1KK7Y

Scallop myosin in the near rigor conformation
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
KLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN, STRIATED MUSCLE
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 23
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Y01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Y02
1YVLA 2L2EA 1U5IA 3NSIA 3I5GC 4N1GA 4ETOA 1OE9B 1CFFA 4ORAB 1OZSA 4MRYA 2F3ZA 2RGIA 1MUXA 3QRXA 1YRUB 4GAOA 4JWQA 5HKZA 5ER5A 4N5XA 2KAXA 1CTRA 3TDIA 4PHMA 2JNXA 1SL8A 1PVBA 1KFXS 3BUMB 4TNCA 1UURA 1KQMC 4QJ4B 4YGDB 3OB2B 3BXKA 1SR6B 4DS7A 3SG2A 5CSNA 4GGNA 1IQ3A 3PN7C 1S3PA 3PLFB 5AANA 4ICBA 2JU0A 1J7PA 3EVRA 4YI8A 1TNXA 1NCYA 2H61A 1Y6WA 2LANA 1YUSA 5CSJA 3TS5C 1YUTA 1NX3A 1TCFA 3VGOA 1CMFA 1N0YA 3EKJA 4UPGA 1TTXA 1Q80A 1L7ZA 1CDPA 1K90D 1OOJA 3SG5A 1EH2A 4JQ0D 1QLSA 1BU3A 3BUOB 2QPTA 1ZACA 4AOMA 1YX8A 2SCPA 4FQOA 4D1EA 1KK8B 3ICBA 4F0ZB 1J1EA 4ORCB 5DKNA 2PALA 1KFUS 3KPXA 3JTDB 2OS8B 2Q91A 1NIWA 5BPJA 1SYMA 2KDHA 4MN0A 2KGBC 1KWOC 2BBNA 2MJWB 2LNKA 2LVJA 2JPTA 1A75B 4DUQA 1NX0A 1A75A 1TRFA 4MEWA 1CLBA 4HREE 1G8IA 1L2OB 2H61C 1R6PA 4XJKB 2KFGA 3O78A 2L4HA 2LLSA 4XJKA 1H4BA 3OHMB 4ZCUA 4PHNA 4DCKA 1K93D 2JRFA 1XFZO 4GUKA 3CR2A 1AHRA 2KI4B 2MRDA 4DIRA 2BE4A 3WNXB 2BECA 2F8PA 2KQYA 2TN4A 1GGZA 2M3WA 4I5JA 1LA0A 2WC8A 1K96A 1JFKA 2MA2A 1MWNA 1C7WA 1S6JA 2VRGA 3MSEB 4PE1A 3CWGA 1IWQA 1RTP1 3SJSA 1KFXL 4CLNA 2OS8C 2AAOA 1S6CA 2BBMA 2M49B 3FWCA 4FTGA 1F55A 2I18A 2K7CA 3KO0A 4YRUA 2KQ6A 1TCOB 1ZFSA 1L2OC 3NSOA 2KFHA 4I5NB 4QJ5B 1HQVA 2LVKA 2QACA 3NSLA 1SPYA 3CTNA 4YGBB 4R1EA 1PVAA 4AQIA 2COLB 1WRLA 1QJTA 2Y5IA 2BCXA 1SL7A 4E68A 1UHNA 4L9MA 1DF0A 2KOTA 2L50A 2PVBA 1F54A 1DT7B 1M46A 2LV7A 2WCBA 2LE9B 4GNKB 2JXCA 1XFVO 1OZOA 5D69A 1CNPA 2R2IA 1NUBA 4BY4A 5CSFA 1K2HA 1KQMB 5D7FA 2KGRA 1FW4A 1K9UA 1QATA 1LINA 1JFJA 1DJYA 1DTLA 3D10A 1MXLC 1SY9A 5AXIA 5TNCA 1JSAA 2L0PA 5HLVA 1G4YR 1WY9A 2KBMA 4WRIA 1TOPA 3DVKA 4MRXA 3PN7B 2A4JA 1SBJA 2BKHB 1XFYO 1D1OA 2PRUA 3VROA 3WXAA 3A4UB 3H4SE 3DF0B 3DF0A 3FIAA 1BODA 3SG7A 3TS5B 3O4YA 1YX7A 5I2OA 1JC2A 1QIWA 1NCZA 3OB1B 3EK8A 1PSBA 1IRJA 1LKJA 1NYAA 5PALA 4P5OE 4YGAA 2KSPA 2MLFC 2K7OA 4NDBA 1WLZA 1JBAA 1SKTA 4PALA 3OX5A 2M7LA 3E3RA 3I5FB 4OKHA 1EG3A 5AFPA 1N65A 4HRHA 2LVIA 3FWBA 2JC2A 2BCBA 1BMOA 2LHIA 3KEVA 4DRWA 2LP2A 3CLNA 1JUOA 3TUYC 1F71A 1JF2A 1SCMC 2M8UA 4U8DA 4PDZA 2JTZA 3F45A 1WLMA 2E30A 1KWOB 2WOSA 4I5KA 1UUSA 1PALA 1CLLA 2KAVA 1QX7A 2I7AA 2LVVA 2M1KB 3RLZA 1S1EA 1QV0A 1NP8A 3OP0A 3JVTC 2WCFA 2JT3A 2LMVA 1S6IA 5AERA 1KQVA 3NXAA 2KNEA 2LP3A 1RECA 1AJ4A 1S26D 2F2PA 1RROA 2HF5A 4PE0A 2FJUB 4C0LA 3PM8A 3I5FC 5ER4X 2JT0A 3HX4A 5HLOA 1M45A 2SASA 1MXEA 1ZOTB 1ZMZA 1DVIA 2KAYA 1UWOA 3BYAA 4YGCB 4PCWA 2LUXA 1XVJA 1Y0VH 4PHJA 4NDDA 3WHTB 2NZ0A 3EK7A 1CDNA 3BUWB 3NSKA 4M2PA 3AKBA 3DVJA 2CXJA 1SK6D 1FI5A 1YTZC 4GFTA 2AMIA 2JWWA 2ZKMX 2FCDA 4OR9B 1B8LA 2JOJA 3IF7A 2K7BA 4JPZB 3GK1A 1XK4A 2K8MB 1UHIA 3A8RA 2JULA 2AUCA 1C07A 5HYDA 1BR1B 1B1GA 1A03A 5HKWA 4NQGA 2HQ8A 1UHKA 2CNPA 1CMGA 3CR4X 1EG4A 2ZRSA 1FPWA 1V1GA 2K2FA 3AAKA 1A2XA 2BCAA 1QX2A 2JNFA 1UHHA 2MAZA 3SG4A 1LA3A 1MF8B 3SG6A 5KSZA 1IJ6A 1BG1A 2ZNDA 1B47A 4GGFA 5AEQA 2WNDA 2Y1NA 1K9KA 4I5LB 1QASA 1M39A 1R2UA 4MZLA 2FCEA 1S36A 1QVIZ 3I5IC 1XK4C 2LHLA 2ZN8A 1CLMA 2NCOA 2P6BB 3ZNIA 1F70A 4OCIA 1PK0D 1OQPA 2WORA 1DF0B 2F3YA 2L98A 3BUNB 3LK0A 5B8IB 1H8BA 1IG5A 3LCPC 3SIBA 2LAPA 4C0JA 2Y4QA 4PE4A 1B4CA 5JJGA 1LXFC 4HSZA 2B1UA 1CM4A 1A29A 1HT9A 1DJGA 3TUYB 2K2AA 1SCMB 2M7NA 3C1VA 4YI9A 1TNQA 1MQ1A 4MZKA 2LUCA 1FBVA 2BE6A 2Q4UA 1VRKA 3KF9A 4CFQA 1B8RA 1BJFA 4M2OA 2L5XB 1YUUA 2V53A 1DJXA 2D8NA 1UP5A 2LMTA 4MBEA 5G08A 1Y1UA 3VRRA 1XO5A 4GGFC 5FYXA 1K94A 1KK7Z 1KFUL 3HCMA 1UHJA 1PSRA 1BT6A 2JZIA 3GK2A 1F4OA 3JVTB 4OV2A 2E6WA 2PASA 2KYCA 1QS7A 1JF0A 1CDMA 3AKAA 2FOTA 1B8CA 3GK4X 1SCVA 3GOFA 5F6TA 2F2OA 3WHUB 1AK8A 4NDCA 3TZ1A 2NLNA 1E8AA 1W7JB 1KSOA 1IKUA 2CCMA 2KFFA 2MBXA 1BLQA 2ZRTA 1PRWA 3CGAA 3CS1A 1QLKA 1YVHA 2GGMA 3EVVA 4CFRA 1DJZA 2EHBA 2ZN9A 3VRNA 1OMVA 2JXLA 3CR5X 1V1FA 3EVUA 3PSRA 1XFUO 2PSRA 1EXRA 1XYDA 1JWDA 4PE7A 1QX5B 3KHEA 4P2YB 4Q04A 1CDLA 3IQOA 1NX2A 3FS7A 3K21A 1J7OA 1AJ5A 1X02A 1WDCC 4YGEB 1EJ3A 4MLWA 2BL0C 2G2BA 1G33A 2HQWA 1NSHA 1LVCD 1KK7Y 1DGVA 3M0WA 1ALWA 3DD4A 2HETA 2GV5A 1NWDA 3BOWB 3BOWA 4CIDA 1J1DA 2IS9A 1DJHA 3D0YB 3D0YA 3I5HC 3LLEA 5JOLA 2KYFA 1XFWO 1FI6A 1GQMA 1SNLA 1OMRA 5GQQC 2OTGC 2MHHA 1Y1AA 4CPVA 2K0JA 1TN4A 2BKIB 1OSAA 2ZFDA 3BQ3A 1IH0A 1CFDA 5CSIA 2LCPA 1SRAA 2K7DA 2M29A 1QIVA 2NCPA 1GJYA 4C0KA 1BF5A 3O6BA 2LM5A 2EC6B 1WRZA 4MSPA 5I8NA 1AVSA 2HPSA 3LK1A 1CM1A 1Y1XA 2I2RE 1MHOA 2L4IA 3I5IB 4HRGA 1XA5A 2CTNA 4PHKA 1CB1A 2CBLA 2CT9A 2LMUA 1N2DA 1IQ5A 1SR6C 1CKKA 1YR5A 1NCXA 2JQ6A 2L51A 2DOQA 1KCYA 1TNPA 1J7QA 1C7VA 2ZNEA 5HKYA 5DKRA 1SW8A 3VRQA 4MVFA 4ZCVA 5I2QA 1MR8A 4OVNF 1EL4A 3EK4A 3AAJA 4YBHB 3LL8B 3PFVA 2H2KA 3SIAA 2G9BA 1PULA 1YURA 4GBAA 1SL9A 5I2LA 3IQQA 3O2PA 2EC6C 2Y1MA 5DKQA 4XYNA 1CFCA 5IBWA 3SG3A 1CFPA 1DMOA 1M31A 1KSMA 4A4CA 2WCEA 1WRKA 1KK8C 2O5GA 4A4BA 1M63B 1TIZA 1B7TZ 2M1UA 5K89A 1K9PA 1S5GZ 1DJIA 1DGUA 3BUXB 4WQ3A 4IL1A 1GGWA 2EGDA 3JTDC 4WQ2A 4AQJA 1OMDA 1QXPA 1ODBA 2O60A 1ALVA 1AUIB 1RJVA 1DJWA 5KU1A 3PATA 2ISDA 2MLEC 1QV1A 3I5GB 4GPLB 1AP4A 3CZTX 1IJ5A 2KHNA 2NXQA 3DVMA 1YRTB 3TDUA 4M2QA 2JT8A 1J7RA 4ORBB 1B9AA 2F33A 3VRPA 1A4PA 5CPVA 2KI6C 3EKHA 2KI6D 1FF1A 1NPQA 1WDCB 1RFJA 2M0RA 4N1FA 4QJ3B 2BL0B 2KI4C 1F4QA 1SMGA 5KTYA 1BR4B 1RK9A 1K8UA 1NX1A 1RWYA 2JTTA 2KBIA 1W7IB 2LC5A 2M97A 1TNWA 1BOCA 1QVIY 3OX6A 3I5HB 1F8HA 2GGZA 1J55A 2M9GA 3PALA 3ZWHA 2PMYA 1B7TY 1K95A 2OTGB 3DVEA 1XFXO 1IGVA 2OPOA 4USLA 2LLTA 4BY5A 2K61A 3TDZA 1S5GY 4MZJA 1ZUZA 2I94A 5J3XA 2LLUA 1QTXA 3RM1A 1U5IB
