1KK7Y

Scallop myosin in the near rigor conformation
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
b'KLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN, STRIATED MUSCLE
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 23
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Y01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Y02
3EVRA 1DF0B 1RFJA 2SCPA 1TNPA 2EHBA 2JTZA 2JXLA 2LC5A 1SCVA 2I94A 5D69A 1XFVO 1MXLC 4AQJA 1QVIY 2LP2A 1OE9B 5HKZA 1DVIA 1W7JB 3WHUB 5CSFA 2JT8A 1UHKA 1KWOC 1M31A 2KI4C 4YRUA 3BYAA 3EK4A 1J1EA 4F0ZB 4I5KA 3K21A 2MHHA 1BR4B 3BUMB 1CFFA 2SASA 4E68A 1DJIA 1TN4A 5K89A 1RECA 1UURA 1NX2A 1OZSA 3VROA 1YR5A 5HKYA 1KWOB 1MWNA 2KI4B 1IJ6A 1K95A 2ZFDA 4IL1A 2JWWA 3AAJA 3LK0A 2M8UA 4N5XA 2K7BA 1FF1A 1PSBA 5AFPA 1B9AA 2M7NA 2BKIB 2Y1MA 1SPYA 1S1EA 1KK7Z 1BT6A 1ZOTB 2M29A 3CGAA 3OP0A 1G4YR 2EGDA 4FTGA 4MBEA 1WRZA 4DS7A 4L9MA 2BL0C 1TCOB 3DF0A 4YGBB 1TOPA 1A75B 1EJ3A 3F45A 1Y0VH 2Y5IA 2KFFA 2L2EA 4M2OA 3CR2A 4ICBA 1BR1B 1AJ4A 5JJGA 1BJFA 2BL0B 3NSLA 3SG5A 1CDLA 2PALA 4GGFA 1KFXL 3SG7A 2CXJA 2K2AA 4CIDA 1Y1AA 1CDPA 3JVTC 4N1FA 3BOWA 2F8PA 2AMIA 1OSAA 2CT9A 1PK0D 2KHNA 4D1EA 4PALA 3I5FC 2BKHB 1NX3A 1PALA 4OCIA 1Y1XA 1KFUL 1ODBA 2M1KB 3JVTB 1KK7Y 4YBHB 3EKJA 5CSNA 1QATA 1BU3A 1CKKA 2M49B 2RGIA 1K9PA 4YI9A 4HREE 1TNWA 3I5FB 2I2RE 1EXRA 2FCEA 2K7OA 2KDHA 2LHIA 4GFTA 2A4JA 2K7CA 3I5GC 3C1VA 3IQQA 3OX6A 3WNXB 1CFCA 2ZNEA 3I5IC 4PE0A 3PFVA 1RTP1 4YGAA 5HLOA 5KSZA 1OZOA 4NQGA 4PHJA 5J3XA 1KCYA 3H4SE 5TNCA 3EVVA 3I5GB 1H8BA 4DRWA 5CSIA 3I5IB 2KAVA 1QXPA 1NPQA 2Q91A 1IKUA 2M3WA 3FIAA 2KI6C 4BY5A 2LVIA 1YTZC 4CFRA 4QJ5B 1G33A 3SIBA 3NSOA 3BUNB 1K9KA 1RK9A 1XFYO 2BCBA 2ZN8A 1VRKA 2JNFA 3SJSA 4CPVA 1M46A 1R6PA 1F4OA 2BE6A 2M7LA 1KSMA 1JUOA 1LVCD 2CTNA 1XK4C 4MRXA 2LUCA 1QVIZ 4MZJA 2M1UA 1NWDA 1MUXA 2CCMA 2D8NA 1K2HA 4DUQA 1CMGA 2L4HA 3LLEA 1JSAA 4QJ3B 1NCYA 1AP4A 1FI6A 5I2QA 1SL9A 1UP5A 1JFJA 2JTTA 1DJGA 4DCKA 1JF0A 1ZACA 4YI8A 2M9GA 1BLQA 5JOLA 1MQ1A 1SRAA 2BBNA 1GQMA 1BOCA 2KI6D 1A75A 1K93D 2NCPA 3ICBA 1B4CA 1NX1A 4M2QA 1A2XA 1QASA 1A03A 1QTXA 1SBJA 1DJHA 4HRHA 3TDUA 3DD4A 1KSOA 3LCPC 1PULA 2JT3A 1J55A 2BCAA 2MA2A 3OHMB 1FPWA 2F33A 2GGMA 5GQQC 1UHIA 3KPXA 4XJKA 3GK2A 2L51A 4JQ0D 4PHMA 4NDBA 2COLB 2MLFC 4WQ3A 1NSHA 1DJZA 2JULA 1CB1A 1C7VA 5B8IB 2KQ6A 2JNXA 2MRDA 3HCMA 3OB1B 2JT0A 4GAOA 1HT9A 1OOJA 3GK4X 1Y6WA 2BECA 1TCFA 2ISDA 3KHEA 1WRKA 2LNKA 1UHJA 3PSRA 3WXAA 1TRFA 1GGZA 1UWOA 1B1GA 1B8LA 2LMTA 2JPTA 2EC6C 1YX7A 1J7RA 3ZNIA 2K0JA 1WRLA 4CLNA 1JF2A 3VRPA 2JC2A 4BY4A 2H61C 3GK1A 3CS1A 1B8RA 1M39A 2JXCA 1B7TZ 4MZKA 5G08A 1K8UA 1MXEA 4OR9B 1XFXO 3D0YB 5DKQA 2PRUA 1CM4A 2EC6B 1S3PA 4MN0A 1YVLA 1TTXA 1AK8A 2LMUA 1CDMA 3BUWB 1F70A 2KYFA 1CLLA 1OMRA 3EK8A 3IQOA 2L4IA 2PASA 2LE9B 4OV2A 4U8DA 1EL4A 1DJWA 3LK1A 1JFKA 2M0RA 2F3ZA 1JBAA 4C0LA 1CFDA 1W7IB 4MVFA 1PVBA 2HQWA 1B8CA 1N0YA 1R2UA 1WLZA 1CDNA 1NP8A 1V1GA 2JZIA 4FQOA 4XJKB 2LANA 1OMDA 1PVAA 1SYMA 3IF7A 2L50A 3VRNA 1NX0A 1ALWA 2KBMA 1XVJA 1ALVA 1BG1A 1B7TY 2LCPA 1QX2A 4NDCA 1QLKA 5ER4X 2HF5A 1XK4A 3O78A 5D7FA 1YUSA 1EG4A 1QV1A 1BF5A 2ZKMX 4I5NB 1NUBA 2I18A 1N65A 2KFHA 2MBXA 1QIVA 1DJYA 3PATA 2LLTA 4ZCUA 2JQ6A 2K61A 1QX5B 2MLEC 3A8RA 3AKBA 3OB2B 1X02A 2B1UA 1AHRA 5CPVA 4P5OE 2IS9A 2KGRA 2QPTA 3I5HC 3SIAA 2KSPA 1D1OA 2KQYA 3NXAA 4HSZA 3OX5A 1PSRA 3FWCA 1ZFSA 4ZCVA 1QX7A 2WCFA 4R1EA 3DVEA 3AAKA 1SKTA 4MLWA 1FW4A 3I5HB 1YRTB 2LVVA 1LA3A 2K2FA 2LVJA 4XYNA 1IG5A 2KFGA 4AOMA 1J7PA 3LL8B 1F4QA 4GBAA 2K7DA 1J7OA 4PE4A 3D10A 1XFZO 5AXIA 3BXKA 2LV7A 1YUUA 1M63B 2KAYA 2HQ8A 4PHNA 2NLNA 5FYXA 4HRGA 3D0YA 3PLFB 3A4UB 3TDIA 1XFWO 4YGEB 1F71A 1KK8C 2H61A 1SR6C 2CBLA 2LLUA 3DVJA 4CFQA 1L7ZA 1XA5A 1Q80A 3O4YA 1B47A 3GOFA 5ER5A 2KOTA 4YGDB 1WDCC 1ZMZA 1SW8A 1QIWA 2DOQA 3EK7A 1RJVA 5HLVA 1ZUZA 1KK8B 1LKJA 2L0PA 5AERA 1CNPA 2VRGA 3E3RA 2FJUB 4ORAB 4TNCA 2WOSA 3SG3A 1WDCB 3PN7C 3TS5C 1K9UA 2ZNDA 3WHTB 2Y4QA 2Y1NA 1AJ5A 5AEQA 4YGCB 1F8HA 4P2YB 1KFXS 2NCOA 1UUSA 1S6IA 3BUOB 3PN7B 1QJTA 1GJYA 3TS5B 1S5GY 1MHOA 1K96A 4WQ2A 3NSKA 3SG2A 3M0WA 3TZ1A 2HPSA 1JWDA 3RM1A 1KFUS 1EH2A 5PALA 1AVSA 1U5IB 2FCDA 1DGUA 1K90D 2FOTA 3VRQA 2KYCA 2WORA 2LVKA 4PE1A 4I5JA 1JC2A 1CLBA 4AQIA 1IQ5A 1SNLA 2F2PA 1UHNA 1IGVA 1XYDA 1OQPA 1DJXA 3CR4X 4MSPA 3NSIA 4JWQA 2OS8C 4NDDA 2I7AA 1C07A 1DGVA 3QRXA 1IWQA 2LMVA 3CTNA 2TN4A 4MRYA 1K94A 5I2OA 1DT7B 1Y1UA 3PM8A 3MSEB 1QLSA 1OMVA 5CSJA 1F54A 5IBWA 1BODA 2OS8B 2WNDA 2JU0A 3FWBA 1C7WA 1SCMC 2O60A 2QACA 2BE4A 3CR5X 4ORCB 4OVNF 3TUYC 1UHHA 3DVKA 1QV0A 1YUTA 3O2PA 2ZRTA 4GPLB 3RLZA 3BQ3A 2AUCA 1S36A 1LINA 1RWYA 1KQMC 4ORBB 1S6JA 3TDZA 1IRJA 1SCMB 2LM5A 3TUYB 3PALA 2LAPA 5HKWA 1TIZA 1FBVA 1LA0A 1SL8A 2R2IA 3KF9A 2MJWB 3SG6A 4A4CA 1KQMB 1A29A 1YRUB 1MF8B 1NCXA 1TNXA 5BPJA 4I5LB 3HX4A 1V1FA 2Q4UA 1IQ3A 1SY9A 4GUKA 4MEWA 1XFUO 3AKAA 3O6BA 2KAXA 4A4BA 2BCXA 1E8AA 5KU1A 1CMFA 2BBMA 2ZN9A 2PVBA 2ZRSA 1EG3A 2G2BA 2P6BB 1SMGA 4JPZB 4UPGA 1YURA 1PRWA 4PCWA 2WCEA 2KNEA 2OTGC 2HETA 1S6CA 1J7QA 2JRFA 5HYDA 1BMOA 1L2OC 4C0JA 4ETOA 2E6WA 1CLMA 1WLMA 4MZLA 2CNPA 3JTDC 1IH0A 4PDZA 1DMOA 3VGOA 1MR8A 2OTGB 2KGBC 2E30A 2GGZA 1J1DA 1LXFC 4Q04A 3CLNA 2LUXA 5I8NA 1L2OB 1CFPA 1DF0A 1U5IA 2MAZA 1G8IA 2H2KA 1A4PA 3JTDB 2O5GA 3SG4A 4GNKB 5F6TA 4QJ4B 1XO5A 2WC8A 1S5GZ 1WY9A 2PMYA 3EVUA 3CZTX 2F2OA 3DF0B 4OKHA 5DKNA 3DVMA 2LP3A 4GGFC 3ZWHA 1HQVA 2V53A 1NIWA 4DIRA 1CTRA 1IJ5A 1GGWA 1SL7A 4PHKA 1QS7A 5AANA 5I2LA 1NCZA 2K8MB 1YVHA 3EKHA 2JOJA 2NXQA 5DKRA 1SR6B 3BUXB 3BOWB 2LLSA 2G9BA 2AAOA 2NZ0A 1RROA 2LHLA 2PSRA 4PE7A 3CWGA 4GGNA 3VRRA 4C0KA 5KTYA 3KO0A 1F55A 1YX8A 1SK6D 1FI5A 3KEVA 1DTLA 1M45A 2KBIA 4WRIA 2GV5A 1S26D 1N2DA 4USLA 3FS7A 1KQVA 1AUIB 2L98A 1CM1A 1NYAA 2L5XB 2WCBA 4M2PA 4N1GA 2OPOA 1H4BA 2F3YA 1TNQA 2M97A
