1KK7Y

Scallop myosin in the near rigor conformation
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
KLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN, STRIATED MUSCLE
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 23
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Y01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Y02
3HCMA 1BMOA 4WQ3A 1NSHA 2SASA 1JC2A 4QJ3B 2LUXA 1YRUB 1CLMA 2KSPA 2IS9A 2K8MB 4NDBA 1OSAA 1IJ5A 3GK2A 3BUXB 3TS5B 1SW8A 1LA0A 2F2PA 4MEWA 1PSBA 1PVAA 1B9AA 2KFFA 2DOQA 3TUYC 3KHEA 1CLLA 3BYAA 1SL7A 1SKTA 2O5GA 1PRWA 2F3ZA 3BUMB 4ORAB 5CSJA 2K7CA 2Y5IA 4ICBA 1KK7Z 2M1KB 3BQ3A 1PSRA 1J7QA 2F33A 1G33A 4HRHA 1BF5A 2H61C 4YBHB 1CDLA 2BL0C 3SG3A 4CPVA 1NCYA 1EXRA 1S36A 1L7ZA 4AQJA 1K8UA 3JTDB 1J55A 1G8IA 1SRAA 2K2FA 1B1GA 2WCEA 1CDMA 2KHNA 3EVVA 1BR4B 3EVUA 1F71A 2A4JA 2KQ6A 3JVTC 2M8UA 2JQ6A 3I5HC 1GGWA 1JUOA 2PALA 1W7JB 2L2EA 3HX4A 1RECA 1YUSA 1QV0A 4YRUA 2BKIB 1SMGA 1B47A 3VRPA 1AHRA 4GFTA 1DJZA 2ZRSA 3D0YA 2CT9A 2ZKMX 1AUIB 1WLZA 2EC6C 3O2PA 3LCPC 4XJKB 1OE9B 4E68A 2JNXA 2GGZA 3PM8A 2L4IA 5HKZA 3TZ1A 1TOPA 1NWDA 2KAYA 3TDIA 2MAZA 1WY9A 1DVIA 1MR8A 3BUNB 5B8IB 1IRJA 5AERA 1XFWO 1G4YR 1K9PA 2L51A 1B7TZ 1DF0B 1R6PA 2OTGC 3I5IB 1A75A 1AJ5A 3PSRA 2NZ0A 4XJKA 4ORCB 5HKYA 2E6WA 2HETA 1DGUA 1YVHA 1UP5A 1J7OA 5HLOA 2ZNEA 3D10A 1WRLA 2AUCA 1QIWA 1YUUA 1B8LA 5I2QA 2CNPA 2QPTA 4FQOA 5IBWA 4C0KA 4YGEB 4ZCVA 1ZUZA 2L98A 1NUBA 4ETOA 3CZTX 3PFVA 2QACA 1QATA 3EK7A 4ORBB 4DIRA 2KOTA 2B1UA 2BL0B 1FW4A 1RK9A 4MZKA 2BCAA 4WQ2A 1F4OA 4WRIA 2JOJA 4YI9A 1YVLA 2FJUB 3ICBA 3SG5A 1F70A 3QRXA 4GAOA 5HYDA 1RTP1 1CB1A 2LHLA 1NPQA 1CDPA 2L4HA 2LC5A 1JBAA 5DKRA 3CR2A 1BT6A 1MQ1A 3PATA 2LANA 1XYDA 4R1EA 2FOTA 2LVIA 5PALA 2K7DA 1W7IB 4USLA 1OOJA 1UHNA 2GGMA 2M49B 2ZRTA 3DF0B 1RFJA 1XFXO 3PN7C 1KK8C 5I2LA 1S6JA 1TNXA 1JF2A 2G9BA 1L2OB 2L5XB 2K2AA 1SPYA 1OMRA 2JZIA 3MSEB 4I5JA 5G08A 3LLEA 1B8CA 1XA5A 1NIWA 1KFUL 1Y0VH 2JXLA 1JF0A 2PVBA 2OS8B 4UPGA 5HKWA 1KFXL 1H4BA 1YRTB 2SCPA 3VGOA 1V1FA 1WLMA 2M3WA 2TN4A 5D69A 1TIZA 1BG1A 5JJGA 1S6IA 1CFDA 3F45A 1KWOB 1CKKA 1OMDA 4N1FA 2Q91A 4D1EA 1EJ3A 3PALA 2K61A 4JQ0D 3LK0A 3WHUB 1F54A 1QVIZ 3KO0A 1MXEA 1KQVA 1MXLC 1Y1XA 3SJSA 1J1EA 1SCMC 2ZFDA 5AXIA 1NCZA 1R2UA 2WCBA 4DRWA 4N5XA 5I2OA 2K7BA 2JULA 2I7AA 4CFQA 4XYNA 4NDCA 1ZACA 1Y6WA 2KQYA 2M0RA 2CTNA 5AANA 1KCYA 2KI6C 2KI6D 3AAKA 4MSPA 1AVSA 4YI8A 4P5OE 1M39A 1TN4A 2AMIA 1CMFA 3AKAA 3BUWB 4GPLB 2R2IA 5GQQC 1BODA 1CM1A 2MJWB 1DJHA 1S5GY 3I5FB 1QS7A 1DGVA 1JFKA 1A4PA 4NDDA 3BUOB 3NSKA 1SCVA 2LLTA 1BU3A 4JWQA 3OP0A 1N0YA 1A03A 1CFFA 1WDCB 1S26D 3D0YB 2KNEA 1S3PA 4GUKA 2NLNA 1AK8A 1C7VA 1E8AA 4MRYA 1FPWA 1NX2A 1M63B 2JT3A 1UHIA 4YGBB 1JFJA 3O78A 1IWQA 2LVKA 2EGDA 1TCOB 2JT8A 2MRDA 3CR4X 3OHMB 5ER4X 1EH2A 2CCMA 3EKHA 2KFGA 1TNWA 1XK4C 1ALVA 3I5GB 2M9GA 2JXCA 3M0WA 2WC8A 1DTLA 1K9KA 1SL9A 2WOSA 1A75B 3NSOA 2HPSA 4PHNA 1OZSA 3ZWHA 1KQMB 2LAPA 4Q04A 2MHHA 1LVCD 2MA2A 2Y1MA 3NSLA 1JSAA 1SK6D 1FBVA 1ZOTB 5F6TA 2AAOA 3SG2A 1CFPA 2LMTA 3IQQA 3EK8A 3FWCA 2KI4C 1TTXA 4I5KA 2JC2A 3SG7A 2ZNDA 2HF5A 4YGDB 2EHBA 2ZN8A 3RLZA 2I2RE 4YGAA 3PLFB 3TUYB 2HQ8A 1EL4A 5AEQA 4CFRA 1UURA 1BJFA 1KSMA 1K93D 4MRXA 2LLUA 1SR6C 1YURA 1ODBA 2LVVA 3RM1A 2MLFC 4AQIA 4HRGA 1F8HA 3DVEA 3BXKA 4PE1A 1TCFA 5D7FA 5AFPA 5CSFA 1K94A 1TRFA 3DVMA 2JRFA 3FWBA 3DVJA 4QJ5B 2LUCA 1XFUO 1V1GA 1J7PA 4PE4A 3LL8B 1Y1AA 5HLVA 4MN0A 4DS7A 1NYAA 1QASA 4C0JA 2H61A 3JVTB 3TS5C 1NX3A 2LP2A 1IGVA 1UHHA 2KFHA 3I5HB 2ISDA 5DKQA 4AOMA 1H8BA 1F4QA 3LK1A 1M31A 1NX0A 3DD4A 2V53A 1SYMA 3AAJA 4OCIA 2GV5A 2Q4UA 3CWGA 1KSOA 1QX2A 1YX7A 4M2QA 1IH0A 2BE4A 4M2OA 3CLNA 1YUTA 4I5LB 1AP4A 1C07A 2EC6B 1B8RA 2PASA 1M46A 3SG6A 4PHMA 3JTDC 1LA3A 2Y1NA 4PCWA 1FI6A 1HQVA 2BE6A 2LV7A 1XFYO 3A8RA 3KEVA 1OMVA 1K9UA 1J1DA 3VRRA 1NX1A 5KTYA 2WORA 3TDZA 3GOFA 2KYCA 2OTGB 4U8DA 1JWDA 2LM5A 1CM4A 1UUSA 1MHOA 2CXJA 3BOWA 2BECA 1Q80A 1DJXA 3GK4X 2KAXA 5ER5A 1YX8A 4PHKA 3H4SE 1QX5B 1CTRA 4OVNF 4GBAA 1NP8A 1BR1B 1AJ4A 2L0PA 3EK4A 1IKUA 2ZN9A 2JTTA 1K96A 1OZOA 4HREE 4I5NB 4JPZB 4MLWA 1F55A 3TDUA 1KFUS 1QIVA 1SY9A 2JU0A 4NQGA 5JOLA 1BOCA 1CNPA 3OB2B 1QXPA 1KFXS 2K7OA 4C0LA 5DKNA 1U5IA 3I5IC 2M97A 4DCKA 2COLB 4PDZA 3E3RA 1KK7Y 1CDNA 1S1EA 3IQOA 4IL1A 2O60A 4QJ4B 1QLKA 4BY5A 1IQ5A 1UHKA 3IF7A 3SIBA 1M45A 2JWWA 1B4CA 1GJYA 2BCBA 1KK8B 2JTZA 3PN7B 1S5GZ 2FCEA 2F8PA 4MZLA 4GNKB 2M7LA 1EG3A 2KGRA 1RROA 4A4CA 1K95A 2NCPA 2D8NA 1IJ6A 2BBMA 1CMGA 1TNQA 1CFCA 3VRQA 4OR9B 1FF1A 1QX7A 2M1UA 3ZNIA 1X02A 3CR5X 1Y1UA 1PALA 4CLNA 2MLEC 4BY4A 3OX5A 1MUXA 3AKBA 1QLSA 1YTZC 5I8NA 2KBMA 1FI5A 4PHJA 2BBNA 2RGIA 3SG4A 3FIAA 5KU1A 1XFZO 2M7NA 1L2OC 1PVBA 2PRUA 3DVKA 1SCMB 4GGFC 1CLBA 1DJYA 5BPJA 2E30A 2BKHB 3A4UB 3VROA 1DJIA 2LE9B 4PE0A 1PULA 3KF9A 5J3XA 1B7TY 1HT9A 1SBJA 5CSIA 1C7WA 1A29A 1J7RA 1EG4A 2OS8C 4FTGA 1RJVA 5CSNA 4PALA 2MBXA 1LINA 3NXAA 1S6CA 2BCXA 1RWYA 2F3YA 2OPOA 3VRNA 3WNXB 1KWOC 2LCPA 5TNCA 3EVRA 1NCXA 1QTXA 4ZCUA 2I94A 2LLSA 1UWOA 1DT7B 1A2XA 2G2BA 3EKJA 2KBIA 2VRGA 4MBEA 1N65A 2LMUA 3CGAA 4YGCB 1IG5A 4A4BA 3C1VA 3GK1A 4CIDA 3WXAA 1BLQA 2LMVA 3CTNA 1SNLA 1DMOA 5K89A 1DF0A 1VRKA 4PE7A 1QJTA 2PSRA 4P2YB 1UHJA 3K21A 1WRKA 4HSZA 4OKHA 2P6BB 2WNDA 2H2KA 1DJGA 3CS1A 5FYXA 1GGZA 4GGNA 2L50A 4N1GA 1PK0D 2JPTA 1MF8B 5CPVA 1WRZA 2LP3A 1XVJA 2KGBC 2M29A 3I5FC 3BOWB 1K2HA 3OX6A 4L9MA 1LKJA 2JNFA 4TNCA 2JT0A 1WDCC 2CBLA 3O4YA 1XK4A 2LNKA 3NSIA 2HQWA 2KAVA 1DJWA 1QV1A 3O6BA 1ZMZA 2KYFA 2F2OA 2PMYA 1GQMA 2I18A 2KI4B 4MVFA 4DUQA 1OQPA 2WCFA 4M2PA 2Y4QA 1LXFC 2LHIA 1ALWA 2FCDA 1MWNA 1N2DA 5KSZA 1D1OA 1K90D 1ZFSA 1IQ3A 4MZJA 1TNPA 3SIAA 1QVIY 1SL8A 1SR6B 2NXQA 1XFVO 1U5IB 3DF0A 3I5GC 3WHTB 2LVJA 2NCOA 3OB1B 4GGFA 1YR5A 4F0ZB 3KPXA 1KQMC 4OV2A 1XO5A 3FS7A 2K0JA 2KDHA