chains in the Genus database with same CATH superfamily
1YVLA 2L2EA 1U5IA 3NSIA 3I5GC 4N1GA 4ETOA 1OE9B 1CFFA 4ORAB 1OZSA 4MRYA 2F3ZA 2RGIA 3BJHA 1MUXA 3QRXA 1YRUB 4GAOA 4JWQA 5HKZA 5ER5A 4N5XA 2KAXA 1CTRA 3TDIA 4PHMA 2JNXA 1SL8A 1PVBA 1KFXS 3B6XA 3BUMB 4TNCA 1UURA 3R72A 3FE9A 1KQMC 4QJ4B 4YGDB 2PQLA 3OB2B 3BXKA 1SR6B 3N7HA 4DS7A 3CABA 3SG2A 5CSNA 4GGNA 1IQ3A 4KYNA 2PYQA 3PJIA 3PN7C 1S3PA 3PLFB 2QEHA 5AANA 4ICBA 2JU0A 3D78A 1J7PA 3EVRA 4YI8A 1TNXA 1NCYA 2H61A 1Y6WA 2LANA 1YUSA 5CSJA 3TS5C 1YUTA 1NX3A 1TCFA 3VGOA 1CMFA 1N0YA 2WCHA 3EKJA 4UPGA 4JD9A 1TTXA 1Q80A 1L7ZA 3CYZA 1CDPA 1K90D 1OOJA 3SG5A 1EH2A 4JQ0D 1QLSA 1BU3A 3B87A 3BUOB 2QPTA 1ZACA 5FI2A 4AOMA 1YX8A 2SCPA 4FQOA 4D1EA 1KK8B 1QWVA 3ICBA 3CZ1A 4F0ZB 1J1EA 4ORCB 5DKNA 2PALA 1KFUS 2GTEA 3KPXA 3JTDB 2OS8B 2Q91A 1NIWA 5BPJA 1SYMA 2KDHA 4MN0A 3SS3A 2KGBC 1KWOC 2BBNA 2MJWB 2LNKA 2LVJA 2JPTA 1A75B 4DUQA 1NX0A 1A75A 1TRFA 2WCKA 4MEWA 4HREE 1G8IA 1L2OB 2H61C 5HL1A 1CLBA 1R6PA 4XJKB 2KFGA 3O78A 2L4HA 2LLSA 4XJKA 1H4BA 3OHMB 4ZCUA 4PHNA 4DCKA 1K93D 2JRFA 1XFZO 3S0EA 4GUKA 3CR2A 1AHRA 2KI4B 2MRDA 4DIRA 2BE4A 1C3YA 3WNXB 2BECA 2F8PA 1Z2CB 2KQYA 2TN4A 1GGZA 2M3WA 4I5JA 1LA0A 1DEKA 2WC8A 1K96A 1JFKA 2MA2A 1MWNA 1C7WA 1S6JA 2VRGA 3MSEB 4PE1A 1C3ZA 3CWGA 1IWQA 2WCJA 1RTP1 3SJSA 1KFXL 4CLNA 2OS8C 2AAOA 1S6CA 2BBMA 2M49B 3FWCA 4FTGA 1F55A 2I18A 2K7CA 3KO0A 4YRUA 2KQ6A 1TCOB 3IVTA 3D76A 1ZFSA 1L2OC 3NSOA 2KFHA 4I5NB 4QJ5B 1HQVA 2LVKA 2QACA 3NSLA 1SPYA 3CTNA 4YGBB 4R1EA 1PVAA 4AQIA 2COLB 1WRLA 1QJTA 2Y5IA 2BCXA 1SL7A 4E68A 1UHNA 4L9MA 1DF0A 2KOTA 2L50A 2PVBA 1F54A 1DT7B 1M46A 2LV7A 2WCBA 2LE9B 4GNKB 2JXCA 1XFVO 1OZOA 1OOFA 4INWA 4IJ7A 5D69A 1CNPA 2R2IA 1NUBA 2BAPA 5CSFA 4BY4A 1K2HA 1KQMB 2QEVA 5D7FA 2KGRA 1FW4A 1K9UA 1QATA 1LINA 1JFJA 1DJYA 1DTLA 3D10A 1MXLC 1SY9A 5AXIA 5TNCA 1JSAA 2L0PA 5HLVA 1G4YR 1WY9A 2KBMA 4WRIA 1TOPA 3DVKA 4MRXA 3SS4A 3PN7B 2A4JA 1SBJA 2BKHB 1XFYO 1D1OA 3BFAA 2PRUA 3VROA 3WXAA 3A4UB 3H4SE 3DF0B 3DF0A 5FI7A 3FIAA 1BODA 3SG7A 3B88A 1OW4A 3DXLA 3TS5B 3O4YA 1YX7A 5I2OA 1JC2A 1QIWA 1NCZA 3OB1B 3EK8A 3FE6A 3R1OA 1PSBA 1IRJA 1LKJA 1NYAA 5PALA 4P5OE 4YGAA 2KSPA 2MLFC 2K7OA 4NDBA 1WLZA 1JBAA 1SKTA 4PALA 3OX5A 2M7LA 3VB1A 3E3RA 3EG5B 3I5FB 4OKHA 1EG3A 1LS8A 3CZ2A 5AFPA 1N65A 4HRHA 2LVIA 1DC1A 3FWBA 2JC2A 2BCBA 1BMOA 2LHIA 1IIOA 3KEVA 4DRWA 2LP2A 3CLNA 1JUOA 3TUYC 1F71A 1JF2A 4PT1A 1SCMC 2M8UA 4U8DA 2BNXA 2JTZA 4PDZA 3F45A 1WLMA 2E30A 1KWOB 2WOSA 4I5KA 4F7FA 1UUSA 1PALA 1CLLA 3CZ0A 1T14A 2KAVA 1QX7A 2I7AA 2LVVA 2M1KB 3RLZA 1S1EA 2QEOA 1QV0A 1NP8A 3OP0A 3JVTC 2L2CA 2WCFA 2WC5A 2JT3A 2LMVA 1S6IA 1XFRA 5AERA 1KQVA 3NXAA 2KNEA 2LP3A 1RECA 1AJ4A 1S26D 2F2PA 3D74A 1RROA 2HF5A 4PE0A 2FJUB 4C0LA 3PM8A 3I5FC 5ER4X 2JT0A 3HX4A 2L5YA 5HLOA 1M45A 2SASA 1MXEA 1ZOTB 1ZMZA 1DVIA 2KAYA 1UWOA 2H8VA 3BYAA 4YGCB 4PCWA 2LUXA 1XVJA 3R1VA 1Y0VH 4PHJA 4NDDA 3WHTB 2NZ0A 3EK7A 1CDNA 3BUWB 3NSKA 4M2PA 2KLDA 1ORGA 3AKBA 3DVJA 2CXJA 1SK6D 1FI5A 1YTZC 4GFTA 2AMIA 2JWWA 2ZKMX 2FCDA 4OR9B 1B8LA 2JOJA 3IF7A 2K7BA 4JPZB 3GK1A 1XK4A 2K8MB 1UHIA 3A8RA 2WC6A 2JULA 3UO9A 2AUCA 2QEBA 1C07A 5HYDA 1BR1B 1B1GA 3UNWA 1A03A 5HKWA 4NQGA 2HQ8A 1UHKA 2CNPA 1CMGA 3CR4X 1EG4A 2ZRSA 1FPWA 3BFHA 1V1GA 2K2FA 4INXA 3AAKA 1A2XA 2BCAA 1QX2A 2JNFA 1UHHA 2MAZA 3SG4A 1LA3A 1MF8B 3SG6A 5KSZA 1IJ6A 2YGUA 1BG1A 2ZNDA 4OZDA 1B47A 2P70A 2JPOA 4GGFA 5AEQA 2WNDA 2Y1NA 3L47A 5EL2A 1K9KA 4I5LB 2WCMA 1QASA 1M39A 1R2UA 4MZLA 2FCEA 1S36A 1QVIZ 3I5IC 1XK4C 2LHLA 2ZN8A 2FJYA 1CLMA 2NCOA 2P6BB 3ZNIA 1F70A 4OCIA 1PK0D 1OQPA 2WORA 1DF0B 2F3YA 2L98A 3BUNB 3LK0A 5B8IB 1H8BA 1IG5A 3LCPC 3S0BA 3SIBA 2LAPA 4C0JA 2Y4QA 4PE4A 1B4CA 5JJGA 1LXFC 4HSZA 2B1UA 1CM4A 1A29A 1HT9A 1DJGA 3TUYB 2K2AA 1SCMB 2M7NA 3C1VA 4YI9A 1TNQA 1MQ1A 4MZKA 2LUCA 1FBVA 2BE6A 2Q4UA 1VRKA 3KF9A 3CDNA 1B8RA 4CFQA 1BJFA 4M2OA 2L5XB 1YUUA 2V53A 1DJXA 2D8NA 1UP5A 2LMTA 4MBEA 5G08A 1Y1UA 3SS5A 1XO5A 3VRRA 3B86A 4GGFC 3L4AA 5FYXA 1K94A 1KK7Z 1KFUL 3HCMA 1UHJA 1PSRA 1BT6A 2JZIA 3GK2A 1F4OA 3JVTB 4OV2A 2E6WA 2PASA 1DELA 1GM0A 3Q8IA 3S0GA 2KYCA 1QS7A 1JF0A 1CDMA 3AKAA 2FOTA 1B8CA 3FE8A 1SCVA 3GK4X 3GOFA 3S0DA 5F6TA 2F2OA 1OOIX 3WHUB 1AK8A 1DQEA 4NDCA 3TZ1A 2NLNA 1E8AA 1W7JB 1KSOA 1IKUA 2CCMA 2KFFA 2MBXA 1BLQA 2WCLA 2ZRTA 1PRWA 3CGAA 3CS1A 1QLKA 1YVHA 2GGMA 3BFBA 3EVVA 4CFRA 1DJZA 2EHBA 2ZN9A 2P71A 3VRNA 1OMVA 2JXLA 3CR5X 1V1FA 3EVUA 3PSRA 1XFUO 2PSRA 1EXRA 3O4XA 1W9ZA 1XYDA 1JWDA 1TWOA 4PE7A 1QX5B 3B7AA 3KHEA 4P2YB 4Q04A 1CDLA 3IQOA 1NX2A 3FS7A 3K21A 1J7OA 1AJ5A 1X02A 1WDCC 4YGEB 1EJ3A 4MLWA 2BL0C 2G2BA 1G33A 2HQWA 1NSHA 1LVCD 1KK7Y 1DGVA 3M0WA 1ALWA 3DD4A 2HETA 2GV5A 1NWDA 3BOWB 3BOWA 3D75A 1J1DA 2IS9A 1DJHA 3D0YB 4CIDA 3D0YA 3I5HC 3LLEA 5JOLA 2KYFA 1XFWO 1FI6A 2QDIA 1GQMA 1SNLA 1OMRA 5GQQC 2OTGC 3QMEA 1OOGA 2MHHA 1Y1AA 4CPVA 2K0JA 1TN4A 2BKIB 1OSAA 2ZFDA 3BQ3A 1IH0A 1CFDA 5CSIA 2LCPA 1SRAA 2K7DA 3DY9A 2M29A 1QIVA 2NCPA 1GJYA 4C0KA 1BF5A 3O6BA 2LM5A 2EC6B 1WRZA 4MSPA 5I8NA 1AVSA 2HPSA 3LK1A 1CM1A 1Y1XA 2I2RE 1MHOA 2L4IA 3I5IB 4HRGA 1OOHA 1XA5A 2CTNA 4PHKA 3R1PA 1CB1A 