1LA3A

Solution structure of recoverin mutant, e85q
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
188
structure length
188
Chain Sequence
b'GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKQYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Structure and calcium-binding studies of a recoverin mutant (E85Q) in an allosteric intermediate state.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 37
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2002-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1la3A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1la3A01
1TCFA 4YRUA 3KO0A 1YRTB 1J7PA 3JTDB 2WNDA 2JTTA 1KFXS 2D8NA 1J55A 2JT3A 4ZCUA 3A4UB 1QVIZ 4YGDB 3A8RA 1IQ5A 2AAOA 5GQQC 4C0JA 1DJHA 2JRFA 1B8RA 2LHIA 1L2OB 2JULA 2Y1MA 3NSKA 3O4YA 2F8PA 3PN7C 4P5OE 5CSFA 4YGCB 4MBEA 3PFVA 1PALA 2KHNA 2K2FA 1NCXA 2K7DA 2KI4C 4MZKA 4OV2A 2K2AA 4GNKB 2MLEC 1CFDA 4GPLB 5HLOA 1XVJA 2F2OA 5CSIA 2LNKA 4GFTA 2JXCA 4P2YB 1DJYA 4JWQA 4AQIA 1C7WA 1DF0A 1S6IA 2LLTA 4YI8A 1H4BA 2M97A 1SR6B 2I2RE 2KQ6A 2BKIB 1J7OA 1TNWA 1KK7Y 4USLA 1QX7A 1ZACA 2L98A 2JOJA 4N5XA 5JJGA 1MXLC 1K9UA 2L50A 2PRUA 5D7FA 4GGFC 2LVIA 3BOWB 1BLQA 1YURA 4HREE 3DF0A 2KBMA 2LMVA 1CKKA 1J7QA 2MRDA 3CR4X 1IG5A 2KI4B 1QLKA 1WY9A 2QACA 1XFXO 1M31A 2ZKMX 1B9AA 3TDUA 1DJIA 2BBMA 2CT9A 3EK8A 2M49B 2K7OA 1RROA 3RM1A 5I2OA 1JFKA 2K0JA 1TRFA 3AAKA 1S5GZ 2COLB 4ETOA 2K61A 5CSNA 4QJ5B 1TN4A 4AOMA 1IRJA 4C0KA 3BUOB 1KK8B 1SKTA 2BE4A 4M2PA 2M7LA 3SG2A 1EG4A 4PCWA 1NCZA 1M46A 1WRLA 5AEQA 1FI6A 3BUMB 1B4CA 1F8HA 1E8AA 1XFVO 1SY9A 5AANA 4DIRA 1FI5A 2OS8B 1RWYA 2KOTA 1J1DA 2M9GA 2MA2A 1LVCD 4TNCA 4UPGA 3IQOA 1SL7A 2V53A 4ICBA 1S5GY 1IQ3A 1CB1A 1N2DA 2AMIA 3I5FB 2E6WA 3ZNIA 5HKZA 1OMDA 2WCEA 5CSJA 4AQJA 2WCFA 3TDZA 3VRQA 3HX4A 4YI9A 2WC8A 3OB2B 5PALA 1V1FA 1OOJA 3KF9A 4MLWA 5DKRA 1MF8B 2LLSA 1Y1UA 2KDHA 3D0YA 3WHUB 5JOLA 2G2BA 2JTZA 3FS7A 2CCMA 2F3ZA 2KFGA 4MZLA 2BE6A 4PHNA 1MR8A 1DF0B 2MAZA 2GGMA 3GK2A 5HYDA 1SYMA 5AXIA 3QRXA 2FCEA 1JSAA 2JZIA 2KGRA 1SBJA 2BCBA 2BCXA 1BR1B 1AJ5A 1XO5A 2Y5IA 3GOFA 4HRGA 1IKUA 2LV7A 1KQVA 2A4JA 3I5IC 4MSPA 1B47A 1Y0VH 3NSOA 2NZ0A 1HT9A 1KWOB 1W7IB 3TDIA 1RJVA 3BXKA 1QTXA 3DF0B 3MSEB 2LVJA 4E68A 1B7TZ 1G8IA 2R2IA 3CR5X 5IBWA 1QV1A 3C1VA 3LLEA 4HSZA 3IF7A 2L4HA 3OP0A 4NQGA 1LA0A 1CFPA 2M7NA 2NCPA 5KU1A 1BR4B 1DT7B 2EC6C 3RLZA 1CLBA 2KAXA 1CTRA 1KSOA 1JC2A 3SJSA 3HCMA 2JC2A 3TS5B 2KYFA 2ZNDA 2CNPA 1CFFA 2LAPA 2F2PA 5TNCA 1C7VA 1TOPA 4N1FA 2M8UA 4I5LB 1AHRA 1CMFA 1TIZA 4MN0A 2IS9A 3VGOA 4OCIA 1DVIA 2LP2A 2CTNA 3I5IB 1OSAA 1CNPA 1A4PA 3M0WA 2QPTA 5G08A 1K95A 1QVIY 3EVVA 4F0ZB 4GAOA 1RECA 2NLNA 3D10A 4I5JA 1F4OA 1YX7A 1EG3A 1M45A 1QXPA 1QIVA 2SASA 2KI6C 2WCBA 3KPXA 1K8UA 3FWCA 3EKHA 4YBHB 1K94A 3H4SE 3OB1B 3PLFB 3AKBA 1SCMC 1S1EA 1NX1A 2KI6D 2ZN9A 1EL4A 2LVKA 1Y1AA 1YRUB 1YX8A 2FJUB 2WORA 1A03A 2CBLA 3PN7B 2FCDA 2HF5A 3D0YB 1V1GA 1L7ZA 4QJ4B 2LP3A 3DVEA 4BY4A 1S3PA 2LM5A 1TNXA 1TNQA 3O6BA 5I8NA 4FTGA 2H61A 2LVVA 3EK4A 3JVTC 4PALA 1QASA 1QLSA 4HRHA 4CFQA 2Y1NA 1QATA 1M39A 3EVUA 4DUQA 1GGWA 1JBAA 1IJ6A 3I5GC 1FW4A 1UHHA 2LE9B 3LL8B 1KFXL 2E30A 2PSRA 1N65A 4MRXA 1DJZA 2F3YA 1WLMA 4M2OA 4U8DA 1A75A 3VRPA 1CMGA 1SCMB 2NCOA 1X02A 1NP8A 5DKQA 4PE0A 4PE1A 5FYXA 2B1UA 1QV0A 4C0LA 4D1EA 4XJKB 1EH2A 4MRYA 2I18A 3EK7A 5HKYA 5KTYA 1OMRA 1YUSA 1K2HA 3TZ1A 3LK1A 4Q04A 2M0RA 1DTLA 1UUSA 3OHMB 1BODA 5AERA 3OX5A 2M1UA 5J3XA 1XK4A 1WLZA 1S6CA 1SK6D 5DKNA 4CIDA 1ZOTB 2LUCA 3EVRA 3PSRA 1H8BA 1PVAA 1ZFSA 2F33A 4BY5A 5K89A 3I5GB 3TUYC 2HQ8A 3ICBA 4JQ0D 1K96A 2H61C 1AUIB 5AFPA 2GV5A 2WOSA 4M2QA 1JF0A 1Y6WA 2NXQA 1YR5A 1RK9A 2JQ6A 2LC5A 1Q80A 5ER4X 4DCKA 1WRZA 4IL1A 4PHJA 1SW8A 2HQWA 4PDZA 4L9MA 1JWDA 1B8LA 1MUXA 