chains in the Genus database with same CATH superfamily
3HCMA 1BMOA 4WQ3A 1NSHA 1Z4HA 2SASA 1JC2A 3L47A 2LUXA 1YRUB 1CLMA 2KSPA 4JD9A 4QJ3B 2IS9A 2K8MB 4NDBA 2QEOA 1OSAA 5DICA 1IJ5A 3GK2A 3BUXB 5HL1A 3TS5B 1SW8A 1LA0A 2F2PA 4MEWA 1PSBA 1PVAA 1B9AA 2KFFA 2DOQA 4OZDA 3TUYC 3KHEA 1CLLA 3BYAA 1SL7A 1SKTA 2O5GA 1PRWA 2F3ZA 3BUMB 4ORAB 5CSJA 1P28A 2K7CA 2Y5IA 3CABA 4ICBA 1KK7Z 2M1KB 3BQ3A 1PSRA 1J7QA 2F33A 1G33A 4HRHA 1BF5A 2H61C 4YBHB 1CDLA 2BL0C 3SG3A 1OW4A 4CPVA 1NCYA 1EXRA 1S36A 1L7ZA 4AQJA 1K8UA 3JTDB 3B6XA 1J55A 1G8IA 1SRAA 2K2FA 1B1GA 2WCEA 1CDMA 2WCHA 2KHNA 3EVVA 1BR4B 3EVUA 3R72A 1F71A 2A4JA 2KQ6A 3JVTC 2M8UA 2P71A 2JQ6A 3I5HC 1GGWA 1JUOA 2PALA 1W7JB 2L2EA 3HX4A 1RECA 1YUSA 1QV0A 2JPOA 2BKIB 4YRUA 1SMGA 1B47A 3K1EA 3VRPA 1AHRA 4GFTA 1DJZA 2ZRSA 3D0YA 3QMEA 2CT9A 2ZKMX 1AUIB 1WLZA 2EC6C 3O2PA 3LCPC 4XJKB 1OE9B 4E68A 2JNXA 2GGZA 3PM8A 2L4IA 5HKZA 5FI2A 3TZ1A 1TOPA 1NWDA 2KAYA 3TDIA 2K60A 1OOGA 2MAZA 1WY9A 1DVIA 1MR8A 3BUNB 3D77A 5B8IB 1IRJA 5AERA 5I94A 1XFWO 1G4YR 1K9PA 2L51A 1B7TZ 1DF0B 1R6PA 2OTGC 3I5IB 1A75A 1AJ5A 3PSRA 2NZ0A 4XJKA 4ORCB 1GM0A 5HKYA 2E6WA 2HETA 1DGUA 1YVHA 1UP5A 3L4AA 1J7OA 3DZTA 5HLOA 2KLDA 2ZNEA 3D10A 3FE6A 3NHIA 1WRLA 2AUCA 1QIWA 1YUUA 1B8LA 5I2QA 2CNPA 2QPTA 4FQOA 5IBWA 4C0KA 4YGEB 4ZCVA 1ZUZA 2L98A 1NUBA 4ETOA 3CZTX 3PFVA 2QACA 1QATA 3EK7A 4ORBB 4DIRA 2KOTA 2B1UA 2BL0B 1FW4A 1DEKA 1RK9A 4MZKA 2BCAA 3CDNA 4WQ2A 1F4OA 1Z2CB 4WRIA 2JOJA 4YI9A 1YVLA 2FJUB 3ICBA 3SG5A 1F70A 3QRXA 3O4XA 3CZ1A 4GAOA 5HYDA 1RTP1 1CB1A 2LHLA 1NPQA 1CDPA 2L4HA 2LC5A 1JBAA 5DKRA 2ERBA 3CR2A 1BT6A 1MQ1A 3DXLA 2LANA 1XYDA 3PATA 2FOTA 2LVIA 4R1EA 2K7DA 1W7IB 4USLA 1OOJA 1UHNA 3B7AA 2GGMA 2M49B 2ZRTA 3DF0B 1RFJA 1XFXO 3PN7C 1KK8C 5I2LA 1S6JA 3L4LA 1TNXA 1JF2A 2G9BA 1L2OB 2L5XB 3SS4A 2K2AA 3CYZA 1SPYA 1OMRA 2JZIA 3MSEB 4I5JA 5FI6A 5G08A 3LLEA 1B8CA 1XA5A 1NIWA 1KFUL 3SS3A 1Y0VH 2JXLA 1JF0A 3OGNA 2PVBA 3BFBA 2OS8B 4UPGA 5HKWA 1KFXL 1H4BA 1YRTB 1T14A 2SCPA 3VGOA 1V1FA 1WLMA 2M3WA 2TN4A 5D69A 1TIZA 4PT1A 1BG1A 5JJGA 1S6IA 1CFDA 3F45A 1KWOB 1CKKA 1OMDA 4N1FA 2Q91A 4D1EA 1EJ3A 3PALA 2K61A 4JQ0D 3LK0A 3WHUB 1F54A 2L2CA 3S0AA 1QVIZ 3KO0A 1MXEA 1KQVA 1MXLC 4INWA 1Y1XA 3SJSA 1J1EA 1SCMC 2ZFDA 5AXIA 1NCZA 1R2UA 2WCBA 4DRWA 4N5XA 5I2OA 1QWVA 2K7BA 2JULA 2I7AA 4CFQA 4XYNA 4NDCA 1ZACA 1Y6WA 2KQYA 2M0RA 2CTNA 5AANA 1KCYA 2KI6C 2KI6D 3CZ2A 3AAKA 4MSPA 1AVSA 4YI8A 4P5OE 3UO9A 1M39A 1TN4A 3IVTA 2AMIA 1CMFA 3AKAA 3BUWB 4GPLB 2R2IA 5GQQC 1BODA 1CM1A 2MJWB 1DJHA 1S5GY 3I5FB 4JKTA 1QS7A 3D74A 1DGVA 1JFKA 1A4PA 4NDDA 3BUOB 3NSKA 1SCVA 2LLTA 1BU3A 5D3OA 4JWQA 3OP0A 1N0YA 1A03A 1CFFA 1WDCB 1S26D 3D0YB 2KNEA 1S3PA 3EG5B 4GUKA 3R1VA 2NLNA 1AK8A 3B86A 1C7VA 1E8AA 2BNXA 1OOHA 4MRYA 1FPWA 1NX2A 1M63B 2JT3A 1UHIA 4YGBB 1JFJA 3O78A 1IWQA 2LVKA 3S0FA 2EGDA 1TCOB 2JT8A 2MRDA 3CR4X 3OHMB 5ER4X 1EH2A 2CCMA 3EKHA 2KFGA 1TNWA 1OOIX 1XK4C 1ALVA 3I5GB 2M9GA 2JXCA 3M0WA 2WC8A 1DTLA 1K9KA 1LS8A 1SL9A 2WOSA 1A75B 3NSOA 2HPSA 4PHNA 1OZSA 3ZWHA 1KQMB 2LAPA 4Q04A 2QDIA 2MHHA 1LVCD 2MA2A 2Y1MA 3NSLA 2QEBA 1JSAA 1SK6D 1DELA 1FBVA 2YGUA 3SS5A 1ZOTB 5F6TA 2AAOA 3SG2A 1CFPA 2LMTA 3IQQA 3EK8A 3FWCA 2KI4C 1TTXA 4I5KA 2JC2A 3SG7A 3S0GA 2ZNDA 2WC5A 2HF5A 4YGDB 2EHBA 2ZN8A 3RLZA 2I2RE 4YGAA 3PLFB 3TUYB 2HQ8A 1EL4A 5AEQA 4CFRA 1UURA 1BJFA 1KSMA 1K93D 4MRXA 2LLUA 1SR6C 1YURA 1ODBA 2LVVA 3RM1A 2MLFC 4AQIA 4HRGA 1F8HA 3DVEA 2PQLA 3BXKA 4PE1A 1TCFA 5D7FA 5AFPA 5CSFA 1K94A 1TRFA 3DVMA 2JRFA 3FWBA 3DVJA 4QJ5B 2LUCA 1XFUO 1V1GA 1J7PA 4PE4A 3LL8B 1Y1AA 5HLVA 4MN0A 4DS7A 1NYAA 1QASA 4C0JA 3UNWA 2H61A 3JVTB 3TS5C 1NX3A 2LP2A 1IGVA 1UHHA 2KFHA 3I5HB 2ISDA 5DKQA 4AOMA 2WC6A 1H8BA 1F4QA 3LK1A 1M31A 1NX0A 3DD4A 2V53A 1SYMA 3AAJA 4OCIA 2GV5A 2Q4UA 3CWGA 1KSOA 1QX2A 1YX7A 4M2QA 1IH0A 2BE4A 4M2OA 3S0EA 3DY9A 5FI7A 3CLNA 1YUTA 4I5LB 1AP4A 2WCMA 1C07A 2EC6B 3S0BA 1B8RA 2PASA 1M46A 2QEHA 3SG6A 4PHMA 3JTDC 1LA3A 2Y1NA 1XFRA 4PCWA 1FI6A 1HQVA 2BE6A 2LV7A 1XFYO 3A8RA 3KEVA 2L5YA 5PALA 3N7HA 1OMVA 1K9UA 1J1DA 3VRRA 1NX1A 5KTYA 2WORA 3TDZA 3GOFA 2KYCA 2OTGB 4U8DA 1JWDA 2LM5A 1CM4A 1UUSA 3VB1A 1MHOA 2CXJA 3BOWA 1TUJA 1Q80A 1DJXA 2BECA 3GK4X 2KAXA 5ER5A 1YX8A 4PHKA 3H4SE 1QX5B 1CTRA 4OVNF 4GBAA 1NP8A 3CZ0A 1BR1B 1AJ4A 2L0PA 3EK4A 1IKUA 2ZN9A 2JTTA 1K96A 1OZOA 4HREE 4I5NB 1DC1A 4JPZB 4MLWA 1F55A 3TDUA 1C3ZA 1KFUS 1QIVA 1SY9A 2JU0A 4NQGA 3D76A 5JOLA 1BOCA 1CNPA 3OB2B 1QXPA 1KFXS 2K7OA 1TUZA 5DKNA 4C0LA 1U5IA 3FE8A 3I5IC 2M97A 4DCKA 2COLB 4PDZA 3BFHA 3E3RA 1KK7Y 1CDNA 1S1EA 3IQOA 4IL1A 2O60A 4QJ4B 1QLKA 4BY5A 1IQ5A 1UHKA 3IF7A 3SIBA 1M45A 2JWWA 1B4CA 1GJYA 2BCBA 1KK8B 2JTZA 3PN7B 3Q8IA 2FJYA 1S5GZ 3NGVA 2FCEA 2F8PA 4MZLA 2WCLA 4GNKB 2M7LA 1EG3A 2WCJA 1IIOA 2KGRA 1RROA 3D75A 4A4CA 1K95A 2NCPA 2D8NA 1IJ6A 2BBMA 3V2LA 1CMGA 1TNQA 1CFCA 3VRQA 4OR9B 1FF1A 1QX7A 2M1UA 3ZNIA 1X02A 3CR5X 1Y1UA 1PALA 4CLNA 2MLEC 4BY4A 3OX5A 1MUXA 3AKBA 1QLSA 1YTZC 5I8NA 2KBMA 1FI5A 4PHJA 2BBNA 2RGIA 3SG4A 3FIAA 4F7FA 5KU1A 1XFZO 2M7NA 1L2OC 1PVBA 2PRUA 3DVKA 1SCMB 4GGFC 1CLBA 1DJYA 5BPJA 2E30A 3FE9A 2BKHB 3A4UB 