1LS8A

Nmr structure of the unliganded bombyx mori pheromone-binding protein at physiological ph
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pheromone binding protein
publication title NMR structure of the unliganded Bombyx mori pheromone-binding protein at physiological pH
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 38
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1ls8A00
2PQLA 1LS8A 5EL2A 2QEVA 3BFBA 3D73A 1TWOA 3Q8IA 3CYZA 2WCKA 3V2LA 4INXA 1ORGA 3D75A 1C3ZA 3K1EA 1OOGA 3L4LA 2JPOA 3D78A 2P71A 3BFHA 1OOFA 2ERBA 1P28A 2WCHA 3S0EA 2FJYA 2KPHA 4OZDA 3CDNA 1XFRA 3VB1A 1T14A 3FE9A 3FE8A 3L4AA 3B6XA 2H8VA 2WC5A 3OGNA 2QEHA 2WCJA 3B7AA 5DICA 1C3YA 2QEOA 3N7HA 3DXLA 3CZ2A 3NHIA 3CABA 3D77A 4JD9A 3CZ1A 3S0GA 3NHTA 2QDIA 3BFAA 3R1OA 4FQTA 3B86A 2WCLA 1QWVA 2WC6A 1OOHA 3S0DA 4F7FA 3BJHA 3QMEA 3DYEA 1TUJA 2L2CA 3NGVA 1OOIX 3S0FA 3R1PA 2WCMA 3PJIA 3DZTA 3S0AA 3B87A 3D74A 1OW4A 1DQEA 2GTEA 2QEBA 3CZ0A 3D76A 3RZSA 3S0BA 3R72A 4PT1A 3FE6A 1GM0A 3B88A 3R1VA 4INWA 3L47A 2P70A 3DY9A
chains in the Genus database with same CATH superfamily
5J3XA 1C07A 1YRUB 2M7LA 4NDDA 2L5YA 1QLKA 1XO5A 5DKNA 4C0KA 1Y1UA 1M63B 1J1EA 2QEVA 3EK4A 4YBHB 4YGBB 1F55A 2ZKMX 1SCVA 3VROA 3UO9A 1KK8B 1A4PA 2NLNA 2OTGB 1IJ6A 1DJZA 4INXA 4JQ0D 2WOSA 1NUBA 1QV0A 1SL7A 3IF7A 3TUYB 3EK8A 3OX5A 1KK7Y 4MRYA 1CTRA 1DVIA 3BUXB 3K1EA 5K89A 4IL1A 2COLB 4BY4A 2F2OA 3L4LA 2Y4QA 2KFFA 1GQMA 1XFZO 4HSZA 2LANA 1J7PA 2NXQA 1W9ZA 3D78A 1JF0A 1XK4C 1FBVA 2JWWA 1MF8B 1KFUL 4MN0A 3OB2B 1IG5A 2I7AA 5CSNA 2F8PA 1FF1A 2HQWA 2MLFC 3NXAA 2LLTA 5HKWA 1CKKA 4U8DA 1DF0A 1MUXA 1DF0B 4A4BA 1ZFSA 1XFRA 3CDNA 2JT3A 2ZNDA 3FE9A 4PDZA 5AEQA 2LM5A 4YRUA 4I5JA 2BCAA 2H8VA 1FPWA 2WORA 1XFUO 2E6WA 3OGNA 1YR5A 3B7AA 1UHHA 1DJGA 3HX4A 1SCMB 2QEOA 2ZN9A 1QX5B 1SW8A 2OPOA 2F3ZA 3I5FB 3UNWA 1NX2A 1NP8A 1YX7A 3CABA 3JVTC 4ZCVA 2KDHA 1DGVA 1LVCD 1B9AA 2H2KA 2M8UA 2O60A 2QACA 4CFQA 1WLZA 5FI7A 1SL8A 1FW4A 1QATA 2JXCA 3I5HB 1CDNA 2NCPA 3AAJA 3LLEA 1QWVA 1YUTA 1M39A 4GGNA 4ZCUA 3AKAA 1DMOA 2JOJA 5BPJA 2M9GA 1D1OA 1CB1A 1YTZC 1CDMA 1QXPA 1M46A 2Y5IA 4F7FA 4BY5A 1QASA 4OKHA 1PULA 1R6PA 1UHIA 2I94A 3PN7C 5FI2A 1Y0VH 4N5XA 1C7VA 3NGVA 2EC6B 1NX1A 3S0FA 1YX8A 1UUSA 2BBMA 4YGDB 1CDPA 2GGZA 2CTNA 1IJ5A 4M2QA 1KQMB 1L2OC 2KHNA 4IJ7A 5CSIA 1A03A 5AERA 1IRJA 3EVVA 4GFTA 4TNCA 1EH2A 1IWQA 1JBAA 3FWBA 1IIOA 1QX7A 5IBWA 5I2OA 3KHEA 4ICBA 3AKBA 3TZ1A 2MLEC 