1PVBA 2JNFA 2O5GA 1OQPA 2HETA 3WNXB 1LA3A 2BL0C 2JT8A 1OMVA 3SG3A 2K8MB 1NX3A 4GBAA 4DS7A 1HQVA 2ZRTA 4R1EA 4PHMA 1M63B 1PK0D 4NDCA 2PMYA 1C07A 2K7CA 1S6JA 2PALA 3BUXB 4GGNA 1BT6A 2KBIA 1L2OC 1KSMA 4YGAA 1GJYA 1YTZC 2JT0A 2GGZA 1IH0A 2M3WA 2L5XB 1BJFA 1XK4C 2JNXA 2KFFA 1IGVA 3K21A 4ZCVA 2L0PA 2BCAA 1YUTA 2JWWA 1KCYA 5ER5A 5F6TA 1BMOA 1AK8A 2P6BB 1QIWA 1CFCA 1B7TY 1U5IA 3CS1A 3I5HC 1SL8A 3DD4A 1CLMA 1R6PA 3CLNA 2LLUA 1F71A 1UHIA 3OX6A 3SIAA 3AAJA 3WXAA 1SR6C 1JFJA 1DJWA 4WQ2A 2Q4UA 2LANA 3CGAA 1AJ4A 3O78A 1A29A 1CDMA 4ORCB 1LXFC 1CM4A 1NIWA 1BF5A 1XFUO 3LCPC 3E3RA 1NSHA 1AP4A 1QJTA 1FF1A 4PE4A 1UURA 2OPOA 1K9KA 1KFUS 1YVLA 1NX0A 2OTGC 1XA5A 1NX2A 2BECA 4DRWA 1EXRA 1PRWA 1K93D 2L51A 1QX2A 2EC6B 1KK7Z 1DJGA 1JF2A 2O60A 1NWDA 4ORAB 3CZTX 1XFZO 2HPSA 2KSPA 1UHJA 3PATA 4QJ3B 4MZJA 1ALWA 5CPVA 1NYAA 1TNPA 1UP5A 2MJWB 3BQ3A 3FWBA 2RGIA 2MBXA 1XFYO 1ZUZA 2MHHA 1QX5B 2JPTA 2Y4QA 3I5HB 3SG7A 1SPYA 1B1GA 4FQOA 3DVKA 2JU0A 3VROA 1KQMC 4MEWA 3WHTB 3SG4A 1KK8C 1OE9B 3BUWB 4NDDA 3KHEA 1A2XA 2KAVA 2KYCA 1LINA 1IJ5A 2M1KB 1SRAA 1CDLA 1VRKA 1WDCC 1UHNA 1QS7A 2OS8C 3KEVA 1K9PA 1RTP1 3F45A 2I94A 2OTGB 1BU3A 2LHLA 1OZOA 1GQMA 1TCOB 3I5FC 1NUBA 1S36A 4WQ3A 2LMUA 3CR2A 1G33A 1EJ3A 4N1GA 2BBNA 1NPQA 3GK1A 2BKHB 1LKJA 1Y1XA 2K7BA 2LMTA 2ZFDA 1YVHA 2KGBC 3O2PA 3NXAA 1KQMB 2ZN8A 2VRGA 1WRKA 1MHOA 3EKJA 1G4YR 2L2EA 4CPVA 1CDPA 3JVTB 2FOTA 4YGEB 1KFUL 5HKWA 2ZNEA 1U5IB 1AVSA 4OKHA 1RFJA 2ISDA 3SIBA 2LUXA 1WDCB 3DVMA 3VRNA 1DGVA 4A4CA 1CM1A 2AUCA 1PSBA 5KSZA 2KNEA 4XYNA 3NSIA 4PE7A 1N0YA 1NCYA 1S26D 1IWQA 1UWOA 2L4IA 2SCPA 1MXEA 2M29A 1OZSA 2TN4A 4A4BA 1F55A 2DOQA 3SG6A 2EHBA 1FPWA 2I7AA 4GUKA 1F54A 2PVBA 1W7JB 2KQYA 4OVNF 1B8CA 1KWOC 2LCPA 4OR9B 4ORBB 3PALA 2CXJA 4I5NB 1ODBA 3BYAA 3LK0A 4NDBA 1F70A 4WRIA 3AKAA 1SNLA 2ZRSA 1ALVA 1XYDA 2KAYA 1BG1A 3BOWA 1CDNA 3CWGA 2PASA 1MWNA 5I2QA 1SL9A 5D69A 4CLNA 1ZMZA 3JTDC 4YGBB 1FBVA 1TTXA 4JPZB 3ZWHA 1YUUA 1GGZA 3TUYB 4CFRA 1R2UA 1SCVA 1XFWO 2JXLA 3TS5C 5HLVA 1CLLA 1MQ1A 1J1EA 3PM8A 3VRRA 3DVJA 1PSRA 3IQQA 3SG5A 1JUOA 5I2LA 4MVFA 1DGUA 3FIAA 1D1OA 1PULA 2MLFC 2H2KA 1F4QA 3CTNA 1DMOA 1UHKA 1BOCA 3BUNB 1A75B 1K90D 2BL0B 1SMGA 2G9BA 3GK4X 3NSLA 4I5KA 4PHKA 4GGFA 1DJXA 2KFHA 2Q91A 2EGDA 5B8IB 4XJKA 5BPJA 1J7RA
chains in the Genus database with same CATH superfamily
1TCFA 4YRUA 3KO0A 1YRTB 2WC6A 2PYQA 3JTDB 2WNDA 1J7PA 2JTTA 2QEBA 1KFXS 2D8NA 1J55A 2JT3A 4ZCUA 1Z2CB 3A4UB 1QVIZ 4YGDB 3A8RA 1IQ5A 2AAOA 5GQQC 4C0JA 1DJHA 2JRFA 1B8RA 2LHIA 1L2OB 2JULA 2Y1MA 3NSKA 3NGVA 2F8PA 3O4YA 3PN7C 4P5OE 5CSFA 4YGCB 4MBEA 3PFVA 1PALA 2KHNA 2K2FA 1NCXA 2K7DA 2KI4C 4MZKA 4OV2A 2K2AA 4GNKB 2MLEC 1CFDA 4GPLB 5HLOA 3BJHA 1XVJA 2F2OA 5CSIA 2LNKA 4GFTA 2JXCA 4P2YB 1DJYA 1W9ZA 4JWQA 4AQIA 1C7WA 1DF0A 1S6IA 2LLTA 4YI8A 1H4BA 2M97A 1SR6B 2I2RE 2KQ6A 2BKIB 1J7OA 1TNWA 1KK7Y 4USLA 5FI2A 1QX7A 1ZACA 2L98A 3CYZA 2JOJA 4N5XA 5JJGA 1MXLC 1K9UA 2P70A 2L50A 2PRUA 3FE8A 3K1EA 2P71A 5D7FA 4GGFC 4F7FA 2ERBA 3D75A 2LVIA 3CABA 3BOWB 1BLQA 1YURA 4HREE 3DF0A 3SS5A 2KBMA 2LMVA 1CKKA 1J7QA 2MRDA 2K60A 3CR4X 1IG5A 4FQTA 2KI4B 1QLKA 1WY9A 3DZTA 2QACA 1XFXO 1M31A 2ZKMX 1B9AA 3TDUA 1DJIA 2BBMA 2CT9A 3EK8A 1OOGA 2M49B 2K7OA 4JD9A 1RROA 3RM1A 5I2OA 5HL1A 1JFKA 2K0JA 1TRFA 3AAKA 1S5GZ 2COLB 4ETOA 2K61A 5CSNA 4QJ5B 1TN4A 4AOMA 1IRJA 4C0KA 1OOHA 3BUOB 1KK8B 1SKTA 2BE4A 4M2PA 2M7LA 3SG2A 1EG4A 4PCWA 1NCZA 1M46A 3NHIA 1WRLA 3EG5B 5AEQA 3S0DA 3BUMB 1FI6A 1B4CA 1F8HA 1E8AA 1XFVO 1SY9A 5AANA 4DIRA 1FI5A 2OS8B 1RWYA 2KOTA 1J1DA 2M9GA 2MA2A 4PT1A 1LVCD 4TNCA 4UPGA 3IQOA 1SL7A 2V53A 4ICBA 1S5GY 1IQ3A 1CB1A 1N2DA 2AMIA 3I5FB 2E6WA 3ZNIA 5HKZA 1OMDA 2WCEA 5CSJA 1LS8A 4AQJA 2WCFA 4INWA 3TDZA 3VRQA 3HX4A 2FJYA 4YI9A 2WC8A 