3RZSA 2CBLA 2CT9A 2LMUA 1N2DA 1IQ5A 1SR6C 1CKKA 1YR5A 3DYEA 1NCXA 2JQ6A 2L51A 2DOQA 1KCYA 1TNPA 4FQTA 1J7QA 1C7VA 3NGVA 2KPHA 2ZNEA 5HKYA 5DKRA 1SW8A 3V2LA 3VRQA 4MVFA 1Z4HA 4ZCVA 2ERBA 1MR8A 4OVNF 1EL4A 5I2QA 3EK4A 3AAJA 4YBHB 3LL8B 4JKTA 3PFVA 2H2KA 3SIAA 3D77A 2G9BA 1P28A 1PULA 1YURA 4GBAA 1SL9A 5DICA 5I2LA 3IQQA 3O2PA 2EC6C 2Y1MA 3NHTA 5DKQA 3OBVA 4XYNA 3K1EA 1CFCA 5IBWA 3SG3A 1CFPA 1DMOA 1M31A 1KSMA 4A4CA 2WCEA 1WRKA 1KK8C 2O5GA 4A4BA 3S0AA 1M63B 1TIZA 1B7TZ 2KLEA 2M1UA 3S0FA 5K89A 1K9PA 1S5GZ 1DJIA 1DGUA 3BUXB 4WQ3A 4IL1A 1GGWA 2EGDA 2K60A 3JTDC 4WQ2A 4AQJA 3NHIA 1OMDA 1QXPA 1ODBA 3DZTA 2O60A 1ALVA 1AUIB 1RJVA 5I94A 1DJWA 5KU1A 3PATA 2ISDA 2MLEC 1QV1A 3I5GB 4GPLB 1AP4A 3CZTX 1IJ5A 2KHNA 2NXQA 3DVMA 1YRTB 3TDUA 4M2QA 2JT8A 1J7RA 3L4LA 4ORBB 1B9AA 2F33A 3VRPA 1A4PA 5CPVA 3OGNA 2KI6C 3EKHA 5D3OA 2KI6D 1FF1A 1NPQA 1TUZA 1RFJA 1WDCB 2M0RA 4N1FA 4QJ3B 2BL0B 2KI4C 1F4QA 1SMGA 5KTYA 1BR4B 1RK9A 1K8UA 1NX1A 1RWYA 2JTTA 2KBIA 1W7IB 2LC5A 2M97A 1TNWA 1BOCA 3PM2A 1QVIY 3OX6A 3I5HB 1F8HA 2GGZA 1J55A 2M9GA 3PALA 3ZWHA 2PMYA 1B7TY 1K95A 2OTGB 3DVEA 1XFXO 1IGVA 2OPOA 4USLA 1SSEB 5FI6A 2LLTA 4BY5A 2K61A 3TDZA 1S5GY 1TUJA 4MZJA 1ZUZA 2I94A 3D73A 5J3XA 2LLUA 1QTXA 3RM1A 1U5IB
chains in the Genus database with same CATH topology
1YVLA 2L2EA 1U5IA 3NSIA 3I5GC 4N1GA 4ETOA 1OE9B 1CFFA 4ORAB 1OZSA 4MRYA 2F3ZA 2RGIA 1MUXA 3QRXA 1YRUB 4GAOA 4JWQA 5HKZA 5ER5A 4N5XA 2KAXA 1CTRA 3TDIA 4PHMA 2JNXA 1SL8A 1PVBA 1KFXS 3BUMB 4TNCA 1UURA 1KQMC 4QJ4B 4YGDB 3OB2B 3BXKA 1SR6B 4DS7A 3SG2A 5CSNA 4GGNA 1IQ3A 3PN7C 1S3PA 3PLFB 5AANA 4ICBA 2JU0A 1J7PA 3EVRA 4YI8A 1TNXA 1NCYA 2H61A 1Y6WA 2LANA 1YUSA 5CSJA 3TS5C 1YUTA 1NX3A 1TCFA 3VGOA 1CMFA 1N0YA 3EKJA 4UPGA 1TTXA 1Q80A 1L7ZA 1CDPA 1K90D 1OOJA 3SG5A 1EH2A 4JQ0D 1QLSA 1BU3A 3BUOB 2QPTA 1ZACA 4AOMA 1YX8A 2SCPA 4FQOA 4D1EA 1KK8B 3ICBA 4F0ZB 1J1EA 4ORCB 5DKNA 2PALA 1KFUS 3KPXA 3JTDB 2OS8B 2Q91A 1NIWA 5BPJA 1SYMA 2KDHA 4MN0A 2KGBC 1KWOC 2BBNA 2MJWB 2LNKA 2LVJA 2JPTA 1A75B 4DUQA 1NX0A 1A75A 1TRFA 4MEWA 1CLBA 4HREE 1G8IA 1L2OB 2H61C 1R6PA 4XJKB 2KFGA 3O78A 2L4HA 2LLSA 4XJKA 1H4BA 3OHMB 4ZCUA 4PHNA 4DCKA 1K93D 2JRFA 1XFZO 4GUKA 3CR2A 1AHRA 2KI4B 2MRDA 4DIRA 2BE4A 3WNXB 2BECA 2F8PA 2KQYA 2TN4A 1GGZA 2M3WA 4I5JA 1LA0A 2WC8A 1K96A 1JFKA 2MA2A 1MWNA 1C7WA 1S6JA 2VRGA 3MSEB 4PE1A 3CWGA 1IWQA 1RTP1 3SJSA 1KFXL 4CLNA 2OS8C 2AAOA 1S6CA 2BBMA 2M49B 3FWCA 4FTGA 1F55A 2I18A 2K7CA 3KO0A 4YRUA 2KQ6A 1TCOB 1ZFSA 1L2OC 3NSOA 2KFHA 4I5NB 4QJ5B 1HQVA 2LVKA 2QACA 3NSLA 1SPYA 3CTNA 4YGBB 4R1EA 1PVAA 4AQIA 2COLB 1WRLA 1QJTA 2Y5IA 2BCXA 1SL7A 4E68A 1UHNA 4L9MA 1DF0A 2KOTA 2L50A 2PVBA 1F54A 1DT7B 1M46A 2LV7A 2WCBA 2LE9B 4GNKB 2JXCA 1XFVO 1OZOA 5D69A 1CNPA 2R2IA 1NUBA 4BY4A 5CSFA 1K2HA 1KQMB 5D7FA 2KGRA 1FW4A 1K9UA 1QATA 1LINA 1JFJA 1DJYA 1DTLA 3D10A 1MXLC 1SY9A 5AXIA 5TNCA 1JSAA 2L0PA 5HLVA 1G4YR 1WY9A 2KBMA 4WRIA 1TOPA 3DVKA 4MRXA 3PN7B 2A4JA 1SBJA 2BKHB 1XFYO 1D1OA 2PRUA 3VROA 3WXAA 3A4UB 3H4SE 3DF0B 3DF0A 3FIAA 1BODA 3SG7A 3TS5B 3O4YA 1YX7A 5I2OA 1JC2A 1QIWA 1NCZA 3OB1B 3EK8A 1PSBA 1IRJA 1LKJA 1NYAA 5PALA 4P5OE 4YGAA 2KSPA 2MLFC 2K7OA 4NDBA 1WLZA 1JBAA 1SKTA 4PALA 3OX5A 2M7LA 3E3RA 3I5FB 4OKHA 1EG3A 5AFPA 1N65A 4HRHA 2LVIA 3FWBA 2JC2A 2BCBA 1BMOA 2LHIA 3KEVA 4DRWA 2LP2A 3CLNA 1JUOA 3TUYC 1F71A 1JF2A 1SCMC 2M8UA 4U8DA 4PDZA 2JTZA 3F45A 1WLMA 2E30A 1KWOB 2WOSA 4I5KA 1UUSA 1PALA 1CLLA 2KAVA 1QX7A 2I7AA 2LVVA 2M1KB 3RLZA 1S1EA 1QV0A 1NP8A 3OP0A 3JVTC 2WCFA 2JT3A 2LMVA 1S6IA 5AERA 1KQVA 3NXAA 2KNEA 2LP3A 1RECA 1AJ4A 1S26D 2F2PA 1RROA 2HF5A 4PE0A 2FJUB 4C0LA 3PM8A 3I5FC 5ER4X 2JT0A 3HX4A 5HLOA 1M45A 2SASA 1MXEA 1ZOTB 1ZMZA 1DVIA 2KAYA 1UWOA 3BYAA 4YGCB 4PCWA 2LUXA 1XVJA 1Y0VH 4PHJA 4NDDA 3WHTB 2NZ0A 3EK7A 1CDNA 3BUWB 3NSKA 4M2PA 3AKBA 3DVJA 2CXJA 1SK6D 1FI5A 1YTZC 4GFTA 2AMIA 2JWWA 2ZKMX 2FCDA 4OR9B 1B8LA 2JOJA 3IF7A 2K7BA 4JPZB 3GK1A 1XK4A 2K8MB 1UHIA 3A8RA 2JULA 2AUCA 1C07A 5HYDA 1BR1B 1B1GA 1A03A 5HKWA 4NQGA 2HQ8A 1UHKA 2CNPA 1CMGA 3CR4X 1EG4A 2ZRSA 1FPWA 1V1GA 2K2FA 3AAKA 1A2XA 2BCAA 1QX2A 2JNFA 1UHHA 2MAZA 3SG4A 1LA3A 1MF8B 3SG6A 5KSZA 1IJ6A 1BG1A 2ZNDA 1B47A 4GGFA 5AEQA 2WNDA 2Y1NA 1K9KA 4I5LB 1QASA 1M39A 1R2UA 4MZLA 2FCEA 1S36A 1QVIZ 3I5IC 1XK4C 2LHLA 2ZN8A 1CLMA 2NCOA 2P6BB 3ZNIA 1F70A 4OCIA 1PK0D 1OQPA 2WORA 1DF0B 2F3YA 2L98A 3BUNB 3LK0A 5B8IB 1H8BA 1IG5A 3LCPC 3SIBA 2LAPA 4C0JA 2Y4QA 4PE4A 1B4CA 5JJGA 1LXFC 4HSZA 2B1UA 1CM4A 1A29A 1HT9A 1DJGA 3TUYB 2K2AA 1SCMB 2M7NA 3C1VA 4YI9A 1TNQA 1MQ1A 4MZKA 2LUCA 1FBVA 2BE6A 2Q4UA 1VRKA 3KF9A 4CFQA 1B8RA 1BJFA 4M2OA 2L5XB 1YUUA 2V53A 1DJXA 2D8NA 1UP5A 2LMTA 4MBEA 5G08A 1Y1UA 3VRRA 1XO5A 4GGFC 5FYXA 1K94A 1KK7Z 1KFUL 3HCMA 1UHJA 1PSRA 1BT6A 2JZIA 3GK2A 1F4OA 3JVTB 4OV2A 2E6WA 2PASA 2KYCA 1QS7A 1JF0A 1CDMA 3AKAA 2FOTA 1B8CA 3GK4X 1SCVA 3GOFA 5F6TA 2F2OA 3WHUB 1AK8A 4NDCA 3TZ1A 2NLNA 1E8AA 1W7JB 1KSOA 1IKUA 2CCMA 2KFFA 2MBXA 1BLQA 2ZRTA 1PRWA 3CGAA 3CS1A 1QLKA 1YVHA 2GGMA 3EVVA 4CFRA 1DJZA 2EHBA 2ZN9A 3VRNA 1OMVA 2JXLA 3CR5X 1V1FA 3EVUA 3PSRA 1XFUO 2PSRA 1EXRA 1XYDA 1JWDA 4PE7A 1QX5B 3KHEA 4P2YB 4Q04A 1CDLA 3IQOA 1NX2A 3FS7A 3K21A 1J7OA 1AJ5A 1X02A 1WDCC 4YGEB 1EJ3A 4MLWA 2BL0C 2G2BA 1G33A 2HQWA 1NSHA 1LVCD 1KK7Y 1DGVA 3M0WA 1ALWA 3DD4A 2HETA 2GV5A 1NWDA 3BOWB 3BOWA 4CIDA 1J1DA 2IS9A 1DJHA 3D0YB 3D0YA 3I5HC 3LLEA 5JOLA 2KYFA 1XFWO 1FI6A 1GQMA 1SNLA 1OMRA 5GQQC 2OTGC 2MHHA 1Y1AA 4CPVA 2K0JA 