1K94A 1A29A 1DJXA 1RFJA 2P6BB 3LL8B 1WDCC 3SG4A 1K96A 4GNKB 2M0RA 4NDBA 2KI4C 4MEWA 1ALWA 1V1FA 1S1EA 4OVNF 2K7CA 3CLNA 1ODBA 1XFYO 3DVKA 1K8UA 2OS8B 3GK4X 1CFFA 2SASA 1B7TZ 4N1FA 4KYNA 4PHJA 2BL0B 2KFGA 1WRZA 1Y1XA 2BCBA 2M49B 1TCOB 1B8CA 2KOTA 1GGWA 5B8IB 3GK2A 4I5NB 1DELA 1GJYA 5I8NA 3EKJA 4N1GA 3O4XA 3PM8A 1MXLC 2Y1MA 2HPSA 4GAOA 2AMIA 2L0PA 2MRDA 4AQJA 1IKUA 1CM1A 1PSBA 3I5IC 5D69A 1M45A 4NDCA 1TN4A 2KYCA 1ORGA 2O5GA 2K61A 1K9PA 2CBLA 1W7JB 2BKHB 3TUYC 3FS7A 3JTDC 4D1EA 1CMFA 1J55A 2H61A 3EVRA 3ZNIA 1MXEA 1S6JA 3RLZA 4XJKB 1AJ5A 2MBXA 1CFCA 3BFHA 1OOFA 2ERBA 1P28A 5AANA 2MHHA 3TDIA 1YVLA 1ZUZA 2FJYA 2Y1NA 4CPVA 2IS9A 4PCWA 1NWDA 1Q80A 2BBNA 2G2BA 3NSLA 4MRXA 1QVIZ 2LE9B 4P2YB 2KAVA 1C7WA 1GGZA 1SK6D 1CM4A 1RROA 1XFWO 2ZFDA 3PSRA 5HKYA 2M3WA 3LCPC 1UHKA 4P5OE 3VB1A 2PRUA 4ORAB 3VRRA 1QS7A 1ALVA 1A75A 2LCPA 2A4JA 1A75B 2M1KB 4QJ4B 1KSOA 4GPLB 4PHMA 1LKJA 1G33A 5DICA 2WCJA 5JJGA 2NCOA 1OQPA 2KI6C 1IQ3A 1SCMC 2HF5A 3DXLA 2JZIA 5HLVA 1OSAA 2WC8A 4L9MA 2LC5A 3SG3A 3H4SE 3VGOA 2VRGA 2D8NA 3LK1A 1YRTB 2NZ0A 2L50A 3KEVA 1QIVA 1ZMZA 1JFJA 3BQ3A 2FOTA 4FQTA 4C0LA 1CFPA 1CLBA 2LP2A 2AAOA 3OBVA 1OMRA 4DS7A 2WCLA 3DVJA 3OB1B 3EG5B 3SIAA 1CFDA 3LK0A 2FCDA 3S0DA 5JOLA 1DT7B 3TS5B 1S6IA 3BJHA 4GGFC 4ETOA 3DVEA 1F4OA 2K7DA 2LVKA 5KSZA 4CIDA 3QRXA 1BF5A 1KWOC 3I5GC 1S5GY 3R1PA 2BE6A 2EC6C 4I5LB 1JUOA 1Y1AA 3BOWA 1SR6C 4PHKA 3SIBA 1K95A 2EGDA 1LA0A 2Q4UA 2ZNEA 3BOWB 3PJIA 4MBEA 1PRWA 1EL4A 1QX2A 2LVIA 1BLQA 5D3OA 4OCIA 4AOMA 2F2PA 3CR5X 5FYXA 2LHIA 1OW4A 1DQEA 2KLEA 4PE1A 1B1GA 2QEBA 4F0ZB 1SPYA 2K2FA 2M1UA 3MSEB 3RZSA 2JT8A 3R72A 2LLSA 5DKRA 2L4IA 4PT1A 2L5XB 1B8LA 1TTXA 1TOPA 3IQQA 5FI6A 4DCKA 4OR9B 1UWOA 2LMTA 2K0JA 1S6CA 2KQYA 2QPTA 4JPZB 1XK4A 2JXLA 2OS8C 3KPXA 3GK1A 1R2UA 1S26D 3L47A 4MZJA 4R1EA 4DRWA 3C1VA 2P70A 3DY9A 1N2DA 3BUNB 2PQLA 1NX3A 1QTXA 5HLOA 5EL2A 4YI9A 3BFBA 5CSJA 3BUWB 2KAXA 1K93D 2I2RE 3F45A 3D73A 5HL1A 2JC2A 3OX6A 3SS3A 4OV2A 1IQ5A 4E68A 3SS4A 2KFHA 3BUMB 2JNXA 5CPVA 1CMGA 2WCKA 2WCEA 1CDLA 1PVBA 2LMVA 5AFPA 2KQ6A 3D75A 1UP5A 1C3ZA 1TNQA 3CS1A 4MZKA 4YGCB 2EHBA 1LXFC 1KK7Z 1PVAA 2H61C 2JPOA 3D0YA 3JVTB 1OOJA 2P71A 2KYFA 1TNXA 2KBMA 3GOFA 2LV7A 3D0YB 1HT9A 4YI8A 1KFXS 2GGMA 5HKZA 1LINA 1AK8A 2BE4A 1S36A 4DIRA 1SYMA 1J7RA 1F4QA 3ZWHA 2KPHA 2L98A 1YURA 1J7OA 4OZDA 2PMYA 1BOCA 1M31A 1RTP1 2L51A 5DKQA 1DJWA 1PALA 2FCEA 1IGVA 1NCZA 1K9UA 2ZN8A 3WHUB 1JSAA 1KK8C 3PALA 4FQOA 