3OB2B 5PALA 3BFAA 3DYEA 1V1FA 1OOJA 3KF9A 4MLWA 5DKRA 1MF8B 2KLEA 2LLSA 1Y1UA 3OGNA 2KDHA 3D0YA 3WHUB 5JOLA 2G2BA 2JTZA 3D73A 2YGUA 2CCMA 2F3ZA 2KFGA 3FS7A 4MZLA 2BE6A 4PHNA 1MR8A 1DF0B 2MAZA 2GGMA 2WCMA 3GK2A 5HYDA 1SYMA 5AXIA 3QRXA 2FCEA 1JSAA 2JZIA 2KGRA 1SBJA 2BCXA 2BCBA 1OW4A 1BR1B 1AJ5A 1XO5A 2Y5IA 3GOFA 4HRGA 3L4AA 1IKUA 2LV7A 1KQVA 2A4JA 3I5IC 4MSPA 1B47A 1Y0VH 3NSOA 2NZ0A 1HT9A 1KWOB 1W7IB 3S0AA 3TDIA 1RJVA 3BXKA 1QTXA 3DF0B 3MSEB 2LVJA 4E68A 1B7TZ 1G8IA 2R2IA 3CR5X 5IBWA 1QV1A 3C1VA 3LLEA 4HSZA 3S0EA 3IF7A 2L4HA 3OP0A 4NQGA 1LA0A 1CFPA 2M7NA 2NCPA 5KU1A 1BR4B 1DT7B 2EC6C 3RLZA 1CLBA 2KAXA 1CTRA 1KSOA 1JC2A 3SJSA 3DY9A 3HCMA 2JC2A 3TS5B 2KYFA 2ZNDA 2CNPA 1CFFA 2LAPA 2F2PA 5TNCA 1C7VA 1TOPA 4N1FA 2M8UA 2WCHA 4I5LB 1AHRA 1CMFA 1TIZA 4MN0A 2IS9A 3VGOA 4OCIA 1DVIA 2LP2A 2CTNA 2WCLA 3I5IB 3B88A 3R1VA 1OSAA 1CNPA 3SS3A 1A4PA 3M0WA 2QPTA 5G08A 1K95A 1QVIY 3EVVA 4F0ZB 4GAOA 5EL2A 1RECA 2NLNA 3D10A 1C3YA 4I5JA 1F4OA 3L47A 4INXA 1YX7A 1EG3A 1M45A 1QXPA 1QIVA 2SASA 2KI6C 2WCBA 3KPXA 1K8UA 3FWCA 3EKHA 3CZ2A 3IVTA 4YBHB 1K94A 3H4SE 3OB1B 3PLFB 3AKBA 1SCMC 1S1EA 1NX1A 2KI6D 2BNXA 2ZN9A 1EL4A 2LVKA 1Y1AA 1YRUB 1YX8A 2FJUB 2WORA 1XFRA 1A03A 2CBLA 3PN7B 2FCDA 2HF5A 3D0YB 1V1GA 1L7ZA 4QJ4B 2GTEA 2LP3A 3B86A 3DVEA 4BY4A 2QEOA 1S3PA 2LM5A 1TNXA 4KYNA 1TNQA 3O6BA 5I8NA 3PJIA 4FTGA 2H61A 2LVVA 2WCKA 3EK4A 3JVTC 4PALA 3S0FA 1QASA 1QLSA 4HRHA 4CFQA 2Y1NA 1QATA 1M39A 3EVUA 5FI6A 3BFHA 4DUQA 1GGWA 1JBAA 2QEHA 1IJ6A 3I5GC 1FW4A 1UHHA 2LE9B 3LL8B 1KFXL 2E30A 2PSRA 1N65A 4MRXA 1DJZA 2F3YA 1WLMA 4M2OA 4U8DA 1A75A 3VRPA 1CMGA 1SCMB 2NCOA 1X02A 1NP8A 3S0GA 5DKQA 4PE0A 4PE1A 5FYXA 2JPOA 1Z4HA 1ORGA 2B1UA 1QV0A 4OZDA 2L2CA 4C0LA 3B6XA 4XJKB 4D1EA 1EH2A 4MRYA 2I18A 3EK7A 5HKYA 5KTYA 1OMRA 1YUSA 1K2HA 3TZ1A 3LK1A 4Q04A 2M0RA 1DTLA 1UUSA 4JKTA 3OHMB 1BODA 5AERA 3N7HA 3OX5A 2M1UA 5J3XA 1XK4A 1WLZA 1S6CA 1SK6D 5DKNA 4CIDA 1ZOTB 2LUCA 3EVRA 3PSRA 1H8BA 1PVAA 1ZFSA 3D77A 2F33A 4BY5A 5K89A 3I5GB 3TUYC 2HQ8A 3ICBA 4JQ0D 1K96A 2H61C 1AUIB 3NHTA 5AFPA 2GV5A 2WOSA 3OBVA 4M2QA 1JF0A 1Y6WA 2NXQA 1YR5A 1RK9A 2JQ6A 2LC5A 1Q80A 5ER4X 4DCKA 1WRZA 4IL1A 4PHJA 1DC1A 1SW8A 2HQWA 4PDZA 4L9MA 1JWDA 1B8LA 1MUXA 1PVBA 2JNFA 2O5GA 1OQPA 2HETA 3WNXB 1LA3A 2BL0C 2JT8A 1OMVA 3SG3A 2K8MB 1NX3A 4GBAA 4DS7A 1HQVA 2ZRTA 4R1EA 4PHMA 3CZ0A 1M63B 1PK0D 4NDCA 2PMYA 3D76A 3Q8IA 1C07A 1QWVA 2K7CA 3SS4A 1S6JA 2PALA 3BUXB 2KPHA 1BT6A 4GGNA 1IIOA 2KBIA 1L2OC 1KSMA 4YGAA 1GJYA 1YTZC 2JT0A 2GGZA 1IH0A 2M3WA 2L5XB 1BJFA 1XK4C 2JNXA 2KFFA 1IGVA 3K21A 4ZCVA 2L0PA 2BCAA 1YUTA 2JWWA 1KCYA 5ER5A 5F6TA 1BMOA 1AK8A 2P6BB 1QIWA 1CFCA 1B7TY 3L4LA 3CZ1A 1U5IA 3CS1A 3I5HC 1SL8A 3DD4A 1CLMA 1R6PA 3CLNA 2LLUA 1F71A 1UHIA 3OX6A 3R72A 3SIAA 3AAJA 3WXAA 1SR6C 3R1PA 2WCJA 1JFJA 1DJWA 4WQ2A 2Q4UA 2LANA 1DELA 1AJ4A 3CGAA 3DXLA 3O78A 1A29A 1CDMA 4ORCB 1DQEA 1DEKA 1CM4A 1LXFC 1NIWA 1OOIX 1BF5A 1XFUO 3LCPC 3E3RA 1NSHA 1AP4A 1QJTA 1FF1A 4PE4A 1UURA 2OPOA 1K9KA 1KFUS 1YVLA 1NX0A 3UO9A 2OTGC 1XA5A 1NX2A 2BECA 2QEVA 4DRWA 1EXRA 1PRWA 1K93D 2L51A 1QX2A 2EC6B 1KK7Z 1DJGA 1JF2A 2O60A 1NWDA 4ORAB 3CZTX 1XFZO 2HPSA 2KSPA 1UHJA 3PATA 4QJ3B 4MZJA 1ALWA 5CPVA 1NYAA 1TNPA 1UP5A 2MJWB 3BQ3A 3FWBA 2RGIA 2MBXA 1XFYO 1ZUZA 2MHHA 1QX5B 2JPTA 2Y4QA 3I5HB 3SG7A 1SPYA 1B1GA 4FQOA 3DVKA 2JU0A 3VROA 1KQMC 4MEWA 3WHTB 3SG4A 1KK8C 1OE9B 5FI7A 3BUWB 4NDDA 3KHEA 1A2XA 2KAVA 2KYCA 1P28A 3UNWA 1LINA 3R1OA 1IJ5A 2M1KB 1SRAA 1CDLA 1VRKA 1WDCC 5I94A 1UHNA 1QS7A 2OS8C 3KEVA 1K9PA 3CDNA 1RTP1 3F45A 2I94A 2OTGB 3D78A 3VB1A 1BU3A 2LHLA 1OZOA 1GQMA 1TCOB 3I5FC 1NUBA 3QMEA 1S36A 4WQ3A 2L5YA 2LMUA 3CR2A 1G33A 1TWOA 3B7AA 1EJ3A 4N1GA 2BBNA 1NPQA 3GK1A 2BKHB 1LKJA 5DICA 1Y1XA 2K7BA 2LMTA 2ZFDA 1YVHA 