1TN4A 2BKIB 1OSAA 2ZFDA 3BQ3A 1IH0A 1CFDA 5CSIA 2LCPA 1SRAA 2K7DA 2M29A 1QIVA 2NCPA 1GJYA 4C0KA 1BF5A 3O6BA 2LM5A 2EC6B 1WRZA 4MSPA 5I8NA 1AVSA 2HPSA 3LK1A 1CM1A 1Y1XA 2I2RE 1MHOA 2L4IA 3I5IB 4HRGA 1XA5A 2CTNA 4PHKA 1CB1A 2CBLA 2CT9A 2LMUA 1N2DA 1IQ5A 1SR6C 1CKKA 1YR5A 1NCXA 2JQ6A 2L51A 2DOQA 1KCYA 1TNPA 1J7QA 1C7VA 2ZNEA 5HKYA 5DKRA 1SW8A 3VRQA 4MVFA 4ZCVA 5I2QA 1MR8A 4OVNF 1EL4A 3EK4A 3AAJA 4YBHB 3LL8B 3PFVA 2H2KA 3SIAA 2G9BA 1PULA 1YURA 4GBAA 1SL9A 5I2LA 3IQQA 3O2PA 2EC6C 2Y1MA 5DKQA 4XYNA 1CFCA 5IBWA 3SG3A 1CFPA 1DMOA 1M31A 1KSMA 4A4CA 2WCEA 1WRKA 1KK8C 2O5GA 4A4BA 1M63B 1TIZA 1B7TZ 2M1UA 5K89A 1K9PA 1S5GZ 1DJIA 1DGUA 3BUXB 4WQ3A 4IL1A 1GGWA 2EGDA 3JTDC 4WQ2A 4AQJA 1OMDA 1QXPA 1ODBA 2O60A 1ALVA 1AUIB 1RJVA 1DJWA 5KU1A 3PATA 2ISDA 2MLEC 1QV1A 3I5GB 4GPLB 1AP4A 3CZTX 1IJ5A 2KHNA 2NXQA 3DVMA 1YRTB 3TDUA 4M2QA 2JT8A 1J7RA 4ORBB 1B9AA 2F33A 3VRPA 1A4PA 5CPVA 2KI6C 3EKHA 2KI6D 1FF1A 1NPQA 1WDCB 1RFJA 2M0RA 4N1FA 4QJ3B 2BL0B 2KI4C 1F4QA 1SMGA 5KTYA 1BR4B 1RK9A 1K8UA 1NX1A 1RWYA 2JTTA 2KBIA 1W7IB 2LC5A 2M97A 1TNWA 1BOCA 1QVIY 3OX6A 3I5HB 1F8HA 2GGZA 1J55A 2M9GA 3PALA 3ZWHA 2PMYA 1B7TY 1K95A 2OTGB 3DVEA 1XFXO 1IGVA 2OPOA 4USLA 2LLTA 4BY5A 2K61A 3TDZA 1S5GY 4MZJA 1ZUZA 2I94A 5J3XA 2LLUA 1QTXA 3RM1A 1U5IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVL A;  2L2E A;  1U5I A;  3NSI A;  3I5G C;  4N1G A;  4ETO A;  1OE9 B;  1CFF A;  4ORA B;  1OZS A;  4MRY A;  2F3Z A;  2RGI A;  1MUX A;  3QRX A;  1YRU B;  4GAO A;  4JWQ A;  5HKZ A;  5ER5 A;  4N5X A;  2KAX A;  1CTR A;  3TDI A;  4PHM A;  2JNX A;  1SL8 A;  1PVB A;  1KFX S;  3BUM B;  4TNC A;  1UUR A;  1KQM C;  4QJ4 B;  4YGD B;  3OB2 B;  3BXK A;  1SR6 B;  4DS7 A;  3SG2 A;  5CSN A;  4GGN A;  1IQ3 A;  3PN7 C;  1S3P A;  3PLF B;  5AAN A;  4ICB A;  2JU0 A;  1J7P A;  3EVR A;  4YI8 A;  1TNX A;  1NCY A;  2H61 A;  1Y6W A;  2LAN A;  1YUS A;  5CSJ A;  3TS5 C;  1YUT A;  1NX3 A;  1TCF A;  3VGO A;  1CMF A;  1N0Y A;  3EKJ A;  4UPG A;  1TTX A;  1Q80 A;  1L7Z A;  1CDP A;  1K90 D;  1OOJ A;  3SG5 A;  1EH2 A;  4JQ0 D;  1QLS A;  1BU3 A;  3BUO B;  2QPT A;  1ZAC A;  4AOM A;  1YX8 A;  2SCP A;  4FQO A;  4D1E A;  1KK8 B;  3ICB A;  4F0Z B;  1J1E A;  4ORC B;  5DKN A;  2PAL A;  1KFU S;  3KPX A;  3JTD B;  2OS8 B;  2Q91 A;  1NIW A;  5BPJ A;  1SYM A;  2KDH A;  4MN0 A;  2KGB C;  1KWO C;  2BBN A;  2MJW B;  2LNK A;  2LVJ A;  2JPT A;  1A75 B;  4DUQ A;  1NX0 A;  1A75 A;  1TRF A;  4MEW A;  1CLB A;  4HRE E;  1G8I A;  1L2O B;  2H61 C;  1R6P A;  4XJK B;  2KFG A;  3O78 A;  2L4H A;  2LLS A;  4XJK A;  1H4B A;  3OHM B;  4ZCU A;  4PHN A;  4DCK A;  1K93 D;  2JRF A;  1XFZ O;  4GUK A;  3CR2 A;  1AHR A;  2KI4 B;  2MRD A;  4DIR A;  2BE4 A;  3WNX B;  2BEC A;  2F8P A;  2KQY A;  2TN4 A;  1GGZ A;  2M3W A;  4I5J A;  1LA0 A;  2WC8 A;  1K96 A;  1JFK A;  2MA2 A;  1MWN A;  1C7W A;  1S6J A;  2VRG A;  3MSE B;  4PE1 A;  3CWG A;  1IWQ A;  1RTP 1;  3SJS A;  1KFX L;  4CLN A;  2OS8 C;  2AAO A;  1S6C A;  2BBM A;  2M49 B;  3FWC A;  4FTG A;  1F55 A;  2I18 A;  2K7C A;  3KO0 A;  4YRU A;  2KQ6 A;  1TCO B;  1ZFS A;  1L2O C;  3NSO A;  2KFH A;  4I5N B;  4QJ5 B;  1HQV A;  2LVK A;  2QAC A;  3NSL A;  1SPY A;  3CTN A;  4YGB B;  4R1E A;  1PVA A;  4AQI A;  2COL B;  1WRL A;  1QJT A;  2Y5I A;  2BCX A;  1SL7 A;  4E68 A;  1UHN A;  4L9M A;  1DF0 A;  2KOT A;  2L50 A;  2PVB A;  1F54 A;  1DT7 B;  1M46 A;  2LV7 A;  2WCB A;  2LE9 B;  4GNK B;  2JXC A;  1XFV O;  1OZO A;  5D69 A;  1CNP A;  2R2I A;  1NUB A;  4BY4 A;  5CSF A;  1K2H A;  1KQM B;  5D7F A;  2KGR A;  1FW4 A;  1K9U A;  1QAT A;  1LIN A;  1JFJ A;  1DJY A;  1DTL A;  3D10 A;  1MXL C;  1SY9 A;  5AXI A;  5TNC A;  1JSA A;  2L0P A;  5HLV A;  1G4Y R;  1WY9 A;  2KBM A;  4WRI A;  1TOP A;  3DVK A;  4MRX A;  3PN7 B;  2A4J A;  1SBJ A;  2BKH B;  1XFY O;  1D1O A;  2PRU A;  3VRO A;  3WXA A;  3A4U B;  3H4S E;  3DF0 B;  3DF0 A;  3FIA A;  1BOD A;  3SG7 A;  3TS5 B;  3O4Y A;  1YX7 A;  5I2O A;  1JC2 A;  1QIW A;  1NCZ A;  3OB1 B;  3EK8 A;  1PSB A;  1IRJ A;  1LKJ A;  1NYA A;  5PAL A;  4P5O E;  4YGA A;  2KSP A;  2MLF C;  2K7O A;  4NDB A;  1WLZ A;  1JBA A;  1SKT A;  4PAL A;  3OX5 A;  2M7L A;  3E3R A;  3I5F B;  4OKH A;  1EG3 A;  5AFP A;  1N65 A;  4HRH A;  2LVI A;  3FWB A;  2JC2 A;  2BCB A;  1BMO A;  2LHI A;  3KEV A;  4DRW A;  2LP2 A;  3CLN A;  1JUO A;  3TUY C;  1F71 A;  1JF2 A;  1SCM C;  2M8U A;  4U8D A;  4PDZ A;  2JTZ A;  3F45 A;  1WLM A;  2E30 A;  1KWO B;  2WOS A;  4I5K A;  1UUS A;  1PAL A;  1CLL A;  2KAV A;  1QX7 A;  2I7A A;  2LVV A;  2M1K B;  3RLZ A;  1S1E A;  1QV0 A;  1NP8 A;  3OP0 A;  3JVT C;  2WCF A;  2JT3 A;  2LMV A;  1S6I A;  5AER A;  1KQV A;  3NXA A;  2KNE A;  2LP3 A;  1REC A;  1AJ4 A;  1S26 D;  2F2P A;  1RRO A;  2HF5 A;  4PE0 A;  2FJU B;  4C0L A;  3PM8 A;  3I5F C;  5ER4 X;  2JT0 A;  3HX4 A;  5HLO A;  1M45 A;  2SAS A;  1MXE A;  1ZOT B;  1ZMZ A;  1DVI A;  2KAY A;  1UWO A;  3BYA A;  4YGC B;  4PCW A;  2LUX A;  1XVJ A;  1Y0V H;  4PHJ A;  4NDD A;  3WHT B;  2NZ0 A;  3EK7 A;  1CDN A;  3BUW B;  3NSK A;  4M2P A;  3AKB A;  3DVJ A;  2CXJ A;  1SK6 D;  1FI5 A;  1YTZ C;  4GFT A;  2AMI A;  2JWW A;  2ZKM X;  2FCD A;  4OR9 B;  1B8L A;  2JOJ A;  3IF7 A;  2K7B A;  4JPZ B;  3GK1 A;  1XK4 A;  2K8M B;  1UHI A;  3A8R A;  2JUL A;  2AUC A;  1C07 A;  5HYD A;  1BR1 B;  1B1G A;  1A03 A;  5HKW A;  4NQG A;  2HQ8 A;  1UHK A;  2CNP A;  1CMG A;  3CR4 X;  1EG4 A;  2ZRS A;  