1LS8A

Nmr structure of the unliganded bombyx mori pheromone-binding protein at physiological ph
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords pheromone binding protein
publication title NMR structure of the unliganded Bombyx mori pheromone-binding protein at physiological pH
pubmed doi rcsb
source organism Bombyx mori
total genus 38
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1ls8A00
3NGVA 3B6XA 5EL2A 1OOGA 2JPOA 2QEBA 1DQEA 2PQLA 3CZ0A 3DY9A 1T14A 3NHIA 2WCHA 2WC5A 2WCKA 2WC6A 3D73A 3CABA 3D76A 3CZ2A 3R1OA 1C3ZA 3BJHA 3S0GA 2QEVA 2L2CA 1OOHA 3B87A 3Q8IA 2QDIA 1QWVA 3FE9A 3D78A 3OGNA 3S0DA 3VB1A 3FE8A 3B86A 3D77A 3S0EA 3BFAA 1ORGA 2WCJA 3V2LA 3DZTA 3N7HA 3QMEA 3S0FA 3DYEA 1C3YA 1TWOA 1P28A 5DICA 3BFHA 4OZDA 1LS8A 2FJYA 1GM0A 3CYZA 1XFRA 3L47A 4F7FA 3R72A 3CDNA 2P71A 4INXA 3S0AA 4PT1A 4FQTA 1OOIX 1TUJA 2WCMA 3S0BA 3K1EA 2QEHA 1OOFA 3NHTA 4JD9A 3DXLA 3B7AA 3CZ1A 3L4LA 2WCLA 4INWA 3B88A 2ERBA 2P70A 2KPHA 2QEOA 3BFBA 3D74A 3R1PA 2GTEA 1OW4A 3R1VA 2H8VA 3FE6A 3L4AA 3PJIA 3RZSA 3D75A
chains in the Genus database with same CATH superfamily
3NGVA 4U8DA 1BF5A 1CDNA 1AK8A 1OOGA 1OE9B 2F33A 3EVUA 1N2DA 1OMVA 1XFYO 1ZOTB 2JRFA 1QVIY 3H4SE 1CMFA 1KSOA 1MWNA 2BE4A 2OTGC 2CCMA 3AKAA 3DF0A 1UHKA 1QJTA 3TDUA 1QLKA 1A29A 2CBLA 3LLEA 3UNWA 1PALA 4MRYA 2WCFA 1AVSA 2M9GA 3CLNA 4A4CA 5I2QA 2KQ6A 2KSPA 3I5IB 2K61A 2KI4B 4BY4A 1RROA 1J7PA 3I5FC 1F4OA 3D76A 4PE1A 3VGOA 2QPTA 1KFUL 4P5OE 2L4IA 1CFCA 1SL8A 3R1OA 4HRHA 2BKHB 3HCMA 1TCFA 1V1GA 1MQ1A 4XJKA 3Q8IA 2KFFA 2SASA 3D78A 1RTP1 4M2OA 1XA5A 3BUNB 1KQMB 4AOMA 1B8RA 3PFVA 1BU3A 5JOLA 1CMGA 2FCEA 3I5HC 3SG4A 3D77A 1QLSA 5AEQA 1YRUB 3HX4A 3SG3A 1U5IA 3TDZA 4MSPA 2RGIA 2I2RE 1BT6A 3BFAA 4CFRA 1FI5A 4ZCUA 1QXPA 1QV0A 2PASA 1IJ6A 1XK4A 1VRKA 3N7HA 2ZNEA 3DYEA 3OB2B 1SK6D 2F2PA 2M7NA 1B8CA 4HREE 3BOWB 4YRUA 1K9PA 4USLA 4WQ2A 2MLFC 2KYFA 2MLEC 2LANA 2EC6C 1JF0A 1N0YA 3I5IC 4YGEB 2BL0C 4GUKA 1DJZA 2K8MB 2KGBC 1NP8A 1S26D 5B8IB 1LVCD 3R72A 3CDNA 2PSRA 1RWYA 2WCEA 1K95A 3DD4A 2MBXA 1EJ3A 4MLWA 1YX7A 1Y1UA 2PRUA 1WRZA 1CTRA 4INXA 1SRAA 2B1UA 4PT1A 2JNXA 2Y1NA 3PATA 1OZOA 4FQTA 1KWOB 1TUJA 1AJ5A 3OX6A 2KFHA 2JT0A 4PHNA 1A75A 2FJUB 2PVBA 1BOCA 3MSEB 5I2OA 1JBAA 2WCLA 2NXQA 2JWWA 2ERBA 1DELA 2P70A 2M8UA 1KFXL 3VRNA 1BJFA 3M0WA 4KYNA 1SBJA 1QX2A 3BUWB 1CM4A 3BFBA 3D74A 1B1GA 3O4YA 1FF1A 3NSOA 1XFVO 1CLBA 2GTEA 2JNFA 5IBWA 1IGVA 2M1KB 1JUOA 1EG4A 