2E A;  1DJI A;  2KAV A;  2M1K B;  3MSE B;  1FPW A;  5CSF A;  1FW4 A;  1YRT B;  1SBJ A;  1DVI A;  3TUY C;  1NYA A;  2KAY A;  2LE9 B;  4YI8 A;  3SG3 A;  4E68 A;  4GAO A;  4NQG A;  1AHR A;  1CB1 A;  3CWG A;  4GGN A;  1DJW A;  1CFF A;  2LMT A;  4PE1 A;  1CDL A;  5I8N A;  4I5N B;  2D8N A;  3KEV A;  1G4Y R;  3DD4 A;  5DKR A;  3DF0 B;  5HKW A;  3SG2 A;  3TZ1 A;  4XJK A;  2KFG A;  2KFH A;  2LVJ A;  1SYM A;  3KO0 A; 
#chains in the Genus database with same CATH topology
 4N1G A;  1Z4H A;  2KHN A;  1BMO A;  4N5X A;  1J1D A;  1A29 A;  3D73 A;  4BY4 A;  2KGB C;  4CLN A;  1F4Q A;  1L7Z A;  1KFU L;  1OSA A;  1P28 A;  2L98 A;  2WCK A;  3VRP A;  4I5K A;  5G08 A;  1NP8 A;  4KYN A;  2F3Y A;  3BUO B;  3BQ3 A;  2KDH A;  5TNC A;  1N65 A;  3D77 A;  3EK4 A;  1BOD A;  2FCD A;  2BBN A;  1CDP A;  5B8I B;  2K7B A;  2I94 A;  1MHO A;  1OZS A;  3QME A;  4PE7 A;  1IQ5 A;  1K2H A;  1SPY A;  2BCX A;  3FS7 A;  3BUX B;  1ODB A;  4GGF C;  5FI7 A;  1KQM C;  1SW8 A;  1SCM B;  2MHH A;  4GFT A;  1CFD A;  2R2I A;  3CR4 X;  2COL B;  3CZT X;  5I2O A;  1J7P A;  1JSA A;  2ZNE A;  4N1F A;  2HPS A;  1AJ5 A;  2K8M B;  4P5O E;  2OS8 B;  1S3P A;  1MWN A;  2MJW B;  1OZO A;  3SG4 A;  1K8U A;  3VB1 A;  3I5G B;  1J1E A;  2OTG C;  1YR5 A;  5J3X A;  1DC1 A;  1F70 A;  1S5G Y;  2Y1N A;  1JF0 A;  1XFY O;  3PN7 C;  4PHM A;  1BF5 A;  3VRO A;  1K9K A;  1TN4 A;  1WLM A;  2K60 A;  3K1E A;  5JOL A;  1TIZ A;  2LUX A;  1BLQ A;  3GK2 A;  1X02 A;  1MXE A;  2IS9 A;  3CTN A;  3DY9 A;  4YGD B;  3E3R A;  4OCI A;  1R6P A;  2SAS A;  4YGA A;  1NCY A;  4PE0 A;  5AFP A;  3JVT C;  1OMD A;  1TNP A;  3DZT A;  4M2P A;  1PVA A;  2NLN A;  1B9A A;  4PE4 A;  1RWY A;  1DT7 B;  1BU3 A;  2F2O A;  1B7T Y;  2HF5 A;  2NZ0 A;  3SG5 A;  2H8V A;  3ZNI A;  1QWV A;  1OOI X;  2L2C A;  3SG7 A;  1YUT A;  1TOP A;  1C7V A;  1UUS A;  1M45 A;  1SNL A;  1J7R A;  1CLM A;  4MZL A;  3BUM B;  1KK8 C;  3BUN B;  3CAB A;  1JBA A;  3RM1 A;  2CXJ A;  1MF8 B;  1JF2 A;  1TUZ A;  3CZ0 A;  1XFX O;  2F8P A;  2JC2 A;  4MBE A;  1BT6 A;  1F54 A;  2K7D A;  2KSP A;  2WC8 A;  1B8C A;  1RRO A;  3BOW B;  3IQO A;  3PN7 B;  3AKA A;  2JT0 A;  3R72 A;  5BPJ A;  1C7W A;  1S6J A;  1XYD A;  3ICB A;  3JTD B;  1J55 A;  4MN0 A;  2JPT