chains in the Genus database with same CATH superfamily
3EVRA 1DF0B 1RFJA 2SCPA 1TNPA 2EHBA 2JTZA 2JXLA 2LC5A 1SCVA 1GM0A 2I94A 5D69A 1XFVO 1MXLC 4AQJA 1QVIY 2LP2A 1OE9B 5HKZA 1DVIA 1W7JB 3WHUB 5CSFA 2JT8A 1UHKA 1KWOC 1M31A 2KI4C 2P70A 4YRUA 2BNXA 3D76A 3BYAA 3EK4A 1J1EA 4F0ZB 4I5KA 3K21A 1TWOA 2MHHA 1BR4B 3BUMB 1CFFA 2SASA 4E68A 1DJIA 1TN4A 5K89A 1RECA 3CZ0A 1UURA 1NX2A 1OZSA 3CABA 1YR5A 3VROA 5HKYA 1KWOB 1MWNA 2KI4B 1IJ6A 1K95A 2ZFDA 4IL1A 4FQTA 4IJ7A 2JWWA 3AAJA 3LK0A 2M8UA 4N5XA 2K7BA 1FF1A 1OOHA 3NHTA 1PSBA 5AFPA 2GTEA 1B9AA 2M7NA 2BKIB 2Y1MA 1SPYA 1S1EA 3O4XA 1KK7Z 1BT6A 1ZOTB 2M29A 3CGAA 3OP0A 1G4YR 2EGDA 4FTGA 4MBEA 1WRZA 4DS7A 4L9MA 3S0EA 2BL0C 1TCOB 3DF0A 4YGBB 1TOPA 1A75B 1EJ3A 3F45A 1Y0VH 2Y5IA 1OW4A 2KFFA 2L2EA 4M2OA 3CR2A 4ICBA 1BR1B 1OOIX 3EG5B 1AJ4A 5JJGA 1BJFA 2BL0B 3NSLA 3SG5A 1CDLA 2PALA 4GGFA 1KFXL 1TUJA 2CXJA 2K2AA 3SG7A 1Y1AA 1CDPA 3JVTC 4N1FA 3BOWA 4CIDA 2F8PA 2AMIA 1OSAA 2CT9A 1PK0D 1SSEB 2KHNA 3FE8A 4D1EA 4PALA 3I5FC 2BKHB 1NX3A 1PALA 3DXLA 4OCIA 1Y1XA 1KFUL 1ODBA 2M1KB 3JVTB 1KK7Y 4YBHB 3EKJA 5CSNA 4F7FA 1QATA 1BU3A 3Q8IA 5FI7A 1CKKA 2M49B 2RGIA 1K9PA 4YI9A 4HREE 5FI6A 1TNWA 3I5FB 2I2RE 1EXRA 2FCEA 2K7OA 2KDHA 2LHIA 2KLDA 2A4JA 4GFTA 3RZSA 2K7CA 3I5GC 3C1VA 3IQQA 3OX6A 3WNXB 1CFCA 2ZNEA 3I5IC 4PE0A 3PFVA 1RTP1 4YGAA 5HLOA 5KSZA 1Z4HA 1OZOA 2ERBA 4NQGA 4PHJA 5J3XA 1KCYA 3H4SE 5TNCA 3EVVA 3I5GB 1H8BA 2P71A 3B88A 4DRWA 3VB1A 5CSIA 3I5IB 2KAVA 3N7HA 1QXPA 3NGVA 1QWVA 1NPQA 2Q91A 1IKUA 2M3WA 3BFHA 2KI6C 3FIAA 4BY5A 2LVIA 1YTZC 4CFRA 1IIOA 4QJ5B 1G33A 3SIBA 3NSOA 3BUNB 1TUZA 1K9KA 1RK9A 1XFYO 2BCBA 2ZN8A 1VRKA 2JNFA 3SJSA 4CPVA 1M46A 1R6PA 3BFAA 1F4OA 3QMEA 2BE6A 2M7LA 1KSMA 1JUOA 1LVCD 2CTNA 1XK4C 4MRXA 1C3ZA 2LUCA 1QVIZ 4MZJA 2M1UA 1NWDA 1MUXA 2CCMA 2D8NA 2JPOA 1K2HA 4DUQA 1CMGA 2L4HA 3LLEA 1JSAA 4QJ3B 1NCYA 1AP4A 1FI6A 5I2QA 2H8VA 1SL9A 1UP5A 2K60A 2L5YA 1JFJA 2JTTA 1DJGA 4DCKA 1JF0A 1ZACA 4YI8A 2M9GA 1OOGA 1BLQA 5HL1A 5JOLA 1MQ1A 1SRAA 2BBNA 1GQMA 1BOCA 2KI6D 1A75A 1K93D 2NCPA 3ICBA 1B4CA 1NX1A 4M2QA 1A2XA 1QASA 1A03A 1QTXA 1SBJA 1DJHA 4HRHA 3TDUA 3DD4A 1KSOA 3LCPC 1PULA 2JT3A 1J55A 2BCAA 2MA2A 2WC5A 3OHMB 1FPWA 2F33A 2GGMA 5GQQC 1UHIA 3KPXA 4XJKA 3GK2A 2L51A 4JQ0D 4PHMA 4NDBA 2COLB 2MLFC 4WQ3A 1NSHA 1DJZA 2JULA 1CB1A 2YGUA 1C7VA 5B8IB 2KQ6A 2JNXA 2MRDA 2WCMA 3HCMA 3OB1B 2JT0A 4GAOA 1HT9A 1OOJA 3GK4X 1Y6WA 2BECA 1TCFA 2ISDA 3KHEA 1WRKA 2LNKA 1UHJA 3PSRA 3WXAA 1TRFA 1GGZA 1UWOA 4OZDA 1B8LA 2LMTA 2JPTA 3UNWA 2EC6C 1YX7A 1J7RA 3ZNIA 2K0JA 1WRLA 4CLNA 1JF2A 3VRPA 2JC2A 4BY4A 2H61C 3GK1A 3CS1A 1B8RA 1M39A 2JXCA 2L2CA 1B7TZ 4MZKA 5G08A 3L4AA 1K8UA 1MXEA 3UO9A 4OR9B 1P28A 1XFXO 3D0YB 5DKQA 2PRUA 1CM4A 2EC6B 1S3PA 4MN0A 1YVLA 1TTXA 1AK8A 2LMUA 1CDMA 3BUWB 1F70A 2KYFA 1CLLA 1OMRA 3EK8A 3IQOA 2L4IA 2PASA 2LE9B 3BJHA 4OV2A 4U8DA 1EL4A 1DJWA 3LK1A 1OOFA 1JFKA 3PM2A 2M0RA 2F3ZA 1JBAA 4C0LA 1CFDA 1W7IB 4MVFA 1PVBA 2HQWA 1B8CA 1N0YA 1R2UA 1WLZA 1CDNA 3DY9A 1NP8A 1V1GA 2JZIA 4FQOA 4XJKB 2LANA 1OMDA 1PVAA 1SYMA 3IF7A 2L50A 3VRNA 1NX0A 1ALWA 2KBMA 1XVJA 1ALVA 1BG1A 1B7TY 2LCPA 1QX2A 4NDCA 1QLKA 5ER4X 2HF5A 1XK4A 3O78A 5D7FA 1YUSA 1EG4A 1QV1A 1BF5A 2ZKMX 4I5NB 1NUBA 2I18A 1N65A 2KFHA 4INWA 2MBXA 1QIVA 1DJYA 1Z2CB 3PATA 2LLTA 4ZCUA 2JQ6A 3NHIA 2K61A 3SS5A 1QX5B 2MLEC 3A8RA 3AKBA 4PT1A 3OB2B 1X02A 2B1UA 1AHRA 1DQEA 5CPVA 4P5OE 2IS9A 2KGRA 2QPTA 3I5HC 3SIAA 2KSPA 1D1OA 2KQYA 2WCKA 3L47A 3NXAA 4HSZA 3OX5A 1PSRA 3FWCA 1ZFSA 4ZCVA 1QX7A 2WCFA 4R1EA 1W9ZA 3AAKA 3DVEA 1SKTA 4MLWA 1FW4A 3I5HB 1YRTB 1XFRA 3R72A 2LVVA 1LA3A 2K2FA 2LVJA 4XYNA 1IG5A 2KFGA 4AOMA 1J7PA 3LL8B 1F4QA 4GBAA 2K7DA 4JKTA 1J7OA 4PE4A 3D10A 1XFZO 3PJIA 5AXIA 3BXKA 2LV7A 1YUUA 1M63B 2QEVA 3FE9A 2KAYA 2HQ8A 4PHNA 2NLNA 5FYXA 3FE6A 3D0YA 4HRGA 3PLFB 3A4UB 3TDIA 1XFWO 4YGEB 1F71A 1KK8C 2H61A 1SR6C 2CBLA 2LLUA 3DVJA 4CFQA 1L7ZA 1XA5A 1Q80A 3O4YA 1B47A 3GOFA 5ER5A 2KOTA 4YGDB 1WDCC 1ZMZA 1SW8A 1QIWA 2DOQA 3EK7A 1RJVA 5HLVA 1ZUZA 1KK8B 1LKJA 2L0PA 5AERA 1CNPA 3R1PA 2VRGA 3E3RA 2FJUB 4ORAB 4TNCA 2WOSA 3SG3A 1WDCB 3PN7C 3TS5C 1K9UA 2ZNDA 3DYEA 3B86A 3WHTB 2Y4QA 2Y1NA 1AJ5A 5AEQA 4YGCB 1F8HA 4P2YB 1KFXS 2NCOA 2KLEA 1UUSA 1S6IA 3BUOB 3B7AA 1QJTA 1GJYA 3PN7B 3TS5B 1S5GY 3DZTA 1MHOA 1K96A 4WQ2A 3NSKA 3SG2A 3M0WA 3TZ1A 2HPSA 3D77A 1JWDA 3RM1A 1KFUS 1EH2A 5PALA 1AVSA 1U5IB 3R1OA 1T14A 2FCDA 1DGUA 3S0FA 1K90D 2FOTA 5EL2A 3VRQA 2KYCA 2WORA 1ORGA 2LVKA 4PE1A 4I5JA 1JC2A 1CLBA 4AQIA 1IQ5A 1SNLA 2F2PA 1UHNA 1IGVA 1XYDA 1OQPA 1DJXA 3CR4X 4MSPA 3NSIA 2QEHA 4JWQA 2OS8C 4NDDA 2I7AA 1C07A 1DGVA 3QRXA 1IWQA 2LMVA 3CTNA 2TN4A 4MRYA 1K94A 5FI2A 3SS3A 5I2OA 1DT7B 1Y1UA 3PM8A 3MSEB 1QLSA 1DEKA 2BAPA 1OMVA 5CSJA 1F54A 5IBWA 3CZ2A 1BODA 4JD9A 2OS8B 2WNDA 2QEBA 2JU0A 3FWBA 1C7WA 1SCMC 2O60A 2QACA 2BE4A 3CR5X 4ORCB 4OVNF 3TUYC 1UHHA 3DVKA 4INXA 1QV0A 1YUTA 3D78A 3L4LA 2ZRTA 3O2PA 4GPLB 3RLZA 3BQ3A 1C3YA 2AUCA 1S36A 3B87A 1LINA 1RWYA 1KQMC 4ORBB 1S6JA 3TDZA 2WCJA 2PYQA 1IRJA 1SCMB 2LM5A 3TUYB 3PALA 2LAPA 5D3OA 5HKWA 1TIZA 3D74A 3V2LA 1FBVA 1LA0A 1SL8A 2R2IA 3KF9A 