1OSAA 3FIAA 3I5GB 4JWQA 2Y1MA 5D3OA 1D1OA 1CB1A 1Y1AA 1LINA 3PJIA 2LHLA 3BUOB 2O60A 4PCWA 1LA0A 1JF2A 1EXRA 3IQOA 1JFKA 4OR9B 1DJXA 3SJSA 3RZSA 1AJ4A 1SY9A 2VRGA 1OMRA 5DKQA 1F8HA 3KEVA 1QIWA 5EL2A 4N5XA 4MRXA 1BODA 1DF0B 1C7VA 3CR2A 2AUCA 1B47A 1PSRA 2ZN8A 3IF7A 1DQEA 1BMOA 2PQLA 3KPXA 1CDPA 3AKBA 3NSKA 1K9UA 1QATA 2LLTA 1T14A 2L4HA 2WCHA 1GJYA 3SG7A 1X02A 3D73A 2LMVA 2PALA 1NSHA 1SW8A 1R6PA 2LP2A 2LNKA 2ZRSA 1CKKA 1IIOA 1SR6B 1XFWO 2KI6D 3VRQA 3PLFB 1C3ZA 3WHUB 1DJYA 5HLOA 2QEVA 1UP5A 1UHNA 4ORCB 1B4CA 1L2OB 4D1EA 3FE9A 3OGNA 4CPVA 1J55A 2L50A 2HQ8A 5AERA 3ICBA 3OBVA 2LP3A 1DJGA 3TS5B 2KAYA 4IJ7A 2NLNA 4L9MA 1QV1A 4M2PA 1C7WA 1YUSA 1WY9A 4PHKA 1HT9A 1W9ZA 3V2LA 1J1EA 3LK1A 3DVKA 1YTZC 1CLLA 2JTZA 2JULA 1NYAA 2NCPA 2L5YA 3SS4A 2CT9A 3S0FA 2FCDA 3KO0A 4GNKB 2AAOA 3LK0A 1M46A 5D7FA 1C3YA 4MZJA 1WRLA 2P6BB 1H4BA 2L2EA 2Y5IA 2YGUA 3AAJA 1SCVA 1LS8A 2H61C 1UHHA 2G9BA 2FJYA 1IRJA 1IQ3A 1GM0A 2O5GA 3IQQA 1DC1A 1N65A 2BKIB 3JTDB 5JJGA 2BBMA 4F7FA 4MEWA 5K89A 2LM5A 2LVJA 1G33A 4OV2A 2PMYA 1QIVA 2L98A 2I7AA 3PN7B 3QRXA 4FTGA 4HRGA 3SG2A 3TUYB 2KAXA 1MUXA 1SL7A 1NX3A 4IL1A 1K8UA 3PM8A 5ER4X 1M45A 1CFFA 3JVTB 2JTTA 2PYQA 5J3XA 1FW4A 1KFUS 5ER5A 4E68A 1H8BA 1BR1B 1WDCB 3FWCA 2G2BA 3SS5A 1CFDA 1F4QA 1SCMB 2LAPA 1CDMA 3EG5B 2HF5A 4MZKA 2M29A 1UWOA 3S0BA 2WCBA 3CZTX 3K1EA 4PE4A 1GGWA 1Z4HA 3EK8A 1K94A 2ISDA 3SG6A 2MHHA 2KI4C 1DTLA 4QJ3B 5I2LA 3GK2A 1Q80A 3B7AA 1E8AA 1LKJA 5D69A 4R1EA 4DIRA 5FI2A 1NX1A 1SPYA 2KPHA 1YURA 2Q91A 2LLSA 2QEOA 1DJWA 1G4YR 3UO9A 3R1PA 1BG1A 1KCYA 2KYCA 2ZKMX 3DF0B 1L7ZA 4DCKA 1OW4A 1NCXA 1KQMC 1TTXA 2LVVA 4PE7A 3L4AA 4PE0A 1AP4A 3WXAA 2LCPA 2R2IA 2IS9A 1PK0D 2OS8B 1TNQA 1SSEB 2JQ6A 4C0JA 4NDBA 1OOJA 1LA3A 1MXEA 2H61A 3BXKA 2BCBA 4XJKB 2ZN9A 1YUUA 1XFUO 4GBAA 1LXFC 3BUMB 3EVRA 2QEBA 4I5KA 4MN0A 1DT7B 2JOJA 2JXCA 1RK9A 1NCYA 3CZ0A 3DY9A 3SIAA 1YRTB 3A8RA 1WLZA 1G8IA 1DGUA 4OCIA 1HQVA 4YBHB 2LLUA 2WC6A 2BCAA 1M39A 5DKRA 4Q04A 3FS7A 2CTNA 1MHOA 3ZNIA 1IWQA 1U5IB 1YR5A 2D8NA 4YGBB 4DRWA 1FPWA 4ICBA 1A4PA 2KBIA 3CZ2A 5FI7A 2SCPA 1S36A 1CDLA 2LC5A 2L0PA 1DGVA 3B87A 2K7CA 3CS1A 1QWVA 1R2UA 5CSIA 2KHNA 1QASA 2Q4UA 3SIBA 1ALVA 4JKTA 3S0DA 1IG5A 1B7TZ 1B8LA 1UHIA 3VB1A 4FQOA 1Y0VH 1TNPA 1WRKA 1ZACA 3FE8A 3OX5A 3ZWHA 4YI9A 1PVAA 2WC8A 3PM2A 1CFPA 1KFXS 2MJWB 1KWOC 1Y1XA 4A4BA 1CM1A 1M63B 4CFQA 4DS7A 1AHRA 1XFXO 2LVKA 4WRIA 2LVIA 1ORGA 4N1GA 1QS7A 4WQ3A 1NPQA 3DZTA 4ETOA 2M7LA 