3VROA 1DJIA 2LE9B 4PE0A 1PULA 3KF9A 5J3XA 1B7TY 1HT9A 1SBJA 4KYNA 5CSIA 1C7WA 1A29A 1J7RA 1EG4A 2OS8C 4FTGA 4INXA 1RJVA 2WCKA 5CSNA 4PALA 2MBXA 1LINA 3NXAA 3PJIA 1S6CA 2BCXA 1RWYA 2F3YA 2OPOA 3S0DA 3VRNA 3WNXB 1KWOC 2LCPA 2BAPA 5TNCA 3EVRA 1NCXA 1QTXA 4ZCUA 2I94A 2LLSA 1UWOA 1DT7B 3D78A 1A2XA 2G2BA 3EKJA 1W9ZA 2KBIA 2VRGA 4MBEA 1N65A 2LMUA 3CGAA 5EL2A 4YGCB 1IG5A 4A4BA 3C1VA 2QEVA 2P70A 3GK1A 4CIDA 3WXAA 1BLQA 1DQEA 2KPHA 3PM2A 2LMVA 3CTNA 1SNLA 3R1OA 1DMOA 5K89A 1DF0A 1VRKA 3DYEA 4PE7A 1QJTA 1OOFA 2PSRA 4P2YB 1UHJA 3K21A 1WRKA 4HSZA 4OKHA 2GTEA 2H8VA 2P6BB 2WNDA 2H2KA 1DJGA 3CS1A 5FYXA 1GGZA 4GGNA 2L50A 4N1GA 1PK0D 4IJ7A 2JPTA 3RZSA 1SSEB 1MF8B 5CPVA 1WRZA 2LP3A 1XVJA 2KGBC 2M29A 3I5FC 1ORGA 3BOWB 3B88A 1K2HA 3OX6A 4L9MA 1LKJA 2JNFA 4TNCA 2JT0A 1WDCC 2CBLA 3O4YA 3BJHA 1XK4A 3D73A 2LNKA 3NSIA 1C3YA 2HQWA 2KAVA 1DJWA 1QV1A 3O6BA 1ZMZA 2KYFA 2F2OA 2PMYA 1GQMA 2I18A 1TWOA 2KI4B 3B87A 4FQTA 4MVFA 4DUQA 1OQPA 2WCFA 4M2PA 2Y4QA 1LXFC 2LHIA 1ALWA 2FCDA 1MWNA 1N2DA 5KSZA 1D1OA 1K90D 1ZFSA 1IQ3A 4MZJA 1TNPA 3SIAA 1QVIY 1SL8A 1SR6B 2NXQA 1XFVO 1U5IB 3DF0A 3I5GC 3WHTB 2LVJA 2NCOA 3OB1B 3BFAA 4GGFA 1YR5A 3NHTA 4F0ZB 3KPXA 1KQMC 4OV2A 1XO5A 2PYQA 3R1PA 3FS7A 3OBVA 2K0JA 2KLEA 2KDHA
chains in the Genus database with same CATH topology
3HCMA 1BMOA 4WQ3A 1NSHA 2SASA 1JC2A 4QJ3B 2LUXA 1YRUB 1CLMA 2KSPA 2IS9A 2K8MB 4NDBA 1OSAA 1IJ5A 3GK2A 3BUXB 3TS5B 1SW8A 1LA0A 2F2PA 4MEWA 1PSBA 1PVAA 1B9AA 2KFFA 2DOQA 3TUYC 3KHEA 1CLLA 3BYAA 1SL7A 1SKTA 2O5GA 1PRWA 2F3ZA 3BUMB 4ORAB 5CSJA 2K7CA 2Y5IA 4ICBA 1KK7Z 2M1KB 3BQ3A 1PSRA 1J7QA 2F33A 1G33A 4HRHA 1BF5A 2H61C 4YBHB 1CDLA 2BL0C 3SG3A 4CPVA 1NCYA 1EXRA 1S36A 1L7ZA 4AQJA 1K8UA 3JTDB 1J55A 1G8IA 1SRAA 2K2FA 1B1GA 2WCEA 1CDMA 2KHNA 3EVVA 1BR4B 3EVUA 1F71A 2A4JA 2KQ6A 3JVTC 2M8UA 2JQ6A 3I5HC 1GGWA 1JUOA 2PALA 1W7JB 2L2EA 3HX4A 1RECA 1YUSA 1QV0A 4YRUA 2BKIB 1SMGA 1B47A 3VRPA 1AHRA 4GFTA 1DJZA 2ZRSA 3D0YA 2CT9A 2ZKMX 1AUIB 1WLZA 2EC6C 3O2PA 3LCPC 4XJKB 1OE9B 4E68A 2JNXA 2GGZA 3PM8A 2L4IA 5HKZA 3TZ1A 1TOPA 1NWDA 2KAYA 3TDIA 2MAZA 1WY9A 1DVIA 1MR8A 3BUNB 5B8IB 1IRJA 5AERA 1XFWO 1G4YR 1K9PA 2L51A 1B7TZ 1DF0B 1R6PA 2OTGC 3I5IB 1A75A 1AJ5A 3PSRA 2NZ0A 4XJKA 4ORCB 5HKYA 2E6WA 2HETA 1DGUA 1YVHA 1UP5A 1J7OA 5HLOA 2ZNEA 3D10A 1WRLA 2AUCA 1QIWA 1YUUA 1B8LA 5I2QA 2CNPA 2QPTA 4FQOA 5IBWA 4C0KA 4YGEB 4ZCVA 1ZUZA 2L98A 1NUBA 4ETOA 3CZTX 3PFVA 2QACA 1QATA 3EK7A 4ORBB 4DIRA 2KOTA 2B1UA 2BL0B 1FW4A 1RK9A 4MZKA 2BCAA 4WQ2A 1F4OA 4WRIA 2JOJA 4YI9A 1YVLA 2FJUB 3ICBA 3SG5A 1F70A 3QRXA 4GAOA 5HYDA 1RTP1 1CB1A 2LHLA 1NPQA 1CDPA 2L4HA 2LC5A 1JBAA 5DKRA 3CR2A 1BT6A 1MQ1A 3PATA 2LANA 1XYDA 4R1EA 2FOTA 2LVIA 5PALA 2K7DA 1W7IB 4USLA 1OOJA 1UHNA 2GGMA 2M49B 2ZRTA 3DF0B 1RFJA 1XFXO 3PN7C 1KK8C 5I2LA 1S6JA 1TNXA 1JF2A 2G9BA 1L2OB 2L5XB 2K2AA 1SPYA 1OMRA 2JZIA 3MSEB 4I5JA 5G08A 3LLEA 1B8CA 1XA5A 1NIWA 1KFUL 1Y0VH 2JXLA 1JF0A 2PVBA 2OS8B 4UPGA 5HKWA 1KFXL 1H4BA 1YRTB 2SCPA 3VGOA 1V1FA 1WLMA 2M3WA 2TN4A 5D69A 1TIZA 1BG1A 5JJGA 1S6IA 1CFDA 3F45A 1KWOB 1CKKA 1OMDA 4N1FA 2Q91A 4D1EA 1EJ3A 3PALA 2K61A 4JQ0D 3LK0A 3WHUB 1F54A 1QVIZ 3KO0A 1MXEA 1KQVA 1MXLC 1Y1XA 3SJSA 1J1EA 1SCMC 2ZFDA 5AXIA 1NCZA 1R2UA 2WCBA 4DRWA 4N5XA 5I2OA 2K7BA 2JULA 2I7AA 4CFQA 4XYNA 4NDCA 1ZACA 1Y6WA 2KQYA 2M0RA 2CTNA 5AANA 1KCYA 2KI6C 2KI6D 3AAKA 4MSPA 1AVSA 4YI8A 4P5OE 1M39A 1TN4A 2AMIA 1CMFA 3AKAA 3BUWB 4GPLB 2R2IA 5GQQC 1BODA 1CM1A 2MJWB 1DJHA 1S5GY 3I5FB 1QS7A 1DGVA 1JFKA 1A4PA 4NDDA 3BUOB 3NSKA 1SCVA 2LLTA 1BU3A 4JWQA 3OP0A 1N0YA 1A03A 1CFFA 1WDCB 1S26D 3D0YB 2KNEA 1S3PA 4GUKA 2NLNA 1AK8A 1C7VA 1E8AA 4MRYA 1FPWA 1NX2A 1M63B 2JT3A 1UHIA 4YGBB 1JFJA 3O78A 1IWQA 2LVKA 2EGDA 1TCOB 2JT8A 2MRDA 3CR4X 3OHMB 5ER4X 1EH2A 2CCMA 3EKHA 2KFGA 1TNWA 1XK4C 1ALVA 3I5GB 2M9GA 2JXCA 3M0WA 2WC8A 1DTLA 1K9KA 1SL9A 2WOSA 1A75B 3NSOA 2HPSA 4PHNA 1OZSA 3ZWHA 1KQMB 2LAPA 4Q04A 2MHHA 1LVCD 2MA2A 2Y1MA 3NSLA 1JSAA 1SK6D 1FBVA 1ZOTB 5F6TA 2AAOA 3SG2A 1CFPA 2LMTA 3IQQA 3EK8A 3FWCA 2KI4C 1TTXA 4I5KA 2JC2A 3SG7A 2ZNDA 2HF5A 4YGDB 2EHBA 2ZN8A 3RLZA 2I2RE 4YGAA 3PLFB 3TUYB 2HQ8A 1EL4A 5AEQA 4CFRA 1UURA 1BJFA 1KSMA 1K93D 4MRXA 2LLUA 1SR6C 1YURA 1ODBA 2LVVA 3RM1A 2MLFC 4AQIA 4HRGA 1F8HA 3DVEA 3BXKA 4PE1A 1TCFA 5D7FA 5AFPA 5CSFA 1K94A 1TRFA 3DVMA 2JRFA 3FWBA 3DVJA 4QJ5B 2LUCA 1XFUO 1V1GA 1J7PA 4PE4A 3LL8B 1Y1AA 5HLVA 4MN0A 4DS7A 1NYAA 1QASA 4C0JA 2H61A 3JVTB 3TS5C 1NX3A 2LP2A 1IGVA 1UHHA 2KFHA 3I5HB 2ISDA 5DKQA 4AOMA 1H8BA 1F4QA 3LK1A 1M31A 1NX0A 3DD4A 2V53A 1SYMA 3AAJA 4OCIA 2GV5A 2Q4UA 3CWGA 1KSOA 1QX2A 1YX7A 4M2QA 1IH0A 2BE4A 4M2OA 3CLNA 1YUTA 4I5LB 1AP4A 1C07A 2EC6B 1B8RA 2PASA 1M46A 3SG6A 4PHMA 3JTDC 1LA3A 2Y1NA 4PCWA 1FI6A 1HQVA 2BE6A 2LV7A 1XFYO 3A8RA 3KEVA 1OMVA 1K9UA 1J1DA 3VRRA 1NX1A 5KTYA 2WORA 3TDZA 3GOFA 2KYCA 2OTGB 4U8DA 1JWDA 2LM5A 1CM4A 1UUSA 1MHOA 2CXJA 3BOWA 2BECA 1Q80A 1DJXA 3GK4X 2KAXA 5ER5A 1YX8A 4PHKA 3H4SE 1QX5B 1CTRA 4OVNF 4GBAA 1NP8A 1BR1B 1AJ4A 2L0PA 3EK4A 1IKUA 2ZN9A 2JTTA 1K96A 1OZOA 4HREE 4I5NB 4JPZB 4MLWA 1F55A 3TDUA 1KFUS 1QIVA 1SY9A 2JU0A 4NQGA 5JOLA 1BOCA 1CNPA 3OB2B 1QXPA 1KFXS 2K7OA 4C0LA 5DKNA 1U5IA 3I5IC 2M97A 4DCKA 2COLB 4PDZA 3E3RA 1KK7Y 1CDNA 1S1EA 3IQOA 4IL1A 2O60A 4QJ4B 1QLKA 4BY5A 1IQ5A 1UHKA 3IF7A 3SIBA 1M45A 2JWWA 1B4CA 1GJYA 2BCBA 1KK8B 2JTZA 3PN7B 1S5GZ 2FCEA 2F8PA 4MZLA 4GNKB 2M7LA 1EG3A 2KGRA 1RROA 4A4CA 1K95A 2NCPA 2D8NA 1IJ6A 2BBMA 1CMGA 1TNQA 1CFCA 