2MJWB 3SG6A 4A4CA 1KQMB 1A29A 1YRUB 1MF8B 1NCXA 1TNXA 3OGNA 5BPJA 4I5LB 3HX4A 1V1FA 2Q4UA 1IQ3A 1SY9A 4GUKA 4MEWA 1XFUO 3AKAA 3O6BA 2KAXA 4A4BA 2BCXA 1E8AA 1DELA 5KU1A 1CMFA 2BBMA 2ZN9A 2PVBA 2ZRSA 1EG3A 2G2BA 2P6BB 2WCHA 1SMGA 4JPZB 4UPGA 3S0GA 1YURA 1PRWA 2KPHA 2WCEA 4PCWA 3B6XA 2KNEA 2OTGC 2HETA 1S6CA 1J7QA 2JRFA 5HYDA 3CYZA 1BMOA 1L2OC 4C0JA 4ETOA 2E6WA 1CLMA 1WLMA 4MZLA 5I94A 2CNPA 3JTDC 3S0AA 4PDZA 1IH0A 1DMOA 3VGOA 1MR8A 2OTGB 2KGBC 2E30A 2FJYA 1J1DA 1LXFC 2GGZA 3CLNA 4Q04A 2LUXA 3R1VA 5I8NA 1L2OB 1CFPA 1DF0A 1U5IA 2MAZA 1G8IA 2H2KA 1A4PA 3JTDB 2O5GA 3SG4A 4GNKB 5F6TA 4QJ4B 1XO5A 2WC8A 3S0BA 1S5GZ 3OBVA 1WY9A 2WCLA 2PMYA 3EVUA 3D73A 3CZTX 2F2OA 3DF0B 4OKHA 5DKNA 3DVMA 2LP3A 4GGFC 3ZWHA 1HQVA 2V53A 1NIWA 4DIRA 1CTRA 1IJ5A 1GGWA 1SL7A 4PHKA 1QS7A 4KYNA 5AANA 5I2LA 1NCZA 2K8MB 1YVHA 3EKHA 2WC6A 2JOJA 2NXQA 5DKRA 1SR6B 3BUXB 2PQLA 3BFBA 3BOWB 2LLSA 2G9BA 2AAOA 1LS8A 2NZ0A 1DC1A 1RROA 3K1EA 2LHLA 2PSRA 4PE7A 3CWGA 4GGNA 3VRRA 4C0KA 5KTYA 3CDNA 3KO0A 1F55A 1YX8A 3CZ1A 1SK6D 1FI5A 2QEOA 3KEVA 1DTLA 1M45A 2KBIA 4WRIA 2GV5A 1S26D 1N2DA 4USLA 3FS7A 5DICA 3S0DA 1KQVA 1AUIB 2QDIA 2L98A 1CM1A 3D75A 1NYAA 3SS4A 2L5XB 2WCBA 3IVTA 4M2PA 4N1GA 2OPOA 1B1GA 1H4BA 2F3YA 1TNQA 2M97A
chains in the Genus database with same CATH topology
3EVRA 1DF0B 1RFJA 2SCPA 1TNPA 2EHBA 2JTZA 2JXLA 2LC5A 1SCVA 2I94A 5D69A 1XFVO 1MXLC 4AQJA 1QVIY 2LP2A 1OE9B 5HKZA 1DVIA 1W7JB 3WHUB 5CSFA 2JT8A 1UHKA 1KWOC 1M31A 2KI4C 4YRUA 3BYAA 3EK4A 1J1EA 4F0ZB 4I5KA 3K21A 2MHHA 1BR4B 3BUMB 1CFFA 2SASA 4E68A 1DJIA 1TN4A 5K89A 1RECA 1UURA 1NX2A 1OZSA 3VROA 1YR5A 5HKYA 1KWOB 1MWNA 2KI4B 1IJ6A 1K95A 2ZFDA 4IL1A 2JWWA 3AAJA 3LK0A 2M8UA 4N5XA 2K7BA 1FF1A 1PSBA 5AFPA 1B9AA 2M7NA 2BKIB 2Y1MA 1SPYA 1S1EA 1KK7Z 1BT6A 1ZOTB 2M29A 3CGAA 3OP0A 1G4YR 2EGDA 4FTGA 4MBEA 1WRZA 4DS7A 4L9MA 2BL0C 1TCOB 3DF0A 4YGBB 1TOPA 1A75B 1EJ3A 3F45A 1Y0VH 2Y5IA 2KFFA 2L2EA 4M2OA 3CR2A 4ICBA 1BR1B 1AJ4A 5JJGA 1BJFA 2BL0B 3NSLA 3SG5A 1CDLA 2PALA 4GGFA 1KFXL 3SG7A 2CXJA 2K2AA 4CIDA 1Y1AA 1CDPA 3JVTC 4N1FA 3BOWA 2F8PA 2AMIA 1OSAA 2CT9A 1PK0D 2KHNA 4D1EA 4PALA 3I5FC 2BKHB 1NX3A 1PALA 4OCIA 1Y1XA 1KFUL 1ODBA 2M1KB 3JVTB 1KK7Y 4YBHB 3EKJA 5CSNA 1QATA 1BU3A 1CKKA 2M49B 2RGIA 1K9PA 4YI9A 4HREE 1TNWA 3I5FB 2I2RE 1EXRA 2FCEA 2K7OA 2KDHA 2LHIA 4GFTA 2A4JA 2K7CA 3I5GC 3C1VA 3IQQA 3OX6A 3WNXB 1CFCA 2ZNEA 3I5IC 4PE0A 3PFVA 1RTP1 4YGAA 5HLOA 5KSZA 1OZOA 4NQGA 4PHJA 5J3XA 1KCYA 3H4SE 5TNCA 3EVVA 3I5GB 1H8BA 4DRWA 5CSIA 3I5IB 2KAVA 1QXPA 1NPQA 2Q91A 1IKUA 2M3WA 3FIAA 2KI6C 4BY5A 2LVIA 1YTZC 4CFRA 4QJ5B 1G33A 3SIBA 3NSOA 3BUNB 1K9KA 1RK9A 1XFYO 2BCBA 2ZN8A 1VRKA 2JNFA 3SJSA 4CPVA 1M46A 1R6PA 1F4OA 2BE6A 2M7LA 1KSMA 1JUOA 1LVCD 2CTNA 1XK4C 4MRXA 2LUCA 1QVIZ 4MZJA 2M1UA 1NWDA 1MUXA 2CCMA 2D8NA 1K2HA 4DUQA 1CMGA 2L4HA 3LLEA 1JSAA 4QJ3B 1NCYA 1AP4A 1FI6A 5I2QA 1SL9A 1UP5A 1JFJA 2JTTA 1DJGA 4DCKA 1JF0A 1ZACA 4YI8A 2M9GA 1BLQA 5JOLA 1MQ1A 1SRAA 2BBNA 1GQMA 1BOCA 2KI6D 1A75A 1K93D 2NCPA 3ICBA 1B4CA 1NX1A 4M2QA 1A2XA 1QASA 1A03A 1QTXA 1SBJA 1DJHA 4HRHA 3TDUA 3DD4A 1KSOA 3LCPC 1PULA 2JT3A 1J55A 2BCAA 2MA2A 3OHMB 1FPWA 2F33A 2GGMA 5GQQC 1UHIA 3KPXA 4XJKA 3GK2A 2L51A 4JQ0D 4PHMA 4NDBA 2COLB 2MLFC 4WQ3A 1NSHA 1DJZA 2JULA 1CB1A 1C7VA 5B8IB 2KQ6A 2JNXA 2MRDA 3HCMA 3OB1B 2JT0A 4GAOA 1HT9A 1OOJA 3GK4X 1Y6WA 2BECA 1TCFA 2ISDA 3KHEA 1WRKA 2LNKA 1UHJA 3PSRA 3WXAA 1TRFA 1GGZA 1UWOA 1B1GA 1B8LA 2LMTA 2JPTA 2EC6C 1YX7A 1J7RA 3ZNIA 2K0JA 1WRLA 4CLNA 1JF2A 3VRPA 2JC2A 4BY4A 2H61C 3GK1A 3CS1A 1B8RA 1M39A 2JXCA 1B7TZ 4MZKA 5G08A 1K8UA 1MXEA 4OR9B 1XFXO 3D0YB 5DKQA 2PRUA 1CM4A 2EC6B 1S3PA 4MN0A 1YVLA 1TTXA 1AK8A 2LMUA 1CDMA 3BUWB 1F70A 2KYFA 1CLLA 1OMRA 3EK8A 3IQOA 2L4IA 2PASA 2LE9B 4OV2A 4U8DA 1EL4A 1DJWA 3LK1A 1JFKA 2M0RA 2F3ZA 1JBAA 4C0LA 1CFDA 1W7IB 4MVFA 1PVBA 2HQWA 1B8CA 1N0YA 1R2UA 1WLZA 1CDNA 1NP8A 1V1GA 2JZIA 4FQOA 4XJKB 2LANA 1OMDA 1PVAA 1SYMA 3IF7A 2L50A 3VRNA 1NX0A 1ALWA 2KBMA 1XVJA 1ALVA 1BG1A 1B7TY 2LCPA 1QX2A 4NDCA 1QLKA 5ER4X 2HF5A 1XK4A 3O78A 5D7FA 1YUSA 1EG4A 1QV1A 1BF5A 2ZKMX 4I5NB 1NUBA 2I18A 1N65A 2KFHA 2MBXA 1QIVA 1DJYA 3PATA 2LLTA 4ZCUA 2JQ6A 2K61A 1QX5B 2MLEC 3A8RA 3AKBA 3OB2B 1X02A 2B1UA 1AHRA 5CPVA 4P5OE 2IS9A 2KGRA 2QPTA 3I5HC 3SIAA 2KSPA 1D1OA 2KQYA 3NXAA 4HSZA 3OX5A 1PSRA 3FWCA 1ZFSA 4ZCVA 1QX7A 2WCFA 4R1EA 3DVEA 3AAKA 1SKTA 4MLWA 1FW4A 3I5HB 1YRTB 2LVVA 1LA3A 2K2FA 2LVJA 4XYNA 1IG5A 2KFGA 4AOMA 1J7PA 3LL8B 1F4QA 4GBAA 2K7DA 1J7OA 4PE4A 3D10A 1XFZO 5AXIA 3BXKA 2LV7A 1YUUA 1M63B 2KAYA 2HQ8A 4PHNA 2NLNA 5FYXA 4HRGA 3D0YA 3PLFB 3A4UB 3TDIA 1XFWO 4YGEB 1F71A 1KK8C 2H61A 1SR6C 2CBLA 2LLUA 3DVJA 4CFQA 1L7ZA 1XA5A 1Q80A 3O4YA 1B47A 3GOFA 5ER5A 2KOTA 4YGDB 1WDCC 1ZMZA 1SW8A 1QIWA 2DOQA 3EK7A 1RJVA 5HLVA 1ZUZA 1KK8B 1LKJA 2L0PA 5AERA 1CNPA 2VRGA 3E3RA 2FJUB 4ORAB 4TNCA 2WOSA 3SG3A 1WDCB 3PN7C 3TS5C 1K9UA 2ZNDA 3WHTB 2Y4QA 2Y1NA 1AJ5A 5AEQA 4YGCB 1F8HA 4P2YB 1KFXS 2NCOA 1UUSA 1S6IA 3BUOB 3PN7B 1QJTA 1GJYA 3TS5B 1S5GY 1MHOA 1K96A 4WQ2A 3NSKA 3SG2A 3M0WA 3TZ1A 2HPSA 1JWDA 3RM1A 1KFUS 1EH2A 5PALA 1AVSA 1U5IB 2FCDA 1DGUA 1K90D 2FOTA 3VRQA 2KYCA 2WORA 2LVKA 4PE1A 4I5JA 1JC2A 1CLBA 4AQIA 1IQ5A 1SNLA 2F2PA 1UHNA 1IGVA 1XYDA 1OQPA 1DJXA 3CR4X 4MSPA 3NSIA 4JWQA 2OS8C 4NDDA 2I7AA 1C07A 1DGVA 3QRXA 1IWQA 2LMVA 3CTNA 2TN4A 4MRYA 1K94A 5I2OA 1DT7B 1Y1UA 3PM8A 3MSEB 1QLSA 1OMVA 5CSJA 1F54A 5IBWA 1BODA 2OS8B 2WNDA 2JU0A 3FWBA 1C7WA 1SCMC 