A;  1KWO C;  5AXI A;  3OB1 B;  1QX2 A;  4NDB A;  1E8A A;  2KI4 C;  3NGV A;  4DS7 A;  1CMF A;  4CPV A;  1T14 A;  1UHK A;  2L50 A;  1IJ5 A;  4P2Y B;  3IF7 A;  4A4C A;  3ZWH A;  1PAL A;  1QAS A;  4TNC A;  3BXK A;  2Y4Q A;  1QLS A;  1Y1X A;  1DJG A;  3D76 A;  4ORC B;  2PMY A;  1YUR A;  3CZ2 A;  3R1O A;  2M7L A;  1QAT A;  2RGI A;  4GBA A;  2PYQ A;  2M7N A;  5EL2 A;  1IQ3 A;  2WCH A;  4AOM A;  3LL8 B;  1BR4 B;  2CT9 A;  2WCF A;  3D75 A;  1Z2C B;  1CFC A;  2ZND A;  1LA3 A;  4GNK B;  5CPV A;  3RZS A;  2LM5 A;  2QEB A;  1GGW A;  2KQY A;  3EKH A;  3EVR A;  1K90 D;  4CFR A;  3R1V A;  1N0Y A;  2BE6 A;  3I5I C;  4PHN A;  1DF0 B;  4JQ0 D;  1ZUZ A;  1QIV A;  1SSE B;  3NSK A;  2E30 A;  1KFU S;  4QJ4 B;  3EKJ A;  1OW4 A;  2F33 A;  5I94 A;  3SJS A;  4OV2 A;  2KLD A;  4MRY A;  3SS4 A;  1OMV A;  3FE6 A;  3WNX B;  2L5X B;  2KQ6 A;  1KWO B;  1SR6 B;  1WY9 A;  3D10 A;  1ALW A;  1ZFS A;  4USL A;  2KI4 B;  1GGZ A;  2KFF A;  3LK0 A;  3DVE A;  3SS3 A;  3TDI A;  1NX1 A;  2PQL A;  3VRQ A;  1DJX A;  1R2U A;  1SRA A;  1VRK A;  2M29 A;  4YGE B;  1PVB A;  1TUJ A;  5HYD A;  2WCE A;  3FWB A;  2HET A;  1KFX L;  4QJ5 B;  1YTZ C;  4HSZ A;  2H61 C;  2JPO A;  1SL8 A;  5ER5 A;  1XO5 A;  3BJH A;  3D0Y A;  1C3Y A;  1FI6 A;  1W7I B;  3CDN A;  1DTL A;  3VGO A;  3I5H C;  1NUB A;  1XK4 A;  3FE9 A;  1YRU B;  1RK9 A;  1TNW A;  4MVF A;  4FTG A;  4R1E A;  5JJG A;  1IJ6 A;  1PRW A;  3NSL A;  1QVI Y;  2Y5I A;  4QJ3 B;  1QTX A;  2K2A A;  2MRD A;  3I5I B;  3HCM A;  1OE9 B;  3TS5 C;  2JT3 A;  1ZMZ A;  1UP5 A;  4L9M A;  1H4B A;  4OVN F;  3LK1 A;  3EVV A;  1RTP 1;  1RFJ A;  4IL1 A;  4D1E A;  1S36 A;  2FJU B;  2KGR A;  1F55 A;  1Y6W A;  2G2B A;  2KYF A;  3TUY B;  4PAL A;  1AUI B;  1QX7 A;  3M0W A;  1H8B A;  2PSR A;  2ISD A;  1C07 A;  2F2P A;  3CLN A;  3O2P A;  1OQP A;  3B88 A;  4F0Z B;  5KU1 A;  2KPH A;  1M31 A;  1JUO A;  2BE4 A;  2JXL A;  4JPZ B;  2LVK A;  3TDU A;  1M63 B;  1QS7 A;  2LLT A;  1YUS A;  1DEL A;  3FIA A;  3OX5 A;  2AUC A;  2M97 A;  1W9Z A;  4YGB B;  2P71 A;  3NXA A;  2BNX A;  4NDC A;  4ZCU A;  2LCP A;  3DF0 A;  2KAX A;  4HRE E;  2QEV A;  3I5H B;  1WRZ A;  5D3O A;  4ICB A;  1KSM A;  1OOJ A;  1Q80 A;  2BCB A;  3KPX A;  1LIN A;  1CMG A;  2I2R