2OTGB 5AFPA 2WORA 1MF8B 1OQPA 4PHJA 4ZCVA 5HLVA 4CLNA 2KLDA 4GGNA 1B7TY 4YGCB 1P28A 1UURA 4JPZB 1TNXA 5HL1A 1GQMA 1SL9A 2K7OA 3BFHA 4OZDA 3RLZA 2M3WA 1KK7Z 4PDZA 5HKYA 2ZFDA 1TCOB 2LHIA 3GK4X 5HKZA 1V1FA 3BQ3A 3I5FB 3BUXB 2KFGA 2HETA 2LV7A 1Z2CB 1XFRA 3KHEA 2KI6C 3L47A 3OB1B 3TDIA 5DKNA 3I5GC 1A2XA 1PSBA 2K2AA 1OMDA 1A75B 2JT3A 2LUXA 5HKWA 2V53A 3C1VA 2P71A 3GOFA 2M0RA 3O78A 4I5LB 1J7RA 1CLMA 2KDHA 1S6IA 3BOWA 3EKHA 2KOTA 1K90D 1F71A 1MXLC 3DVJA 2DOQA 3LL8B 4MZLA 1KK7Y 3I5HB 5AANA 3S0AA 2Y4QA 3CR4X 4MBEA 3CWGA 2MRDA 2I94A 3CR5X 1Y6WA 2WCMA 4PALA 1CNPA 2K7DA 1KK8B 2K2FA 4NQGA 2QEHA 1GGZA 1OOFA 2E30A 2HQWA 3O6BA 3E3RA 1KQVA 3IVTA 3NHTA 2JT8A 1XVJA 4M2QA 5G08A 2L51A 3D0YB 1S1EA 4C0LA 1DVIA 1PULA 5I94A 3CZ1A 3L4LA 5I8NA 1IH0A 1S6JA 1XO5A 2WNDA 4INWA 3B88A 1SR6C 5KTYA 2ZNDA 2EC6B 1L2OC 1TUZA 2BL0B 4JQ0D 1NX2A 1RJVA 1YX8A 1NUBA 3VRRA 2F2OA 5CSNA 2FOTA 3WHTB 3K21A 3KF9A 3TS5C 2H8VA 3FE6A 4AQIA 2EHBA 1F54A 2GGZA 3A4UB 1SNLA 1W7IB 4NDDA 5PALA 2E6WA 1J1DA 1W7JB 2LUCA 3B6XA 2F8PA 5CSFA 1F70A 2COLB 2F3YA 2BCXA 3AAKA 2M97A 2JPOA 3D10A 1QTXA 2JC2A 5GQQC 3SG5A 1NCZA 2BECA 1IQ5A 1KK8C 1QX5B 1SYMA 2F3ZA 1UHJA 4ORAB 2M49B 1BR4B 3NHIA 1OZSA 2WC5A 1TN4A 1TOPA 2WCKA 3PALA 4ORBB 3CABA 2NZ0A 3DVEA 3OP0A 4N1FA 2TN4A 1DJHA 4YGAA 5CPVA 4F0ZB 1FBVA 5KU1A 1EH2A 3JTDC 3PSRA 1DJIA 3LCPC 1JC2A 1PRWA 2NCOA 3EK7A 1K9KA 1K93D 1SMGA 1DF0A 2KLEA 1MR8A 3BJHA 3PN7C 2L2CA 3S0GA 4C0KA 4GAOA 2K0JA 2BE6A 1OOHA 3GK1A 2K7BA 2QDIA 3TUYC 2CXJA 2CNPA 1YVLA 2M1UA 1B9AA 1J7QA 2WOSA 3JVTC 1NIWA 4I5JA 4GFTA 4MVFA 1WDCC 1YUTA 3B86A 2BNXA 5FYXA 3TZ1A 1TNWA 2LMUA 1ODBA 4GGFC 4XYNA 3S0EA 1SCMC 2WCJA 2HPSA 4OKHA 3QMEA 1SKTA 1ZUZA 1EG3A 2GV5A 4PHMA 3NXAA 3OHMB 3O4XA 1C07A 2MAZA 1TWOA 2LE9B 4OVNF 5HYDA 4UPGA 5DICA 2AMIA 4QJ4B 2JXLA 2GGMA 3CYZA 3VRPA 1RECA 1DMOA 1RFJA 1F55A 1S6CA 1JWDA 4I5NB 2BBNA 1JFJA 3FWBA 4NDCA 4HSZA 1J7OA 1AUIB 1NX0A 3SS3A 2K60A 2KNEA 2OS8C 3WNXB 1K96A 3DVMA 4YI8A 2KGRA 1PVBA 5AXIA 3BYAA 1S5GZ 2A4JA 1EL4A 2H2KA 3O2PA 4TNCA 4BY5A 4YGDB 3D0YA 1OOIX 1IJ5A 5F6TA 2LMTA 2JPTA 5FI6A 1FI6A 2KQYA 1TRFA 4QJ5B 3RM1A 1DEKA 3F45A 4JD9A 5TNCA 1JSAA 3DXLA 1WLMA 2KBMA 2ZRTA 1QX7A 5KSZA 1NWDA 1KSMA 3NSIA 5BPJA 1UUSA 4GPLB 3NSLA 1YVHA 2BAPA 3EVVA 1XK4C 2JZIA 3VROA 1S5GY 1QVIZ 2QACA 1ZFSA 3EK4A 2L5XB 2I18A 1BLQA 2OPOA 4CIDA 4GGFA 1XYDA 2MA2A 5CSJA 3CTNA 2JU0A 1K2HA 1IKUA 1S3PA 1M31A 3R1VA 1ALWA 2EGDA 3EKJA 4P2YB 4DUQA 1XFZO 1ZMZA 3CGAA 4AQJA 2KAVA 3D75A 1TIZA 1A03A