2O60A 2QACA 2BE4A 3CR5X 4ORCB 4OVNF 3TUYC 1UHHA 3DVKA 1QV0A 1YUTA 3O2PA 2ZRTA 4GPLB 3RLZA 3BQ3A 2AUCA 1S36A 1LINA 1RWYA 1KQMC 4ORBB 1S6JA 3TDZA 1IRJA 1SCMB 2LM5A 3TUYB 3PALA 2LAPA 5HKWA 1TIZA 1FBVA 1LA0A 1SL8A 2R2IA 3KF9A 2MJWB 3SG6A 4A4CA 1KQMB 1A29A 1YRUB 1MF8B 1NCXA 1TNXA 5BPJA 4I5LB 3HX4A 1V1FA 2Q4UA 1IQ3A 1SY9A 4GUKA 4MEWA 1XFUO 3AKAA 3O6BA 2KAXA 4A4BA 2BCXA 1E8AA 5KU1A 1CMFA 2BBMA 2ZN9A 2PVBA 2ZRSA 1EG3A 2G2BA 2P6BB 1SMGA 4JPZB 4UPGA 1YURA 1PRWA 4PCWA 2WCEA 2KNEA 2OTGC 2HETA 1S6CA 1J7QA 2JRFA 5HYDA 1BMOA 1L2OC 4C0JA 4ETOA 2E6WA 1CLMA 1WLMA 4MZLA 2CNPA 3JTDC 1IH0A 4PDZA 1DMOA 3VGOA 1MR8A 2OTGB 2KGBC 2E30A 2GGZA 1J1DA 1LXFC 4Q04A 3CLNA 2LUXA 5I8NA 1L2OB 1CFPA 1DF0A 1U5IA 2MAZA 1G8IA 2H2KA 1A4PA 3JTDB 2O5GA 3SG4A 4GNKB 5F6TA 4QJ4B 1XO5A 2WC8A 1S5GZ 1WY9A 2PMYA 3EVUA 3CZTX 2F2OA 3DF0B 4OKHA 5DKNA 3DVMA 2LP3A 4GGFC 3ZWHA 1HQVA 2V53A 1NIWA 4DIRA 1CTRA 1IJ5A 1GGWA 1SL7A 4PHKA 1QS7A 5AANA 5I2LA 1NCZA 2K8MB 1YVHA 3EKHA 2JOJA 2NXQA 5DKRA 1SR6B 3BUXB 3BOWB 2LLSA 2G9BA 2AAOA 2NZ0A 1RROA 2LHLA 2PSRA 4PE7A 3CWGA 4GGNA 3VRRA 4C0KA 5KTYA 3KO0A 1F55A 1YX8A 1SK6D 1FI5A 3KEVA 1DTLA 1M45A 2KBIA 4WRIA 2GV5A 1S26D 1N2DA 4USLA 3FS7A 1KQVA 1AUIB 2L98A 1CM1A 1NYAA 2L5XB 2WCBA 4M2PA 4N1GA 2OPOA 1H4BA 2F3YA 1TNQA 2M97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVR A;  1DF0 B;  1RFJ A;  2SCP A;  1TNP A;  2EHB A;  2JTZ A;  2JXL A;  2LC5 A;  1SCV A;  2I94 A;  5D69 A;  1XFV O;  1MXL C;  4AQJ A;  1QVI Y;  2LP2 A;  1OE9 B;  5HKZ A;  1DVI A;  1W7J B;  3WHU B;  5CSF A;  2JT8 A;  1UHK A;  1KWO C;  1M31 A;  2KI4 C;  4YRU A;  3BYA A;  3EK4 A;  1J1E A;  4F0Z B;  4I5K A;  3K21 A;  2MHH A;  1BR4 B;  3BUM B;  1CFF A;  2SAS A;  4E68 A;  1DJI A;  1TN4 A;  5K89 A;  1REC A;  1UUR A;  1NX2 A;  1OZS A;  3VRO A;  1YR5 A;  5HKY A;  1KWO B;  1MWN A;  2KI4 B;  1IJ6 A;  1K95 A;  2ZFD A;  4IL1 A;  2JWW A;  3AAJ A;  3LK0 A;  2M8U A;  4N5X A;  2K7B A;  1FF1 A;  1PSB A;  5AFP A;  1B9A A;  2M7N A;  2BKI B;  2Y1M A;  1SPY A;  1S1E A;  1KK7 Z;  1BT6 A;  1ZOT B;  2M29 A;  3CGA A;  3OP0 A;  1G4Y R;  2EGD A;  4FTG A;  4MBE A;  1WRZ A;  4DS7 A;  4L9M A;  2BL0 C;  1TCO B;  3DF0 A;  4YGB B;  1TOP A;  1A75 B;  1EJ3 A;  3F45 A;  1Y0V H;  2Y5I A;  2KFF A;  2L2E A;  4M2O A;  3CR2 A;  4ICB A;  1BR1 B;  1AJ4 A;  5JJG A;  1BJF A;  2BL0 B;  3NSL A;  3SG5 A;  1CDL A;  2PAL A;  4GGF A;  1KFX L;  3SG7 A;  2CXJ A;  2K2A A;  4CID A;  1Y1A A;  1CDP A;  3JVT C;  4N1F A;  3BOW A;  2F8P A;  2AMI A;  1OSA A;  2CT9 A;  1PK0 D;  2KHN A;  4D1E A;  4PAL A;  3I5F C;  2BKH B;  1NX3 A;  1PAL A;  4OCI A;  1Y1X A;  1KFU L;  1ODB A;  2M1K B;  3JVT B;  1KK7 Y;  4YBH B;  3EKJ A;  5CSN A;  1QAT A;  1BU3 A;  1CKK A;  2M49 B;  2RGI A;  1K9P A;  4YI9 A;  4HRE E;  1TNW A;  3I5F B;  2I2R E;  1EXR A;  2FCE A;  2K7O A;  2KDH A;  2LHI A;  4GFT A;  2A4J A;  2K7C A;  3I5G C;  3C1V A;  3IQQ A;  3OX6 A;  3WNX B;  1CFC A;  2ZNE A;  3I5I C;  4PE0 A;  3PFV A;  1RTP 1;  4YGA A;  5HLO A;  5KSZ A;  1OZO A;  4NQG A;  4PHJ A;  5J3X A;  1KCY A;  3H4S E;  5TNC A;  3EVV A;  3I5G B;  1H8B A;  4DRW A;  5CSI A;  3I5I B;  2KAV A;  1QXP A;  1NPQ A;  2Q91 A;  1IKU A;  2M3W A;  3FIA A;  2KI6 C;  4BY5 A;  2LVI A;  1YTZ C;  4CFR A;  4QJ5 B;  1G33 A;  3SIB A;  3NSO A;  3BUN B;  1K9K A;  1RK9 A;  1XFY O;  2BCB A;  2ZN8 A;  1VRK A;  2JNF A;  3SJS A;  4CPV A;  1M46 A;  1R6P A;  1F4O A;  2BE6 A;  2M7L A;  1KSM A;  1JUO A;  1LVC D;  2CTN A;  1XK4 C;  4MRX A;  2LUC A;  1QVI Z;  4MZJ A;  2M1U A;  1NWD A;  1MUX A;  2CCM A;  2D8N A;  1K2H A;  4DUQ A;  1CMG A;  2L4H A;  3LLE A;  1JSA A;  4QJ3 B;  1NCY A;  1AP4 A;  1FI6 A;  5I2Q A;  1SL9 A;  1UP5 A;  1JFJ A;  2JTT A;  1DJG A;  4DCK A;  1JF0 A;  1ZAC A;  4YI8 A;  2M9G A;  1BLQ A;  5JOL A;  1MQ1 A;  1SRA A;  2BBN A;  1GQM A;  1BOC A;  2KI6 D;  1A75 A;  1K93 D;  2NCP A;  3ICB A;  1B4C A;  1NX1 A;  4M2Q A;  1A2X A;  1QAS A;  1A03 A;  1QTX A;  1SBJ A;  1DJH A;  4HRH A;  3TDU A;  3DD4 A;  1KSO A;  3LCP C;  1PUL A;  2JT3 A;  1J55 A;  2BCA A;  2MA2 A;  3OHM B;  1FPW A;  2F33 A;  2GGM A;  5GQQ C;  1UHI A;  3KPX A;  4XJK A;  3GK2 A;  2L51 A;  4JQ0 D;  4PHM A;  4NDB A;  2COL B;  2MLF C;  4WQ3 A;  1NSH A;  1DJZ A;  2JUL A;  1CB1 A;  1C7V A;  5B8I B;  2KQ6 A;  2JNX A;  2MRD A;  3HCM A;  3OB1 B;  2JT0 A;  4GAO A;  1HT9 A;  1OOJ A;  3GK4 X;  1Y6W A;  2BEC A;  1TCF A;  2ISD A;  3KHE A;  1WRK A;  2LNK A;  1UHJ A;  3PSR A;  3WXA A;  1TRF A;  1GGZ A;  1UWO A;  1B1G A;  1B8L A;  2LMT A;  2JPT A;  2EC6 C;  1YX7 A;  1J7R A;  3ZNI A;  2K0J A;  1WRL A;  4CLN A;  1JF2 A;  3VRP A;  2JC2 A;  4BY4 A;  2H61 C;  3GK1 A;  3CS1 A;  1B8R A;  1M39 A;  2JXC A;  1B7T Z;  4MZK A;  5G08 A;  1K8U A;  1MXE A;  4OR9 B;  1XFX O;  3D0Y B;  5DKQ A;  2PRU A;  1CM4 A;  2EC6 B;  1S3P A;  4MN0 A;  1YVL A;  1TTX A;  1AK8 A;  2LMU A;  1CDM A;  3BUW B;  1F70 A;  2KYF A;  1CLL A;  1OMR A;  3EK8 A;  3IQO A;  2L4I A;  2PAS A;  2LE9 B;  4OV2 A;  4U8D A;  1EL4 A;  1DJW A;  3LK1 A;  1JFK A;  2M0R A;  2F3Z A;  1JBA A;  4C0L A;  1CFD A;  1W7I B;  4MVF A;  1PVB A;  2HQW A;  1B8C A;  1N0Y A;  1R2U A;  1WLZ A;  1CDN A;  1NP8 A;  1V1G A;  2JZI A;  4FQO A;  4XJK B;  2LAN A;  1OMD A;  1PVA A;  1SYM A;  3IF7 A;  2L50 A;  3VRN A;  1NX0 A;  1ALW A;  2KBM A;  1XVJ A;  1ALV A;  1BG1 A;  1B7T Y;  2LCP A;  1QX2 A;  4NDC A;  1QLK A;  5ER4 X;  2HF5 A;  1XK4 A;  3O78 A;  