1FPW A;  1V1G A;  2K2F A;  3AAK A;  1A2X A;  2BCA A;  1QX2 A;  2JNF A;  1UHH A;  2MAZ A;  3SG4 A;  1LA3 A;  1MF8 B;  3SG6 A;  5KSZ A;  1IJ6 A;  1BG1 A;  2ZND A;  1B47 A;  4GGF A;  5AEQ A;  2WND A;  2Y1N A;  1K9K A;  4I5L B;  1QAS A;  1M39 A;  1R2U A;  4MZL A;  2FCE A;  1S36 A;  1QVI Z;  3I5I C;  1XK4 C;  2LHL A;  2ZN8 A;  1CLM A;  2NCO A;  2P6B B;  3ZNI A;  1F70 A;  4OCI A;  1PK0 D;  1OQP A;  2WOR A;  1DF0 B;  2F3Y A;  2L98 A;  3BUN B;  3LK0 A;  5B8I B;  1H8B A;  1IG5 A;  3LCP C;  3SIB A;  2LAP A;  4C0J A;  2Y4Q A;  4PE4 A;  1B4C A;  5JJG A;  1LXF C;  4HSZ A;  2B1U A;  1CM4 A;  1A29 A;  1HT9 A;  1DJG A;  3TUY B;  2K2A A;  1SCM B;  2M7N A;  3C1V A;  4YI9 A;  1TNQ A;  1MQ1 A;  4MZK A;  2LUC A;  1FBV A;  2BE6 A;  2Q4U A;  1VRK A;  3KF9 A;  4CFQ A;  1B8R A;  1BJF A;  4M2O A;  2L5X B;  1YUU A;  2V53 A;  1DJX A;  2D8N A;  1UP5 A;  2LMT A;  4MBE A;  5G08 A;  1Y1U A;  3VRR A;  1XO5 A;  4GGF C;  5FYX A;  1K94 A;  1KK7 Z;  1KFU L;  3HCM A;  1UHJ A;  1PSR A;  1BT6 A;  2JZI A;  3GK2 A;  1F4O A;  3JVT B;  4OV2 A;  2E6W A;  2PAS A;  2KYC A;  1QS7 A;  1JF0 A;  1CDM A;  3AKA A;  2FOT A;  1B8C A;  3GK4 X;  1SCV A;  3GOF A;  5F6T A;  2F2O A;  3WHU B;  1AK8 A;  4NDC A;  3TZ1 A;  2NLN A;  1E8A A;  1W7J B;  1KSO A;  1IKU A;  2CCM A;  2KFF A;  2MBX A;  1BLQ A;  2ZRT A;  1PRW A;  3CGA A;  3CS1 A;  1QLK A;  1YVH A;  2GGM A;  3EVV A;  4CFR A;  1DJZ A;  2EHB A;  2ZN9 A;  3VRN A;  1OMV A;  2JXL A;  3CR5 X;  1V1F A;  3EVU A;  3PSR A;  1XFU O;  2PSR A;  1EXR A;  1XYD A;  1JWD A;  4PE7 A;  1QX5 B;  3KHE A;  4P2Y B;  4Q04 A;  1CDL A;  3IQO A;  1NX2 A;  3FS7 A;  3K21 A;  1J7O A;  1AJ5 A;  1X02 A;  1WDC C;  4YGE B;  1EJ3 A;  4MLW A;  2BL0 C;  2G2B A;  1G33 A;  2HQW A;  1NSH A;  1LVC D;  1KK7 Y;  1DGV A;  3M0W A;  1ALW A;  3DD4 A;  2HET A;  2GV5 A;  1NWD A;  3BOW B;  3BOW A;  4CID A;  1J1D A;  2IS9 A;  1DJH A;  3D0Y B;  3D0Y A;  3I5H C;  3LLE A;  5JOL A;  2KYF A;  1XFW O;  1FI6 A;  1GQM A;  1SNL A;  1OMR A;  5GQQ C;  2OTG C;  2MHH A;  1Y1A A;  4CPV A;  2K0J A;  1TN4 A;  2BKI B;  1OSA A;  2ZFD A;  3BQ3 A;  1IH0 A;  1CFD A;  5CSI A;  2LCP A;  1SRA A;  2K7D A;  2M29 A;  1QIV A;  2NCP A;  1GJY A;  4C0K A;  1BF5 A;  3O6B A;  2LM5 A;  2EC6 B;  1WRZ A;  4MSP A;  5I8N A;  1AVS A;  2HPS A;  3LK1 A;  1CM1 A;  1Y1X A;  2I2R E;  1MHO A;  2L4I A;  3I5I B;  4HRG A;  1XA5 A;  2CTN A;  4PHK A;  1CB1 A;  2CBL A;  2CT9 A;  2LMU A;  1N2D A;  1IQ5 A;  1SR6 C;  1CKK A;  1YR5 A;  1NCX A;  2JQ6 A;  2L51 A;  2DOQ A;  1KCY A;  1TNP A;  1J7Q A;  1C7V A;  2ZNE A;  5HKY A;  5DKR A;  1SW8 A;  3VRQ A;  4MVF A;  4ZCV A;  5I2Q A;  1MR8 A;  4OVN F;  1EL4 A;  3EK4 A;  3AAJ A;  4YBH B;  3LL8 B;  3PFV A;  2H2K A;  3SIA A;  2G9B A;  1PUL A;  1YUR A;  4GBA A;  1SL9 A;  5I2L A;  3IQQ A;  3O2P A;  2EC6 C;  2Y1M A;  5DKQ A;  4XYN A;  1CFC A;  5IBW A;  3SG3 A;  1CFP A;  1DMO A;  1M31 A;  1KSM A;  4A4C A;  2WCE A;  1WRK A;  1KK8 C;  2O5G A;  4A4B A;  1M63 B;  1TIZ A;  1B7T Z;  2M1U A;  5K89 A;  1K9P A;  1S5G Z;  1DJI A;  1DGU A;  3BUX B;  4WQ3 A;  4IL1 A;  1GGW A;  2EGD A;  3JTD C;  4WQ2 A;  4AQJ A;  1OMD A;  1QXP A;  1ODB A;  2O60 A;  1ALV A;  1AUI B;  1RJV A;  1DJW A;  5KU1 A;  3PAT A;  2ISD A;  2MLE C;  1QV1 A;  3I5G B;  4GPL B;  1AP4 A;  3CZT X;  1IJ5 A;  2KHN A;  2NXQ A;  3DVM A;  1YRT B;  3TDU A;  4M2Q A;  2JT8 A;  1J7R A;  4ORB B;  1B9A A;  2F33 A;  3VRP A;  1A4P A;  5CPV A;  2KI6 C;  3EKH A;  2KI6 D;  1FF1 A;  1NPQ A;  1WDC B;  1RFJ A;  2M0R A;  4N1F A;  4QJ3 B;  2BL0 B;  2KI4 C;  1F4Q A;  1SMG A;  5KTY A;  1BR4 B;  1RK9 A;  1K8U A;  1NX1 A;  1RWY A;  2JTT A;  2KBI A;  1W7I B;  2LC5 A;  2M97 A;  1TNW A;  1BOC A;  1QVI Y;  3OX6 A;  3I5H B;  1F8H A;  2GGZ A;  1J55 A;  2M9G A;  3PAL A;  3ZWH A;  2PMY A;  1B7T Y;  1K95 A;  2OTG B;  3DVE A;  1XFX O;  1IGV A;  2OPO A;  4USL A;  2LLT A;  4BY5 A;  2K61 A;  3TDZ A;  1S5G Y;  4MZJ A;  1ZUZ A;  2I94 A;  5J3X A;  2LLU A;  1QTX A;  3RM1 A;  1U5I B; 
#chains in the Genus database with same CATH topology
 1YVL A;  2L2E A;  1U5I A;  3NSI A;  3I5G C;  4N1G A;  4ETO A;  1OE9 B;  1CFF A;  4ORA B;  1OZS A;  4MRY A;  2F3Z A;  2RGI A;  3BJH A;  1MUX A;  3QRX A;  1YRU B;  4GAO A;  4JWQ A;  5HKZ A;  5ER5 A;  4N5X A;  2KAX A;  1CTR A;  3TDI A;  4PHM A;  2JNX A;  1SL8 A;  1PVB A;  1KFX S;  3B6X A;  3BUM B;  4TNC A;  1UUR A;  3R72 A;  3FE9 A;  1KQM C;  4QJ4 B;  4YGD B;  2PQL A;  3OB2 B;  3BXK A;  1SR6 B;  3N7H A;  4DS7 A;  3CAB A;  3SG2 A;  5CSN A;  4GGN A;  1IQ3 A;  4KYN A;  2PYQ A;  3PJI A;  3PN7 C;  1S3P A;  3PLF B;  2QEH A;  5AAN A;  4ICB A;  2JU0 A;  3D78 A;  1J7P A;  3EVR A;  4YI8 A;  1TNX A;  1NCY A;  2H61 A;  1Y6W A;  2LAN A;  1YUS A;  5CSJ A;  3TS5 C;  1YUT A;  1NX3 A;  1TCF A;  3VGO A;  1CMF A;  1N0Y A;  2WCH A;  3EKJ A;  4UPG A;  4JD9 A;  1TTX A;  1Q80 A;  1L7Z A;  3CYZ A;  1CDP A;  1K90 D;  1OOJ A;  3SG5 A;  1EH2 A;  4JQ0 D;  1QLS A;  1BU3 A;  3B87 A;  3BUO B;  2QPT A;  1ZAC A;  5FI2 A;  4AOM A;  1YX8 A;  2SCP A;  4FQO A;  4D1E A;  1KK8 B;  1QWV A;  3ICB A;  3CZ1 A;  4F0Z B;  1J1E A;  4ORC B;  5DKN A;  2PAL A;  1KFU S;  2GTE A;  3KPX A;  3JTD B;  2OS8 B;  2Q91 A;  1NIW A;  5BPJ A;  1SYM A;  2KDH A;  4MN0 A;  3SS3 A;  2KGB C;  1KWO C;  2BBN A;  2MJW B;  2LNK A;  2LVJ A;  2JPT A;  1A75 B;  4DUQ A;  1NX0 A;  1A75 A;  1TRF A;  2WCK A;  4MEW A;  4HRE E;  1G8I