3VRQA 4OR9B 1FF1A 1QX7A 2M1UA 3ZNIA 1X02A 3CR5X 1Y1UA 1PALA 4CLNA 2MLEC 4BY4A 3OX5A 1MUXA 3AKBA 1QLSA 1YTZC 5I8NA 2KBMA 1FI5A 4PHJA 2BBNA 2RGIA 3SG4A 3FIAA 5KU1A 1XFZO 2M7NA 1L2OC 1PVBA 2PRUA 3DVKA 1SCMB 4GGFC 1CLBA 1DJYA 5BPJA 2E30A 2BKHB 3A4UB 3VROA 1DJIA 2LE9B 4PE0A 1PULA 3KF9A 5J3XA 1B7TY 1HT9A 1SBJA 5CSIA 1C7WA 1A29A 1J7RA 1EG4A 2OS8C 4FTGA 1RJVA 5CSNA 4PALA 2MBXA 1LINA 3NXAA 1S6CA 2BCXA 1RWYA 2F3YA 2OPOA 3VRNA 3WNXB 1KWOC 2LCPA 5TNCA 3EVRA 1NCXA 1QTXA 4ZCUA 2I94A 2LLSA 1UWOA 1DT7B 1A2XA 2G2BA 3EKJA 2KBIA 2VRGA 4MBEA 1N65A 2LMUA 3CGAA 4YGCB 1IG5A 4A4BA 3C1VA 3GK1A 4CIDA 3WXAA 1BLQA 2LMVA 3CTNA 1SNLA 1DMOA 5K89A 1DF0A 1VRKA 4PE7A 1QJTA 2PSRA 4P2YB 1UHJA 3K21A 1WRKA 4HSZA 4OKHA 2P6BB 2WNDA 2H2KA 1DJGA 3CS1A 5FYXA 1GGZA 4GGNA 2L50A 4N1GA 1PK0D 2JPTA 1MF8B 5CPVA 1WRZA 2LP3A 1XVJA 2KGBC 2M29A 3I5FC 3BOWB 1K2HA 3OX6A 4L9MA 1LKJA 2JNFA 4TNCA 2JT0A 1WDCC 2CBLA 3O4YA 1XK4A 2LNKA 3NSIA 2HQWA 2KAVA 1DJWA 1QV1A 3O6BA 1ZMZA 2KYFA 2F2OA 2PMYA 1GQMA 2I18A 2KI4B 4MVFA 4DUQA 1OQPA 2WCFA 4M2PA 2Y4QA 1LXFC 2LHIA 1ALWA 2FCDA 1MWNA 1N2DA 5KSZA 1D1OA 1K90D 1ZFSA 1IQ3A 4MZJA 1TNPA 3SIAA 1QVIY 1SL8A 1SR6B 2NXQA 1XFVO 1U5IB 3DF0A 3I5GC 3WHTB 2LVJA 2NCOA 3OB1B 4GGFA 1YR5A 4F0ZB 3KPXA 1KQMC 4OV2A 1XO5A 3FS7A 2K0JA 2KDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCM A;  1BMO A;  4WQ3 A;  1NSH A;  2SAS A;  1JC2 A;  4QJ3 B;  2LUX A;  1YRU B;  1CLM A;  2KSP A;  2IS9 A;  2K8M B;  4NDB A;  1OSA A;  1IJ5 A;  3GK2 A;  3BUX B;  3TS5 B;  1SW8 A;  1LA0 A;  2F2P A;  4MEW A;  1PSB A;  1PVA A;  1B9A A;  2KFF A;  2DOQ A;  3TUY C;  3KHE A;  1CLL A;  3BYA A;  1SL7 A;  1SKT A;  2O5G A;  1PRW A;  2F3Z A;  3BUM B;  4ORA B;  5CSJ A;  2K7C A;  2Y5I A;  4ICB A;  1KK7 Z;  2M1K B;  3BQ3 A;  1PSR A;  1J7Q A;  2F33 A;  1G33 A;  4HRH A;  1BF5 A;  2H61 C;  4YBH B;  1CDL A;  2BL0 C;  3SG3 A;  4CPV A;  1NCY A;  1EXR A;  1S36 A;  1L7Z A;  4AQJ A;  1K8U A;  3JTD B;  1J55 A;  1G8I A;  1SRA A;  2K2F A;  1B1G A;  2WCE A;  1CDM A;  2KHN A;  3EVV A;  1BR4 B;  3EVU A;  1F71 A;  2A4J A;  2KQ6 A;  3JVT C;  2M8U A;  2JQ6 A;  3I5H C;  1GGW A;  1JUO A;  2PAL A;  1W7J B;  2L2E A;  3HX4 A;  1REC A;  1YUS A;  1QV0 A;  4YRU A;  2BKI B;  1SMG A;  1B47 A;  3VRP A;  1AHR A;  4GFT A;  1DJZ A;  2ZRS A;  3D0Y A;  2CT9 A;  2ZKM X;  1AUI B;  1WLZ A;  2EC6 C;  3O2P A;  3LCP C;  4XJK B;  1OE9 B;  4E68 A;  2JNX A;  2GGZ A;  3PM8 A;  2L4I A;  5HKZ A;  3TZ1 A;  1TOP A;  1NWD A;  2KAY A;  3TDI A;  2MAZ A;  1WY9 A;  1DVI A;  1MR8 A;  3BUN B;  5B8I B;  1IRJ A;  5AER A;  1XFW O;  1G4Y R;  1K9P A;  2L51 A;  1B7T Z;  1DF0 B;  1R6P A;  2OTG C;  3I5I B;  1A75 A;  1AJ5 A;  3PSR A;  2NZ0 A;  4XJK A;  4ORC B;  5HKY A;  2E6W A;  2HET A;  1DGU A;  1YVH A;  1UP5 A;  1J7O A;  5HLO A;  2ZNE A;  3D10 A;  1WRL A;  2AUC A;  1QIW A;  1YUU A;  1B8L A;  5I2Q A;  2CNP A;  2QPT A;  4FQO A;  5IBW A;  4C0K A;  4YGE B;  4ZCV A;  1ZUZ A;  2L98 A;  1NUB A;  4ETO A;  3CZT X;  3PFV A;  2QAC A;  1QAT A;  3EK7 A;  4ORB B;  4DIR A;  2KOT A;  2B1U A;  2BL0 B;  1FW4 A;  1RK9 A;  4MZK A;  2BCA A;  4WQ2 A;  1F4O A;  4WRI A;  2JOJ A;  4YI9 A;  1YVL A;  2FJU B;  3ICB A;  3SG5 A;  1F70 A;  3QRX A;  4GAO A;  5HYD A;  1RTP 1;  1CB1 A;  2LHL A;  1NPQ A;  1CDP A;  2L4H A;  2LC5 A;  1JBA A;  5DKR A;  3CR2 A;  1BT6 A;  1MQ1 A;  3PAT A;  2LAN A;  1XYD A;  4R1E A;  2FOT A;  2LVI A;  5PAL A;  2K7D A;  1W7I B;  4USL A;  1OOJ A;  1UHN A;  2GGM A;  2M49 B;  2ZRT A;  3DF0 B;  1RFJ A;  1XFX O;  3PN7 C;  1KK8 C;  5I2L A;  1S6J A;  1TNX A;  1JF2 A;  2G9B A;  1L2O B;  2L5X B;  2K2A A;  1SPY A;  1OMR A;  2JZI A;  3MSE B;  4I5J A;  5G08 A;  3LLE A;  1B8C A;  1XA5 A;  1NIW A;  1KFU L;  1Y0V H;  2JXL A;  1JF0 A;  2PVB A;  2OS8 B;  4UPG A;  5HKW A;  1KFX L;  1H4B A;  1YRT B;  2SCP A;  3VGO A;  1V1F A;  1WLM A;  2M3W A;  2TN4 A;  5D69 A;  1TIZ A;  1BG1 A;  5JJG A;  1S6I A;  1CFD A;  3F45 A;  1KWO B;  1CKK A;  1OMD A;  4N1F A;  2Q91 A;  4D1E A;  1EJ3 A;  3PAL A;  2K61 A;  4JQ0 D;  3LK0 A;  3WHU B;  1F54 A;  1QVI Z;  3KO0 A;  1MXE A;  1KQV A;  1MXL C;  1Y1X A;  3SJS A;  1J1E A;  1SCM C;  2ZFD A;  5AXI A;  1NCZ A;  1R2U A;  2WCB A;  4DRW A;  4N5X A;  5I2O A;  2K7B A;  2JUL A;  2I7A A;  4CFQ A;  4XYN A;  4NDC A;  1ZAC A;  1Y6W A;  2KQY A;  2M0R A;  2CTN A;  5AAN A;  1KCY A;  2KI6 C;  2KI6 D;  3AAK A;  4MSP A;  1AVS A;  4YI8 A;  4P5O E;  1M39 A;  1TN4 A;  2AMI A;  1CMF A;  3AKA A;  3BUW B;  4GPL B;  2R2I A;  5GQQ C;  1BOD A;  1CM1 A;  2MJW B;  1DJH A;  1S5G Y;  3I5F B;  1QS7 A;  1DGV A;  1JFK A;  1A4P A;  4NDD A;  3BUO B;  3NSK A;  1SCV A;  2LLT A;  1BU3 A;  4JWQ A;  3OP0 A;  1N0Y A;  1A03 A;  1CFF A;  1WDC B;  1S26 D;  3D0Y B;  2KNE A;  1S3P A;  4GUK A;  2NLN A;  1AK8 A;  1C7V A;  1E8A A;  4MRY A;  1FPW A;  1NX2 A;  1M63 B;  2JT3 A;  1UHI A;  4YGB B;  1JFJ A;  3O78 A;  1IWQ A;  2LVK A;  2EGD A;  1TCO B;  2JT8 A;  2MRD A;  3CR4 X;  3OHM B;  5ER4 X;  1EH2 A;  2CCM A;  3EKH A;  2KFG A;  1TNW A;  1XK4 C;  1ALV A;  3I5G B;  2M9G A;  2JXC A;  3M0W A;  2WC8 A;  1DTL A;  1K9K A;  1SL9 A;  2WOS A;  1A75 B;  3NSO A;  2HPS A;  4PHN A;  1OZS A;  3ZWH A;  1KQM B;  2LAP A;  4Q04 A;  2MHH A;  1LVC D;  2MA2 A;  2Y1M A;  3NSL A;  1JSA A;  1SK6 D;  1FBV A;  1ZOT B;  5F6T A;  2AAO A;  3SG2 A;  1CFP A;  2LMT A;  3IQQ A;  3EK8 A;  3FWC A;  2KI4 C;  1TTX A;  4I5K A;  2JC2 A;  3SG7 A;  