5D7F A;  1YUS A;  1EG4 A;  1QV1 A;  1BF5 A;  2ZKM X;  4I5N B;  1NUB A;  2I18 A;  1N65 A;  2KFH A;  2MBX A;  1QIV A;  1DJY A;  3PAT A;  2LLT A;  4ZCU A;  2JQ6 A;  2K61 A;  1QX5 B;  2MLE C;  3A8R A;  3AKB A;  3OB2 B;  1X02 A;  2B1U A;  1AHR A;  5CPV A;  4P5O E;  2IS9 A;  2KGR A;  2QPT A;  3I5H C;  3SIA A;  2KSP A;  1D1O A;  2KQY A;  3NXA A;  4HSZ A;  3OX5 A;  1PSR A;  3FWC A;  1ZFS A;  4ZCV A;  1QX7 A;  2WCF A;  4R1E A;  3DVE A;  3AAK A;  1SKT A;  4MLW A;  1FW4 A;  3I5H B;  1YRT B;  2LVV A;  1LA3 A;  2K2F A;  2LVJ A;  4XYN A;  1IG5 A;  2KFG A;  4AOM A;  1J7P A;  3LL8 B;  1F4Q A;  4GBA A;  2K7D A;  1J7O A;  4PE4 A;  3D10 A;  1XFZ O;  5AXI A;  3BXK A;  2LV7 A;  1YUU A;  1M63 B;  2KAY A;  2HQ8 A;  4PHN A;  2NLN A;  5FYX A;  4HRG A;  3D0Y A;  3PLF B;  3A4U B;  3TDI A;  1XFW O;  4YGE B;  1F71 A;  1KK8 C;  2H61 A;  1SR6 C;  2CBL A;  2LLU A;  3DVJ A;  4CFQ A;  1L7Z A;  1XA5 A;  1Q80 A;  3O4Y A;  1B47 A;  3GOF A;  5ER5 A;  2KOT A;  4YGD B;  1WDC C;  1ZMZ A;  1SW8 A;  1QIW A;  2DOQ A;  3EK7 A;  1RJV A;  5HLV A;  1ZUZ A;  1KK8 B;  1LKJ A;  2L0P A;  5AER A;  1CNP A;  2VRG A;  3E3R A;  2FJU B;  4ORA B;  4TNC A;  2WOS A;  3SG3 A;  1WDC B;  3PN7 C;  3TS5 C;  1K9U A;  2ZND A;  3WHT B;  2Y4Q A;  2Y1N A;  1AJ5 A;  5AEQ A;  4YGC B;  1F8H A;  4P2Y B;  1KFX S;  2NCO A;  1UUS A;  1S6I A;  3BUO B;  3PN7 B;  1QJT A;  1GJY A;  3TS5 B;  1S5G Y;  1MHO A;  1K96 A;  4WQ2 A;  3NSK A;  3SG2 A;  3M0W A;  3TZ1 A;  2HPS A;  1JWD A;  3RM1 A;  1KFU S;  1EH2 A;  5PAL A;  1AVS A;  1U5I B;  2FCD A;  1DGU A;  1K90 D;  2FOT A;  3VRQ A;  2KYC A;  2WOR A;  2LVK A;  4PE1 A;  4I5J A;  1JC2 A;  1CLB A;  4AQI A;  1IQ5 A;  1SNL A;  2F2P A;  1UHN A;  1IGV A;  1XYD A;  1OQP A;  1DJX A;  3CR4 X;  4MSP A;  3NSI A;  4JWQ A;  2OS8 C;  4NDD A;  2I7A A;  1C07 A;  1DGV A;  3QRX A;  1IWQ A;  2LMV A;  3CTN A;  2TN4 A;  4MRY A;  1K94 A;  5I2O A;  1DT7 B;  1Y1U A;  3PM8 A;  3MSE B;  1QLS A;  1OMV A;  5CSJ A;  1F54 A;  5IBW A;  1BOD A;  2OS8 B;  2WND A;  2JU0 A;  3FWB A;  1C7W A;  1SCM C;  2O60 A;  2QAC A;  2BE4 A;  3CR5 X;  4ORC B;  4OVN F;  3TUY C;  1UHH A;  3DVK A;  1QV0 A;  1YUT A;  3O2P A;  2ZRT A;  4GPL B;  3RLZ A;  3BQ3 A;  2AUC A;  1S36 A;  1LIN A;  1RWY A;  1KQM C;  4ORB B;  1S6J A;  3TDZ A;  1IRJ A;  1SCM B;  2LM5 A;  3TUY B;  3PAL A;  2LAP A;  5HKW A;  1TIZ A;  1FBV A;  1LA0 A;  1SL8 A;  2R2I A;  3KF9 A;  2MJW B;  3SG6 A;  4A4C A;  1KQM B;  1A29 A;  1YRU B;  1MF8 B;  1NCX A;  1TNX A;  5BPJ A;  4I5L B;  3HX4 A;  1V1F A;  2Q4U A;  1IQ3 A;  1SY9 A;  4GUK A;  4MEW A;  1XFU O;  3AKA A;  3O6B A;  2KAX A;  4A4B A;  2BCX A;  1E8A A;  5KU1 A;  1CMF A;  2BBM A;  2ZN9 A;  2PVB A;  2ZRS A;  1EG3 A;  2G2B A;  2P6B B;  1SMG A;  4JPZ B;  4UPG A;  1YUR A;  1PRW A;  4PCW A;  2WCE A;  2KNE A;  2OTG C;  2HET A;  1S6C A;  1J7Q A;  2JRF A;  5HYD A;  1BMO A;  1L2O C;  4C0J A;  4ETO A;  2E6W A;  1CLM A;  1WLM A;  4MZL A;  2CNP A;  3JTD C;  1IH0 A;  4PDZ A;  1DMO A;  3VGO A;  1MR8 A;  2OTG B;  2KGB C;  2E30 A;  2GGZ A;  1J1D A;  1LXF C;  4Q04 A;  3CLN A;  2LUX A;  5I8N A;  1L2O B;  1CFP A;  1DF0 A;  1U5I A;  2MAZ A;  1G8I A;  2H2K A;  1A4P A;  3JTD B;  2O5G A;  3SG4 A;  4GNK B;  5F6T A;  4QJ4 B;  1XO5 A;  2WC8 A;  1S5G Z;  1WY9 A;  2PMY A;  3EVU A;  3CZT X;  2F2O A;  3DF0 B;  4OKH A;  5DKN A;  3DVM A;  2LP3 A;  4GGF C;  3ZWH A;  1HQV A;  2V53 A;  1NIW A;  4DIR A;  1CTR A;  1IJ5 A;  1GGW A;  1SL7 A;  4PHK A;  1QS7 A;  5AAN A;  5I2L A;  1NCZ A;  2K8M B;  1YVH A;  3EKH A;  2JOJ A;  2NXQ A;  5DKR A;  1SR6 B;  3BUX B;  3BOW B;  2LLS A;  2G9B A;  2AAO A;  2NZ0 A;  1RRO A;  2LHL A;  2PSR A;  4PE7 A;  3CWG A;  4GGN A;  3VRR A;  4C0K A;  5KTY A;  3KO0 A;  1F55 A;  1YX8 A;  1SK6 D;  1FI5 A;  3KEV A;  1DTL A;  1M45 A;  2KBI A;  4WRI A;  2GV5 A;  1S26 D;  1N2D A;  4USL A;  3FS7 A;  1KQV A;  1AUI B;  2L98 A;  1CM1 A;  1NYA A;  2L5X B;  2WCB A;  4M2P A;  4N1G A;  2OPO A;  1H4B A;  2F3Y A;  1TNQ A;  2M97 A; 
#chains in the Genus database with same CATH topology
 3EVR A;  1DF0 B;  1RFJ A;  2SCP A;  1TNP A;  2EHB A;  2JTZ A;  2JXL A;  2LC5 A;  1SCV A;  1GM0 A;  2I94 A;  5D69 A;  1XFV O;  1MXL C;  4AQJ A;  1QVI Y;  2LP2 A;  1OE9 B;  5HKZ A;  1DVI A;  1W7J B;  3WHU B;  5CSF A;  2JT8 A;  1UHK A;  1KWO C;  1M31 A;  2KI4 C;  2P70 A;  4YRU A;  2BNX A;  3D76 A;  3BYA A;  3EK4 A;  1J1E A;  4F0Z B;  4I5K A;  3K21 A;  1TWO A;  2MHH A;  1BR4 B;  3BUM B;  1CFF A;  2SAS A;  4E68 A;  1DJI A;  1TN4 A;  5K89 A;  1REC A;  3CZ0 A;  1UUR A;  1NX2 A;  1OZS A;  3CAB A;  1YR5 A;  3VRO A;  5HKY A;  1KWO B;  1MWN A;  2KI4 B;  1IJ6 A;  1K95 A;  2ZFD A;  4IL1 A;  4FQT A;  4IJ7 A;  2JWW A;  3AAJ A;  3LK0 A;  2M8U A;  4N5X A;  2K7B A;  1FF1 A;  1OOH A;  3NHT A;  1PSB A;  5AFP A;  2GTE A;  1B9A A;  2M7N A;  2BKI B;  2Y1M A;  1SPY A;  1S1E A;  3O4X A;  1KK7 Z;  1BT6 A;  1ZOT B;  2M29 A;  3CGA A;  3OP0 A;  1G4Y R;  2EGD A;  4FTG A;  4MBE A;  1WRZ A;  4DS7 A;  4L9M A;  3S0E A;  2BL0 C;  1TCO B;  3DF0 A;  4YGB B;  1TOP A;  1A75 B;  1EJ3 A;  3F45 A;  1Y0V H;  2Y5I A;  1OW4 A;  2KFF A;  2L2E A;  4M2O A;  3CR2 A;  4ICB A;  1BR1 B;  1OOI X;  3EG5 B;  1AJ4 A;  5JJG A;  1BJF A;  2BL0 B;  3NSL A;  3SG5 A;  1CDL A;  2PAL A;  4GGF A;  1KFX L;  1TUJ A;  2CXJ A;  2K2A A;  3SG7 A;  1Y1A A;  1CDP A;  3JVT C;  4N1F A;  3BOW A;  4CID A;  2F8P A;  2AMI A;  