E;  1WDC C;  1S5G Z;  1TNQ A;  3RLZ A;  3CYZ A;  3H4S E;  4WRI A;  1NWD A;  3OP0 A;  4YBH B;  3AAK A;  4F7F A;  1EXR A;  3CR5 X;  5KSZ A;  1DJZ A;  4YI9 A;  1LKJ A;  2JWW A;  2LHI A;  3CR2 A;  3PFV A;  2LNK A;  3FE8 A;  5HKY A;  1NSH A;  2KBI A;  2LLU A;  2ZRS A;  1XFR A;  4Q04 A;  3S0E A;  1KSO A;  2BBM A;  1OOH A;  2NCP A;  3KF9 A;  1KQM B;  4INX A;  1BR1 B;  1WRL A;  4MEW A;  5D69 A;  1YVL A;  2BAP A;  4GPL B;  1QLK A;  1V1F A;  1B47 A;  2EC6 C;  2ERB A;  2QPT A;  4M2Q A;  2MBX A;  2LV7 A;  1B7T Z;  1JC2 A;  5D7F A;  1SKT A;  2OTG B;  1SY9 A;  2I7A A;  2CBL A;  3CS1 A;  1SMG A;  1TTX A;  1XFW O;  2QDI A;  1L2O C;  3FWC A;  1S1E A;  1QV0 A;  3OB2 B;  1XK4 C;  1QX5 B;  2LVI A;  1K9U A;  1YVH A;  2VRG A;  1YX8 A;  3PSR A;  4U8D A;  4ORA B;  5I2Q A;  2A4J A;  1U5I B;  2H2K A;  5FYX A;  3JVT B;  3DXL A;  2EGD A;  3DVK A;  5CSI A;  3S0F A;  1A75 A;  2GV5 A;  4HRH A;  1MQ1 A;  3PM2 A;  4MRX A;  2BCA A;  3S0B A;  5HLV A;  2ZRT A;  4OKH A;  4AQJ A;  2B1U A;  4MLW A;  5HLO A;  1BJF A;  1BG1 A;  3VRR A;  4YRU A;  2GTE A;  3CGA A;  1KFX S;  3D78 A;  3I5F C;  1DGV A;  1KK7 Y;  1S26 D;  3PJI A;  3GK4 X;  4JKT A;  2JTZ A;  1UWO A;  2ZFD A;  1IWQ A;  3O6B A;  4DRW A;  4I5L B;  1IGV A;  1K94 A;  1KK8 B;  2BKH B;  1B8L A;  2MLF C;  4MZK A;  5FI6 A;  2CCM A;  2Q91 A;  4AQI A;  4XJK B;  4PHK A;  4HRG A;  1PUL A;  2LP2 A;  3UNW A;  4ETO A;  3D0Y B;  4INW A;  2OPO A;  1CLL A;  1Y0V H;  3O4X A;  1L2O B;  1C3Z A;  1PSR A;  2BL0 C;  2LUC A;  3NHT A;  2KBM A;  1AP4 A;  2Q4U A;  2LC5 A;  1Y1U A;  4DCK A;  1CNP A;  2JTT A;  5HKZ A;  3BOW A;  1MXL C;  2M49 B;  1HQV A;  1GQM A;  5DKN A;  1QXP A;  1EG4 A;  2O5G A;  5CSN A;  1CFP A;  2HQ8 A;  1UHJ A;  3BUW B;  1CLB A;  1V1G A;  3HX4 A;  1ZOT B;  1S6C A;  1B8R A;  3EG5 B;  2M8U A;  3BFH A;  5ER4 X;  2Y1M A;  1M39 A;  1XFZ O;  4BY5 A;  3PAL A;  1LVC D;  1K95 A;  3B87 A;  2NCO A;  3I5F B;  1DJY A;  1G8I A;  1Y1A A;  3AAJ A;  4C0K A;  1F4O A;  1QV1 A;  2L4H A;  2MAZ A;  1F71 A;  4I5J A;  1UHH A;  3BFB A;  2I18 A;  3OGN A;  2GGZ A;  1ALV A;  1JFK A;  3CZ1 A;  1OMR A;  2G9B A;  1LXF C;  3D74 A;  1A03 A;  1SCM C;  5F6T A;  1SL9 A;  4MZJ A;  3DYE A;  1UHN A;  2JOJ A;  4FQO A;  4OR9 B;  