2ZND A;  2HF5 A;  4YGD B;  2EHB A;  2ZN8 A;  3RLZ A;  2I2R E;  4YGA A;  3PLF B;  3TUY B;  2HQ8 A;  1EL4 A;  5AEQ A;  4CFR A;  1UUR A;  1BJF A;  1KSM A;  1K93 D;  4MRX A;  2LLU A;  1SR6 C;  1YUR A;  1ODB A;  2LVV A;  3RM1 A;  2MLF C;  4AQI A;  4HRG A;  1F8H A;  3DVE A;  3BXK A;  4PE1 A;  1TCF A;  5D7F A;  5AFP A;  5CSF A;  1K94 A;  1TRF A;  3DVM A;  2JRF A;  3FWB A;  3DVJ A;  4QJ5 B;  2LUC A;  1XFU O;  1V1G A;  1J7P A;  4PE4 A;  3LL8 B;  1Y1A A;  5HLV A;  4MN0 A;  4DS7 A;  1NYA A;  1QAS A;  4C0J A;  2H61 A;  3JVT B;  3TS5 C;  1NX3 A;  2LP2 A;  1IGV A;  1UHH A;  2KFH A;  3I5H B;  2ISD A;  5DKQ A;  4AOM A;  1H8B A;  1F4Q A;  3LK1 A;  1M31 A;  1NX0 A;  3DD4 A;  2V53 A;  1SYM A;  3AAJ A;  4OCI A;  2GV5 A;  2Q4U A;  3CWG A;  1KSO A;  1QX2 A;  1YX7 A;  4M2Q A;  1IH0 A;  2BE4 A;  4M2O A;  3CLN A;  1YUT A;  4I5L B;  1AP4 A;  1C07 A;  2EC6 B;  1B8R A;  2PAS A;  1M46 A;  3SG6 A;  4PHM A;  3JTD C;  1LA3 A;  2Y1N A;  4PCW A;  1FI6 A;  1HQV A;  2BE6 A;  2LV7 A;  1XFY O;  3A8R A;  3KEV A;  1OMV A;  1K9U A;  1J1D A;  3VRR A;  1NX1 A;  5KTY A;  2WOR A;  3TDZ A;  3GOF A;  2KYC A;  2OTG B;  4U8D A;  1JWD A;  2LM5 A;  1CM4 A;  1UUS A;  1MHO A;  2CXJ A;  3BOW A;  2BEC A;  1Q80 A;  1DJX A;  3GK4 X;  2KAX A;  5ER5 A;  1YX8 A;  4PHK A;  3H4S E;  1QX5 B;  1CTR A;  4OVN F;  4GBA A;  1NP8 A;  1BR1 B;  1AJ4 A;  2L0P A;  3EK4 A;  1IKU A;  2ZN9 A;  2JTT A;  1K96 A;  1OZO A;  4HRE E;  4I5N B;  4JPZ B;  4MLW A;  1F55 A;  3TDU A;  1KFU S;  1QIV A;  1SY9 A;  2JU0 A;  4NQG A;  5JOL A;  1BOC A;  1CNP A;  3OB2 B;  1QXP A;  1KFX S;  2K7O A;  4C0L A;  5DKN A;  1U5I A;  3I5I C;  2M97 A;  4DCK A;  2COL B;  4PDZ A;  3E3R A;  1KK7 Y;  1CDN A;  1S1E A;  3IQO A;  4IL1 A;  2O60 A;  4QJ4 B;  1QLK A;  4BY5 A;  1IQ5 A;  1UHK A;  3IF7 A;  3SIB A;  1M45 A;  2JWW A;  1B4C A;  1GJY A;  2BCB A;  1KK8 B;  2JTZ A;  3PN7 B;  1S5G Z;  2FCE A;  2F8P A;  4MZL A;  4GNK B;  2M7L A;  1EG3 A;  2KGR A;  1RRO A;  4A4C A;  1K95 A;  2NCP A;  2D8N A;  1IJ6 A;  2BBM A;  1CMG A;  1TNQ A;  1CFC A;  3VRQ A;  4OR9 B;  1FF1 A;  1QX7 A;  2M1U A;  3ZNI A;  1X02 A;  3CR5 X;  1Y1U A;  1PAL A;  4CLN A;  2MLE C;  4BY4 A;  3OX5 A;  1MUX A;  3AKB A;  1QLS A;  1YTZ C;  5I8N A;  2KBM A;  1FI5 A;  4PHJ A;  2BBN A;  2RGI A;  3SG4 A;  3FIA A;  5KU1 A;  1XFZ O;  2M7N A;  1L2O C;  1PVB A;  2PRU A;  3DVK A;  1SCM B;  4GGF C;  1CLB A;  1DJY A;  5BPJ A;  2E30 A;  2BKH B;  3A4U B;  3VRO A;  1DJI A;  2LE9 B;  4PE0 A;  1PUL A;  3KF9 A;  5J3X A;  1B7T Y;  1HT9 A;  1SBJ A;  5CSI A;  1C7W A;  1A29 A;  1J7R A;  1EG4 A;  2OS8 C;  4FTG A;  1RJV A;  5CSN A;  4PAL A;  2MBX A;  1LIN A;  3NXA A;  1S6C A;  2BCX A;  1RWY A;  2F3Y A;  2OPO A;  3VRN A;  3WNX B;  1KWO C;  2LCP A;  5TNC A;  3EVR A;  1NCX A;  1QTX A;  4ZCU A;  2I94 A;  2LLS A;  1UWO A;  1DT7 B;  1A2X A;  2G2B A;  3EKJ A;  2KBI A;  2VRG A;  4MBE A;  1N65 A;  2LMU A;  3CGA A;  4YGC B;  1IG5 A;  4A4B A;  3C1V A;  3GK1 A;  4CID A;  3WXA A;  1BLQ A;  2LMV A;  3CTN A;  1SNL A;  1DMO A;  5K89 A;  1DF0 A;  1VRK A;  4PE7 A;  1QJT A;  2PSR A;  4P2Y B;  1UHJ A;  3K21 A;  1WRK A;  4HSZ A;  4OKH A;  2P6B B;  2WND A;  2H2K A;  1DJG A;  3CS1 A;  5FYX A;  1GGZ A;  4GGN A;  2L50 A;  4N1G A;  1PK0 D;  2JPT A;  1MF8 B;  5CPV A;  1WRZ A;  2LP3 A;  1XVJ A;  2KGB C;  2M29 A;  3I5F C;  3BOW B;  1K2H A;  3OX6 A;  4L9M A;  1LKJ A;  2JNF A;  4TNC A;  2JT0 A;  1WDC C;  2CBL A;  3O4Y A;  1XK4 A;  2LNK A;  3NSI A;  2HQW A;  2KAV A;  1DJW A;  1QV1 A;  3O6B A;  1ZMZ A;  2KYF A;  2F2O A;  2PMY A;  1GQM A;  2I18 A;  2KI4 B;  4MVF A;  4DUQ A;  1OQP A;  2WCF A;  4M2P A;  2Y4Q A;  1LXF C;  2LHI A;  1ALW A;  2FCD A;  1MWN A;  1N2D A;  5KSZ A;  1D1O A;  1K90 D;  1ZFS A;  1IQ3 A;  4MZJ A;  1TNP A;  3SIA A;  1QVI Y;  1SL8 A;  1SR6 B;  2NXQ A;  1XFV O;  1U5I B;  3DF0 A;  3I5G C;  3WHT B;  2LVJ A;  2NCO A;  3OB1 B;  4GGF A;  1YR5 A;  4F0Z B;  3KPX A;  1KQM C;  4OV2 A;  1XO5 A;  3FS7 A;  2K0J A;  2KDH A; 
#chains in the Genus database with same CATH topology
 3HCM A;  1BMO A;  4WQ3 A;  1NSH A;  1Z4H A;  2SAS A;  1JC2 A;  3L47 A;  2LUX A;  1YRU B;  1CLM A;  2KSP A;  4JD9 A;  4QJ3 B;  2IS9 A;  2K8M B;  4NDB A;  2QEO A;  1OSA A;  5DIC A;  1IJ5 A;  3GK2 A;  3BUX B;  5HL1 A;  3TS5 B;  1SW8 A;  1LA0 A;  2F2P A;  4MEW A;  1PSB A;  1PVA A;  1B9A A;  2KFF A;  2DOQ A;  4OZD A;  3TUY C;  3KHE A;  1CLL A;  3BYA A;  1SL7 A;  1SKT A;  2O5G A;  1PRW A;  2F3Z A;  3BUM B;  4ORA B;  5CSJ A;  1P28 A;  2K7C A;  2Y5I A;  3CAB A;  4ICB A;  1KK7 Z;  2M1K B;  3BQ3 A;  1PSR A;  1J7Q A;  2F33 A;  1G33 A;  4HRH A;  1BF5 A;  2H61 C;  4YBH B;  1CDL A;  2BL0 C;  3SG3 A;  1OW4 A;  4CPV A;  1NCY A;  1EXR A;  1S36 A;  1L7Z A;  4AQJ A;  1K8U A;  3JTD B;  3B6X A;  1J55 A;  1G8I A;  1SRA A;  2K2F A;  1B1G A;  2WCE A;  1CDM A;  2WCH A;  2KHN A;  3EVV A;  1BR4 B;  3EVU A;  3R72 A;  1F71 A;  2A4J A;  2KQ6 A;  3JVT C;  2M8U A;  2P71 A;  2JQ6 A;  3I5H C;  1GGW A;  1JUO A;  2PAL A;  1W7J B;  2L2E A;  3HX4 A;  1REC A;  1YUS A;  1QV0 A;  2JPO A;  2BKI B;  4YRU A;  1SMG A;  1B47 A;  3K1E A;  3VRP A;  1AHR A;  4GFT A;  1DJZ A;  2ZRS A;  3D0Y A;  3QME A;  2CT9 A;  2ZKM X;  1AUI B;  1WLZ A;  2EC6 C;  3O2P A;  3LCP C;  4XJK B;  1OE9 B;  4E68 A;  2JNX A;  2GGZ A;  3PM8 A;  2L4I A;  5HKZ A;  5FI2 A;  3TZ1 A;  1TOP A;  1NWD A;  2KAY A;  3TDI A;  2K60 A;  1OOG