1OSA A;  2CT9 A;  1PK0 D;  1SSE B;  2KHN A;  3FE8 A;  4D1E A;  4PAL A;  3I5F C;  2BKH B;  1NX3 A;  1PAL A;  3DXL A;  4OCI A;  1Y1X A;  1KFU L;  1ODB A;  2M1K B;  3JVT B;  1KK7 Y;  4YBH B;  3EKJ A;  5CSN A;  4F7F A;  1QAT A;  1BU3 A;  3Q8I A;  5FI7 A;  1CKK A;  2M49 B;  2RGI A;  1K9P A;  4YI9 A;  4HRE E;  5FI6 A;  1TNW A;  3I5F B;  2I2R E;  1EXR A;  2FCE A;  2K7O A;  2KDH A;  2LHI A;  2KLD A;  2A4J A;  4GFT A;  3RZS A;  2K7C A;  3I5G C;  3C1V A;  3IQQ A;  3OX6 A;  3WNX B;  1CFC A;  2ZNE A;  3I5I C;  4PE0 A;  3PFV A;  1RTP 1;  4YGA A;  5HLO A;  5KSZ A;  1Z4H A;  1OZO A;  2ERB A;  4NQG A;  4PHJ A;  5J3X A;  1KCY A;  3H4S E;  5TNC A;  3EVV A;  3I5G B;  1H8B A;  2P71 A;  3B88 A;  4DRW A;  3VB1 A;  5CSI A;  3I5I B;  2KAV A;  3N7H A;  1QXP A;  3NGV A;  1QWV A;  1NPQ A;  2Q91 A;  1IKU A;  2M3W A;  3BFH A;  2KI6 C;  3FIA A;  4BY5 A;  2LVI A;  1YTZ C;  4CFR A;  1IIO A;  4QJ5 B;  1G33 A;  3SIB A;  3NSO A;  3BUN B;  1TUZ A;  1K9K A;  1RK9 A;  1XFY O;  2BCB A;  2ZN8 A;  1VRK A;  2JNF A;  3SJS A;  4CPV A;  1M46 A;  1R6P A;  3BFA A;  1F4O A;  3QME A;  2BE6 A;  2M7L A;  1KSM A;  1JUO A;  1LVC D;  2CTN A;  1XK4 C;  4MRX A;  1C3Z A;  2LUC A;  1QVI Z;  4MZJ A;  2M1U A;  1NWD A;  1MUX A;  2CCM A;  2D8N A;  2JPO A;  1K2H A;  4DUQ A;  1CMG A;  2L4H A;  3LLE A;  1JSA A;  4QJ3 B;  1NCY A;  1AP4 A;  1FI6 A;  5I2Q A;  2H8V A;  1SL9 A;  1UP5 A;  2K60 A;  2L5Y A;  1JFJ A;  2JTT A;  1DJG A;  4DCK A;  1JF0 A;  1ZAC A;  4YI8 A;  2M9G A;  1OOG A;  1BLQ A;  5HL1 A;  5JOL A;  1MQ1 A;  1SRA A;  2BBN A;  1GQM A;  1BOC A;  2KI6 D;  1A75 A;  1K93 D;  2NCP A;  3ICB A;  1B4C A;  1NX1 A;  4M2Q A;  1A2X A;  1QAS A;  1A03 A;  1QTX A;  1SBJ A;  1DJH A;  4HRH A;  3TDU A;  3DD4 A;  1KSO A;  3LCP C;  1PUL A;  2JT3 A;  1J55 A;  2BCA A;  2MA2 A;  2WC5 A;  3OHM B;  1FPW A;  2F33 A;  2GGM A;  5GQQ C;  1UHI A;  3KPX A;  4XJK A;  3GK2 A;  2L51 A;  4JQ0 D;  4PHM A;  4NDB A;  2COL B;  2MLF C;  4WQ3 A;  1NSH A;  1DJZ A;  2JUL A;  1CB1 A;  2YGU A;  1C7V A;  5B8I B;  2KQ6 A;  2JNX A;  2MRD A;  2WCM A;  3HCM A;  3OB1 B;  2JT0 A;  4GAO A;  1HT9 A;  1OOJ A;  3GK4 X;  1Y6W A;  2BEC A;  1TCF A;  2ISD A;  3KHE A;  1WRK A;  2LNK A;  1UHJ A;  3PSR A;  3WXA A;  1TRF A;  1GGZ A;  1UWO A;  4OZD A;  1B8L A;  2LMT A;  2JPT A;  3UNW A;  2EC6 C;  1YX7 A;  1J7R A;  3ZNI A;  2K0J A;  1WRL A;  4CLN A;  1JF2 A;  3VRP A;  2JC2 A;  4BY4 A;  2H61 C;  3GK1 A;  3CS1 A;  1B8R A;  1M39 A;  2JXC A;  2L2C A;  1B7T Z;  4MZK A;  5G08 A;  3L4A A;  1K8U A;  1MXE A;  3UO9 A;  4OR9 B;  1P28 A;  1XFX O;  3D0Y B;  5DKQ A;  2PRU A;  1CM4 A;  2EC6 B;  1S3P A;  4MN0 A;  1YVL A;  1TTX A;  1AK8 A;  2LMU A;  1CDM A;  3BUW B;  1F70 A;  2KYF A;  1CLL A;  1OMR A;  3EK8 A;  3IQO A;  2L4I A;  2PAS A;  2LE9 B;  3BJH A;  4OV2 A;  4U8D A;  1EL4 A;  1DJW A;  3LK1 A;  1OOF A;  1JFK A;  3PM2 A;  2M0R A;  2F3Z A;  1JBA A;  4C0L A;  1CFD A;  1W7I B;  4MVF A;  1PVB A;  2HQW A;  1B8C A;  1N0Y A;  1R2U A;  1WLZ A;  1CDN A;  3DY9 A;  1NP8 A;  1V1G A;  2JZI A;  4FQO A;  4XJK B;  2LAN A;  1OMD A;  1PVA A;  1SYM A;  3IF7 A;  2L50 A;  3VRN A;  1NX0 A;  1ALW A;  2KBM A;  1XVJ A;  1ALV A;  1BG1 A;  1B7T Y;  2LCP A;  1QX2 A;  4NDC A;  1QLK A;  5ER4 X;  2HF5 A;  1XK4 A;  3O78 A;  5D7F A;  1YUS A;  1EG4 A;  1QV1 A;  1BF5 A;  2ZKM X;  4I5N B;  1NUB A;  2I18 A;  1N65 A;  2KFH A;  4INW A;  2MBX A;  1QIV A;  1DJY A;  1Z2C B;  3PAT A;  2LLT A;  4ZCU A;  2JQ6 A;  3NHI A;  2K61 A;  3SS5 A;  1QX5 B;  2MLE C;  3A8R A;  3AKB A;  4PT1 A;  3OB2 B;  1X02 A;  2B1U A;  1AHR A;  1DQE A;  5CPV A;  4P5O E;  2IS9 A;  2KGR A;  2QPT A;  3I5H C;  3SIA A;  2KSP A;  1D1O A;  2KQY A;  2WCK A;  3L47 A;  3NXA A;  4HSZ A;  3OX5 A;  1PSR A;  3FWC A;  1ZFS A;  4ZCV A;  1QX7 A;  2WCF A;  4R1E A;  1W9Z A;  3AAK A;  3DVE A;  1SKT A;  4MLW A;  1FW4 A;  3I5H B;  1YRT B;  1XFR A;  3R72 A;  2LVV A;  1LA3 A;  2K2F A;  2LVJ A;  4XYN A;  1IG5 A;  2KFG A;  4AOM A;  1J7P A;  3LL8 B;  1F4Q A;  4GBA A;  2K7D A;  4JKT A;  1J7O A;  4PE4 A;  3D10 A;  1XFZ O;  3PJI A;  5AXI A;  3BXK A;  2LV7 A;  1YUU A;  1M63 B;  2QEV A;  3FE9 A;  2KAY A;  2HQ8 A;  4PHN A;  2NLN A;  5FYX A;  3FE6 A;  3D0Y A;  4HRG A;  3PLF B;  3A4U B;  3TDI A;  1XFW O;  4YGE B;  1F71 A;  1KK8 C;  2H61 A;  1SR6 C;  2CBL A;  2LLU A;  3DVJ A;  4CFQ A;  1L7Z A;  1XA5 A;  1Q80 A;  3O4Y A;  1B47 A;  3GOF A;  5ER5 A;  2KOT A;  4YGD B;  1WDC C;  1ZMZ A;  1SW8 A;  1QIW A;  2DOQ A;  3EK7 A;  1RJV A;  5HLV A;  1ZUZ A;  1KK8 B;  1LKJ A;  2L0P A;  5AER A;  1CNP A;  3R1P A;  2VRG A;  3E3R A;  2FJU B;  4ORA B;  4TNC A;  2WOS A;  3SG3 A;  1WDC B;  3PN7 C;  3TS5 C;  1K9U A;  2ZND A;  3DYE A;  3B86 A;  3WHT B;  2Y4Q A;  2Y1N A;  1AJ5 A;  5AEQ A;  4YGC B;  1F8H A;  4P2Y B;  1KFX S;  2NCO A;  2KLE A;  1UUS A;  1S6I A;  3BUO B;  3B7A A;  1QJT A;  1GJY A;  3PN7 B;  3TS5 B;  1S5G Y;  3DZT A;  1MHO A;  1K96 A;  4WQ2 A;  3NSK A;  3SG2 A;  3M0W A;  3TZ1 A;  2HPS A;  3D77 A;  1JWD A;  3RM1 A;  1KFU S;  1EH2 A;  5PAL A;  1AVS A;  1U5I B;  3R1O A;  1T14 A;  2FCD A;  1DGU A;  3S0F A;  1K90 D;  2FOT A;  5EL2 A;  3VRQ A;  2KYC A;  2WOR A;  1ORG A;  2LVK A;  4PE1 A;  4I5J A;  1JC2 A;  1CLB A;  4AQI A;  1IQ5 A;  1SNL A;  2F2P A;  1UHN A;  1IGV A;  1XYD A;  1OQP A;  1DJX A;  3CR4 X;  4MSP A;  3NSI A;  2QEH A;  4JWQ A;  2OS8 C;  4NDD A;  2I7A A;  1C07 A;  1DGV