chains in the Genus database with same CATH topology
3NGVA 3B6XA 5EL2A 1OOGA 2JPOA 2QEBA 1DQEA 2PQLA 3CZ0A 3DY9A 1T14A 3NHIA 2WCHA 2WC5A 2WCKA 2WC6A 3D73A 3CABA 3D76A 3CZ2A 3R1OA 1C3ZA 3BJHA 3S0GA 2QEVA 2L2CA 1OOHA 3B87A 3Q8IA 2QDIA 1QWVA 3FE9A 3D78A 3OGNA 3S0DA 3VB1A 3FE8A 3B86A 3D77A 3S0EA 3BFAA 1ORGA 2WCJA 3V2LA 3DZTA 3N7HA 3QMEA 3S0FA 3DYEA 1C3YA 1TWOA 1P28A 5DICA 3BFHA 4OZDA 1LS8A 2FJYA 1GM0A 3CYZA 1XFRA 3L47A 4F7FA 3R72A 3CDNA 2P71A 4INXA 3S0AA 4PT1A 4FQTA 1OOIX 1TUJA 2WCMA 3S0BA 3K1EA 2QEHA 1OOFA 3NHTA 4JD9A 3DXLA 3B7AA 3CZ1A 3L4LA 2WCLA 4INWA 3B88A 2ERBA 2P70A 2KPHA 2QEOA 3BFBA 3D74A 3R1PA 2GTEA 1OW4A 3R1VA 2H8VA 3FE6A 3L4AA 3PJIA 3RZSA 3D75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGV A;  3B6X A;  5EL2 A;  1OOG A;  2JPO A;  2QEB A;  1DQE A;  2PQL A;  3CZ0 A;  3DY9 A;  1T14 A;  3NHI A;  2WCH A;  2WC5 A;  2WCK A;  2WC6 A;  3D73 A;  3CAB A;  3D76 A;  3CZ2 A;  3R1O A;  1C3Z A;  3BJH A;  3S0G A;  2QEV A;  2L2C A;  1OOH A;  3B87 A;  3Q8I A;  2QDI A;  1QWV A;  3FE9 A;  3D78 A;  3OGN A;  3S0D A;  3VB1 A;  3FE8 A;  3B86 A;  3D77 A;  3S0E A;  3BFA A;  1ORG A;  2WCJ A;  3V2L A;  3DZT A;  3N7H A;  3QME A;  3S0F A;  3DYE A;  1C3Y A;  1TWO A;  1P28 A;  5DIC A;  3BFH A;  4OZD A;  1LS8 A;  2FJY A;  1GM0 A;  3CYZ A;  1XFR A;  3L47 A;  4F7F A;  3R72 A;  3CDN A;  2P71 A;  4INX A;  3S0A A;  4PT1 A;  4FQT A;  1OOI X;  1TUJ A;  2WCM A;  3S0B A;  3K1E A;  2QEH A;  1OOF A;  3NHT A;  4JD9 A;  3DXL A;  3B7A A;  3CZ1 A;  3L4L A;  2WCL A;  4INW A;  3B88 A;  2ERB A;  2P70 A;  2KPH A;  2QEO A;  3BFB A;  3D74 A;  3R1P A;  2GTE A;  1OW4 A;  3R1V A;  2H8V A;  3FE6 A;  3L4A A;  3PJI A;  3RZS A;  3D75 A; 
#chains in the Genus database with same CATH topology
 3NGV A;  4U8D A;  1BF5 A;  1CDN A;  1AK8 A;  1OOG A;  1OE9 B;  2F33 A;  3EVU A;  1N2D A;  1OMV A;  1XFY O;  1ZOT B;  2JRF A;  1QVI Y;  3H4S E;  1CMF A;  1KSO A;  1MWN A;  2BE4 A;  2OTG C;  2CCM A;  3AKA A;  3DF0 A;  1UHK A;  1QJT A;  3TDU A;  1QLK A;  1A29 A;  2CBL A;  3LLE A;  3UNW A;  1PAL A;  4MRY A;  2WCF A;  1AVS A;  2M9G A;  3CLN A;  4A4C A;  5I2Q A;  2KQ6 A;  2KSP A;  3I5I B;  2K61 A;  2KI4 B;  4BY4 A;  1RRO A;  1J7P A;  3I5F C;  1F4O A;  3D76 A;  4PE1 A;  3VGO A;  2QPT A;  1KFU L;  4P5O E;  2L4I A;  1CFC A;  1SL8 A;  3R1O A;  4HRH A;  2BKH B;  3HCM A;  1TCF A;  1V1G A;  1MQ1 A;  4XJK A;  3Q8I A;  2KFF