1JF2A 1T14A 2JULA 1YVHA 2OTGC 1W7IB 4USLA 2L4HA 1XA5A 4HRHA 3SG5A 2F33A 2FJUB 1BODA 1MHOA 4AQIA 2KNEA 1BT6A 2WC5A 3CZTX 1UHJA 2PALA 4I5KA 1C3YA 1L2OB 1RWYA 3OP0A 1Y6WA 1MQ1A 1OMVA 2BNXA 3TDUA 1ZOTB 1RK9A 4GUKA 1NX0A 4Q04A 5HYDA 1XFXO 2B1UA 2KGRA 3D77A 4JD9A 3CZ1A 3IQOA 3CR4X 3S0GA 1U5IA 2QDIA 3NHTA 4WQ2A 3WXAA 1NCXA 1U5IB 3BFAA 3FWCA 3R1OA 1K2HA 1OZOA 1WLMA 3A8RA 3B86A 1WDCB 4MLWA 5D7FA 3BXKA 3DF0A 1AVSA 4QJ5B 2M7NA 1F54A 3SG7A 1DTLA 3EVUA 4JKTA 1DC1A 2ZRTA 2WCBA 2JNFA 2JPTA 1NYAA 3HCMA 3K21A 1FI6A 1K9KA 3QMEA 1SRAA 1TCFA 2KLDA 1TUJA 3EK7A 1KQVA 1J1DA 5TNCA 1BMOA 4JWQA 1F71A 4ORCB 2LUCA 2KSPA 3SJSA 1MR8A 4YGEB 5PALA 3S0AA 2CCMA 3I5FC 2PSRA 3B87A 4C0JA 2L2EA 2RGIA 3D74A 1F70A 2GTEA 5GQQC 3KO0A 3SG6A 1BG1A 1HQVA 2TN4A 3CZ0A 1AUIB 2AUCA 3D76A 1PSRA 3I5HC 3IVTA 3S0BA 1VRKA 3BUOB 1KFUS 1QLSA 2LVVA 3I5IB 3E3RA 2DOQA 3SG2A 2LP3A 2MJWB 2KBIA 1TIZA 3FE6A 2LUXA 1DGUA 1JWDA 1RECA 3JTDB 2K2AA 1IH0A 1YUSA 1B7TY 2PYQA 2Q91A 1XFVO 3TDZA 5ER4X 3R1VA 4MSPA 4PHNA 1SNLA 2JRFA 2LLUA 2CT9A 4CFRA 1KCYA 4HREE 4QJ3B 1KQMC 2CXJA 4M2PA 2G9BA 5AXIA 5I2QA 1QIWA 1XVJA 2LNKA 4FTGA 1LS8A 1BR1B 2JTTA 3O6BA 1WRLA 2HETA 2BCXA 2LAPA 1TWOA 1TNPA 3Q8IA 2WNDA 3CYZA 5ER5A 3V2LA 2KI6D 3CR2A 1KSMA 2F3YA 4WQ3A 1BJFA 1CLLA 1NCYA 4A4CA 1Z2CB 2KAYA 1NIWA 1TRFA 2JQ6A 1OOGA 1QV1A 2ZRSA 1OMDA 1ZACA 4PE0A 2GV5A 2CNPA 1F8HA 2LHLA 1Z4HA 1EG3A 2BL0C 2K7OA 2BAPA 2WCHA 3S0EA 1QVIY 2ISDA 1AJ4A 1BR4B 1TUZA 2HQ8A 4HRGA 4M2OA 1RJVA 4GGFA 3FE8A 4PALA 2WCFA 3L4AA 3RM1A 3B6XA 1KWOB 3I5GB 1AP4A 4DUQA 1JFKA 1SL9A 1WY9A 1DJIA 2QEHA 1SR6B 1EJ3A 2K7BA 1OE9B 3DD4A 3N7HA 3CZ2A 4GBAA 1H8BA 5F6TA 2MA2A 3NHIA 4UPGA 1X02A 1QJTA 1CLMA 1J7QA 1N65A 3PM2A 3BYAA 3DVMA 1K90D 2BECA 3EKHA 3KF9A 1DJHA 3AAKA 4XYNA 4WRIA 2LVJA 4ORBB 3SS5A 2WC6A 3WHTB 2KGBC 2BKIB 2E30A 1L7ZA 1DJYA 3O2PA 1FI5A 1AHRA 1OOHA 3CGAA 1B4CA 1EG4A 1UHNA 1KFXL 3PN7B 1YUUA 2JU0A 3DYEA 2L2CA 5I94A 5KU1A 2K60A 1WRKA 1LA3A 1N0YA 1OOIX 1SMGA 3CWGA 3D10A 4PE4A 1H4BA 3FIAA 1EXRA 3M0WA 3A4UB 2WCMA 1XYDA 2V53A 2JTZA 1V1GA 1S5GZ 3DZTA 3PLFB 2R2IA 3O78A 2K8MB 2MAZA 1NSHA 1SBJA 1TNWA 4CLNA 1JC2A 5CSFA 1G4YR 3O4YA 4NQGA 2LMUA 1G8IA 2YGUA 3OHMB 1DEKA 5G08A 5KTYA 2I18A 2KI4B 3ICBA 1OZSA 4MZLA 3PFVA 1GM0A 3DF0B 3NSIA 2M97A 1SSEB 3VRPA 3WNXB 3PATA 1NPQA 3CTNA 1B47A 1BU3A 2SCPA 1PK0D 3B88A 1E8AA 2PASA 3TS5C 1CNPA 4XJKA 2PVBA 1A2XA 4INWA 4YGAA 5I2LA 3VRQA 3NSKA 4PE7A 1S3PA 3VRNA 1SY9A 1SKTA 1MWNA 2M29A 4MVFA 1UURA 3NSOA 1B8RA 2JT0A