4XYN A;  2OS8 C;  2PRU A;  2BKI B;  3OHM B;  1HT9 A;  2LAN A;  5DIC A;  3S0A A;  4PCW A;  1MR8 A;  2BL0 B;  2K7C A;  2PAS A;  3I5G C;  4MSP A;  1QVI Z;  1DF0 A;  2M1U A;  1XFV O;  2LLS A;  2LAP A;  4M2O A;  3O78 A;  1SL7 A;  1PSB A;  2JUL A;  1TNX A;  2ZN9 A;  3NHI A;  1WRK A;  1BOC A;  2M0R A;  1JWD A;  3UO9 A;  2QAC A;  3A8R A;  3EK8 A;  2LP3 A;  1ZAC A;  3NSI A;  2LMV A;  3AKB A;  2CNP A;  1DJH A;  2M9G A;  2V53 A;  4UPG A;  4JWQ A;  1AK8 A;  2WCL A;  5K89 A;  1SCV A;  4DUQ A;  1IG5 A;  3OX6 A;  3B86 A;  3S0D A;  1AVS A;  1J7Q A;  2FCE A;  2BEC A;  3PLF B;  3BYA A;  2KI6 D;  1TCF A;  1TRF A;  1DGU A;  3OBV A;  5HL1 A;  3SIB A;  1YX7 A;  1CKK A;  1K93 D;  3TS5 B;  4A4B A;  1FI5 A;  2FOT A;  2WOR A;  3VRN A;  2DOQ A;  2F3Z A;  1MUX A;  1UHI A;  2NXQ A;  4WQ2 A;  3WHU B;  1DMO A;  2TN4 A;  1W7J B;  2KOT A;  2QEO A;  3R1P A;  2KLE A;  2LHL A;  3L4A A;  1M46 A;  3WXA A;  3SS5 A;  1EJ3 A;  1IH0 A;  2MA2 A;  2JQ6 A;  3K21 A;  2L4I A;  2WCM A;  4JD9 A;  2K2F A;  2JU0 A;  2PVB A;  2QEH A;  1TCO B;  1FBV A;  1LS8 A;  4PDZ A;  1GJY A;  2ZKM X;  3BFA A;  5FI2 A;  1OOG A;  1IKU A;  2WND A;  3JTD C;  1A75 B;  1N2D A;  2JXC A;  3GOF A;  1YUU A;  1G33 A;  1S6I A;  1CM1 A;  1ORG A;  2P70 A;  1A4P A;  1K96 A;  2O60 A;  1DEK A;  2WCB A;  2WC6 A;  2L0P A;  2M3W A;  2YGU A;  1XFU O;  3DVJ A;  5AAN A;  1K9P A;  3A4U B;  1CTR A;  3DVM A;  2EHB A;  1RJV A;  3C1V A;  4ORB B;  2K0J A;  2CTN A;  2PAL A;  4GUK A;  3F45 A;  4C0L A;  2H61 A;  2HQW A;  2JNF A;  3EK7 A;  1B1G A;  1CM4 A;  4NDD A;  1LA0 A;  1WDC B;  2ZN8 A;  1KCY A;  3KHE A;  3B6X A;  1PK0 D;  4WQ3 A;  3PM8 A;  2KYC A;  3PAT A;  5CSJ A;  5AEQ A;  1REC A;  3TDZ A;  2JZI A;  5IBW A;  1EH2 A;  1NCX A;  3QRX A;  2JNX A;  4YGC B;  4CFQ A;  3Q8I A;  2L51 A;  3IVT A;  1FF1 A;  2LVV A;  3LLE A;  3N7H A;  1EG3 A;  1NX3 A;  1UUR A;  3GK1 A;  1NX0 A;  3WHT B;  1IRJ A;  1JFJ A;  4ZCV A;  1A2X A;  1XA5 A;  5AER A;  5PAL A;  2EC6 B;  3EVU A;  4OZD A;  2GGM A;  4GGF A;  1XVJ A;  3LCP C;  1SR6 C;  1EL4 A;  3NSO A;  1NX2 A;  2WC5 A;  3B7A A;  1F8H A;  1J7O A;  2WOS A;  1KK7 Z;  2LMU A;  1QJT A;  3SIA A;  1QIW A;  3IQQ A;  5KTY A;  1KQV A;  1AJ4 A;  5I2L A;  1CDM A;  4FQT A;  2KNE