A;  3QRX A;  1IWQ A;  2LMV A;  3CTN A;  2TN4 A;  4MRY A;  1K94 A;  5FI2 A;  3SS3 A;  5I2O A;  1DT7 B;  1Y1U A;  3PM8 A;  3MSE B;  1QLS A;  1DEK A;  2BAP A;  1OMV A;  5CSJ A;  1F54 A;  5IBW A;  3CZ2 A;  1BOD A;  4JD9 A;  2OS8 B;  2WND A;  2QEB A;  2JU0 A;  3FWB A;  1C7W A;  1SCM C;  2O60 A;  2QAC A;  2BE4 A;  3CR5 X;  4ORC B;  4OVN F;  3TUY C;  1UHH A;  3DVK A;  4INX A;  1QV0 A;  1YUT A;  3D78 A;  3L4L A;  2ZRT A;  3O2P A;  4GPL B;  3RLZ A;  3BQ3 A;  1C3Y A;  2AUC A;  1S36 A;  3B87 A;  1LIN A;  1RWY A;  1KQM C;  4ORB B;  1S6J A;  3TDZ A;  2WCJ A;  2PYQ A;  1IRJ A;  1SCM B;  2LM5 A;  3TUY B;  3PAL A;  2LAP A;  5D3O A;  5HKW A;  1TIZ A;  3D74 A;  3V2L A;  1FBV A;  1LA0 A;  1SL8 A;  2R2I A;  3KF9 A;  2MJW B;  3SG6 A;  4A4C A;  1KQM B;  1A29 A;  1YRU B;  1MF8 B;  1NCX A;  1TNX A;  3OGN A;  5BPJ A;  4I5L B;  3HX4 A;  1V1F A;  2Q4U A;  1IQ3 A;  1SY9 A;  4GUK A;  4MEW A;  1XFU O;  3AKA A;  3O6B A;  2KAX A;  4A4B A;  2BCX A;  1E8A A;  1DEL A;  5KU1 A;  1CMF A;  2BBM A;  2ZN9 A;  2PVB A;  2ZRS A;  1EG3 A;  2G2B A;  2P6B B;  2WCH A;  1SMG A;  4JPZ B;  4UPG A;  3S0G A;  1YUR A;  1PRW A;  2KPH A;  2WCE A;  4PCW A;  3B6X A;  2KNE A;  2OTG C;  2HET A;  1S6C A;  1J7Q A;  2JRF A;  5HYD A;  3CYZ A;  1BMO A;  1L2O C;  4C0J A;  4ETO A;  2E6W A;  1CLM A;  1WLM A;  4MZL A;  5I94 A;  2CNP A;  3JTD C;  3S0A A;  4PDZ A;  1IH0 A;  1DMO A;  3VGO A;  1MR8 A;  2OTG B;  2KGB C;  2E30 A;  2FJY A;  1J1D A;  1LXF C;  2GGZ A;  3CLN A;  4Q04 A;  2LUX A;  3R1V A;  5I8N A;  1L2O B;  1CFP A;  1DF0 A;  1U5I A;  2MAZ A;  1G8I A;  2H2K A;  1A4P A;  3JTD B;  2O5G A;  3SG4 A;  4GNK B;  5F6T A;  4QJ4 B;  1XO5 A;  2WC8 A;  3S0B A;  1S5G Z;  3OBV A;  1WY9 A;  2WCL A;  2PMY A;  3EVU A;  3D73 A;  3CZT X;  2F2O A;  3DF0 B;  4OKH A;  5DKN A;  3DVM A;  2LP3 A;  4GGF C;  3ZWH A;  1HQV A;  2V53 A;  1NIW A;  4DIR A;  1CTR A;  1IJ5 A;  1GGW A;  1SL7 A;  4PHK A;  1QS7 A;  4KYN A;  5AAN A;  5I2L A;  1NCZ A;  2K8M B;  1YVH A;  3EKH A;  2WC6 A;  2JOJ A;  2NXQ A;  5DKR A;  1SR6 B;  3BUX B;  2PQL A;  3BFB A;  3BOW B;  2LLS A;  2G9B A;  2AAO A;  1LS8 A;  2NZ0 A;  1DC1 A;  1RRO A;  3K1E A;  2LHL A;  2PSR A;  4PE7 A;  3CWG A;  4GGN A;  3VRR A;  4C0K A;  5KTY A;  3CDN A;  3KO0 A;  1F55 A;  1YX8 A;  3CZ1 A;  1SK6 D;  1FI5 A;  2QEO A;  3KEV A;  1DTL A;  1M45 A;  2KBI A;  4WRI A;  2GV5 A;  1S26 D;  1N2D A;  4USL A;  3FS7 A;  5DIC A;  3S0D A;  1KQV A;  1AUI B;  2QDI A;  2L98 A;  1CM1 A;  3D75 A;  1NYA A;  3SS4 A;  2L5X B;  2WCB A;  3IVT A;  4M2P A;  4N1G A;  2OPO A;  1B1G A;  1H4B A;  2F3Y A;  1TNQ A;  2M97 A; 
#chains in the Genus database with same CATH homology
 3EVR A;  1DF0 B;  1RFJ A;  2SCP A;  1TNP A;  2EHB A;  2JTZ A;  2JXL A;  2LC5 A;  1SCV A;  2I94 A;  5D69 A;  1XFV O;  1MXL C;  4AQJ A;  1QVI Y;  2LP2 A;  1OE9 B;  5HKZ A;  1DVI A;  1W7J B;  3WHU B;  5CSF A;  2JT8 A;  1UHK A;  1KWO C;  1M31 A;  2KI4 C;  4YRU A;  3BYA A;  3EK4 A;  1J1E A;  4F0Z B;  4I5K A;  3K21 A;  2MHH A;  1BR4 B;  3BUM B;  1CFF A;  2SAS A;  4E68 A;  1DJI A;  1TN4 A;  5K89 A;  1REC A;  1UUR A;  1NX2 A;  1OZS A;  3VRO A;  1YR5 A;  5HKY A;  1KWO B;  1MWN A;  2KI4 B;  1IJ6 A;  1K95 A;  2ZFD A;  4IL1 A;  2JWW A;  3AAJ A;  3LK0 A;  2M8U A;  4N5X A;  2K7B A;  1FF1 A;  1PSB A;  5AFP A;  1B9A A;  2M7N A;  2BKI B;  2Y1M A;  1SPY A;  1S1E A;  1KK7 Z;  1BT6 A;  1ZOT B;  2M29 A;  3CGA A;  3OP0 A;  1G4Y R;  2EGD A;  4FTG A;  4MBE A;  1WRZ A;  4DS7 A;  4L9M A;  2BL0 C;  1TCO B;  3DF0 A;  4YGB B;  1TOP A;  1A75 B;  1EJ3 A;  3F45 A;  1Y0V H;  2Y5I A;  2KFF A;  2L2E A;  4M2O A;  3CR2 A;  4ICB A;  1BR1 B;  1AJ4 A;  5JJG A;  1BJF A;  2BL0 B;  3NSL A;  3SG5 A;  1CDL A;  2PAL A;  4GGF A;  1KFX L;  3SG7 A;  2CXJ A;  2K2A A;  4CID A;  1Y1A A;  1CDP A;  3JVT C;  4N1F A;  3BOW A;  2F8P A;  2AMI A;  1OSA A;  2CT9 A;  1PK0 D;  2KHN A;  4D1E A;  4PAL A;  3I5F C;  2BKH B;  1NX3 A;  1PAL A;  4OCI A;  1Y1X A;  1KFU L;  1ODB A;  2M1K B;  3JVT B;  1KK7 Y;  4YBH B;  3EKJ A;  5CSN A;  1QAT A;  1BU3 A;  1CKK A;  2M49 B;  2RGI A;  1K9P A;  4YI9 A;  4HRE E;  1TNW A;  3I5F B;  2I2R E;  1EXR A;  2FCE A;  2K7O A;  2KDH A;  2LHI A;  4GFT A;  2A4J A;  2K7C A;  3I5G C;  3C1V A;  3IQQ A;  3OX6 A;  3WNX B;  1CFC A;  2ZNE A;  3I5I C;  4PE0 A;  3PFV A;  1RTP 1;  4YGA A;  5HLO A;  5KSZ A;  1OZO A;  4NQG A;  4PHJ A;  5J3X A;  1KCY A;  3H4S E;  5TNC A;  3EVV A;  3I5G B;  1H8B A;  4DRW A;  5CSI A;  3I5I B;  2KAV A;  1QXP A;  1NPQ A;  2Q91 A;  1IKU A;  2M3W A;  3FIA A;  2KI6 C;  4BY5 A;  2LVI A;  1YTZ C;  4CFR A;  4QJ5 B;  1G33 A;  3SIB A;  3NSO A;  3BUN B;  1K9K A;  1RK9 A;  1XFY O;  2BCB A;  2ZN8 A;  1VRK A;  2JNF A;  3SJS A;  4CPV A;  1M46 A;  1R6P A;  1F4O A;  2BE6 A;  2M7L A;  1KSM A;  1JUO A;  1LVC D;  2CTN A;  1XK4 C;  4MRX A;  2LUC A;  1QVI Z;  4MZJ A;  2M1U A;  1NWD A;  1MUX A;  2CCM A;  2D8N A;  1K2H A;  4DUQ A;  1CMG A;  2L4H A;  3LLE A;  1JSA A;  4QJ3 B;  1NCY A;  1AP4 A;  1FI6 A;  5I2Q A;  1SL9 A;  1UP5 A;  1JFJ A;  2JTT A;  1DJG A;  4DCK A;  1JF0 A;  1ZAC A;  4YI8 A;  2M9G A;  1BLQ A;  5JOL A;  1MQ1 A;  1SRA A;  2BBN A;  1GQM A;  1BOC A;  2KI6 D;  1A75 A;  1K93 D;  2NCP A;  3ICB A;  1B4C A;  1NX1 A;  4M2Q A;  1A2X A;  1QAS A;  1A03 A;  1QTX A;  1SBJ A;  1DJH A;  4HRH A;  3TDU A;  3DD4 A;  1KSO A;  3LCP C;  1PUL A;  2JT3 A;  1J55 A;  2BCA A;  2MA2 A;  