A;  2SAS A;  3D78 A;  1RTP 1;  4M2O A;  1XA5 A;  3BUN B;  1KQM B;  4AOM A;  1B8R A;  3PFV A;  1BU3 A;  5JOL A;  1CMG A;  2FCE A;  3I5H C;  3SG4 A;  3D77 A;  1QLS A;  5AEQ A;  1YRU B;  3HX4 A;  3SG3 A;  1U5I A;  3TDZ A;  4MSP A;  2RGI A;  2I2R E;  1BT6 A;  3BFA A;  4CFR A;  1FI5 A;  4ZCU A;  1QXP A;  1QV0 A;  2PAS A;  1IJ6 A;  1XK4 A;  1VRK A;  3N7H A;  2ZNE A;  3DYE A;  3OB2 B;  1SK6 D;  2F2P A;  2M7N A;  1B8C A;  4HRE E;  3BOW B;  4YRU A;  1K9P A;  4USL A;  4WQ2 A;  2MLF C;  2KYF A;  2MLE C;  2LAN A;  2EC6 C;  1JF0 A;  1N0Y A;  3I5I C;  4YGE B;  2BL0 C;  4GUK A;  1DJZ A;  2K8M B;  2KGB C;  1NP8 A;  1S26 D;  5B8I B;  1LVC D;  3R72 A;  3CDN A;  2PSR A;  1RWY A;  2WCE A;  1K95 A;  3DD4 A;  2MBX A;  1EJ3 A;  4MLW A;  1YX7 A;  1Y1U A;  2PRU A;  1WRZ A;  1CTR A;  4INX A;  1SRA A;  2B1U A;  4PT1 A;  2JNX A;  2Y1N A;  3PAT A;  1OZO A;  4FQT A;  1KWO B;  1TUJ A;  1AJ5 A;  3OX6 A;  2KFH A;  2JT0 A;  4PHN A;  1A75 A;  2FJU B;  2PVB A;  1BOC A;  3MSE B;  5I2O A;  1JBA A;  2WCL A;  2NXQ A;  2JWW A;  2ERB A;  1DEL A;  2P70 A;  2M8U A;  1KFX L;  3VRN A;  1BJF A;  3M0W A;  4KYN A;  1SBJ A;  1QX2 A;  3BUW B;  1CM4 A;  3BFB A;  3D74 A;  1B1G A;  3O4Y A;  1FF1 A;  3NSO A;  1XFV O;  1CLB A;  2GTE A;  2JNF A;  5IBW A;  1IGV A;  2M1K B;  1JUO A;  1EG4 A;  1OSA A;  3FIA A;  3I5G B;  4JWQ A;  2Y1M A;  5D3O A;  1D1O A;  1CB1 A;  1Y1A A;  1LIN A;  3PJI A;  2LHL A;  3BUO B;  2O60 A;  4PCW A;  1LA0 A;  1JF2 A;  1EXR A;  3IQO A;  1JFK A;  4OR9 B;  1DJX A;  3SJS A;  3RZS A;  1AJ4 A;  1SY9 A;  2VRG A;  1OMR A;  5DKQ A;  1F8H A;  3KEV A;  1QIW A;  5EL2 A;  4N5X A;  4MRX A;  1BOD A;  1DF0 B;  1C7V A;  3CR2 A;  2AUC A;  1B47 A;  1PSR A;  2ZN8 A;  3IF7 A;  1DQE A;  1BMO A;  2PQL A;  3KPX A;  1CDP A;  3AKB A;  3NSK A;  1K9U A;  1QAT A;  2LLT A;  1T14 A;  2L4H A;  2WCH A;  1GJY A;  3SG7 A;  1X02 A;  3D73 A;  2LMV A;  2PAL A;  1NSH A;  1SW8 A;  1R6P A;  2LP2 A;  2LNK A;  2ZRS A;  1CKK A;  1IIO A;  1SR6 B;  1XFW O;  2KI6 D;  3VRQ A;  3PLF B;  1C3Z A;  3WHU B;  1DJY A;  5HLO A;  2QEV A;  1UP5 A;  1UHN A;  4ORC B;  1B4C A;  1L2O B;  4D1E A;  3FE9 A;  3OGN A;  4CPV A;  1J55 A;  2L50 A;  2HQ8 A;  5AER A;  3ICB A;  3OBV A;  2LP3 A;  1DJG A;  3TS5 B;  2KAY A;  4IJ7 A;  2NLN A;  4L9M A;  1QV1 A;  4M2P A;  1C7W A;  1YUS A;  1WY9 A;  4PHK A;  1HT9 A;  1W9Z A;  3V2L A;  1J1E A;  3LK1 A;  3DVK A;  1YTZ C;  1CLL A;  2JTZ A;  