chains in the Genus database with same CATH topology
2PQLA 1LS8A 5EL2A 2QEVA 3BFBA 3D73A 1TWOA 3Q8IA 3CYZA 2WCKA 3V2LA 4INXA 1ORGA 3D75A 1C3ZA 3K1EA 1OOGA 3L4LA 2JPOA 3D78A 2P71A 3BFHA 1OOFA 2ERBA 1P28A 2WCHA 3S0EA 2FJYA 2KPHA 4OZDA 3CDNA 1XFRA 3VB1A 1T14A 3FE9A 3FE8A 3L4AA 3B6XA 2H8VA 2WC5A 3OGNA 2QEHA 2WCJA 3B7AA 5DICA 1C3YA 2QEOA 3N7HA 3DXLA 3CZ2A 3NHIA 3CABA 3D77A 4JD9A 3CZ1A 3S0GA 3NHTA 2QDIA 3BFAA 3R1OA 4FQTA 3B86A 2WCLA 1QWVA 2WC6A 1OOHA 3S0DA 4F7FA 3BJHA 3QMEA 3DYEA 1TUJA 2L2CA 3NGVA 1OOIX 3S0FA 3R1PA 2WCMA 3PJIA 3DZTA 3S0AA 3B87A 3D74A 1OW4A 1DQEA 2GTEA 2QEBA 3CZ0A 3D76A 3RZSA 3S0BA 3R72A 4PT1A 3FE6A 1GM0A 3B88A 3R1VA 4INWA 3L47A 2P70A 3DY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQL A;  1LS8 A;  5EL2 A;  2QEV A;  3BFB A;  3D73 A;  1TWO A;  3Q8I A;  3CYZ A;  2WCK A;  3V2L A;  4INX A;  1ORG A;  3D75 A;  1C3Z A;  3K1E A;  1OOG A;  3L4L A;  2JPO A;  3D78 A;  2P71 A;  3BFH A;  1OOF A;  2ERB A;  1P28 A;  2WCH A;  3S0E A;  2FJY A;  2KPH A;  4OZD A;  3CDN A;  1XFR A;  3VB1 A;  1T14 A;  3FE9 A;  3FE8 A;  3L4A A;  3B6X A;  2H8V A;  2WC5 A;  3OGN A;  2QEH A;  2WCJ A;  3B7A A;  5DIC A;  1C3Y A;  2QEO A;  3N7H A;  3DXL A;  3CZ2 A;  3NHI A;  3CAB A;  3D77 A;  4JD9 A;  3CZ1 A;  3S0G A;  3NHT A;  2QDI A;  3BFA A;  3R1O A;  4FQT A;  3B86 A;  2WCL A;  1QWV A;  2WC6 A;  1OOH A;  3S0D A;  4F7F A;  3BJH A;  3QME A;  3DYE A;  1TUJ A;  2L2C A;  3NGV A;  1OOI X;  3S0F A;  3R1P A;  2WCM A;  3PJI A;  3DZT A;  3S0A A;  3B87 A;  3D74 A;  1OW4 A;  1DQE A;  2GTE A;  2QEB A;  3CZ0 A;  3D76 A;  3RZS A;  3S0B A;  3R72 A;  4PT1 A;  3FE6 A;  1GM0 A;  3B88 A;  3R1V A;  4INW A;  3L47 A;  2P70 A;  3DY9 A; 
#chains in the Genus database with same CATH topology
 5J3X A;  1C07 A;  1YRU B;  2M7L A;  4NDD A;  2L5Y A;  1QLK A;  1XO5 A;  5DKN A;  4C0K A;  1Y1U A;  1M63 B;  1J1E A;  2QEV A;  3EK4 A;  4YBH B;  4YGB B;  1F55 A;  2ZKM X;  1SCV A;  3VRO A;  3UO9 A;  1KK8 B;  1A4P A;  2NLN A;  2OTG B;  1IJ6 A;  1DJZ A;  4INX A;  4JQ0 D;  2WOS A;  1NUB A;  1QV0 A;  1SL7 A;  3IF7 A;  3TUY B;  3EK8 A;  3OX5 A;  1KK7 Y;  4MRY A;  1CTR A;  1DVI A;  3BUX B;  3K1E A;  5K89 A;  4IL1 A;  2COL B;  4BY4 A;  2F2O A;  3L4L A;  2Y4Q A;  2KFF A;  1GQM A;  1XFZ O;  4HSZ A;  2LAN A;  1J7P A;  2NXQ A;  1W9Z A;  3D78 A;  1JF0 A;  1XK4 C;  1FBV A;  2JWW A;  1MF8 B;  1KFU L;  4MN0 A;  3OB2 B;  1IG5 