A;  2MAZ A;  1WY9 A;  1DVI A;  1MR8 A;  3BUN B;  3D77 A;  5B8I B;  1IRJ A;  5AER A;  5I94 A;  1XFW O;  1G4Y R;  1K9P A;  2L51 A;  1B7T Z;  1DF0 B;  1R6P A;  2OTG C;  3I5I B;  1A75 A;  1AJ5 A;  3PSR A;  2NZ0 A;  4XJK A;  4ORC B;  1GM0 A;  5HKY A;  2E6W A;  2HET A;  1DGU A;  1YVH A;  1UP5 A;  3L4A A;  1J7O A;  3DZT A;  5HLO A;  2KLD A;  2ZNE A;  3D10 A;  3FE6 A;  3NHI A;  1WRL A;  2AUC A;  1QIW A;  1YUU A;  1B8L A;  5I2Q A;  2CNP A;  2QPT A;  4FQO A;  5IBW A;  4C0K A;  4YGE B;  4ZCV A;  1ZUZ A;  2L98 A;  1NUB A;  4ETO A;  3CZT X;  3PFV A;  2QAC A;  1QAT A;  3EK7 A;  4ORB B;  4DIR A;  2KOT A;  2B1U A;  2BL0 B;  1FW4 A;  1DEK A;  1RK9 A;  4MZK A;  2BCA A;  3CDN A;  4WQ2 A;  1F4O A;  1Z2C B;  4WRI A;  2JOJ A;  4YI9 A;  1YVL A;  2FJU B;  3ICB A;  3SG5 A;  1F70 A;  3QRX A;  3O4X A;  3CZ1 A;  4GAO A;  5HYD A;  1RTP 1;  1CB1 A;  2LHL A;  1NPQ A;  1CDP A;  2L4H A;  2LC5 A;  1JBA A;  5DKR A;  2ERB A;  3CR2 A;  1BT6 A;  1MQ1 A;  3DXL A;  2LAN A;  1XYD A;  3PAT A;  2FOT A;  2LVI A;  4R1E A;  2K7D A;  1W7I B;  4USL A;  1OOJ A;  1UHN A;  3B7A A;  2GGM A;  2M49 B;  2ZRT A;  3DF0 B;  1RFJ A;  1XFX O;  3PN7 C;  1KK8 C;  5I2L A;  1S6J A;  3L4L A;  1TNX A;  1JF2 A;  2G9B A;  1L2O B;  2L5X B;  3SS4 A;  2K2A A;  3CYZ A;  1SPY A;  1OMR A;  2JZI A;  3MSE B;  4I5J A;  5FI6 A;  5G08 A;  3LLE A;  1B8C A;  1XA5 A;  1NIW A;  1KFU L;  3SS3 A;  1Y0V H;  2JXL A;  1JF0 A;  3OGN A;  2PVB A;  3BFB A;  2OS8 B;  4UPG A;  5HKW A;  1KFX L;  1H4B A;  1YRT B;  1T14 A;  2SCP A;  3VGO A;  1V1F A;  1WLM A;  2M3W A;  2TN4 A;  5D69 A;  1TIZ A;  4PT1 A;  1BG1 A;  5JJG A;  1S6I A;  1CFD A;  3F45 A;  1KWO B;  1CKK A;  1OMD A;  4N1F A;  2Q91 A;  4D1E A;  1EJ3 A;  3PAL A;  2K61 A;  4JQ0 D;  3LK0 A;  3WHU B;  1F54 A;  2L2C A;  3S0A A;  1QVI Z;  3KO0 A;  1MXE A;  1KQV A;  1MXL C;  4INW A;  1Y1X A;  3SJS A;  1J1E A;  1SCM C;  2ZFD A;  5AXI A;  1NCZ A;  1R2U A;  2WCB A;  4DRW A;  4N5X A;  5I2O A;  1QWV A;  2K7B A;  2JUL A;  2I7A A;  4CFQ A;  4XYN A;  4NDC A;  1ZAC A;  1Y6W A;  2KQY A;  2M0R A;  2CTN A;  5AAN A;  1KCY A;  2KI6 C;  2KI6 D;  3CZ2 A;  3AAK A;  4MSP A;  1AVS A;  4YI8 A;  4P5O E;  3UO9 A;  1M39 A;  1TN4 A;  3IVT A;  2AMI A;  1CMF A;  3AKA A;  3BUW B;  4GPL B;  2R2I A;  5GQQ C;  1BOD A;  1CM1 A;  2MJW B;  1DJH A;  1S5G Y;  3I5F B;  4JKT A;  1QS7 A;  3D74 A;  1DGV A;  1JFK A;  1A4P A;  4NDD A;  3BUO B;  3NSK A;  1SCV A;  2LLT A;  1BU3 A;  5D3O A;  4JWQ A;  3OP0 A;  1N0Y A;  1A03 A;  1CFF A;  1WDC B;  1S26 D;  3D0Y B;  2KNE A;  1S3P A;  3EG5 B;  4GUK A;  3R1V A;  2NLN A;  1AK8 A;  3B86 A;  1C7V A;  1E8A A;  2BNX A;  1OOH A;  4MRY A;  1FPW A;  1NX2 A;  1M63 B;  2JT3 A;  1UHI A;  4YGB B;  1JFJ A;  3O78 A;  1IWQ A;  2LVK A;  3S0F A;  2EGD A;  1TCO B;  2JT8 A;  2MRD A;  3CR4 X;  3OHM B;  5ER4 X;  1EH2 A;  2CCM A;  3EKH A;  2KFG A;  1TNW A;  1OOI X;  1XK4 C;  1ALV A;  3I5G B;  2M9G A;  2JXC A;  3M0W A;  2WC8 A;  1DTL A;  1K9K A;  1LS8 A;  1SL9 A;  2WOS A;  1A75 B;  3NSO A;  2HPS A;  4PHN A;  1OZS A;  3ZWH A;  1KQM B;  2LAP A;  4Q04 A;  2QDI A;  2MHH A;  1LVC D;  2MA2 A;  2Y1M A;  3NSL A;  2QEB A;  1JSA A;  1SK6 D;  1DEL A;  1FBV A;  2YGU A;  3SS5 A;  1ZOT B;  5F6T A;  2AAO A;  3SG2 A;  1CFP A;  2LMT A;  3IQQ A;  3EK8 A;  3FWC A;  2KI4 C;  1TTX A;  4I5K A;  2JC2 A;  3SG7 A;  3S0G A;  2ZND A;  2WC5 A;  2HF5 A;  4YGD B;  2EHB A;  2ZN8 A;  3RLZ A;  2I2R E;  4YGA A;  3PLF B;  3TUY B;  2HQ8 A;  1EL4 A;  5AEQ A;  4CFR A;  1UUR A;  1BJF A;  1KSM A;  1K93 D;  4MRX A;  2LLU A;  1SR6 C;  1YUR A;  1ODB A;  2LVV A;  3RM1 A;  2MLF C;  4AQI A;  4HRG A;  1F8H A;  3DVE A;  2PQL A;  3BXK A;  4PE1 A;  1TCF A;  5D7F A;  5AFP A;  5CSF A;  1K94 A;  1TRF A;  3DVM A;  2JRF A;  3FWB A;  3DVJ A;  4QJ5 B;  2LUC A;  1XFU O;  1V1G A;  1J7P A;  4PE4 A;  3LL8 B;  1Y1A A;  5HLV A;  4MN0 A;  4DS7 A;  1NYA A;  1QAS A;  4C0J A;  3UNW A;  2H61 A;  3JVT B;  3TS5 C;  1NX3 A;  2LP2 A;  1IGV A;  1UHH A;  2KFH A;  3I5H B;  2ISD A;  5DKQ A;  4AOM A;  2WC6 A;  1H8B A;  1F4Q A;  3LK1 A;  1M31 A;  1NX0 A;  3DD4 A;  2V53 A;  1SYM A;  3AAJ A;  4OCI A;  2GV5 A;  2Q4U A;  3CWG A;  1KSO A;  1QX2 A;  1YX7 A;  4M2Q A;  1IH0 A;  2BE4 A;  4M2O A;  3S0E A;  3DY9 A;  5FI7 A;  3CLN A;  1YUT A;  4I5L B;  1AP4 A;  2WCM A;  1C07 A;  2EC6 B;  3S0B A;  1B8R A;  2PAS A;  1M46 A;  2QEH A;  3SG6 A;  4PHM A;  3JTD C;  1LA3 A;  2Y1N A;  1XFR A;  4PCW A;  1FI6 A;  1HQV A;  2BE6 A;  2LV7 A;  1XFY O;  3A8R A;  3KEV A;  2L5Y A;  5PAL A;  3N7H A;  1OMV A;  1K9U A;  1J1D A;  3VRR A;  1NX1 A;  5KTY A;  2WOR A;  3TDZ A;  3GOF A;  2KYC A;  2OTG B;  4U8D A;  1JWD A;  2LM5 A;  1CM4 A;  1UUS A;  3VB1 A;  1MHO A;  2CXJ A;  3BOW A;  1TUJ A;  1Q80 A;  1DJX A;  2BEC A;  3GK4 X;  2KAX A;  5ER5 A;  1YX8 A;  4PHK A;  3H4S E;  1QX5 B;  1CTR A;  4OVN F;  4GBA A;  1NP8 A;  3CZ0 A;  1BR1 B;  1AJ4 A;  2L0P A;  3EK4 A;  1IKU A;  2ZN9 A;  2JTT A;  1K96 A;  1OZO A;  4HRE E;  4I5N B;  1DC1 A;  4JPZ B;  4MLW A;  1F55 A;  3TDU A;  1C3Z A;  1KFU S;  1QIV A;  1SY9 A;  2JU0 A;  4NQG A;  3D76 A;  5JOL A;  1BOC A;  1CNP A;  3OB2 B;  1QXP A;  1KFX S;  2K7O A;  1TUZ A;  5DKN A;  4C0L A;  1U5I A;  3FE8 A;  3I5I C;  2M97 A;  4DCK A;  2COL B;  4PDZ A;  3BFH A;  3E3R A;  1KK7 Y;  1CDN A;  1S1E A;  3IQO A;  4IL1 A;  2O60 A;  4QJ4 B;  1QLK A;  4BY5 A;  1IQ5 A;  1UHK A;  3IF7 