2JUL A;  1NYA A;  2NCP A;  2L5Y A;  3SS4 A;  2CT9 A;  3S0F A;  2FCD A;  3KO0 A;  4GNK B;  2AAO A;  3LK0 A;  1M46 A;  5D7F A;  1C3Y A;  4MZJ A;  1WRL A;  2P6B B;  1H4B A;  2L2E A;  2Y5I A;  2YGU A;  3AAJ A;  1SCV A;  1LS8 A;  2H61 C;  1UHH A;  2G9B A;  2FJY A;  1IRJ A;  1IQ3 A;  1GM0 A;  2O5G A;  3IQQ A;  1DC1 A;  1N65 A;  2BKI B;  3JTD B;  5JJG A;  2BBM A;  4F7F A;  4MEW A;  5K89 A;  2LM5 A;  2LVJ A;  1G33 A;  4OV2 A;  2PMY A;  1QIV A;  2L98 A;  2I7A A;  3PN7 B;  3QRX A;  4FTG A;  4HRG A;  3SG2 A;  3TUY B;  2KAX A;  1MUX A;  1SL7 A;  1NX3 A;  4IL1 A;  1K8U A;  3PM8 A;  5ER4 X;  1M45 A;  1CFF A;  3JVT B;  2JTT A;  2PYQ A;  5J3X A;  1FW4 A;  1KFU S;  5ER5 A;  4E68 A;  1H8B A;  1BR1 B;  1WDC B;  3FWC A;  2G2B A;  3SS5 A;  1CFD A;  1F4Q A;  1SCM B;  2LAP A;  1CDM A;  3EG5 B;  2HF5 A;  4MZK A;  2M29 A;  1UWO A;  3S0B A;  2WCB A;  3CZT X;  3K1E A;  4PE4 A;  1GGW A;  1Z4H A;  3EK8 A;  1K94 A;  2ISD A;  3SG6 A;  2MHH A;  2KI4 C;  1DTL A;  4QJ3 B;  5I2L A;  3GK2 A;  1Q80 A;  3B7A A;  1E8A A;  1LKJ A;  5D69 A;  4R1E A;  4DIR A;  5FI2 A;  1NX1 A;  1SPY A;  2KPH A;  1YUR A;  2Q91 A;  2LLS A;  2QEO A;  1DJW A;  1G4Y R;  3UO9 A;  3R1P A;  1BG1 A;  1KCY A;  2KYC A;  2ZKM X;  3DF0 B;  1L7Z A;  4DCK A;  1OW4 A;  1NCX A;  1KQM C;  1TTX A;  2LVV A;  4PE7 A;  3L4A A;  4PE0 A;  1AP4 A;  3WXA A;  2LCP A;  2R2I A;  2IS9 A;  1PK0 D;  2OS8 B;  1TNQ A;  1SSE B;  2JQ6 A;  4C0J A;  4NDB A;  1OOJ A;  1LA3 A;  1MXE A;  2H61 A;  3BXK A;  2BCB A;  4XJK B;  2ZN9 A;  1YUU A;  1XFU O;  4GBA A;  1LXF C;  3BUM B;  3EVR A;  2QEB A;  4I5K A;  4MN0 A;  1DT7 B;  2JOJ A;  2JXC A;  1RK9 A;  1NCY A;  3CZ0 A;  3DY9 A;  3SIA A;  1YRT B;  3A8R A;  1WLZ A;  1G8I A;  1DGU A;  4OCI A;  1HQV A;  4YBH B;  2LLU A;  2WC6 A;  2BCA A;  1M39 A;  5DKR A;  4Q04 A;  3FS7 A;  2CTN A;  1MHO A;  3ZNI A;  1IWQ A;  1U5I B;  1YR5 A;  2D8N A;  4YGB B;  4DRW A;  1FPW A;  4ICB A;  1A4P A;  2KBI A;  3CZ2 A;  5FI7 A;  2SCP A;  1S36 A;  1CDL A;  2LC5 A;  2L0P A;  1DGV A;  3B87 A;  2K7C A;  3CS1 A;  1QWV A;  1R2U A;  5CSI A;  2KHN A;  1QAS A;  2Q4U A;  3SIB A;  1ALV A;  4JKT A;  3S0D A;  1IG5 A;  1B7T Z;  1B8L A;  1UHI A;  3VB1 A;  4FQO A;  1Y0V H;  1TNP A;  1WRK A;  1ZAC A;  3FE8 A;  3OX5 A;  3ZWH A;  4YI9 A;  1PVA A;  2WC8 A;  3PM2 A;  1CFP A;  1KFX S;  2MJW B;  1KWO C;  1Y1X A;  4A4B A;  1CM1 A;  1M63 B;  4CFQ A;  4DS7 A;  1AHR A;  1XFX O;  2LVK