A;  2I7A A;  5CSN A;  2F8P A;  1FF1 A;  2HQW A;  2MLF C;  3NXA A;  2LLT A;  5HKW A;  1CKK A;  4U8D A;  1DF0 A;  1MUX A;  1DF0 B;  4A4B A;  1ZFS A;  1XFR A;  3CDN A;  2JT3 A;  2ZND A;  3FE9 A;  4PDZ A;  5AEQ A;  2LM5 A;  4YRU A;  4I5J A;  2BCA A;  2H8V A;  1FPW A;  2WOR A;  1XFU O;  2E6W A;  3OGN A;  1YR5 A;  3B7A A;  1UHH A;  1DJG A;  3HX4 A;  1SCM B;  2QEO A;  2ZN9 A;  1QX5 B;  1SW8 A;  2OPO A;  2F3Z A;  3I5F B;  3UNW A;  1NX2 A;  1NP8 A;  1YX7 A;  3CAB A;  3JVT C;  4ZCV A;  2KDH A;  1DGV A;  1LVC D;  1B9A A;  2H2K A;  2M8U A;  2O60 A;  2QAC A;  4CFQ A;  1WLZ A;  5FI7 A;  1SL8 A;  1FW4 A;  1QAT A;  2JXC A;  3I5H B;  1CDN A;  2NCP A;  3AAJ A;  3LLE A;  1QWV A;  1YUT A;  1M39 A;  4GGN A;  4ZCU A;  3AKA A;  1DMO A;  2JOJ A;  5BPJ A;  2M9G A;  1D1O A;  1CB1 A;  1YTZ C;  1CDM A;  1QXP A;  1M46 A;  2Y5I A;  4F7F A;  4BY5 A;  1QAS A;  4OKH A;  1PUL A;  1R6P A;  1UHI A;  2I94 A;  3PN7 C;  5FI2 A;  1Y0V H;  4N5X A;  1C7V A;  3NGV A;  2EC6 B;  1NX1 A;  3S0F A;  1YX8 A;  1UUS A;  2BBM A;  4YGD B;  1CDP A;  2GGZ A;  2CTN A;  1IJ5 A;  4M2Q A;  1KQM B;  1L2O C;  2KHN A;  4IJ7 A;  5CSI A;  1A03 A;  5AER A;  1IRJ A;  3EVV A;  4GFT A;  4TNC A;  1EH2 A;  1IWQ A;  1JBA A;  3FWB A;  1IIO A;  1QX7 A;  5IBW A;  5I2O A;  3KHE A;  4ICB A;  3AKB A;  3TZ1 A;  2MLE C;  1K94 A;  1A29 A;  1DJX A;  1RFJ A;  2P6B B;  3LL8 B;  1WDC C;  3SG4 A;  1K96 A;  4GNK B;  2M0R A;  4NDB A;  2KI4 C;  4MEW A;  1ALW A;  1V1F A;  1S1E A;  4OVN F;  2K7C A;  3CLN A;  1ODB A;  1XFY O;  3DVK A;  1K8U A;  2OS8 B;  3GK4 X;  1CFF A;  2SAS A;  1B7T Z;  4N1F A;  4KYN A;  4PHJ A;  2BL0 B;  2KFG A;  1WRZ A;  1Y1X A;  2BCB A;  2M49 B;  1TCO B;  1B8C A;  2KOT A;  1GGW A;  5B8I B;  3GK2 A;  4I5N B;  1DEL A;  1GJY A;  5I8N A;  3EKJ A;  4N1G A;  3O4X A;  3PM8 A;  1MXL C;  2Y1M A;  2HPS A;  4GAO A;  2AMI A;  2L0P A;  2MRD A;  4AQJ A;  1IKU A;  1CM1 A;  1PSB A;  3I5I C;  5D69 A;  1M45 A;  4NDC A;  1TN4 A;  2KYC A;  1ORG A;  2O5G A;  2K61 A;  1K9P A;  2CBL A;  1W7J B;  2BKH B;  3TUY C;  3FS7 A;  3JTD C;  4D1E A;  1CMF A;  1J55 A;  2H61 A;  3EVR A;  3ZNI A;  1MXE A;  1S6J A;  3RLZ A;  4XJK B;  1AJ5 A;  2MBX A;  1CFC A;  3BFH A;  1OOF A;  2ERB A;  1P28 A;  5AAN A;  2MHH A;  3TDI A;  1YVL A;  1ZUZ A;  2FJY A;  2Y1N A;  4CPV A;  2IS9 A;  4PCW A;  1NWD A;  1Q80 A;  2BBN A;  2G2B A;  3NSL A;  4MRX A;  1QVI Z;  2LE9 B;  4P2Y B;  2KAV A;  1C7W A;  