A;  2JRF A;  2MLE C;  5GQQ C;  3O4Y A;  1DQE A;  2P6B B;  1SK6 D;  1WLZ A;  2AAO A;  1B4C A;  4PT1 A;  1D1O A;  1NCZ A;  3S0G A;  5DKQ A;  2K61 A;  4C0J A;  1IIO A;  4PHJ A;  1NIW A;  1OOF A;  2AMI A;  3SG6 A;  2L5Y A;  2E6W A;  1NPQ A;  2JT8 A;  4CID A;  2K7O A;  2FJY A;  2SCP A;  4DIR A;  1CDN A;  2KI6 C;  3L4L A;  1U5I A;  2L2E A;  1DJI A;  2KAV A;  2M1K B;  3MSE B;  1FPW A;  5CSF A;  1FW4 A;  1YRT B;  1SBJ A;  1DVI A;  4IJ7 A;  1NYA A;  3TUY C;  2KAY A;  2LE9 B;  4YI8 A;  3SG3 A;  4E68 A;  4GAO A;  4NQG A;  1AHR A;  1CB1 A;  3CWG A;  4GGN A;  1DJW A;  1CFF A;  2LMT A;  4PE1 A;  1CDL A;  5I8N A;  4I5N B;  2D8N A;  3KEV A;  3L47 A;  1G4Y R;  2WCJ A;  3DD4 A;  5DKR A;  3V2L A;  1GM0 A;  3DF0 B;  5HKW A;  3SG2 A;  3TZ1 A;  4XJK A;  2KFG A;  2KFH A;  2LVJ A;  1TWO A;  1SYM A;  3KO0 A; 
#chains in the Genus database with same CATH homology
 4N1G A;  2KHN A;  1BMO A;  4N5X A;  1J1D A;  1A29 A;  4BY4 A;  2KGB C;  4CLN A;  1F4Q A;  1L7Z A;  1KFU L;  1OSA A;  2L98 A;  3VRP A;  4I5K A;  5G08 A;  1NP8 A;  2F3Y A;  3BUO B;  3BQ3 A;  2KDH A;  5TNC A;  1N65 A;  3EK4 A;  1BOD A;  2FCD A;  2BBN A;  1CDP A;  5B8I B;  2K7B A;  2I94 A;  1MHO A;  1OZS A;  4PE7 A;  1IQ5 A;  1K2H A;  1SPY A;  2BCX A;  3FS7 A;  3BUX B;  1ODB A;  4GGF C;  1KQM C;  1SW8 A;  1SCM B;  2MHH A;  4GFT A;  1CFD A;  2R2I A;  3CR4 X;  2COL B;  3CZT X;  5I2O A;  1J7P A;  1JSA A;  2ZNE A;  4N1F A;  2HPS A;  1AJ5 A;  2K8M B;  4P5O E;  2OS8 B;  1S3P A;  1MWN A;  2MJW B;  1OZO A;  3SG4 A;  1K8U A;  3I5G B;  1J1E A;  2OTG C;  1YR5 A;  5J3X A;  1F70 A;  1S5G Y;  2Y1N A;  1JF0 A;  1XFY O;  3PN7 C;  4PHM A;  1BF5 A;  3VRO A;  1K9K A;  1TN4 A;  1WLM A;  5JOL A;  1TIZ A;  2LUX A;  1BLQ A;  3GK2 A;  1X02 A;  1MXE A;  2IS9 A;  3CTN A;  4YGD B;  3E3R A;  4OCI A;  1R6P A;  2SAS A;  4YGA A;  1NCY A;  4PE0 A;  5AFP A;  3JVT C;  1OMD A;  1TNP A;  4M2P A;  1PVA A;  2NLN A;  1B9A A;  4PE4 A;  1RWY A;  1DT7 B;  1BU3 A;  2F2O A;  1B7T Y;  2HF5 A;  2NZ0 A;  3SG5 A;  3ZNI A;  3SG7 A;  1YUT A;  1TOP A;  1C7V A;  1UUS A;  1M45 A;  1SNL A;  1J7R A;  1CLM A;  4MZL A;  3BUM B;  1KK8 C;  3BUN B;  1JBA A;  3RM1 A;  2CXJ A;  1MF8 B;  1JF2 A;  4MBE A;  1XFX O;  2F8P A;  2JC2 