2KGBC 3O2PA 3NXAA 1KQMB 2KLDA 2ZN8A 2VRGA 1WRKA 1MHOA 3FE6A 3EKJA 1G4YR 2L2EA 4CPVA 1CDPA 3JVTB 1OOFA 2FOTA 1TUJA 1KFUL 4YGEB 5D3OA 2ZNEA 5HKWA 1U5IB 1AVSA 4OKHA 1RFJA 3S0BA 2ISDA 3SIBA 2LUXA 1WDCB 3DVMA 3VRNA 1DGVA 4A4CA 1CM1A 2AUCA 1PSBA 5KSZA 3RZSA 2KNEA 4XYNA 3NSIA 4PE7A 1N0YA 1NCYA 1S26D 1IWQA 1TUZA 1UWOA 3BFBA 3PM2A 2L4IA 2SCPA 1MXEA 2M29A 1OZSA 2TN4A 4A4BA 1F55A 2DOQA 3B87A 3SG6A 2EHBA 1FPWA 2I7AA 4GUKA 1F54A 2PVBA 1W7JB 2KQYA 4OVNF 1SSEB 1B8CA 1KWOC 2LCPA 4OR9B 4ORBB 3FE9A 3PALA 2CXJA 4I5NB 1ODBA 1C3ZA 2WC5A 3BYAA 3LK0A 4NDBA 1F70A 4WRIA 3AKAA 1SNLA 1T14A 2ZRSA 1ALVA 1XYDA 2KAYA 1BG1A 3BOWA 1CDNA 3CWGA 2PASA 1MWNA 5I2QA 1SL9A 5D69A 4CLNA 1ZMZA 3JTDC 4YGBB 1FBVA 1TTXA 3D74A 4JPZB 3ZWHA 1YUUA 1GGZA 3TUYB 4CFRA 1R2UA 2BAPA 1SCVA 1XFWO 2JXLA 3TS5C 5HLVA 1CLLA 1MQ1A 1J1EA 3O4XA 3PM8A 3VRRA 3DVJA 1PSRA 3IQQA 3SG5A 2H8VA 1JUOA 5I2LA 4MVFA 1DGUA 3FIAA 1D1OA 1PULA 2MLFC 2H2KA 2PQLA 1F4QA 3CTNA 1DMOA 1UHKA 1BOCA 3BUNB 1A75B 1GM0A 1K90D 2BL0B 1SMGA 2G9BA 3GK4X 3NSLA 4I5KA 4PHKA 4GGFA 1DJXA 2KFHA 2QDIA 2Q91A 2EGDA 5B8IB 4IJ7A 4XJKA 5BPJA 1J7RA 3V2LA
chains in the Genus database with same CATH topology
1TCFA 4YRUA 3KO0A 1YRTB 1J7PA 3JTDB 2WNDA 2JTTA 1KFXS 2D8NA 1J55A 2JT3A 4ZCUA 3A4UB 1QVIZ 4YGDB 3A8RA 1IQ5A 2AAOA 5GQQC 4C0JA 1DJHA 2JRFA 1B8RA 2LHIA 1L2OB 2JULA 2Y1MA 3NSKA 3O4YA 2F8PA 3PN7C 4P5OE 5CSFA 4YGCB 4MBEA 3PFVA 1PALA 2KHNA 2K2FA 1NCXA 2K7DA 2KI4C 4MZKA 4OV2A 2K2AA 4GNKB 2MLEC 1CFDA 4GPLB 5HLOA 1XVJA 2F2OA 5CSIA 2LNKA 4GFTA 2JXCA 4P2YB 1DJYA 4JWQA 4AQIA 1C7WA 1DF0A 1S6IA 2LLTA 4YI8A 1H4BA 2M97A 1SR6B 2I2RE 2KQ6A 2BKIB 1J7OA 1TNWA 1KK7Y 4USLA 1QX7A 1ZACA 2L98A 2JOJA 4N5XA 5JJGA 1MXLC 1K9UA 2L50A 2PRUA 5D7FA 4GGFC 2LVIA 3BOWB 1BLQA 1YURA 4HREE 3DF0A 2KBMA 2LMVA 1CKKA 1J7QA 2MRDA 3CR4X 1IG5A 2KI4B 1QLKA 1WY9A 2QACA 1XFXO 1M31A 2ZKMX 1B9AA 3TDUA 1DJIA 2BBMA 2CT9A 3EK8A 2M49B 2K7OA 1RROA 3RM1A 5I2OA 1JFKA 2K0JA 1TRFA 3AAKA 1S5GZ 2COLB 4ETOA 2K61A 5CSNA 4QJ5B 1TN4A 4AOMA 1IRJA 4C0KA 3BUOB 1KK8B 1SKTA 2BE4A 4M2PA 2M7LA 3SG2A 1EG4A 4PCWA 1NCZA 1M46A 1WRLA 5AEQA 1FI6A 3BUMB 1B4CA 1F8HA 1E8AA 1XFVO 1SY9A 5AANA 4DIRA 1FI5A 2OS8B 1RWYA 2KOTA 1J1DA 2M9GA 2MA2A 1LVCD 4TNCA 4UPGA 3IQOA 1SL7A 2V53A 4ICBA 1S5GY 1IQ3A 1CB1A 1N2DA 2AMIA 3I5FB 2E6WA 3ZNIA 5HKZA 1OMDA 2WCEA 5CSJA 4AQJA 2WCFA 3TDZA 3VRQA 3HX4A 4YI9A 2WC8A 3OB2B 5PALA 1V1FA 1OOJA 3KF9A 4MLWA 5DKRA 1MF8B 2LLSA 1Y1UA 2KDHA 3D0YA 3WHUB 5JOLA 2G2BA 2JTZA 3FS7A 2CCMA 2F3ZA 2KFGA 4MZLA 2BE6A 4PHNA 1MR8A 1DF0B 2MAZA 2GGMA 3GK2A 5HYDA 1SYMA 5AXIA 3QRXA 2FCEA 1JSAA 2JZIA 2KGRA 1SBJA 2BCBA 2BCXA 1BR1B 1AJ5A 1XO5A 2Y5IA 3GOFA 4HRGA 1IKUA 2LV7A 1KQVA 2A4JA 3I5IC 4MSPA 1B47A 1Y0VH 3NSOA 2NZ0A 1HT9A 1KWOB 1W7IB 3TDIA 1RJVA 3BXKA 1QTXA 3DF0B 3MSEB 2LVJA 4E68A 1B7TZ 1G8IA 2R2IA 3CR5X 5IBWA 1QV1A 3C1VA 3LLEA 4HSZA 3IF7A 2L4HA 3OP0A 4NQGA 1LA0A 1CFPA 2M7NA 2NCPA 5KU1A 1BR4B 1DT7B 2EC6C 3RLZA 1CLBA 2KAXA 1CTRA 1KSOA 1JC2A 3SJSA 3HCMA 2JC2A 3TS5B 2KYFA 2ZNDA 2CNPA 1CFFA 2LAPA 2F2PA 5TNCA 1C7VA 1TOPA 4N1FA 2M8UA 4I5LB 1AHRA 1CMFA 1TIZA 4MN0A 2IS9A 3VGOA 4OCIA 1DVIA 2LP2A 2CTNA 3I5IB 1OSAA 1CNPA 1A4PA 3M0WA 2QPTA 5G08A 1K95A 1QVIY 3EVVA 4F0ZB 4GAOA 1RECA 2NLNA 3D10A 4I5JA 1F4OA 1YX7A 1EG3A 1M45A 1QXPA 1QIVA 2SASA 2KI6C 2WCBA 3KPXA 1K8UA 3FWCA 3EKHA 4YBHB 1K94A 3H4SE 3OB1B 3PLFB 3AKBA 1SCMC 1S1EA 1NX1A 2KI6D 2ZN9A 1EL4A 2LVKA 1Y1AA 1YRUB 1YX8A 2FJUB 2WORA 1A03A 2CBLA 3PN7B 2FCDA 2HF5A 3D0YB 1V1GA 1L7ZA 4QJ4B 2LP3A 3DVEA 4BY4A 1S3PA 2LM5A 1TNXA 1TNQA 3O6BA 5I8NA 4FTGA 2H61A 2LVVA 3EK4A 3JVTC 4PALA 1QASA 1QLSA 4HRHA 4CFQA 2Y1NA 1QATA 1M39A 3EVUA 4DUQA 1GGWA 1JBAA 1IJ6A 3I5GC 1FW4A 1UHHA 2LE9B 3LL8B 1KFXL 2E30A 2PSRA 1N65A 4MRXA 1DJZA 2F3YA 1WLMA 