1GGZ A;  1SK6 D;  1CM4 A;  1RRO A;  1XFW O;  2ZFD A;  3PSR A;  5HKY A;  2M3W A;  3LCP C;  1UHK A;  4P5O E;  3VB1 A;  2PRU A;  4ORA B;  3VRR A;  1QS7 A;  1ALV A;  1A75 A;  2LCP A;  2A4J A;  1A75 B;  2M1K B;  4QJ4 B;  1KSO A;  4GPL B;  4PHM A;  1LKJ A;  1G33 A;  5DIC A;  2WCJ A;  5JJG A;  2NCO A;  1OQP A;  2KI6 C;  1IQ3 A;  1SCM C;  2HF5 A;  3DXL A;  2JZI A;  5HLV A;  1OSA A;  2WC8 A;  4L9M A;  2LC5 A;  3SG3 A;  3H4S E;  3VGO A;  2VRG A;  2D8N A;  3LK1 A;  1YRT B;  2NZ0 A;  2L50 A;  3KEV A;  1QIV A;  1ZMZ A;  1JFJ A;  3BQ3 A;  2FOT A;  4FQT A;  4C0L A;  1CFP A;  1CLB A;  2LP2 A;  2AAO A;  3OBV A;  1OMR A;  4DS7 A;  2WCL A;  3DVJ A;  3OB1 B;  3EG5 B;  3SIA A;  1CFD A;  3LK0 A;  2FCD A;  3S0D A;  5JOL A;  1DT7 B;  3TS5 B;  1S6I A;  3BJH A;  4GGF C;  4ETO A;  3DVE A;  1F4O A;  2K7D A;  2LVK A;  5KSZ A;  4CID A;  3QRX A;  1BF5 A;  1KWO C;  3I5G C;  1S5G Y;  3R1P A;  2BE6 A;  2EC6 C;  4I5L B;  1JUO A;  1Y1A A;  3BOW A;  1SR6 C;  4PHK A;  3SIB A;  1K95 A;  2EGD A;  1LA0 A;  2Q4U A;  2ZNE A;  3BOW B;  3PJI A;  4MBE A;  1PRW A;  1EL4 A;  1QX2 A;  2LVI A;  1BLQ A;  5D3O A;  4OCI A;  4AOM A;  2F2P A;  3CR5 X;  5FYX A;  2LHI A;  1OW4 A;  1DQE A;  2KLE A;  4PE1 A;  1B1G A;  2QEB A;  4F0Z B;  1SPY A;  2K2F A;  2M1U A;  3MSE B;  3RZS A;  2JT8 A;  3R72 A;  2LLS A;  5DKR A;  2L4I A;  4PT1 A;  2L5X B;  1B8L A;  1TTX A;  1TOP A;  3IQQ A;  5FI6 A;  4DCK A;  4OR9 B;  1UWO A;  2LMT A;  2K0J A;  1S6C A;  2KQY A;  2QPT A;  4JPZ B;  1XK4 A;  2JXL A;  2OS8 C;  3KPX A;  3GK1 A;  1R2U A;  1S26 D;  3L47 A;  4MZJ A;  4R1E A;  4DRW A;  3C1V A;  2P70 A;  3DY9 A;  1N2D A;  3BUN B;  2PQL A;  1NX3 A;  1QTX A;  5HLO A;  5EL2 A;  4YI9 A;  3BFB A;  5CSJ A;  3BUW B;  2KAX A;  1K93 D;  2I2R E;  3F45 A;  3D73 A;  5HL1 A;  2JC2 A;  3OX6 A;  3SS3 A;  4OV2 A;  1IQ5 A;  4E68 A;  3SS4 A;  2KFH A;  3BUM B;  2JNX A;  5CPV A;  1CMG A;  2WCK A;  2WCE A;  1CDL A;  1PVB A;  2LMV A;  5AFP A;  2KQ6 A;  3D75 A;  1UP5 A;  1C3Z A;  1TNQ A;  3CS1 A;  4MZK A;  4YGC B;  2EHB A;  1LXF C;  1KK7 Z;  1PVA A;  2H61 C;  2JPO A;  3D0Y A;  3JVT B;  1OOJ A;  2P71 A;  2KYF A;  1TNX A;  2KBM A;  3GOF A;  2LV7 A;  3D0Y B;  1HT9 A;  4YI8 A;  1KFX S;  2GGM A;  5HKZ A;  1LIN A;  1AK8 A;  2BE4 A;  1S36 A;  4DIR A;  1SYM A;  1J7R A;  1F4Q A;  3ZWH A;  2KPH A;  2L98 A;  1YUR A;  1J7O A;  4OZD A;  2PMY A;  1BOC A;  1M31 A;  1RTP 1;  2L51 A;  5DKQ A;  1DJW