3OHM B;  1FPW A;  2F33 A;  2GGM A;  5GQQ C;  1UHI A;  3KPX A;  4XJK A;  3GK2 A;  2L51 A;  4JQ0 D;  4PHM A;  4NDB A;  2COL B;  2MLF C;  4WQ3 A;  1NSH A;  1DJZ A;  2JUL A;  1CB1 A;  1C7V A;  5B8I B;  2KQ6 A;  2JNX A;  2MRD A;  3HCM A;  3OB1 B;  2JT0 A;  4GAO A;  1HT9 A;  1OOJ A;  3GK4 X;  1Y6W A;  2BEC A;  1TCF A;  2ISD A;  3KHE A;  1WRK A;  2LNK A;  1UHJ A;  3PSR A;  3WXA A;  1TRF A;  1GGZ A;  1UWO A;  1B1G A;  1B8L A;  2LMT A;  2JPT A;  2EC6 C;  1YX7 A;  1J7R A;  3ZNI A;  2K0J A;  1WRL A;  4CLN A;  1JF2 A;  3VRP A;  2JC2 A;  4BY4 A;  2H61 C;  3GK1 A;  3CS1 A;  1B8R A;  1M39 A;  2JXC A;  1B7T Z;  4MZK A;  5G08 A;  1K8U A;  1MXE A;  4OR9 B;  1XFX O;  3D0Y B;  5DKQ A;  2PRU A;  1CM4 A;  2EC6 B;  1S3P A;  4MN0 A;  1YVL A;  1TTX A;  1AK8 A;  2LMU A;  1CDM A;  3BUW B;  1F70 A;  2KYF A;  1CLL A;  1OMR A;  3EK8 A;  3IQO A;  2L4I A;  2PAS A;  2LE9 B;  4OV2 A;  4U8D A;  1EL4 A;  1DJW A;  3LK1 A;  1JFK A;  2M0R A;  2F3Z A;  1JBA A;  4C0L A;  1CFD A;  1W7I B;  4MVF A;  1PVB A;  2HQW A;  1B8C A;  1N0Y A;  1R2U A;  1WLZ A;  1CDN A;  1NP8 A;  1V1G A;  2JZI A;  4FQO A;  4XJK B;  2LAN A;  1OMD A;  1PVA A;  1SYM A;  3IF7 A;  2L50 A;  3VRN A;  1NX0 A;  1ALW A;  2KBM A;  1XVJ A;  1ALV A;  1BG1 A;  1B7T Y;  2LCP A;  1QX2 A;  4NDC A;  1QLK A;  5ER4 X;  2HF5 A;  1XK4 A;  3O78 A;  5D7F A;  1YUS A;  1EG4 A;  1QV1 A;  1BF5 A;  2ZKM X;  4I5N B;  1NUB A;  2I18 A;  1N65 A;  2KFH A;  2MBX A;  1QIV A;  1DJY A;  3PAT A;  2LLT A;  4ZCU A;  2JQ6 A;  2K61 A;  1QX5 B;  2MLE C;  3A8R A;  3AKB A;  3OB2 B;  1X02 A;  2B1U A;  1AHR A;  5CPV A;  4P5O E;  2IS9 A;  2KGR A;  2QPT A;  3I5H C;  3SIA A;  2KSP A;  1D1O A;  2KQY A;  3NXA A;  4HSZ A;  3OX5 A;  1PSR A;  3FWC A;  1ZFS A;  4ZCV A;  1QX7 A;  2WCF A;  4R1E A;  3DVE A;  3AAK A;  1SKT A;  4MLW A;  1FW4 A;  3I5H B;  1YRT B;  2LVV A;  1LA3 A;  2K2F A;  2LVJ A;  4XYN A;  1IG5 A;  2KFG A;  4AOM A;  1J7P A;  3LL8 B;  1F4Q A;  4GBA A;  2K7D A;  1J7O A;  4PE4 A;  3D10 A;  1XFZ O;  5AXI A;  3BXK A;  2LV7 A;  1YUU A;  1M63 B;  2KAY A;  2HQ8 A;  4PHN A;  2NLN A;  5FYX A;  4HRG A;  3D0Y A;  3PLF B;  3A4U B;  3TDI A;  1XFW O;  4YGE B;  1F71 A;  1KK8 C;  2H61 A;  1SR6 C;  2CBL A;  2LLU A;  3DVJ A;  4CFQ A;  1L7Z A;  1XA5 A;  1Q80 A;  3O4Y A;  1B47 A;  3GOF A;  5ER5 A;  2KOT A;  4YGD B;  1WDC C;  1ZMZ A;  1SW8 A;  1QIW A;  2DOQ A;  3EK7 A;  1RJV A;  5HLV A;  1ZUZ A;  1KK8 B;  1LKJ A;  2L0P A;  5AER A;  1CNP A;  2VRG A;  3E3R A;  2FJU B;  4ORA B;  4TNC A;  2WOS A;  3SG3 A;  1WDC B;  3PN7 C;  3TS5 C;  1K9U A;  2ZND A;  3WHT B;  2Y4Q A;  2Y1N A;  1AJ5 A;  5AEQ A;  4YGC B;  1F8H A;  4P2Y B;  1KFX S;  2NCO A;  1UUS A;  1S6I A;  3BUO B;  3PN7 B;  1QJT A;  1GJY A;  3TS5 B;  1S5G Y;  1MHO A;  1K96 A;  4WQ2 A;  3NSK A;  3SG2 A;  3M0W A;  3TZ1 A;  2HPS A;  1JWD A;  3RM1 A;  1KFU S;  1EH2 A;  5PAL A;  1AVS A;  1U5I B;  2FCD A;  1DGU A;  1K90 D;  2FOT A;  3VRQ A;  2KYC A;  2WOR A;  2LVK A;  4PE1 A;  4I5J A;  1JC2 A;  1CLB A;  4AQI A;  1IQ5 A;  1SNL A;  2F2P A;  1UHN A;  1IGV A;  1XYD A;  1OQP A;  1DJX A;  3CR4 X;  4MSP A;  3NSI A;  4JWQ A;  2OS8 C;  4NDD A;  2I7A A;  1C07 A;  1DGV A;  3QRX A;  1IWQ A;  2LMV A;  3CTN A;  2TN4 A;  4MRY A;  1K94 A;  5I2O A;  1DT7 B;  1Y1U A;  3PM8 A;  3MSE B;  1QLS A;  1OMV A;  5CSJ A;  1F54 A;  5IBW A;  1BOD A;  2OS8 B;  2WND A;  2JU0 A;  3FWB A;  1C7W A;  1SCM C;  2O60 A;  2QAC A;  2BE4 A;  3CR5 X;  4ORC B;  4OVN F;  3TUY C;  1UHH A;  3DVK A;  1QV0 A;  1YUT A;  3O2P A;  2ZRT A;  4GPL B;  3RLZ A;  3BQ3 A;  2AUC A;  1S36 A;  1LIN A;  1RWY A;  1KQM C;  4ORB B;  1S6J A;  3TDZ A;  1IRJ A;  1SCM B;  2LM5 A;  3TUY B;  3PAL A;  2LAP A;  5HKW A;  1TIZ A;  1FBV A;  1LA0 A;  1SL8 A;  2R2I A;  3KF9 A;  2MJW B;  3SG6 A;  4A4C A;  1KQM B;  1A29 A;  1YRU B;  1MF8 B;  1NCX A;  1TNX A;  5BPJ A;  4I5L B;  3HX4 A;  1V1F A;  2Q4U A;  1IQ3 A;  1SY9 A;  4GUK A;  4MEW A;  1XFU O;  3AKA A;  3O6B A;  2KAX A;  4A4B A;  2BCX A;  1E8A A;  5KU1 A;  1CMF A;  2BBM A;  2ZN9 A;  2PVB A;  2ZRS A;  1EG3 A;  2G2B A;  2P6B B;  1SMG A;  4JPZ B;  4UPG A;  1YUR A;  1PRW A;  4PCW A;  2WCE A;  2KNE A;  2OTG C;  2HET A;  1S6C A;  1J7Q A;  2JRF A;  5HYD A;  1BMO A;  1L2O C;  4C0J A;  4ETO A;  2E6W A;  1CLM A;  1WLM A;  4MZL A;  2CNP A;  3JTD C;  1IH0 A;  4PDZ A;  1DMO A;  3VGO A;  1MR8 A;  2OTG B;  2KGB C;  2E30 A;  2GGZ A;  1J1D A;  1LXF C;  4Q04 A;  3CLN A;  2LUX A;  5I8N A;  1L2O B;  1CFP A;  1DF0 A;  1U5I A;  2MAZ A;  1G8I A;  2H2K A;  1A4P A;  3JTD B;  2O5G A;  3SG4 A;  4GNK B;  5F6T A;  4QJ4 B;  1XO5 A;  2WC8 A;  1S5G Z;  1WY9 A;  2PMY A;  3EVU A;  3CZT X;  2F2O A;  3DF0 B;  4OKH A;  5DKN A;  3DVM A;  2LP3 A;  4GGF C;  3ZWH A;  1HQV A;  2V53 A;  1NIW A;  4DIR A;  1CTR A;  1IJ5 A;  1GGW A;  1SL7 A;  4PHK A;  1QS7 A;  5AAN A;  5I2L A;  1NCZ A;  2K8M B;  1YVH A;  3EKH A;  2JOJ A;  2NXQ A;  5DKR A;  1SR6 B;  3BUX B;  3BOW B;  2LLS A;  2G9B A;  2AAO A;  2NZ0 A;  1RRO A;  2LHL A;  2PSR A;  4PE7 A;  3CWG A;  4GGN A;  3VRR A;  4C0K A;  5KTY A;  3KO0 A;  1F55 A;  1YX8 A;  1SK6 D;  1FI5 A;  3KEV A;  1DTL A;  1M45 A;  2KBI A;  4WRI A;  2GV5 A;  1S26 D;  1N2D A;  4USL A;  3FS7 A;  1KQV A;  1AUI B;  2L98 A;  1CM1 A;  1NYA A;  2L5X B;  2WCB A;  4M2P A;  4N1G A;  2OPO A;  1H4B A;  2F3Y A;  1TNQ A;  2M97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...