A;  4WRI A;  2LVI A;  1ORG A;  4N1G A;  1QS7 A;  4WQ3 A;  1NPQ A;  3DZT A;  4ETO A;  2M7L A;  2OTG B;  5AFP A;  2WOR A;  1MF8 B;  1OQP A;  4PHJ A;  4ZCV A;  5HLV A;  4CLN A;  2KLD A;  4GGN A;  1B7T Y;  4YGC B;  1P28 A;  1UUR A;  4JPZ B;  1TNX A;  5HL1 A;  1GQM A;  1SL9 A;  2K7O A;  3BFH A;  4OZD A;  3RLZ A;  2M3W A;  1KK7 Z;  4PDZ A;  5HKY A;  2ZFD A;  1TCO B;  2LHI A;  3GK4 X;  5HKZ A;  1V1F A;  3BQ3 A;  3I5F B;  3BUX B;  2KFG A;  2HET A;  2LV7 A;  1Z2C B;  1XFR A;  3KHE A;  2KI6 C;  3L47 A;  3OB1 B;  3TDI A;  5DKN A;  3I5G C;  1A2X A;  1PSB A;  2K2A A;  1OMD A;  1A75 B;  2JT3 A;  2LUX A;  5HKW A;  2V53 A;  3C1V A;  2P71 A;  3GOF A;  2M0R A;  3O78 A;  4I5L B;  1J7R A;  1CLM A;  2KDH A;  1S6I A;  3BOW A;  3EKH A;  2KOT A;  1K90 D;  1F71 A;  1MXL C;  3DVJ A;  2DOQ A;  3LL8 B;  4MZL A;  1KK7 Y;  3I5H B;  5AAN A;  3S0A A;  2Y4Q A;  3CR4 X;  4MBE A;  3CWG A;  2MRD A;  2I94 A;  3CR5 X;  1Y6W A;  2WCM A;  4PAL A;  1CNP A;  2K7D A;  1KK8 B;  2K2F A;  4NQG A;  2QEH A;  1GGZ A;  1OOF A;  2E30 A;  2HQW A;  3O6B A;  3E3R A;  1KQV A;  3IVT A;  3NHT A;  2JT8 A;  1XVJ A;  4M2Q A;  5G08 A;  2L51 A;  3D0Y B;  1S1E A;  4C0L A;  1DVI A;  1PUL A;  5I94 A;  3CZ1 A;  3L4L A;  5I8N A;  1IH0 A;  1S6J A;  1XO5 A;  2WND A;  4INW A;  3B88 A;  1SR6 C;  5KTY A;  2ZND A;  2EC6 B;  1L2O C;  1TUZ A;  2BL0 B;  4JQ0 D;  1NX2 A;  1RJV A;  1YX8 A;  1NUB A;  3VRR A;  2F2O A;  5CSN A;  2FOT A;  3WHT B;  3K21 A;  3KF9 A;  3TS5 C;  2H8V A;  3FE6 A;  4AQI A;  2EHB A;  1F54 A;  2GGZ A;  3A4U B;  1SNL A;  1W7I B;  4NDD A;  5PAL A;  2E6W A;  1J1D A;  1W7J B;  2LUC A;  3B6X A;  2F8P A;  5CSF A;  1F70 A;  2COL B;  2F3Y A;  2BCX A;  3AAK A;  2M97 A;  2JPO A;  3D10 A;  1QTX A;  2JC2 A;  5GQQ C;  3SG5 A;  1NCZ A;  2BEC A;  1IQ5 A;  1KK8 C;  1QX5 B;  1SYM A;  2F3Z A;  1UHJ A;  4ORA B;  2M49 B;  1BR4 B;  3NHI A;  1OZS A;  2WC5 A;  1TN4 A;  1TOP A;  2WCK A;  3PAL A;  4ORB B;  3CAB A;  2NZ0 A;  3DVE A;  3OP0 A;  4N1F A;  2TN4 A;  1DJH A;  4YGA A;  5CPV A;  4F0Z B;  1FBV A;  5KU1 A;  1EH2 A;  3JTD C;  3PSR A;  1DJI A;  3LCP C;  1JC2 A;  1PRW A;  2NCO A;  3EK7 A;  1K9K A;  1K93 D;  1SMG A;  1DF0 A;  2KLE A;  1MR8 A;  3BJH A;  3PN7 C;  2L2C A;  3S0G A;  4C0K A;  4GAO A;  2K0J A;  2BE6 A;  1OOH A;  3GK1 A;  2K7B A;  2QDI A;  3TUY C;  2CXJ A;  2CNP A;  1YVL A;  2M1U A;  1B9A A;  1J7Q A;  2WOS A;  3JVT C;  1NIW A;  4I5J A;  4GFT A;  