A;  3SIB A;  1M45 A;  2JWW A;  1B4C A;  1GJY A;  2BCB A;  1KK8 B;  2JTZ A;  3PN7 B;  3Q8I A;  2FJY A;  1S5G Z;  3NGV A;  2FCE A;  2F8P A;  4MZL A;  2WCL A;  4GNK B;  2M7L A;  1EG3 A;  2WCJ A;  1IIO A;  2KGR A;  1RRO A;  3D75 A;  4A4C A;  1K95 A;  2NCP A;  2D8N A;  1IJ6 A;  2BBM A;  3V2L A;  1CMG A;  1TNQ A;  1CFC A;  3VRQ A;  4OR9 B;  1FF1 A;  1QX7 A;  2M1U A;  3ZNI A;  1X02 A;  3CR5 X;  1Y1U A;  1PAL A;  4CLN A;  2MLE C;  4BY4 A;  3OX5 A;  1MUX A;  3AKB A;  1QLS A;  1YTZ C;  5I8N A;  2KBM A;  1FI5 A;  4PHJ A;  2BBN A;  2RGI A;  3SG4 A;  3FIA A;  4F7F A;  5KU1 A;  1XFZ O;  2M7N A;  1L2O C;  1PVB A;  2PRU A;  3DVK A;  1SCM B;  4GGF C;  1CLB A;  1DJY A;  5BPJ A;  2E30 A;  3FE9 A;  2BKH B;  3A4U B;  3VRO A;  1DJI A;  2LE9 B;  4PE0 A;  1PUL A;  3KF9 A;  5J3X A;  1B7T Y;  1HT9 A;  1SBJ A;  4KYN A;  5CSI A;  1C7W A;  1A29 A;  1J7R A;  1EG4 A;  2OS8 C;  4FTG A;  4INX A;  1RJV A;  2WCK A;  5CSN A;  4PAL A;  2MBX A;  1LIN A;  3NXA A;  3PJI A;  1S6C A;  2BCX A;  1RWY A;  2F3Y A;  2OPO A;  3S0D A;  3VRN A;  3WNX B;  1KWO C;  2LCP A;  2BAP A;  5TNC A;  3EVR A;  1NCX A;  1QTX A;  4ZCU A;  2I94 A;  2LLS A;  1UWO A;  1DT7 B;  3D78 A;  1A2X A;  2G2B A;  3EKJ A;  1W9Z A;  2KBI A;  2VRG A;  4MBE A;  1N65 A;  2LMU A;  3CGA A;  5EL2 A;  4YGC B;  1IG5 A;  4A4B A;  3C1V A;  2QEV A;  2P70 A;  3GK1 A;  4CID A;  3WXA A;  1BLQ A;  1DQE A;  2KPH A;  3PM2 A;  2LMV A;  3CTN A;  1SNL A;  3R1O A;  1DMO A;  5K89 A;  1DF0 A;  1VRK A;  3DYE A;  4PE7 A;  1QJT A;  1OOF A;  2PSR A;  4P2Y B;  1UHJ A;  3K21 A;  1WRK A;  4HSZ A;  4OKH A;  2GTE A;  2H8V A;  2P6B B;  2WND A;  2H2K A;  1DJG A;  3CS1 A;  5FYX A;  1GGZ A;  4GGN A;  2L50 A;  4N1G A;  1PK0 D;  4IJ7 A;  2JPT A;  3RZS A;  1SSE B;  1MF8 B;  5CPV A;  1WRZ A;  2LP3 A;  1XVJ A;  2KGB C;  2M29 A;  3I5F C;  1ORG A;  3BOW B;  3B88 A;  1K2H A;  3OX6 A;  4L9M A;  1LKJ A;  2JNF A;  4TNC A;  2JT0 A;  1WDC C;  2CBL A;  3O4Y A;  3BJH A;  1XK4 A;  3D73 A;  2LNK A;  3NSI A;  1C3Y A;  2HQW A;  2KAV A;  1DJW A;  1QV1 A;  3O6B A;  1ZMZ A;  2KYF A;  2F2O A;  2PMY A;  1GQM A;  2I18 A;  1TWO A;  2KI4 B;  3B87 A;  4FQT A;  4MVF A;  4DUQ A;  1OQP A;  2WCF A;  4M2P A;  2Y4Q A;  1LXF C;  2LHI A;  1ALW A;  2FCD A;  1MWN A;  1N2D A;  5KSZ A;  1D1O A;  1K90 D;  1ZFS A;  1IQ3 A;  4MZJ A;  1TNP A;  3SIA A;  1QVI Y;  1SL8 A;  1SR6 B;  2NXQ A;  1XFV O;  1U5I B;  3DF0 A;  3I5G C;  3WHT B;  2LVJ A;  2NCO A;  3OB1 B;  3BFA A;  4GGF A;  1YR5 A;  3NHT A;  4F0Z B;  3KPX A;  1KQM C;  4OV2 A;  1XO5 A;  2PYQ A;  3R1P A;  3FS7 A;  3OBV A;  2K0J A;  2KLE A;  2KDH A; 
#chains in the Genus database with same CATH homology
 3HCM A;  1BMO A;  4WQ3 A;  1NSH A;  2SAS A;  1JC2 A;  4QJ3 B;  2LUX A;  1YRU B;  1CLM A;  2KSP A;  2IS9 A;  2K8M B;  4NDB A;  1OSA A;  1IJ5 A;  3GK2 A;  3BUX B;  3TS5 B;  1SW8 A;  1LA0 A;  2F2P A;  4MEW A;  1PSB A;  1PVA A;  1B9A A;  2KFF A;  2DOQ A;  3TUY C;  3KHE A;  1CLL A;  3BYA A;  1SL7 A;  1SKT A;  2O5G A;  1PRW A;  2F3Z A;  3BUM B;  4ORA B;  5CSJ A;  2K7C A;  2Y5I A;  4ICB A;  1KK7 Z;  2M1K B;  3BQ3 A;  1PSR A;  1J7Q A;  2F33 A;  1G33 A;  4HRH A;  1BF5 A;  2H61 C;  4YBH B;  1CDL A;  2BL0 C;  3SG3 A;  4CPV A;  1NCY A;  1EXR A;  1S36 A;  1L7Z A;  4AQJ A;  1K8U A;  3JTD B;  1J55 A;  1G8I A;  1SRA A;  2K2F A;  1B1G A;  2WCE A;  1CDM A;  2KHN A;  3EVV A;  1BR4 B;  3EVU A;  1F71 A;  2A4J A;  2KQ6 A;  3JVT C;  2M8U A;  2JQ6 A;  3I5H C;  1GGW A;  1JUO A;  2PAL A;  1W7J B;  2L2E A;  3HX4 A;  1REC A;  1YUS A;  1QV0 A;  4YRU A;  2BKI B;  1SMG A;  1B47 A;  3VRP A;  1AHR A;  4GFT A;  1DJZ A;  2ZRS A;  3D0Y A;  2CT9 A;  2ZKM X;  1AUI B;  1WLZ A;  2EC6 C;  3O2P A;  3LCP C;  4XJK B;  1OE9 B;  4E68 A;  2JNX A;  2GGZ A;  3PM8 A;  2L4I A;  5HKZ A;  3TZ1 A;  1TOP A;  1NWD A;  2KAY A;  3TDI A;  2MAZ A;  1WY9 A;  1DVI A;  1MR8 A;  3BUN B;  5B8I B;  1IRJ A;  5AER A;  1XFW O;  1G4Y R;  1K9P A;  2L51 A;  1B7T Z;  1DF0 B;  1R6P A;  2OTG C;  3I5I B;  1A75 A;  1AJ5 A;  3PSR A;  2NZ0 A;  4XJK A;  4ORC B;  5HKY A;  2E6W A;  2HET A;  1DGU A;  1YVH A;  1UP5 A;  1J7O A;  5HLO A;  2ZNE A;  3D10 A;  1WRL A;  2AUC A;  1QIW A;  1YUU A;  1B8L A;  5I2Q A;  2CNP A;  2QPT A;  4FQO A;  5IBW A;  4C0K A;  4YGE B;  4ZCV A;  1ZUZ A;  2L98 A;  1NUB A;  4ETO A;  3CZT X;  3PFV A;  2QAC A;  1QAT A;  3EK7 A;  4ORB B;  4DIR A;  2KOT A;  2B1U A;  2BL0 B;  1FW4 A;  1RK9 A;  4MZK A;  2BCA A;  4WQ2 A;  1F4O A;  4WRI A;  2JOJ A;  4YI9 A;  1YVL A;  2FJU B;  3ICB A;  3SG5 A;  1F70 A;  3QRX A;  4GAO A;  5HYD A;  1RTP 1;  1CB1 A;  2LHL A;  1NPQ A;  1CDP A;  2L4H A;  2LC5 A;  1JBA A;  5DKR A;  3CR2 A;  1BT6 A;  1MQ1 A;  3PAT A;  2LAN A;  1XYD A;  4R1E A;  2FOT A;  2LVI A;  5PAL A;  2K7D A;  1W7I B;  4USL A;  1OOJ A;  1UHN A;  2GGM A;  2M49 B;  2ZRT A;  3DF0 B;  1RFJ A;  1XFX O;  3PN7 C;  1KK8 C;  5I2L A;  1S6J A;  1TNX A;  1JF2 A;  2G9B A;  1L2O B;  2L5X B;  2K2A A;  1SPY A;  1OMR A;  2JZI A;  3MSE B;  4I5J A;  5G08 A;  3LLE A;  1B8C A;  1XA5 A;  1NIW A;  1KFU L;  1Y0V H;  2JXL A;  1JF0 A;  2PVB A;  2OS8 B;  4UPG A;  5HKW A;  1KFX L;  1H4B A;  1YRT B;  2SCP A;  3VGO A;  1V1F A;  1WLM A;  2M3W A;  2TN4 A;  5D69 A;  1TIZ A;  1BG1 A;  5JJG A;  1S6I A;  1CFD A;  3F45 A;  1KWO B;  1CKK A;  1OMD A;  4N1F A;  2Q91 A;  4D1E A;  1EJ3 A;  3PAL A;  2K61 A;  4JQ0 D;  3LK0 A;  3WHU B;  1F54 A;  