A;  1BT6 A;  1F54 A;  2K7D A;  2KSP A;  2WC8 A;  1B8C A;  1RRO A;  3BOW B;  3IQO A;  3PN7 B;  3AKA A;  2JT0 A;  5BPJ A;  1C7W A;  1S6J A;  1XYD A;  3ICB A;  3JTD B;  1J55 A;  4MN0 A;  2JPT A;  1KWO C;  5AXI A;  3OB1 B;  1QX2 A;  4NDB A;  1E8A A;  2KI4 C;  4DS7 A;  1CMF A;  4CPV A;  1UHK A;  4P2Y B;  2L50 A;  1IJ5 A;  4A4C A;  3IF7 A;  3ZWH A;  1PAL A;  1QAS A;  4TNC A;  3BXK A;  2Y4Q A;  1QLS A;  1Y1X A;  1DJG A;  4ORC B;  2PMY A;  1YUR A;  2M7L A;  1QAT A;  2RGI A;  4GBA A;  2M7N A;  1IQ3 A;  4AOM A;  3LL8 B;  1BR4 B;  2CT9 A;  2WCF A;  1CFC A;  2ZND A;  1LA3 A;  4GNK B;  5CPV A;  2LM5 A;  1GGW A;  2KQY A;  3EKH A;  3EVR A;  1K90 D;  4CFR A;  2BE6 A;  1N0Y A;  3I5I C;  4PHN A;  1DF0 B;  4JQ0 D;  1ZUZ A;  1QIV A;  3NSK A;  4QJ4 B;  2E30 A;  1KFU S;  3EKJ A;  2F33 A;  3SJS A;  4OV2 A;  4MRY A;  1OMV A;  3WNX B;  2L5X B;  2KQ6 A;  1KWO B;  1SR6 B;  1WY9 A;  3D10 A;  1ALW A;  1ZFS A;  4USL A;  2KI4 B;  1GGZ A;  2KFF A;  3LK0 A;  3DVE A;  3TDI A;  1NX1 A;  3VRQ A;  1DJX A;  1R2U A;  1SRA A;  1VRK A;  2M29 A;  4YGE B;  1PVB A;  5HYD A;  2WCE A;  3FWB A;  2HET A;  1KFX L;  4QJ5 B;  1YTZ C;  4HSZ A;  2H61 C;  1SL8 A;  5ER5 A;  1XO5 A;  3D0Y A;  1FI6 A;  1W7I B;  1DTL A;  3VGO A;  3I5H C;  1NUB A;  1XK4 A;  1YRU B;  1RK9 A;  1TNW A;  4MVF A;  4FTG A;  4R1E A;  5JJG A;  1IJ6 A;  1PRW A;  3NSL A;  1QVI Y;  2Y5I A;  4QJ3 B;  1QTX A;  2K2A A;  2MRD A;  3I5I B;  3HCM A;  1OE9 B;  3TS5 C;  2JT3 A;  1ZMZ A;  1UP5 A;  4L9M A;  1H4B A;  4OVN F;  3LK1 A;  3EVV A;  1RTP 1;  1RFJ A;  4IL1 A;  4D1E A;  1S36 A;  2FJU B;  2KGR A;  1F55 A;  1Y6W A;  2G2B A;  2KYF A;  3TUY B;  4PAL A;  1AUI B;  1QX7 A;  3M0W A;  1H8B A;  2PSR A;  2ISD A;  1C07 A;  2F2P A;  3CLN A;  3O2P A;  1OQP A;  4F0Z B;  5KU1 A;  1M31 A;  1JUO A;  2BE4 A;  2JXL A;  4JPZ B;  2LVK A;  3TDU A;  1M63 B;  1QS7 A;  2LLT A;  1YUS A;  3OX5 A;  3FIA A;  2AUC A;  2M97 A;  4YGB B;  3NXA A;  4NDC A;  4ZCU A;  2LCP A;  3DF0 A;  2KAX A;  4HRE E;  3I5H B;  1WRZ A;  4ICB A;  1KSM A;  1OOJ A;  1Q80 A;  2BCB A;  3KPX A;  1LIN A;  1CMG A;  2I2R E;  1WDC C;  1S5G Z;  1TNQ A;  3RLZ A;  3H4S E;  4WRI A;  1NWD A;  3OP0 A;  4YBH B;  3AAK A;  1EXR A;  3CR5 X;  5KSZ A;  1DJZ A;  