A;  1L2O B;  2H61 C;  5HL1 A;  1CLB A;  1R6P A;  4XJK B;  2KFG A;  3O78 A;  2L4H A;  2LLS A;  4XJK A;  1H4B A;  3OHM B;  4ZCU A;  4PHN A;  4DCK A;  1K93 D;  2JRF A;  1XFZ O;  3S0E A;  4GUK A;  3CR2 A;  1AHR A;  2KI4 B;  2MRD A;  4DIR A;  2BE4 A;  1C3Y A;  3WNX B;  2BEC A;  2F8P A;  1Z2C B;  2KQY A;  2TN4 A;  1GGZ A;  2M3W A;  4I5J A;  1LA0 A;  1DEK A;  2WC8 A;  1K96 A;  1JFK A;  2MA2 A;  1MWN A;  1C7W A;  1S6J A;  2VRG A;  3MSE B;  4PE1 A;  1C3Z A;  3CWG A;  1IWQ A;  2WCJ A;  1RTP 1;  3SJS A;  1KFX L;  4CLN A;  2OS8 C;  2AAO A;  1S6C A;  2BBM A;  2M49 B;  3FWC A;  4FTG A;  1F55 A;  2I18 A;  2K7C A;  3KO0 A;  4YRU A;  2KQ6 A;  1TCO B;  3IVT A;  3D76 A;  1ZFS A;  1L2O C;  3NSO A;  2KFH A;  4I5N B;  4QJ5 B;  1HQV A;  2LVK A;  2QAC A;  3NSL A;  1SPY A;  3CTN A;  4YGB B;  4R1E A;  1PVA A;  4AQI A;  2COL B;  1WRL A;  1QJT A;  2Y5I A;  2BCX A;  1SL7 A;  4E68 A;  1UHN A;  4L9M A;  1DF0 A;  2KOT A;  2L50 A;  2PVB A;  1F54 A;  1DT7 B;  1M46 A;  2LV7 A;  2WCB A;  2LE9 B;  4GNK B;  2JXC A;  1XFV O;  1OZO A;  1OOF A;  4INW A;  4IJ7 A;  5D69 A;  1CNP A;  2R2I A;  1NUB A;  2BAP A;  5CSF A;  4BY4 A;  1K2H A;  1KQM B;  2QEV A;  5D7F A;  2KGR A;  1FW4 A;  1K9U A;  1QAT A;  1LIN A;  1JFJ A;  1DJY A;  1DTL A;  3D10 A;  1MXL C;  1SY9 A;  5AXI A;  5TNC A;  1JSA A;  2L0P A;  5HLV A;  1G4Y R;  1WY9 A;  2KBM A;  4WRI A;  1TOP A;  3DVK A;  4MRX A;  3SS4 A;  3PN7 B;  2A4J A;  1SBJ A;  2BKH B;  1XFY O;  1D1O A;  3BFA A;  2PRU A;  3VRO A;  3WXA A;  3A4U B;  3H4S E;  3DF0 B;  3DF0 A;  5FI7 A;  3FIA A;  1BOD A;  3SG7 A;  3B88 A;  1OW4 A;  3DXL A;  3TS5 B;  3O4Y A;  1YX7 A;  5I2O A;  1JC2 A;  1QIW A;  1NCZ A;  3OB1 B;  3EK8 A;  3FE6 A;  3R1O A;  1PSB A;  1IRJ A;  1LKJ A;  1NYA A;  5PAL A;  4P5O E;  4YGA A;  2KSP A;  2MLF C;  2K7O A;  4NDB A;  1WLZ A;  1JBA A;  1SKT A;  4PAL A;  3OX5 A;  2M7L A;  3VB1 A;  3E3R A;  3EG5 B;  3I5F B;  4OKH A;  1EG3 A;  1LS8 A;  3CZ2 A;  5AFP A;  1N65 A;  4HRH A;  2LVI A;  1DC1 A;  3FWB A;  2JC2 A;  2BCB A;  1BMO A;  2LHI A;  1IIO A;  3KEV A;  4DRW A;  2LP2 A;  3CLN A;  1JUO A;  3TUY C;  1F71 A;  1JF2 A;  4PT1 A;  1SCM C;  2M8U A;  4U8D A;  2BNX A;  2JTZ A;  4PDZ A;  3F45 A;  1WLM A;  2E30 A;  1KWO B;  2WOS A;  4I5K A;  4F7F A;  1UUS A;  1PAL A;  1CLL A;  3CZ0 A;  1T14 A;  2KAV A;  1QX7 A;  2I7A A;  2LVV A;  2M1K B;  3RLZ A;  1S1E A;  2QEO A;  1QV0 A;  1NP8 A;  3OP0 A;  3JVT C;  2L2C A;  2WCF A;  2WC5 A;  2JT3 A;  2LMV A;  1S6I A;  1XFR A;  5AER A;  1KQV A;  3NXA A;  2KNE A;  2LP3 A;  1REC A;  1AJ4 A;  1S26 D;  2F2P A;  3D74 A;  1RRO A;  2HF5 A;  4PE0 A;  2FJU B;  4C0L A;  3PM8 A;  3I5F C;  5ER4 X;  2JT0 A;  3HX4 A;  2L5Y A;  5HLO A;  1M45 A;  2SAS A;  1MXE A;  1ZOT B;  1ZMZ A;  1DVI A;  2KAY A;  1UWO A;  2H8V A;  3BYA A;  4YGC B;  4PCW A;  2LUX A;  1XVJ A;  3R1V A;  1Y0V H;  4PHJ A;  4NDD A;  3WHT B;  2NZ0 A;  3EK7 A;  1CDN A;  3BUW B;  3NSK A;  4M2P A;  2KLD A;  1ORG A;  3AKB A;  3DVJ A;  2CXJ A;  1SK6 D;  1FI5 A;  1YTZ C;  4GFT A;  2AMI A;  2JWW A;  2ZKM X;  2FCD A;  4OR9 B;  1B8L A;  2JOJ A;  3IF7 A;  2K7B A;  4JPZ B;  3GK1 A;  1XK4 A;  2K8M B;  1UHI A;  3A8R A;  2WC6 A;  2JUL A;  3UO9 A;  2AUC A;  2QEB A;  1C07 A;  5HYD A;  1BR1 B;  1B1G A;  3UNW A;  1A03 A;  5HKW A;  4NQG A;  2HQ8 A;  1UHK A;  2CNP A;  1CMG A;  3CR4 X;  1EG4 A;  2ZRS A;  1FPW A;  3BFH A;  1V1G A;  2K2F A;  4INX A;  3AAK A;  1A2X A;  2BCA A;  1QX2 A;  2JNF A;  1UHH A;  2MAZ A;  3SG4 A;  1LA3 A;  1MF8 B;  3SG6 A;  5KSZ A;  1IJ6 A;  2YGU A;  1BG1 A;  2ZND A;  4OZD A;  1B47 A;  2P70 A;  2JPO A;  4GGF A;  5AEQ A;  2WND A;  2Y1N A;  3L47 A;  5EL2 A;  1K9K A;  4I5L B;  2WCM A;  1QAS A;  1M39 A;  1R2U A;  4MZL A;  2FCE A;  1S36 A;  1QVI Z;  3I5I C;  1XK4 C;  2LHL A;  2ZN8 A;  2FJY A;  1CLM A;  2NCO A;  2P6B B;  3ZNI A;  1F70 A;  4OCI A;  1PK0 D;  1OQP A;  2WOR A;  1DF0 B;  2F3Y A;  2L98 A;  3BUN B;  3LK0 A;  5B8I B;  1H8B A;  1IG5 A;  3LCP C;  3S0B A;  3SIB A;  2LAP A;  4C0J A;  2Y4Q A;  4PE4 A;  1B4C A;  5JJG A;  1LXF C;  4HSZ A;  2B1U A;  1CM4 A;  1A29 A;  1HT9 A;  1DJG A;  3TUY B;  2K2A A;  1SCM B;  2M7N A;  3C1V A;  4YI9 A;  1TNQ A;  1MQ1 A;  4MZK A;  2LUC A;  1FBV A;  2BE6 A;  2Q4U A;  1VRK A;  3KF9 A;  3CDN A;  1B8R A;  4CFQ A;  1BJF A;  4M2O A;  2L5X B;  1YUU A;  2V53 A;  1DJX A;  2D8N A;  1UP5 A;  2LMT A;  4MBE A;  5G08 A;  1Y1U A;  3SS5 A;  1XO5 A;  3VRR A;  3B86 A;  4GGF C;  3L4A A;  5FYX A;  1K94 A;  1KK7 Z;  1KFU L;  3HCM A;  1UHJ A;  1PSR A;  1BT6 A;  2JZI A;  3GK2 A;  1F4O A;  3JVT B;  4OV2 A;  2E6W A;  2PAS A;  1DEL A;  1GM0 A;  3Q8I A;  3S0G A;  2KYC A;  1QS7 A;  1JF0 A;  1CDM A;  3AKA A;  2FOT A;  1B8C A;  3FE8 A;  1SCV A;  3GK4 X;  3GOF A;  3S0D A;  5F6T A;  2F2O A;  1OOI X;  3WHU B;  1AK8 A;  1DQE A;  4NDC A;  3TZ1 A;  2NLN A;  1E8A A;  1W7J B;  1KSO A;  1IKU A;  2CCM A;  2KFF A;  2MBX A;  1BLQ A;  2WCL A;  2ZRT A;  1PRW A;  3CGA A;  3CS1 A;  1QLK A;  1YVH A;  2GGM A;  3BFB A;  3EVV A;  4CFR A;  1DJZ A;  2EHB A;  2ZN9 A;  2P71 A;  3VRN A;  1OMV A;  2JXL A;  3CR5 X;  1V1F A;  3EVU A;  3PSR A;  1XFU O;  2PSR A;  1EXR A;  3O4X A;  1W9Z A;  1XYD A;  1JWD A;  1TWO A;  4PE7 A;  1QX5 B;  3B7A A;  3KHE A;  4P2Y B;  4Q04 A;  1CDL A;  3IQO A;  1NX2 A;  3FS7 A;  3K21 A;  1J7O A;  1AJ5 A;  1X02 A;  1WDC C;  4YGE B;  1EJ3 A;  4MLW A;  2BL0 C;  2G2B A;  