1QVI Z;  3KO0 A;  1MXE A;  1KQV A;  1MXL C;  1Y1X A;  3SJS A;  1J1E A;  1SCM C;  2ZFD A;  5AXI A;  1NCZ A;  1R2U A;  2WCB A;  4DRW A;  4N5X A;  5I2O A;  2K7B A;  2JUL A;  2I7A A;  4CFQ A;  4XYN A;  4NDC A;  1ZAC A;  1Y6W A;  2KQY A;  2M0R A;  2CTN A;  5AAN A;  1KCY A;  2KI6 C;  2KI6 D;  3AAK A;  4MSP A;  1AVS A;  4YI8 A;  4P5O E;  1M39 A;  1TN4 A;  2AMI A;  1CMF A;  3AKA A;  3BUW B;  4GPL B;  2R2I A;  5GQQ C;  1BOD A;  1CM1 A;  2MJW B;  1DJH A;  1S5G Y;  3I5F B;  1QS7 A;  1DGV A;  1JFK A;  1A4P A;  4NDD A;  3BUO B;  3NSK A;  1SCV A;  2LLT A;  1BU3 A;  4JWQ A;  3OP0 A;  1N0Y A;  1A03 A;  1CFF A;  1WDC B;  1S26 D;  3D0Y B;  2KNE A;  1S3P A;  4GUK A;  2NLN A;  1AK8 A;  1C7V A;  1E8A A;  4MRY A;  1FPW A;  1NX2 A;  1M63 B;  2JT3 A;  1UHI A;  4YGB B;  1JFJ A;  3O78 A;  1IWQ A;  2LVK A;  2EGD A;  1TCO B;  2JT8 A;  2MRD A;  3CR4 X;  3OHM B;  5ER4 X;  1EH2 A;  2CCM A;  3EKH A;  2KFG A;  1TNW A;  1XK4 C;  1ALV A;  3I5G B;  2M9G A;  2JXC A;  3M0W A;  2WC8 A;  1DTL A;  1K9K A;  1SL9 A;  2WOS A;  1A75 B;  3NSO A;  2HPS A;  4PHN A;  1OZS A;  3ZWH A;  1KQM B;  2LAP A;  4Q04 A;  2MHH A;  1LVC D;  2MA2 A;  2Y1M A;  3NSL A;  1JSA A;  1SK6 D;  1FBV A;  1ZOT B;  5F6T A;  2AAO A;  3SG2 A;  1CFP A;  2LMT A;  3IQQ A;  3EK8 A;  3FWC A;  2KI4 C;  1TTX A;  4I5K A;  2JC2 A;  3SG7 A;  2ZND A;  2HF5 A;  4YGD B;  2EHB A;  2ZN8 A;  3RLZ A;  2I2R E;  4YGA A;  3PLF B;  3TUY B;  2HQ8 A;  1EL4 A;  5AEQ A;  4CFR A;  1UUR A;  1BJF A;  1KSM A;  1K93 D;  4MRX A;  2LLU A;  1SR6 C;  1YUR A;  1ODB A;  2LVV A;  3RM1 A;  2MLF C;  4AQI A;  4HRG A;  1F8H A;  3DVE A;  3BXK A;  4PE1 A;  1TCF A;  5D7F A;  5AFP A;  5CSF A;  1K94 A;  1TRF A;  3DVM A;  2JRF A;  3FWB A;  3DVJ A;  4QJ5 B;  2LUC A;  1XFU O;  1V1G A;  1J7P A;  4PE4 A;  3LL8 B;  1Y1A A;  5HLV A;  4MN0 A;  4DS7 A;  1NYA A;  1QAS A;  4C0J A;  2H61 A;  3JVT B;  3TS5 C;  1NX3 A;  2LP2 A;  1IGV A;  1UHH A;  2KFH A;  3I5H B;  2ISD A;  5DKQ A;  4AOM A;  1H8B A;  1F4Q A;  3LK1 A;  1M31 A;  1NX0 A;  3DD4 A;  2V53 A;  1SYM A;  3AAJ A;  4OCI A;  2GV5 A;  2Q4U A;  3CWG A;  1KSO A;  1QX2 A;  1YX7 A;  4M2Q A;  1IH0 A;  2BE4 A;  4M2O A;  3CLN A;  1YUT A;  4I5L B;  1AP4 A;  1C07 A;  2EC6 B;  1B8R A;  2PAS A;  1M46 A;  3SG6 A;  4PHM A;  3JTD C;  1LA3 A;  2Y1N A;  4PCW A;  1FI6 A;  1HQV A;  2BE6 A;  2LV7 A;  1XFY O;  3A8R A;  3KEV A;  1OMV A;  1K9U A;  1J1D A;  3VRR A;  1NX1 A;  5KTY A;  2WOR A;  3TDZ A;  3GOF A;  2KYC A;  2OTG B;  4U8D A;  1JWD A;  2LM5 A;  1CM4 A;  1UUS A;  1MHO A;  2CXJ A;  3BOW A;  2BEC A;  1Q80 A;  1DJX A;  3GK4 X;  2KAX A;  5ER5 A;  1YX8 A;  4PHK A;  3H4S E;  1QX5 B;  1CTR A;  4OVN F;  4GBA A;  1NP8 A;  1BR1 B;  1AJ4 A;  2L0P A;  3EK4 A;  1IKU A;  2ZN9 A;  2JTT A;  1K96 A;  1OZO A;  4HRE E;  4I5N B;  4JPZ B;  4MLW A;  1F55 A;  3TDU A;  1KFU S;  1QIV A;  1SY9 A;  2JU0 A;  4NQG A;  5JOL A;  1BOC A;  1CNP A;  3OB2 B;  1QXP A;  1KFX S;  2K7O A;  4C0L A;  5DKN A;  1U5I A;  3I5I C;  2M97 A;  4DCK A;  2COL B;  4PDZ A;  3E3R A;  1KK7 Y;  1CDN A;  1S1E A;  3IQO A;  4IL1 A;  2O60 A;  4QJ4 B;  1QLK A;  4BY5 A;  1IQ5 A;  1UHK A;  3IF7 A;  3SIB A;  1M45 A;  2JWW A;  1B4C A;  1GJY A;  2BCB A;  1KK8 B;  2JTZ A;  3PN7 B;  1S5G Z;  2FCE A;  2F8P A;  4MZL A;  4GNK B;  2M7L A;  1EG3 A;  2KGR A;  1RRO A;  4A4C A;  1K95 A;  2NCP A;  2D8N A;  1IJ6 A;  2BBM A;  1CMG A;  1TNQ A;  1CFC A;  3VRQ A;  4OR9 B;  1FF1 A;  1QX7 A;  2M1U A;  3ZNI A;  1X02 A;  3CR5 X;  1Y1U A;  1PAL A;  4CLN A;  2MLE C;  4BY4 A;  3OX5 A;  1MUX A;  3AKB A;  1QLS A;  1YTZ C;  5I8N A;  2KBM A;  1FI5 A;  4PHJ A;  2BBN A;  2RGI A;  3SG4 A;  3FIA A;  5KU1 A;  1XFZ O;  2M7N A;  1L2O C;  1PVB A;  2PRU A;  3DVK A;  1SCM B;  4GGF C;  1CLB A;  1DJY A;  5BPJ A;  2E30 A;  2BKH B;  3A4U B;  3VRO A;  1DJI A;  2LE9 B;  4PE0 A;  1PUL A;  3KF9 A;  5J3X A;  1B7T Y;  1HT9 A;  1SBJ A;  5CSI A;  1C7W A;  1A29 A;  1J7R A;  1EG4 A;  2OS8 C;  4FTG A;  1RJV A;  5CSN A;  4PAL A;  2MBX A;  1LIN A;  3NXA A;  1S6C A;  2BCX A;  1RWY A;  2F3Y A;  2OPO A;  3VRN A;  3WNX B;  1KWO C;  2LCP A;  5TNC A;  3EVR A;  1NCX A;  1QTX A;  4ZCU A;  2I94 A;  2LLS A;  1UWO A;  1DT7 B;  1A2X A;  2G2B A;  3EKJ A;  2KBI A;  2VRG A;  4MBE A;  1N65 A;  2LMU A;  3CGA A;  4YGC B;  1IG5 A;  4A4B A;  3C1V A;  3GK1 A;  4CID A;  3WXA A;  1BLQ A;  2LMV A;  3CTN A;  1SNL A;  1DMO A;  5K89 A;  1DF0 A;  1VRK A;  4PE7 A;  1QJT A;  2PSR A;  4P2Y B;  1UHJ A;  3K21 A;  1WRK A;  4HSZ A;  4OKH A;  2P6B B;  2WND A;  2H2K A;  1DJG A;  3CS1 A;  5FYX A;  1GGZ A;  4GGN A;  2L50 A;  4N1G A;  1PK0 D;  2JPT A;  1MF8 B;  5CPV A;  1WRZ A;  2LP3 A;  1XVJ A;  2KGB C;  2M29 A;  3I5F C;  3BOW B;  1K2H A;  3OX6 A;  4L9M A;  1LKJ A;  2JNF A;  4TNC A;  2JT0 A;  1WDC C;  2CBL A;  3O4Y A;  1XK4 A;  2LNK A;  3NSI A;  2HQW A;  2KAV A;  1DJW A;  1QV1 A;  3O6B A;  1ZMZ A;  2KYF A;  2F2O A;  2PMY A;  1GQM A;  2I18 A;  2KI4 B;  4MVF A;  4DUQ A;  1OQP A;  2WCF A;  4M2P A;  2Y4Q A;  1LXF C;  2LHI A;  1ALW A;  2FCD A;  1MWN A;  1N2D A;  5KSZ A;  1D1O A;  1K90 D;  1ZFS A;  1IQ3 A;  4MZJ A;  1TNP A;  3SIA A;  1QVI Y;  1SL8 A;  1SR6 B;  2NXQ A;  1XFV O;  1U5I B;  3DF0 A;  3I5G C;  3WHT B;  2LVJ A;  2NCO A;  3OB1 B;  4GGF A;  1YR5 A;  4F0Z B;  3KPX A;  1KQM C;  4OV2 A;  1XO5 A;  3FS7 A;  2K0J A;  2KDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...