4YI9 A;  1LKJ A;  2JWW A;  2LHI A;  3CR2 A;  3PFV A;  2LNK A;  5HKY A;  1NSH A;  2KBI A;  2LLU A;  2ZRS A;  4Q04 A;  1KSO A;  2BBM A;  2NCP A;  3KF9 A;  1KQM B;  1BR1 B;  1WRL A;  4MEW A;  5D69 A;  1YVL A;  4GPL B;  1QLK A;  1V1F A;  1B47 A;  2EC6 C;  2QPT A;  4M2Q A;  2MBX A;  2LV7 A;  1B7T Z;  1JC2 A;  5D7F A;  1SKT A;  2OTG B;  1SY9 A;  2I7A A;  2CBL A;  3CS1 A;  1SMG A;  1TTX A;  1XFW O;  1L2O C;  3FWC A;  1S1E A;  1QV0 A;  3OB2 B;  1XK4 C;  1QX5 B;  2LVI A;  1K9U A;  1YVH A;  2VRG A;  1YX8 A;  3PSR A;  4U8D A;  4ORA B;  5I2Q A;  2A4J A;  1U5I B;  2H2K A;  5FYX A;  3JVT B;  2EGD A;  3DVK A;  5CSI A;  1A75 A;  2GV5 A;  4HRH A;  1MQ1 A;  4MRX A;  2BCA A;  5HLV A;  2ZRT A;  4OKH A;  4AQJ A;  2B1U A;  4MLW A;  5HLO A;  1BJF A;  1BG1 A;  3VRR A;  4YRU A;  3CGA A;  1KFX S;  3I5F C;  1DGV A;  1KK7 Y;  1S26 D;  3GK4 X;  2JTZ A;  1UWO A;  2ZFD A;  1IWQ A;  3O6B A;  4DRW A;  4I5L B;  1IGV A;  1K94 A;  1KK8 B;  2BKH B;  1B8L A;  2MLF C;  4MZK A;  2CCM A;  2Q91 A;  4AQI A;  4XJK B;  4PHK A;  4HRG A;  1PUL A;  2LP2 A;  4ETO A;  3D0Y B;  2OPO A;  1CLL A;  1Y0V H;  1L2O B;  1PSR A;  2BL0 C;  2LUC A;  1AP4 A;  2KBM A;  2Q4U A;  2LC5 A;  1Y1U A;  4DCK A;  1CNP A;  2JTT A;  5HKZ A;  3BOW A;  1MXL C;  2M49 B;  1HQV A;  1GQM A;  5DKN A;  1QXP A;  1EG4 A;  2O5G A;  5CSN A;  1CFP A;  2HQ8 A;  1UHJ A;  3BUW B;  1CLB A;  1V1G A;  3HX4 A;  1ZOT B;  1S6C A;  1B8R A;  2M8U A;  5ER4 X;  2Y1M A;  1M39 A;  1XFZ O;  4BY5 A;  3PAL A;  1LVC D;  1K95 A;  2NCO A;  3I5F B;  1DJY A;  1G8I A;  1Y1A A;  3AAJ A;  4C0K A;  1F4O A;  1QV1 A;  2L4H A;  2MAZ A;  1F71 A;  4I5J A;  1UHH A;  2I18 A;  2GGZ A;  1ALV A;  1JFK A;  1OMR A;  2G9B A;  1LXF C;  1A03 A;  1SCM C;  5F6T A;  1SL9 A;  4MZJ A;  1UHN A;  2JOJ A;  4FQO A;  4OR9 B;  4XYN A;  2OS8 C;  2PRU A;  2BKI B;  3OHM B;  1HT9 A;  2LAN A;  4PCW A;  1MR8 A;  2BL0 B;  2K7C A;  2PAS A;  3I5G C;  4MSP A;  1QVI Z;  1DF0 A;  2M1U A;  1XFV O;  2LLS A;  2LAP A;  4M2O A;  3O78 A;  1SL7 A;  1PSB A;  2JUL A;  1TNX A;  2ZN9 A;  1JWD A;  1WRK A;  1BOC A;  2M0R A;  2QAC A;  3A8R A;  3EK8 A;  2LP3 A;  1ZAC A;  3NSI A;  2LMV A;  3AKB A;  2CNP A;  1DJH A;  2M9G A;  2V53 A;  4UPG A;  4JWQ A;  1AK8 A;  