4M2OA 4U8DA 1A75A 3VRPA 1CMGA 1SCMB 2NCOA 1X02A 1NP8A 5DKQA 4PE0A 4PE1A 5FYXA 2B1UA 1QV0A 4C0LA 4D1EA 4XJKB 1EH2A 4MRYA 2I18A 3EK7A 5HKYA 5KTYA 1OMRA 1YUSA 1K2HA 3TZ1A 3LK1A 4Q04A 2M0RA 1DTLA 1UUSA 3OHMB 1BODA 5AERA 3OX5A 2M1UA 5J3XA 1XK4A 1WLZA 1S6CA 1SK6D 5DKNA 4CIDA 1ZOTB 2LUCA 3EVRA 3PSRA 1H8BA 1PVAA 1ZFSA 2F33A 4BY5A 5K89A 3I5GB 3TUYC 2HQ8A 3ICBA 4JQ0D 1K96A 2H61C 1AUIB 5AFPA 2GV5A 2WOSA 4M2QA 1JF0A 1Y6WA 2NXQA 1YR5A 1RK9A 2JQ6A 2LC5A 1Q80A 5ER4X 4DCKA 1WRZA 4IL1A 4PHJA 1SW8A 2HQWA 4PDZA 4L9MA 1JWDA 1B8LA 1MUXA 1PVBA 2JNFA 2O5GA 1OQPA 2HETA 3WNXB 1LA3A 2BL0C 2JT8A 1OMVA 3SG3A 2K8MB 1NX3A 4GBAA 4DS7A 1HQVA 2ZRTA 4R1EA 4PHMA 1M63B 1PK0D 4NDCA 2PMYA 1C07A 2K7CA 1S6JA 2PALA 3BUXB 4GGNA 1BT6A 2KBIA 1L2OC 1KSMA 4YGAA 1GJYA 1YTZC 2JT0A 2GGZA 1IH0A 2M3WA 2L5XB 1BJFA 1XK4C 2JNXA 2KFFA 1IGVA 3K21A 4ZCVA 2L0PA 2BCAA 1YUTA 2JWWA 1KCYA 5ER5A 5F6TA 1BMOA 1AK8A 2P6BB 1QIWA 1CFCA 1B7TY 1U5IA 3CS1A 3I5HC 1SL8A 3DD4A 1CLMA 1R6PA 3CLNA 2LLUA 1F71A 1UHIA 3OX6A 3SIAA 3AAJA 3WXAA 1SR6C 1JFJA 1DJWA 4WQ2A 2Q4UA 2LANA 3CGAA 1AJ4A 3O78A 1A29A 1CDMA 4ORCB 1LXFC 1CM4A 1NIWA 1BF5A 1XFUO 3LCPC 3E3RA 1NSHA 1AP4A 1QJTA 1FF1A 4PE4A 1UURA 2OPOA 1K9KA 1KFUS 1YVLA 1NX0A 2OTGC 1XA5A 1NX2A 2BECA 4DRWA 1EXRA 1PRWA 1K93D 2L51A 1QX2A 2EC6B 1KK7Z 1DJGA 1JF2A 2O60A 1NWDA 4ORAB 3CZTX 1XFZO 2HPSA 2KSPA 1UHJA 3PATA 4QJ3B 4MZJA 1ALWA 5CPVA 1NYAA 1TNPA 1UP5A 2MJWB 3BQ3A 3FWBA 2RGIA 2MBXA 1XFYO 1ZUZA 2MHHA 1QX5B 2JPTA 2Y4QA 3I5HB 3SG7A 1SPYA 1B1GA 4FQOA 3DVKA 2JU0A 3VROA 1KQMC 4MEWA 3WHTB 3SG4A 1KK8C 1OE9B 3BUWB 4NDDA 3KHEA 1A2XA 2KAVA 2KYCA 1LINA 1IJ5A 2M1KB 1SRAA 1CDLA 1VRKA 1WDCC 1UHNA 1QS7A 2OS8C 3KEVA 1K9PA 1RTP1 3F45A 2I94A 2OTGB 1BU3A 2LHLA 1OZOA 1GQMA 1TCOB 3I5FC 1NUBA 1S36A 4WQ3A 2LMUA 3CR2A 1G33A 1EJ3A 4N1GA 2BBNA 1NPQA 3GK1A 2BKHB 1LKJA 1Y1XA 2K7BA 2LMTA 2ZFDA 1YVHA 2KGBC 3O2PA 3NXAA 1KQMB 2ZN8A 2VRGA 1WRKA 1MHOA 3EKJA 1G4YR 2L2EA 4CPVA 1CDPA 3JVTB 2FOTA 4YGEB 1KFUL 5HKWA 2ZNEA 1U5IB 1AVSA 4OKHA 1RFJA 2ISDA 3SIBA 2LUXA 1WDCB 3DVMA 3VRNA 1DGVA 4A4CA 1CM1A 2AUCA 1PSBA 5KSZA 2KNEA 4XYNA 3NSIA 4PE7A 1N0YA 1NCYA 1S26D 1IWQA 1UWOA 2L4IA 2SCPA 1MXEA 2M29A 1OZSA 2TN4A 4A4BA 1F55A 2DOQA 3SG6A 2EHBA 1FPWA 2I7AA 4GUKA 1F54A 2PVBA 1W7JB 2KQYA 4OVNF 1B8CA 1KWOC 2LCPA 4OR9B 4ORBB 3PALA 2CXJA 4I5NB 1ODBA 3BYAA 3LK0A 4NDBA 1F70A 4WRIA 3AKAA 1SNLA 2ZRSA 1ALVA 1XYDA 2KAYA 1BG1A 3BOWA 1CDNA 3CWGA 2PASA 1MWNA 5I2QA 1SL9A 5D69A 4CLNA 1ZMZA 3JTDC 4YGBB 1FBVA 1TTXA 4JPZB 3ZWHA 1YUUA 1GGZA 3TUYB 4CFRA 1R2UA 1SCVA 1XFWO 2JXLA 3TS5C 5HLVA 1CLLA 1MQ1A 1J1EA 3PM8A 3VRRA 3DVJA 1PSRA 3IQQA 3SG5A 1JUOA 5I2LA 4MVFA 1DGUA 3FIAA 1D1OA 1PULA 2MLFC 2H2KA 1F4QA 3CTNA 1DMOA 1UHKA 1BOCA 3BUNB 1A75B 1K90D 2BL0B 1SMGA 2G9BA 3GK4X 3NSLA 4I5KA 4PHKA 4GGFA 1DJXA 2KFHA 2Q91A 2EGDA 5B8IB 4XJKA 5BPJA 1J7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCF A;  4YRU A;  3KO0 A;  1YRT B;  1J7P A;  3JTD B;  2WND A;  2JTT A;  1KFX S;  2D8N A;  1J55 A;  2JT3 A;  4ZCU A;  3A4U B;  1QVI Z;  4YGD B;  3A8R A;  1IQ5 A;  2AAO A;  5GQQ C;  4C0J A;  1DJH A;  2JRF A;  1B8R A;  2LHI A;  1L2O B;  2JUL A;  2Y1M A;  3NSK A;  3O4Y A;  2F8P A;  3PN7 C;  4P5O E;  5CSF A;  4YGC B;  4MBE A;  3PFV A;  1PAL A;  2KHN A;  2K2F A;  1NCX A;  2K7D A;  2KI4 C;  4MZK A;  4OV2 A;  2K2A A;  4GNK B;  2MLE C;  1CFD A;  4GPL B;  5HLO A;  1XVJ A;  2F2O A;  5CSI A;  2LNK A;  4GFT A;  2JXC A;  4P2Y B;  1DJY A;  4JWQ A;  4AQI A;  1C7W A;  1DF0 A;  1S6I A;  2LLT A;  4YI8 A;  1H4B A;  2M97 A;  1SR6 B;  2I2R E;  2KQ6 A;  2BKI B;  1J7O A;  1TNW A;  1KK7 Y;  4USL A;  1QX7 A;  1ZAC A;  2L98 A;  2JOJ A;  4N5X A;  5JJG A;  1MXL C;  1K9U A;  2L50 A;  2PRU A;  5D7F A;  4GGF C;  2LVI A;  3BOW