1G33 A;  2HQW A;  1NSH A;  1LVC D;  1KK7 Y;  1DGV A;  3M0W A;  1ALW A;  3DD4 A;  2HET A;  2GV5 A;  1NWD A;  3BOW B;  3BOW A;  3D75 A;  1J1D A;  2IS9 A;  1DJH A;  3D0Y B;  4CID A;  3D0Y A;  3I5H C;  3LLE A;  5JOL A;  2KYF A;  1XFW O;  1FI6 A;  2QDI A;  1GQM A;  1SNL A;  1OMR A;  5GQQ C;  2OTG C;  3QME A;  1OOG A;  2MHH A;  1Y1A A;  4CPV A;  2K0J A;  1TN4 A;  2BKI B;  1OSA A;  2ZFD A;  3BQ3 A;  1IH0 A;  1CFD A;  5CSI A;  2LCP A;  1SRA A;  2K7D A;  3DY9 A;  2M29 A;  1QIV A;  2NCP A;  1GJY A;  4C0K A;  1BF5 A;  3O6B A;  2LM5 A;  2EC6 B;  1WRZ A;  4MSP A;  5I8N A;  1AVS A;  2HPS A;  3LK1 A;  1CM1 A;  1Y1X A;  2I2R E;  1MHO A;  2L4I A;  3I5I B;  4HRG A;  1OOH A;  1XA5 A;  2CTN A;  4PHK A;  3R1P A;  1CB1 A;  3RZS A;  2CBL A;  2CT9 A;  2LMU A;  1N2D A;  1IQ5 A;  1SR6 C;  1CKK A;  1YR5 A;  3DYE A;  1NCX A;  2JQ6 A;  2L51 A;  2DOQ A;  1KCY A;  1TNP A;  4FQT A;  1J7Q A;  1C7V A;  3NGV A;  2KPH A;  2ZNE A;  5HKY A;  5DKR A;  1SW8 A;  3V2L A;  3VRQ A;  4MVF A;  1Z4H A;  4ZCV A;  2ERB A;  1MR8 A;  4OVN F;  1EL4 A;  5I2Q A;  3EK4 A;  3AAJ A;  4YBH B;  3LL8 B;  4JKT A;  3PFV A;  2H2K A;  3SIA A;  3D77 A;  2G9B A;  1P28 A;  1PUL A;  1YUR A;  4GBA A;  1SL9 A;  5DIC A;  5I2L A;  3IQQ A;  3O2P A;  2EC6 C;  2Y1M A;  3NHT A;  5DKQ A;  3OBV A;  4XYN A;  3K1E A;  1CFC A;  5IBW A;  3SG3 A;  1CFP A;  1DMO A;  1M31 A;  1KSM A;  4A4C A;  2WCE A;  1WRK A;  1KK8 C;  2O5G A;  4A4B A;  3S0A A;  1M63 B;  1TIZ A;  1B7T Z;  2KLE A;  2M1U A;  3S0F A;  5K89 A;  1K9P A;  1S5G Z;  1DJI A;  1DGU A;  3BUX B;  4WQ3 A;  4IL1 A;  1GGW A;  2EGD A;  2K60 A;  3JTD C;  4WQ2 A;  4AQJ A;  3NHI A;  1OMD A;  1QXP A;  1ODB A;  3DZT A;  2O60 A;  1ALV A;  1AUI B;  1RJV A;  5I94 A;  1DJW A;  5KU1 A;  3PAT A;  2ISD A;  2MLE C;  1QV1 A;  3I5G B;  4GPL B;  1AP4 A;  3CZT X;  1IJ5 A;  2KHN A;  2NXQ A;  3DVM A;  1YRT B;  3TDU A;  4M2Q A;  2JT8 A;  1J7R A;  3L4L A;  4ORB B;  1B9A A;  2F33 A;  3VRP A;  1A4P A;  5CPV A;  3OGN A;  2KI6 C;  3EKH A;  5D3O A;  2KI6 D;  1FF1 A;  1NPQ A;  1TUZ A;  1RFJ A;  1WDC B;  2M0R A;  4N1F A;  4QJ3 B;  2BL0 B;  2KI4 C;  1F4Q A;  1SMG A;  5KTY A;  1BR4 B;  1RK9 A;  1K8U A;  1NX1 A;  1RWY A;  2JTT A;  2KBI A;  1W7I B;  2LC5 A;  2M97 A;  1TNW A;  1BOC A;  3PM2 A;  1QVI Y;  3OX6 A;  3I5H B;  1F8H A;  2GGZ A;  1J55 A;  2M9G A;  3PAL A;  3ZWH A;  2PMY A;  1B7T Y;  1K95 A;  2OTG B;  3DVE A;  1XFX O;  1IGV A;  2OPO A;  4USL A;  1SSE B;  5FI6 A;  2LLT A;  4BY5 A;  2K61 A;  3TDZ A;  1S5G Y;  1TUJ A;  4MZJ A;  1ZUZ A;  2I94 A;  3D73 A;  5J3X A;  2LLU A;  1QTX A;  3RM1 A;  1U5I B; 
#chains in the Genus database with same CATH homology
 1YVL A;  2L2E A;  1U5I A;  3NSI A;  3I5G C;  4N1G A;  4ETO A;  1OE9 B;  1CFF A;  4ORA B;  1OZS A;  4MRY A;  2F3Z A;  2RGI A;  1MUX A;  3QRX A;  1YRU B;  4GAO A;  4JWQ A;  5HKZ A;  5ER5 A;  4N5X A;  2KAX A;  1CTR A;  3TDI A;  4PHM A;  2JNX A;  1SL8 A;  1PVB A;  1KFX S;  3BUM B;  4TNC A;  1UUR A;  1KQM C;  4QJ4 B;  4YGD B;  3OB2 B;  3BXK A;  1SR6 B;  4DS7 A;  3SG2 A;  5CSN A;  4GGN A;  1IQ3 A;  3PN7 C;  1S3P A;  3PLF B;  5AAN A;  4ICB A;  2JU0 A;  1J7P A;  3EVR A;  4YI8 A;  1TNX A;  1NCY A;  2H61 A;  1Y6W A;  2LAN A;  1YUS A;  5CSJ A;  3TS5 C;  1YUT A;  1NX3 A;  1TCF A;  3VGO A;  1CMF A;  1N0Y A;  3EKJ A;  4UPG A;  1TTX A;  1Q80 A;  1L7Z A;  1CDP A;  1K90 D;  1OOJ A;  3SG5 A;  1EH2 A;  4JQ0 D;  1QLS A;  1BU3 A;  3BUO B;  2QPT A;  1ZAC A;  4AOM A;  1YX8 A;  2SCP A;  4FQO A;  4D1E A;  1KK8 B;  3ICB A;  4F0Z B;  1J1E A;  4ORC B;  5DKN A;  2PAL A;  1KFU S;  3KPX A;  3JTD B;  2OS8 B;  2Q91 A;  1NIW A;  5BPJ A;  1SYM A;  2KDH A;  4MN0 A;  2KGB C;  1KWO C;  2BBN A;  2MJW B;  2LNK A;  2LVJ A;  2JPT A;  1A75 B;  4DUQ A;  1NX0 A;  1A75 A;  1TRF A;  4MEW A;  1CLB A;  4HRE E;  1G8I A;  1L2O B;  2H61 C;  1R6P A;  4XJK B;  2KFG A;  3O78 A;  2L4H A;  2LLS A;  4XJK A;  1H4B A;  3OHM B;  4ZCU A;  4PHN A;  4DCK A;  1K93 D;  2JRF A;  1XFZ O;  4GUK A;  3CR2 A;  1AHR A;  2KI4 B;  2MRD A;  4DIR A;  2BE4 A;  3WNX B;  2BEC A;  2F8P A;  2KQY A;  2TN4 A;  1GGZ A;  2M3W A;  4I5J A;  1LA0 A;  2WC8 A;  1K96 A;  1JFK A;  2MA2 A;  1MWN A;  1C7W A;  1S6J A;  2VRG A;  3MSE B;  4PE1 A;  3CWG A;  1IWQ A;  1RTP 1;  3SJS A;  1KFX L;  4CLN A;  2OS8 C;  2AAO A;  1S6C A;  2BBM A;  2M49 B;  3FWC A;  4FTG A;  1F55 A;  2I18 A;  2K7C A;  3KO0 A;  4YRU A;  2KQ6 A;  1TCO B;  1ZFS A;  1L2O C;  3NSO A;  2KFH A;  4I5N B;  4QJ5 B;  1HQV A;  2LVK A;  2QAC A;  3NSL A;  1SPY A;  3CTN A;  4YGB B;  4R1E A;  1PVA A;  4AQI A;  2COL B;  1WRL A;  1QJT A;  2Y5I A;  2BCX A;  1SL7 A;  4E68 A;  1UHN A;  4L9M A;  1DF0 A;  2KOT A;  2L50 A;  2PVB A;  1F54 A;  1DT7 B;  1M46 A;  2LV7 A;  2WCB A;  2LE9 B;  4GNK B;  2JXC A;  1XFV O;  1OZO A;  5D69 A;  1CNP A;  2R2I A;  1NUB A;  4BY4 A;  5CSF A;  1K2H A;  1KQM B;  5D7F A;  2KGR A;  1FW4 A;  1K9U A;  1QAT A;  1LIN A;  1JFJ A;  1DJY A;  1DTL A;  3D10 A;  1MXL C;  1SY9 A;  5AXI A;  5TNC A;  1JSA A;  2L0P A;  5HLV A;  1G4Y R;  1WY9 A;  2KBM A;  4WRI A;  1TOP A;  3DVK A;  4MRX A;  3PN7 B;  2A4J A;  1SBJ A;  2BKH B;  1XFY O;  1D1O A;  2PRU A;  3VRO A;  3WXA A;  3A4U B;  3H4S E;  3DF0 B;  3DF0 A;  3FIA A;  1BOD A;  3SG7 A;  3TS5 B;  3O4Y A;  1YX7 A;  5I2O A;  1JC2 A;  1QIW A;  1NCZ A;  3OB1 B;  3EK8 A;  1PSB A;  1IRJ A;  1LKJ A;  1NYA A;  5PAL A;  4P5O E;  