A;  1PAL A;  2FCE A;  1IGV A;  1NCZ A;  1K9U A;  2ZN8 A;  3WHU B;  1JSA A;  1KK8 C;  3PAL A;  4FQO A;  1JF2 A;  1T14 A;  2JUL A;  1YVH A;  2OTG C;  1W7I B;  4USL A;  2L4H A;  1XA5 A;  4HRH A;  3SG5 A;  2F33 A;  2FJU B;  1BOD A;  1MHO A;  4AQI A;  2KNE A;  1BT6 A;  2WC5 A;  3CZT X;  1UHJ A;  2PAL A;  4I5K A;  1C3Y A;  1L2O B;  1RWY A;  3OP0 A;  1Y6W A;  1MQ1 A;  1OMV A;  2BNX A;  3TDU A;  1ZOT B;  1RK9 A;  4GUK A;  1NX0 A;  4Q04 A;  5HYD A;  1XFX O;  2B1U A;  2KGR A;  3D77 A;  4JD9 A;  3CZ1 A;  3IQO A;  3CR4 X;  3S0G A;  1U5I A;  2QDI A;  3NHT A;  4WQ2 A;  3WXA A;  1NCX A;  1U5I B;  3BFA A;  3FWC A;  3R1O A;  1K2H A;  1OZO A;  1WLM A;  3A8R A;  3B86 A;  1WDC B;  4MLW A;  5D7F A;  3BXK A;  3DF0 A;  1AVS A;  4QJ5 B;  2M7N A;  1F54 A;  3SG7 A;  1DTL A;  3EVU A;  4JKT A;  1DC1 A;  2ZRT A;  2WCB A;  2JNF A;  2JPT A;  1NYA A;  3HCM A;  3K21 A;  1FI6 A;  1K9K A;  3QME A;  1SRA A;  1TCF A;  2KLD A;  1TUJ A;  3EK7 A;  1KQV A;  1J1D A;  5TNC A;  1BMO A;  4JWQ A;  1F71 A;  4ORC B;  2LUC A;  2KSP A;  3SJS A;  1MR8 A;  4YGE B;  5PAL A;  3S0A A;  2CCM A;  3I5F C;  2PSR A;  3B87 A;  4C0J A;  2L2E A;  2RGI A;  3D74 A;  1F70 A;  2GTE A;  5GQQ C;  3KO0 A;  3SG6 A;  1BG1 A;  1HQV A;  2TN4 A;  3CZ0 A;  1AUI B;  2AUC A;  3D76 A;  1PSR A;  3I5H C;  3IVT A;  3S0B A;  1VRK A;  3BUO B;  1KFU S;  1QLS A;  2LVV A;  3I5I B;  3E3R A;  2DOQ A;  3SG2 A;  2LP3 A;  2MJW B;  2KBI A;  1TIZ A;  3FE6 A;  2LUX A;  1DGU A;  1JWD A;  1REC A;  3JTD B;  2K2A A;  1IH0 A;  1YUS A;  1B7T Y;  2PYQ A;  2Q91 A;  1XFV O;  3TDZ A;  5ER4 X;  3R1V A;  4MSP A;  4PHN A;  1SNL A;  2JRF A;  2LLU A;  2CT9 A;  4CFR A;  1KCY A;  4HRE E;  4QJ3 B;  1KQM C;  2CXJ A;  4M2P A;  2G9B A;  5AXI A;  5I2Q A;  1QIW A;  1XVJ A;  2LNK A;  4FTG A;  1LS8 A;  1BR1 B;  2JTT A;  3O6B A;  1WRL A;  2HET A;  2BCX A;  2LAP A;  1TWO A;  1TNP A;  3Q8I A;  2WND A;  3CYZ A;  5ER5 A;  3V2L A;  2KI6 D;  3CR2 A;  1KSM A;  2F3Y A;  4WQ3 A;  1BJF A;  1CLL A;  1NCY A;  4A4C A;  1Z2C B;  2KAY A;  1NIW A;  1TRF A;  2JQ6 A;  1OOG A;  1QV1 A;  2ZRS A;  1OMD A;  1ZAC A;  4PE0 A;  2GV5 A;  2CNP A;  1F8H A;  2LHL A;  1Z4H A;  1EG3 A;  2BL0 C;  2K7O A;  2BAP A;  2WCH A;  3S0E A;  1QVI Y;  2ISD A;  1AJ4 A;  1BR4 B;  1TUZ A;  2HQ8 A;  4HRG A;  4M2O A;  1RJV A;  4GGF A;  3FE8 A;  4PAL A;  2WCF A;  3L4A A;  3RM1 A;  3B6X A;  1KWO B;  3I5G B;  1AP4 A;  4DUQ A;  1JFK A;  1SL9 A;  