B;  1BLQ A;  1YUR A;  4HRE E;  3DF0 A;  2KBM A;  2LMV A;  1CKK A;  1J7Q A;  2MRD A;  3CR4 X;  1IG5 A;  2KI4 B;  1QLK A;  1WY9 A;  2QAC A;  1XFX O;  1M31 A;  2ZKM X;  1B9A A;  3TDU A;  1DJI A;  2BBM A;  2CT9 A;  3EK8 A;  2M49 B;  2K7O A;  1RRO A;  3RM1 A;  5I2O A;  1JFK A;  2K0J A;  1TRF A;  3AAK A;  1S5G Z;  2COL B;  4ETO A;  2K61 A;  5CSN A;  4QJ5 B;  1TN4 A;  4AOM A;  1IRJ A;  4C0K A;  3BUO B;  1KK8 B;  1SKT A;  2BE4 A;  4M2P A;  2M7L A;  3SG2 A;  1EG4 A;  4PCW A;  1NCZ A;  1M46 A;  1WRL A;  5AEQ A;  1FI6 A;  3BUM B;  1B4C A;  1F8H A;  1E8A A;  1XFV O;  1SY9 A;  5AAN A;  4DIR A;  1FI5 A;  2OS8 B;  1RWY A;  2KOT A;  1J1D A;  2M9G A;  2MA2 A;  1LVC D;  4TNC A;  4UPG A;  3IQO A;  1SL7 A;  2V53 A;  4ICB A;  1S5G Y;  1IQ3 A;  1CB1 A;  1N2D A;  2AMI A;  3I5F B;  2E6W A;  3ZNI A;  5HKZ A;  1OMD A;  2WCE A;  5CSJ A;  4AQJ A;  2WCF A;  3TDZ A;  3VRQ A;  3HX4 A;  4YI9 A;  2WC8 A;  3OB2 B;  5PAL A;  1V1F A;  1OOJ A;  3KF9 A;  4MLW A;  5DKR A;  1MF8 B;  2LLS A;  1Y1U A;  2KDH A;  3D0Y A;  3WHU B;  5JOL A;  2G2B A;  2JTZ A;  3FS7 A;  2CCM A;  2F3Z A;  2KFG A;  4MZL A;  2BE6 A;  4PHN A;  1MR8 A;  1DF0 B;  2MAZ A;  2GGM A;  3GK2 A;  5HYD A;  1SYM A;  5AXI A;  3QRX A;  2FCE A;  1JSA A;  2JZI A;  2KGR A;  1SBJ A;  2BCB A;  2BCX A;  1BR1 B;  1AJ5 A;  1XO5 A;  2Y5I A;  3GOF A;  4HRG A;  1IKU A;  2LV7 A;  1KQV A;  2A4J A;  3I5I C;  4MSP A;  1B47 A;  1Y0V H;  3NSO A;  2NZ0 A;  1HT9 A;  1KWO B;  1W7I B;  3TDI A;  1RJV A;  3BXK A;  1QTX A;  3DF0 B;  3MSE B;  2LVJ A;  4E68 A;  1B7T Z;  1G8I A;  2R2I A;  3CR5 X;  5IBW A;  1QV1 A;  3C1V A;  3LLE A;  4HSZ A;  3IF7 A;  2L4H A;  3OP0 A;  4NQG A;  1LA0 A;  1CFP A;  2M7N A;  2NCP A;  5KU1 A;  1BR4 B;  1DT7 B;  2EC6 C;  3RLZ A;  1CLB A;  2KAX A;  1CTR A;  1KSO A;  1JC2 A;  3SJS A;  3HCM A;  2JC2 A;  3TS5 B;  2KYF A;  2ZND A;  2CNP A;  1CFF A;  2LAP A;  2F2P A;  5TNC A;  1C7V A;  1TOP A;  4N1F A;  2M8U A;  4I5L B;  1AHR A;  1CMF A;  1TIZ A;  4MN0 A;  2IS9 A;  3VGO A;  4OCI A;  1DVI A;  2LP2 A;  2CTN A;  3I5I B;  1OSA A;  1CNP A;  1A4P A;  3M0W A;  2QPT A;  5G08 A;  1K95 A;  1QVI Y;  3EVV A;  4F0Z B;  4GAO A;  1REC A;  2NLN A;  3D10 A;  4I5J A;  1F4O A;  1YX7 A;  1EG3 A;  1M45 A;  1QXP A;  1QIV A;  2SAS A;  2KI6 C;  2WCB A;  3KPX A;  1K8U A;  3FWC A;  3EKH A;  4YBH B;  1K94 A;  3H4S E;  3OB1 B;  3PLF B;  3AKB A;  1SCM C;  1S1E A;  1NX1 A;  2KI6 D;  2ZN9 A;  1EL4 A;  2LVK A;  1Y1A A;  1YRU B;  1YX8 A;  2FJU B;  2WOR A;  1A03 A;  2CBL A;  3PN7 B;  2FCD A;  2HF5 A;  3D0Y B;  1V1G A;  1L7Z A;  4QJ4 B;  2LP3 A;  3DVE A;  4BY4 A;  1S3P A;  2LM5 A;  1TNX A;  1TNQ A;  3O6B A;  5I8N A;  4FTG A;  2H61 A;  2LVV A;  3EK4 A;  3JVT C;  4PAL A;  1QAS A;  1QLS A;  4HRH A;  4CFQ A;  2Y1N A;  1QAT A;  1M39 A;  3EVU A;  4DUQ A;  1GGW A;  1JBA A;  1IJ6 A;  3I5G C;  1FW4 A;  1UHH A;  2LE9 B;  3LL8 B;  1KFX L;  2E30 A;  2PSR A;  1N65 A;  4MRX A;  1DJZ A;  2F3Y A;  1WLM A;  4M2O A;  4U8D A;  1A75 A;  3VRP A;  1CMG A;  1SCM B;  2NCO A;  1X02 A;  1NP8 A;  5DKQ A;  4PE0 A;  4PE1 A;  5FYX A;  2B1U A;  1QV0 A;  4C0L A;  4D1E A;  4XJK B;  1EH2 A;  4MRY A;  2I18 A;  3EK7 A;  5HKY A;  5KTY A;  1OMR A;  1YUS A;  1K2H A;  3TZ1 A;  3LK1 A;  4Q04 A;  2M0R A;  1DTL A;  1UUS A;  3OHM B;  1BOD A;  5AER A;  3OX5 A;  2M1U A;  5J3X A;  1XK4 A;  1WLZ A;  1S6C A;  1SK6 D;  5DKN A;  4CID A;  1ZOT B;  2LUC A;  3EVR A;  3PSR A;  1H8B A;  1PVA A;  1ZFS A;  2F33 A;  4BY5 A;  5K89 A;  3I5G B;  3TUY C;  2HQ8 A;  3ICB A;  4JQ0 D;  1K96 A;  2H61 C;  1AUI B;  5AFP A;  2GV5 A;  2WOS A;  4M2Q A;  1JF0 A;  1Y6W A;  2NXQ A;  1YR5 A;  1RK9 A;  2JQ6 A;  2LC5 A;  1Q80 A;  5ER4 X;  4DCK A;  1WRZ A;  4IL1 A;  