4MVF A;  1WDC C;  1YUT A;  3B86 A;  2BNX A;  5FYX A;  3TZ1 A;  1TNW A;  2LMU A;  1ODB A;  4GGF C;  4XYN A;  3S0E A;  1SCM C;  2WCJ A;  2HPS A;  4OKH A;  3QME A;  1SKT A;  1ZUZ A;  1EG3 A;  2GV5 A;  4PHM A;  3NXA A;  3OHM B;  3O4X A;  1C07 A;  2MAZ A;  1TWO A;  2LE9 B;  4OVN F;  5HYD A;  4UPG A;  5DIC A;  2AMI A;  4QJ4 B;  2JXL A;  2GGM A;  3CYZ A;  3VRP A;  1REC A;  1DMO A;  1RFJ A;  1F55 A;  1S6C A;  1JWD A;  4I5N B;  2BBN A;  1JFJ A;  3FWB A;  4NDC A;  4HSZ A;  1J7O A;  1AUI B;  1NX0 A;  3SS3 A;  2K60 A;  2KNE A;  2OS8 C;  3WNX B;  1K96 A;  3DVM A;  4YI8 A;  2KGR A;  1PVB A;  5AXI A;  3BYA A;  1S5G Z;  2A4J A;  1EL4 A;  2H2K A;  3O2P A;  4TNC A;  4BY5 A;  4YGD B;  3D0Y A;  1OOI X;  1IJ5 A;  5F6T A;  2LMT A;  2JPT A;  5FI6 A;  1FI6 A;  2KQY A;  1TRF A;  4QJ5 B;  3RM1 A;  1DEK A;  3F45 A;  4JD9 A;  5TNC A;  1JSA A;  3DXL A;  1WLM A;  2KBM A;  2ZRT A;  1QX7 A;  5KSZ A;  1NWD A;  1KSM A;  3NSI A;  5BPJ A;  1UUS A;  4GPL B;  3NSL A;  1YVH A;  2BAP A;  3EVV A;  1XK4 C;  2JZI A;  3VRO A;  1S5G Y;  1QVI Z;  2QAC A;  1ZFS A;  3EK4 A;  2L5X B;  2I18 A;  1BLQ A;  2OPO A;  4CID A;  4GGF A;  1XYD A;  2MA2 A;  5CSJ A;  3CTN A;  2JU0 A;  1K2H A;  1IKU A;  1S3P A;  1M31 A;  3R1V A;  1ALW A;  2EGD A;  3EKJ A;  4P2Y B;  4DUQ A;  1XFZ O;  1ZMZ A;  3CGA A;  4AQJ A;  2KAV A;  3D75 A;  1TIZ A;  1A03 A; 
#chains in the Genus database with same CATH homology
 3NGV A;  3B6X A;  5EL2 A;  1OOG A;  2JPO A;  2QEB A;  1DQE A;  2PQL A;  3CZ0 A;  3DY9 A;  1T14 A;  3NHI A;  2WCH A;  2WC5 A;  2WCK A;  2WC6 A;  3D73 A;  3CAB A;  3D76 A;  3CZ2 A;  3R1O A;  1C3Z A;  3BJH A;  3S0G A;  2QEV A;  2L2C A;  1OOH A;  3B87 A;  3Q8I A;  2QDI A;  1QWV A;  3FE9 A;  3D78 A;  3OGN A;  3S0D A;  3VB1 A;  3FE8 A;  3B86 A;  3D77 A;  3S0E A;  3BFA A;  1ORG A;  2WCJ A;  3V2L A;  3DZT A;  3N7H A;  3QME A;  3S0F A;  3DYE A;  1C3Y A;  1TWO A;  1P28 A;  5DIC A;  3BFH A;  4OZD A;  1LS8 A;  2FJY A;  1GM0 A;  3CYZ A;  1XFR A;  3L47 A;  4F7F A;  3R72 A;  3CDN A;  2P71 A;  4INX A;  3S0A A;  4PT1 A;  4FQT A;  1OOI X;  1TUJ A;  2WCM A;  3S0B A;  3K1E A;  2QEH A;  1OOF A;  3NHT A;  4JD9 A;  3DXL A;  3B7A A;  3CZ1 A;  3L4L A;  2WCL A;  4INW A;  3B88 A;  2ERB A;  2P70 A;  2KPH A;  2QEO A;  3BFB A;  3D74 A;  3R1P A;  2GTE A;  1OW4 A;  3R1V A;  2H8V A;  3FE6 A;  3L4A A;  3PJI A;  3RZS A;  3D75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...