1WY9 A;  1DJI A;  2QEH A;  1SR6 B;  1EJ3 A;  2K7B A;  1OE9 B;  3DD4 A;  3N7H A;  3CZ2 A;  4GBA A;  1H8B A;  5F6T A;  2MA2 A;  3NHI A;  4UPG A;  1X02 A;  1QJT A;  1CLM A;  1J7Q A;  1N65 A;  3PM2 A;  3BYA A;  3DVM A;  1K90 D;  2BEC A;  3EKH A;  3KF9 A;  1DJH A;  3AAK A;  4XYN A;  4WRI A;  2LVJ A;  4ORB B;  3SS5 A;  2WC6 A;  3WHT B;  2KGB C;  2BKI B;  2E30 A;  1L7Z A;  1DJY A;  3O2P A;  1FI5 A;  1AHR A;  1OOH A;  3CGA A;  1B4C A;  1EG4 A;  1UHN A;  1KFX L;  3PN7 B;  1YUU A;  2JU0 A;  3DYE A;  2L2C A;  5I94 A;  5KU1 A;  2K60 A;  1WRK A;  1LA3 A;  1N0Y A;  1OOI X;  1SMG A;  3CWG A;  3D10 A;  4PE4 A;  1H4B A;  3FIA A;  1EXR A;  3M0W A;  3A4U B;  2WCM A;  1XYD A;  2V53 A;  2JTZ A;  1V1G A;  1S5G Z;  3DZT A;  3PLF B;  2R2I A;  3O78 A;  2K8M B;  2MAZ A;  1NSH A;  1SBJ A;  1TNW A;  4CLN A;  1JC2 A;  5CSF A;  1G4Y R;  3O4Y A;  4NQG A;  2LMU A;  1G8I A;  2YGU A;  3OHM B;  1DEK A;  5G08 A;  5KTY A;  2I18 A;  2KI4 B;  3ICB A;  1OZS A;  4MZL A;  3PFV A;  1GM0 A;  3DF0 B;  3NSI A;  2M97 A;  1SSE B;  3VRP A;  3WNX B;  3PAT A;  1NPQ A;  3CTN A;  1B47 A;  1BU3 A;  2SCP A;  1PK0 D;  3B88 A;  1E8A A;  2PAS A;  3TS5 C;  1CNP A;  4XJK A;  2PVB A;  1A2X A;  4INW A;  4YGA A;  5I2L A;  3VRQ A;  3NSK A;  4PE7 A;  1S3P A;  3VRN A;  1SY9 A;  1SKT A;  1MWN A;  2M29 A;  4MVF A;  1UUR A;  3NSO A;  1B8R A;  2JT0 A; 
#chains in the Genus database with same CATH homology
 2PQL A;  1LS8 A;  5EL2 A;  2QEV A;  3BFB A;  3D73 A;  1TWO A;  3Q8I A;  3CYZ A;  2WCK A;  3V2L A;  4INX A;  1ORG A;  3D75 A;  1C3Z A;  3K1E A;  1OOG A;  3L4L A;  2JPO A;  3D78 A;  2P71 A;  3BFH A;  1OOF A;  2ERB A;  1P28 A;  2WCH A;  3S0E A;  2FJY A;  2KPH A;  4OZD A;  3CDN A;  1XFR A;  3VB1 A;  1T14 A;  3FE9 A;  3FE8 A;  3L4A A;  3B6X A;  2H8V A;  2WC5 A;  3OGN A;  2QEH A;  2WCJ A;  3B7A A;  5DIC A;  1C3Y A;  2QEO A;  3N7H A;  3DXL A;  3CZ2 A;  3NHI A;  3CAB A;  3D77 A;  4JD9 A;  3CZ1 A;  3S0G A;  3NHT A;  2QDI A;  3BFA A;  3R1O A;  4FQT A;  3B86 A;  2WCL A;  1QWV A;  2WC6 A;  1OOH A;  3S0D A;  4F7F A;  3BJH A;  3QME A;  3DYE A;  1TUJ A;  2L2C A;  3NGV A;  1OOI X;  3S0F A;  3R1P A;  2WCM A;  3PJI A;  3DZT A;  3S0A A;  3B87 A;  3D74 A;  1OW4 A;  1DQE A;  2GTE A;  2QEB A;  3CZ0 A;  3D76 A;  3RZS A;  3S0B A;  3R72 A;  4PT1 A;  3FE6 A;  1GM0 A;  3B88 A;  3R1V A;  4INW A;  3L47 A;  2P70 A;  3DY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...