4YGA A;  2KSP A;  2MLF C;  2K7O A;  4NDB A;  1WLZ A;  1JBA A;  1SKT A;  4PAL A;  3OX5 A;  2M7L A;  3E3R A;  3I5F B;  4OKH A;  1EG3 A;  5AFP A;  1N65 A;  4HRH A;  2LVI A;  3FWB A;  2JC2 A;  2BCB A;  1BMO A;  2LHI A;  3KEV A;  4DRW A;  2LP2 A;  3CLN A;  1JUO A;  3TUY C;  1F71 A;  1JF2 A;  1SCM C;  2M8U A;  4U8D A;  4PDZ A;  2JTZ A;  3F45 A;  1WLM A;  2E30 A;  1KWO B;  2WOS A;  4I5K A;  1UUS A;  1PAL A;  1CLL A;  2KAV A;  1QX7 A;  2I7A A;  2LVV A;  2M1K B;  3RLZ A;  1S1E A;  1QV0 A;  1NP8 A;  3OP0 A;  3JVT C;  2WCF A;  2JT3 A;  2LMV A;  1S6I A;  5AER A;  1KQV A;  3NXA A;  2KNE A;  2LP3 A;  1REC A;  1AJ4 A;  1S26 D;  2F2P A;  1RRO A;  2HF5 A;  4PE0 A;  2FJU B;  4C0L A;  3PM8 A;  3I5F C;  5ER4 X;  2JT0 A;  3HX4 A;  5HLO A;  1M45 A;  2SAS A;  1MXE A;  1ZOT B;  1ZMZ A;  1DVI A;  2KAY A;  1UWO A;  3BYA A;  4YGC B;  4PCW A;  2LUX A;  1XVJ A;  1Y0V H;  4PHJ A;  4NDD A;  3WHT B;  2NZ0 A;  3EK7 A;  1CDN A;  3BUW B;  3NSK A;  4M2P A;  3AKB A;  3DVJ A;  2CXJ A;  1SK6 D;  1FI5 A;  1YTZ C;  4GFT A;  2AMI A;  2JWW A;  2ZKM X;  2FCD A;  4OR9 B;  1B8L A;  2JOJ A;  3IF7 A;  2K7B A;  4JPZ B;  3GK1 A;  1XK4 A;  2K8M B;  1UHI A;  3A8R A;  2JUL A;  2AUC A;  1C07 A;  5HYD A;  1BR1 B;  1B1G A;  1A03 A;  5HKW A;  4NQG A;  2HQ8 A;  1UHK A;  2CNP A;  1CMG A;  3CR4 X;  1EG4 A;  2ZRS A;  1FPW A;  1V1G A;  2K2F A;  3AAK A;  1A2X A;  2BCA A;  1QX2 A;  2JNF A;  1UHH A;  2MAZ A;  3SG4 A;  1LA3 A;  1MF8 B;  3SG6 A;  5KSZ A;  1IJ6 A;  1BG1 A;  2ZND A;  1B47 A;  4GGF A;  5AEQ A;  2WND A;  2Y1N A;  1K9K A;  4I5L B;  1QAS A;  1M39 A;  1R2U A;  4MZL A;  2FCE A;  1S36 A;  1QVI Z;  3I5I C;  1XK4 C;  2LHL A;  2ZN8 A;  1CLM A;  2NCO A;  2P6B B;  3ZNI A;  1F70 A;  4OCI A;  1PK0 D;  1OQP A;  2WOR A;  1DF0 B;  2F3Y A;  2L98 A;  3BUN B;  3LK0 A;  5B8I B;  1H8B A;  1IG5 A;  3LCP C;  3SIB A;  2LAP A;  4C0J A;  2Y4Q A;  4PE4 A;  1B4C A;  5JJG A;  1LXF C;  4HSZ A;  2B1U A;  1CM4 A;  1A29 A;  1HT9 A;  1DJG A;  3TUY B;  2K2A A;  1SCM B;  2M7N A;  3C1V A;  4YI9 A;  1TNQ A;  1MQ1 A;  4MZK A;  2LUC A;  1FBV A;  2BE6 A;  2Q4U A;  1VRK A;  3KF9 A;  4CFQ A;  1B8R A;  1BJF A;  4M2O A;  2L5X B;  1YUU A;  2V53 A;  1DJX A;  2D8N A;  1UP5 A;  2LMT A;  4MBE A;  5G08 A;  1Y1U A;  3VRR A;  1XO5 A;  4GGF C;  5FYX A;  1K94 A;  1KK7 Z;  1KFU L;  3HCM A;  1UHJ A;  1PSR A;  1BT6 A;  2JZI A;  3GK2 A;  1F4O A;  3JVT B;  4OV2 A;  2E6W A;  2PAS A;  2KYC A;  1QS7 A;  1JF0 A;  1CDM A;  3AKA A;  2FOT A;  1B8C A;  3GK4 X;  1SCV A;  3GOF A;  5F6T A;  2F2O A;  3WHU B;  1AK8 A;  4NDC A;  3TZ1 A;  2NLN A;  1E8A A;  1W7J B;  1KSO A;  1IKU A;  2CCM A;  2KFF A;  2MBX A;  1BLQ A;  2ZRT A;  1PRW A;  3CGA A;  3CS1 A;  1QLK A;  1YVH A;  2GGM A;  3EVV A;  4CFR A;  1DJZ A;  2EHB A;  2ZN9 A;  3VRN A;  1OMV A;  2JXL A;  3CR5 X;  1V1F A;  3EVU A;  3PSR A;  1XFU O;  2PSR A;  1EXR A;  1XYD A;  1JWD A;  4PE7 A;  1QX5 B;  3KHE A;  4P2Y B;  4Q04 A;  1CDL A;  3IQO A;  1NX2 A;  3FS7 A;  3K21 A;  1J7O A;  1AJ5 A;  1X02 A;  1WDC C;  4YGE B;  1EJ3 A;  4MLW A;  2BL0 C;  2G2B A;  1G33 A;  2HQW A;  1NSH A;  1LVC D;  1KK7 Y;  1DGV A;  3M0W A;  1ALW A;  3DD4 A;  2HET A;  2GV5 A;  1NWD A;  3BOW B;  3BOW A;  4CID A;  1J1D A;  2IS9 A;  1DJH A;  3D0Y B;  3D0Y A;  3I5H C;  3LLE A;  5JOL A;  2KYF A;  1XFW O;  1FI6 A;  1GQM A;  1SNL A;  1OMR A;  5GQQ C;  2OTG C;  2MHH A;  1Y1A A;  4CPV A;  2K0J A;  1TN4 A;  2BKI B;  1OSA A;  2ZFD A;  3BQ3 A;  1IH0 A;  1CFD A;  5CSI A;  2LCP A;  1SRA A;  2K7D A;  2M29 A;  1QIV A;  2NCP A;  1GJY A;  4C0K A;  1BF5 A;  3O6B A;  2LM5 A;  2EC6 B;  1WRZ A;  4MSP A;  5I8N A;  1AVS A;  2HPS A;  3LK1 A;  1CM1 A;  1Y1X A;  2I2R E;  1MHO A;  2L4I A;  3I5I B;  4HRG A;  1XA5 A;  2CTN A;  4PHK A;  1CB1 A;  2CBL A;  2CT9 A;  2LMU A;  1N2D A;  1IQ5 A;  1SR6 C;  1CKK A;  1YR5 A;  1NCX A;  2JQ6 A;  2L51 A;  2DOQ A;  1KCY A;  1TNP A;  1J7Q A;  1C7V A;  2ZNE A;  5HKY A;  5DKR A;  1SW8 A;  3VRQ A;  4MVF A;  4ZCV A;  5I2Q A;  1MR8 A;  4OVN F;  1EL4 A;  3EK4 A;  3AAJ A;  4YBH B;  3LL8 B;  3PFV A;  2H2K A;  3SIA A;  2G9B A;  1PUL A;  1YUR A;  4GBA A;  1SL9 A;  5I2L A;  3IQQ A;  3O2P A;  2EC6 C;  2Y1M A;  5DKQ A;  4XYN A;  1CFC A;  5IBW A;  3SG3 A;  1CFP A;  1DMO A;  1M31 A;  1KSM A;  4A4C A;  2WCE A;  1WRK A;  1KK8 C;  2O5G A;  4A4B A;  1M63 B;  1TIZ A;  1B7T Z;  2M1U A;  5K89 A;  1K9P A;  1S5G Z;  1DJI A;  1DGU A;  3BUX B;  4WQ3 A;  4IL1 A;  1GGW A;  2EGD A;  3JTD C;  4WQ2 A;  4AQJ A;  1OMD A;  1QXP A;  1ODB A;  2O60 A;  1ALV A;  1AUI B;  1RJV A;  1DJW A;  5KU1 A;  3PAT A;  2ISD A;  2MLE C;  1QV1 A;  3I5G B;  4GPL B;  1AP4 A;  3CZT X;  1IJ5 A;  2KHN A;  2NXQ A;  3DVM A;  1YRT B;  3TDU A;  4M2Q A;  2JT8 A;  1J7R A;  4ORB B;  1B9A A;  2F33 A;  3VRP A;  1A4P A;  5CPV A;  2KI6 C;  3EKH A;  2KI6 D;  1FF1 A;  1NPQ A;  1WDC B;  1RFJ A;  2M0R A;  4N1F A;  4QJ3 B;  2BL0 B;  2KI4 C;  1F4Q A;  1SMG A;  5KTY A;  1BR4 B;  1RK9 A;  1K8U A;  1NX1 A;  1RWY A;  2JTT A;  2KBI A;  1W7I B;  2LC5 A;  2M97 A;  1TNW A;  1BOC A;  1QVI Y;  3OX6 A;  3I5H B;  1F8H A;  2GGZ A;  1J55 A;  2M9G A;  3PAL A;  3ZWH A;  2PMY A;  1B7T Y;  1K95 A;  2OTG B;  3DVE A;  1XFX O;  1IGV A;  2OPO A;  4USL A;  2LLT A;  4BY5 A;  2K61 A;  3TDZ A;  1S5G Y;  4MZJ A;  1ZUZ A;  2I94 A;  5J3X A;  2LLU A;  1QTX A;  3RM1 A;  1U5I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...