4PHJ A;  1SW8 A;  2HQW A;  4PDZ A;  4L9M A;  1JWD A;  1B8L A;  1MUX A;  1PVB A;  2JNF A;  2O5G A;  1OQP A;  2HET A;  3WNX B;  1LA3 A;  2BL0 C;  2JT8 A;  1OMV A;  3SG3 A;  2K8M B;  1NX3 A;  4GBA A;  4DS7 A;  1HQV A;  2ZRT A;  4R1E A;  4PHM A;  1M63 B;  1PK0 D;  4NDC A;  2PMY A;  1C07 A;  2K7C A;  1S6J A;  2PAL A;  3BUX B;  4GGN A;  1BT6 A;  2KBI A;  1L2O C;  1KSM A;  4YGA A;  1GJY A;  1YTZ C;  2JT0 A;  2GGZ A;  1IH0 A;  2M3W A;  2L5X B;  1BJF A;  1XK4 C;  2JNX A;  2KFF A;  1IGV A;  3K21 A;  4ZCV A;  2L0P A;  2BCA A;  1YUT A;  2JWW A;  1KCY A;  5ER5 A;  5F6T A;  1BMO A;  1AK8 A;  2P6B B;  1QIW A;  1CFC A;  1B7T Y;  1U5I A;  3CS1 A;  3I5H C;  1SL8 A;  3DD4 A;  1CLM A;  1R6P A;  3CLN A;  2LLU A;  1F71 A;  1UHI A;  3OX6 A;  3SIA A;  3AAJ A;  3WXA A;  1SR6 C;  1JFJ A;  1DJW A;  4WQ2 A;  2Q4U A;  2LAN A;  3CGA A;  1AJ4 A;  3O78 A;  1A29 A;  1CDM A;  4ORC B;  1LXF C;  1CM4 A;  1NIW A;  1BF5 A;  1XFU O;  3LCP C;  3E3R A;  1NSH A;  1AP4 A;  1QJT A;  1FF1 A;  4PE4 A;  1UUR A;  2OPO A;  1K9K A;  1KFU S;  1YVL A;  1NX0 A;  2OTG C;  1XA5 A;  1NX2 A;  2BEC A;  4DRW A;  1EXR A;  1PRW A;  1K93 D;  2L51 A;  1QX2 A;  2EC6 B;  1KK7 Z;  1DJG A;  1JF2 A;  2O60 A;  1NWD A;  4ORA B;  3CZT X;  1XFZ O;  2HPS A;  2KSP A;  1UHJ A;  3PAT A;  4QJ3 B;  4MZJ A;  1ALW A;  5CPV A;  1NYA A;  1TNP A;  1UP5 A;  2MJW B;  3BQ3 A;  3FWB A;  2RGI A;  2MBX A;  1XFY O;  1ZUZ A;  2MHH A;  1QX5 B;  2JPT A;  2Y4Q A;  3I5H B;  3SG7 A;  1SPY A;  1B1G A;  4FQO A;  3DVK A;  2JU0 A;  3VRO A;  1KQM C;  4MEW A;  3WHT B;  3SG4 A;  1KK8 C;  1OE9 B;  3BUW B;  4NDD A;  3KHE A;  1A2X A;  2KAV A;  2KYC A;  1LIN A;  1IJ5 A;  2M1K B;  1SRA A;  1CDL A;  1VRK A;  1WDC C;  1UHN A;  1QS7 A;  2OS8 C;  3KEV A;  1K9P A;  1RTP 1;  3F45 A;  2I94 A;  2OTG B;  1BU3 A;  2LHL A;  1OZO A;  1GQM A;  1TCO B;  3I5F C;  1NUB A;  1S36 A;  4WQ3 A;  2LMU A;  3CR2 A;  1G33 A;  1EJ3 A;  4N1G A;  2BBN A;  1NPQ A;  3GK1 A;  2BKH B;  1LKJ A;  1Y1X A;  2K7B A;  2LMT A;  2ZFD A;  1YVH A;  2KGB C;  3O2P A;  3NXA A;  1KQM B;  2ZN8 A;  2VRG A;  1WRK A;  1MHO A;  3EKJ A;  1G4Y R;  2L2E A;  4CPV A;  1CDP A;  3JVT B;  2FOT A;  4YGE B;  1KFU L;  5HKW A;  2ZNE A;  1U5I B;  1AVS A;  4OKH A;  1RFJ A;  2ISD A;  3SIB A;  2LUX A;  1WDC B;  3DVM A;  3VRN A;  1DGV A;  4A4C A;  1CM1 A;  2AUC A;  1PSB A;  5KSZ A;  2KNE A;  4XYN A;  3NSI A;  4PE7 A;  1N0Y A;  1NCY A;  1S26 D;  1IWQ A;  1UWO A;  2L4I A;  2SCP A;  1MXE A;  2M29 A;  1OZS A;  2TN4 A;  4A4B A;  1F55 A;  2DOQ A;  3SG6 A;  2EHB A;  1FPW A;  2I7A A;  4GUK A;  1F54 A;  2PVB A;  1W7J B;  2KQY A;  4OVN F;  1B8C A;  1KWO C;  2LCP A;  4OR9 B;  4ORB B;  3PAL A;  2CXJ A;  4I5N B;  1ODB A;  3BYA A;  3LK0 A;  4NDB A;  1F70 A;  4WRI A;  3AKA A;  1SNL A;  2ZRS A;  1ALV A;  1XYD A;  2KAY A;  1BG1 A;  3BOW A;  1CDN A;  3CWG A;  2PAS A;  1MWN A;  5I2Q A;  1SL9 A;  5D69 A;  4CLN A;  1ZMZ A;  3JTD C;  4YGB B;  1FBV A;  1TTX A;  4JPZ B;  3ZWH A;  1YUU A;  1GGZ A;  3TUY B;  4CFR A;  1R2U A;  1SCV A;  1XFW O;  2JXL A;  3TS5 C;  5HLV A;  1CLL A;  1MQ1 A;  1J1E A;  3PM8 A;  3VRR A;  3DVJ A;  1PSR A;  3IQQ A;  3SG5 A;  1JUO A;  5I2L A;  4MVF A;  1DGU A;  3FIA A;  1D1O A;  1PUL A;  2MLF C;  2H2K A;  1F4Q A;  3CTN A;  1DMO A;  1UHK A;  1BOC A;  3BUN B;  1A75 B;  1K90 D;  2BL0 B;  1SMG A;  2G9B A;  3GK4 X;  3NSL A;  4I5K A;  4PHK A;  4GGF A;  1DJX A;  2KFH A;  2Q91 A;  2EGD A;  5B8I B;  4XJK A;  5BPJ A;  1J7R A; 
#chains in the Genus database with same CATH topology