5K89 A;  1SCV A;  4DUQ A;  1IG5 A;  3OX6 A;  1AVS A;  1J7Q A;  2FCE A;  2BEC A;  3PLF B;  3BYA A;  2KI6 D;  1TCF A;  1TRF A;  1DGU A;  3SIB A;  1YX7 A;  1CKK A;  1K93 D;  3TS5 B;  4A4B A;  1FI5 A;  2FOT A;  2WOR A;  3VRN A;  2DOQ A;  2F3Z A;  1MUX A;  1UHI A;  2NXQ A;  4WQ2 A;  3WHU B;  1DMO A;  2TN4 A;  1W7J B;  2KOT A;  1IH0 A;  2LHL A;  1M46 A;  3WXA A;  1EJ3 A;  2MA2 A;  2JQ6 A;  3K21 A;  2L4I A;  2K2F A;  2JU0 A;  2PVB A;  1TCO B;  1FBV A;  4PDZ A;  1GJY A;  2ZKM X;  1IKU A;  2WND A;  3JTD C;  1A75 B;  1N2D A;  2JXC A;  3GOF A;  1YUU A;  1G33 A;  1S6I A;  1CM1 A;  1A4P A;  1K96 A;  2O60 A;  2WCB A;  2L0P A;  2M3W A;  1XFU O;  3DVJ A;  5AAN A;  1K9P A;  3A4U B;  1CTR A;  3DVM A;  2EHB A;  1RJV A;  3C1V A;  4ORB B;  2K0J A;  2CTN A;  2PAL A;  4GUK A;  3F45 A;  4C0L A;  2H61 A;  2HQW A;  2JNF A;  3EK7 A;  1B1G A;  1CM4 A;  4NDD A;  1LA0 A;  1WDC B;  2ZN8 A;  1KCY A;  3KHE A;  1PK0 D;  4WQ3 A;  3PM8 A;  2KYC A;  3PAT A;  5CSJ A;  5AEQ A;  1REC A;  3TDZ A;  2JZI A;  5IBW A;  1EH2 A;  1NCX A;  3QRX A;  2JNX A;  4YGC B;  4CFQ A;  2L51 A;  1FF1 A;  2LVV A;  3LLE A;  1EG3 A;  1NX3 A;  1UUR A;  3GK1 A;  1NX0 A;  3WHT B;  1IRJ A;  1JFJ A;  4ZCV A;  1A2X A;  1XA5 A;  5AER A;  5PAL A;  2EC6 B;  3EVU A;  2GGM A;  4GGF A;  1XVJ A;  3LCP C;  1SR6 C;  1EL4 A;  3NSO A;  1NX2 A;  1F8H A;  1J7O A;  2WOS A;  1KK7 Z;  2LMU A;  1QJT A;  3SIA A;  1QIW A;  3IQQ A;  5KTY A;  1KQV A;  1AJ4 A;  5I2L A;  1CDM A;  2KNE A;  2JRF A;  2MLE C;  5GQQ C;  3O4Y A;  2P6B B;  1SK6 D;  1WLZ A;  2AAO A;  1B4C A;  1D1O A;  1NCZ A;  5DKQ A;  2K61 A;  4C0J A;  4PHJ A;  1NIW A;  2AMI A;  3SG6 A;  2E6W A;  1NPQ A;  2JT8 A;  4CID A;  2K7O A;  2SCP A;  4DIR A;  1CDN A;  2KI6 C;  1U5I A;  2L2E A;  1DJI A;  2KAV A;  2M1K B;  3MSE B;  1FPW A;  5CSF A;  1FW4 A;  1YRT B;  1SBJ A;  1DVI A;  3TUY C;  1NYA A;  2KAY A;  2LE9 B;  4YI8 A;  3SG3 A;  4E68 A;  4GAO A;  4NQG A;  1AHR A;  1CB1 A;  3CWG A;  4GGN A;  1DJW A;  1CFF A;  2LMT A;  4PE1 A;  1CDL A;  5I8N A;  4I5N B;  2D8N A;  3KEV A;  1G4Y R;  3DD4 A;  5DKR A;  3DF0 B;  5HKW A;  3SG2 A;  3TZ1 A;  4XJK A;  2KFG A;  2KFH A;  2LVJ A;  1SYM A;  3KO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...