 1TCF A;  4YRU A;  3KO0 A;  1YRT B;  2WC6 A;  2PYQ A;  3JTD B;  2WND A;  1J7P A;  2JTT A;  2QEB A;  1KFX S;  2D8N A;  1J55 A;  2JT3 A;  4ZCU A;  1Z2C B;  3A4U B;  1QVI Z;  4YGD B;  3A8R A;  1IQ5 A;  2AAO A;  5GQQ C;  4C0J A;  1DJH A;  2JRF A;  1B8R A;  2LHI A;  1L2O B;  2JUL A;  2Y1M A;  3NSK A;  3NGV A;  2F8P A;  3O4Y A;  3PN7 C;  4P5O E;  5CSF A;  4YGC B;  4MBE A;  3PFV A;  1PAL A;  2KHN A;  2K2F A;  1NCX A;  2K7D A;  2KI4 C;  4MZK A;  4OV2 A;  2K2A A;  4GNK B;  2MLE C;  1CFD A;  4GPL B;  5HLO A;  3BJH A;  1XVJ A;  2F2O A;  5CSI A;  2LNK A;  4GFT A;  2JXC A;  4P2Y B;  1DJY A;  1W9Z A;  4JWQ A;  4AQI A;  1C7W A;  1DF0 A;  1S6I A;  2LLT A;  4YI8 A;  1H4B A;  2M97 A;  1SR6 B;  2I2R E;  2KQ6 A;  2BKI B;  1J7O A;  1TNW A;  1KK7 Y;  4USL A;  5FI2 A;  1QX7 A;  1ZAC A;  2L98 A;  3CYZ A;  2JOJ A;  4N5X A;  5JJG A;  1MXL C;  1K9U A;  2P70 A;  2L50 A;  2PRU A;  3FE8 A;  3K1E A;  2P71 A;  5D7F A;  4GGF C;  4F7F A;  2ERB A;  3D75 A;  2LVI A;  3CAB A;  3BOW B;  1BLQ A;  1YUR A;  4HRE E;  3DF0 A;  3SS5 A;  2KBM A;  2LMV A;  1CKK A;  1J7Q A;  2MRD A;  2K60 A;  3CR4 X;  1IG5 A;  4FQT A;  2KI4 B;  1QLK A;  1WY9 A;  3DZT A;  2QAC A;  1XFX O;  1M31 A;  2ZKM X;  1B9A A;  3TDU A;  1DJI A;  2BBM A;  2CT9 A;  3EK8 A;  1OOG A;  2M49 B;  2K7O A;  4JD9 A;  1RRO A;  3RM1 A;  5I2O A;  5HL1 A;  1JFK A;  2K0J A;  1TRF A;  3AAK A;  1S5G Z;  2COL B;  4ETO A;  2K61 A;  5CSN A;  4QJ5 B;  1TN4 A;  4AOM A;  1IRJ A;  4C0K A;  1OOH A;  3BUO B;  1KK8 B;  1SKT A;  2BE4 A;  4M2P A;  2M7L A;  3SG2 A;  1EG4 A;  4PCW A;  1NCZ A;  1M46 A;  3NHI A;  1WRL A;  3EG5 B;  5AEQ A;  3S0D A;  3BUM B;  1FI6 A;  1B4C A;  1F8H A;  1E8A A;  1XFV O;  1SY9 A;  5AAN A;  4DIR A;  1FI5 A;  2OS8 B;  1RWY A;  2KOT A;  1J1D A;  2M9G A;  2MA2 A;  4PT1 A;  1LVC D;  4TNC A;  4UPG A;  3IQO A;  1SL7 A;  2V53 A;  4ICB A;  1S5G Y;  1IQ3 A;  1CB1 A;  1N2D A;  2AMI A;  3I5F B;  2E6W A;  3ZNI A;  5HKZ A;  1OMD A;  2WCE A;  5CSJ A;  1LS8 A;  4AQJ A;  2WCF A;  4INW A;  3TDZ A;  3VRQ A;  3HX4 A;  2FJY A;  4YI9 A;  2WC8 A;  3OB2 B;  5PAL A;  3BFA A;  3DYE A;  1V1F A;  1OOJ A;  3KF9 A;  4MLW A;  5DKR A;  1MF8 B;  2KLE A;  2LLS A;  1Y1U A;  3OGN A;  2KDH A;  3D0Y A;  3WHU B;  5JOL A;  2G2B A;  2JTZ A;  3D73 A;  2YGU A;  2CCM A;  2F3Z A;  2KFG A;  3FS7 A;  4MZL A;  2BE6 A;  4PHN A;  1MR8 A;  1DF0 B;  2MAZ A;  2GGM A;  2WCM A;  3GK2 A;  5HYD A;  1SYM A;  5AXI A;  3QRX A;  2FCE A;  1JSA A;  2JZI A;  2KGR A;  1SBJ A;  2BCX A;  2BCB A;  1OW4 A;  1BR1 B;  1AJ5 A;  1XO5 A;  2Y5I A;  3GOF A;  4HRG A;  3L4A A;  1IKU A;  2LV7 A;  1KQV A;  2A4J A;  3I5I C;  4MSP A;  1B47 A;  1Y0V H;  3NSO A;  2NZ0 A;  1HT9 A;  1KWO B;  1W7I B;  3S0A A;  3TDI A;  1RJV A;  3BXK A;  1QTX A;  3DF0 B;  3MSE B;  2LVJ A;  4E68 A;  1B7T Z;  1G8I A;  2R2I A;  3CR5 X;  5IBW A;  1QV1 A;  3C1V A;  3LLE A;  4HSZ A;  3S0E A;  3IF7 A;  2L4H A;  3OP0 A;  4NQG A;  1LA0 A;  1CFP A;  2M7N A;  2NCP A;  5KU1 A;  1BR4 B;  1DT7 B;  2EC6 C;  3RLZ A;  1CLB A;  2KAX A;  1CTR A;  1KSO A;  1JC2 A;  3SJS A;  3DY9 A;  3HCM A;  2JC2 A;  3TS5 B;  2KYF A;  2ZND A;  2CNP A;  1CFF A;  2LAP A;  2F2P A;  5TNC A;  1C7V A;  1TOP A;  4N1F A;  2M8U A;  2WCH A;  4I5L B;  1AHR A;  1CMF A;  1TIZ A;  4MN0 A;  2IS9 A;  3VGO A;  4OCI A;  1DVI A;  2LP2 A;  2CTN A;  2WCL A;  3I5I B;  3B88 A;  3R1V A;  1OSA A;  1CNP A;  3SS3 A;  1A4P A;  3M0W A;  2QPT A;  5G08 A;  1K95 A;  1QVI Y;  3EVV A;  4F0Z B;  4GAO A;  5EL2 A;  1REC A;  2NLN A;  3D10 A;  1C3Y A;  4I5J A;  1F4O A;  3L47 A;  4INX A;  1YX7 A;  1EG3 A;  1M45 A;  1QXP A;  1QIV A;  2SAS A;  2KI6 C;  2WCB A;  3KPX A;  1K8U A;  3FWC A;  3EKH A;  3CZ2 A;  3IVT A;  4YBH B;  1K94 A;  3H4S E;  3OB1 B;  3PLF B;  3AKB A;  1SCM C;  1S1E A;  1NX1 A;  2KI6 D;  2BNX A;  2ZN9 A;  1EL4 A;  2LVK A;  1Y1A A;  1YRU B;  1YX8 A;  2FJU B;  2WOR A;  1XFR A;  1A03 A;  2CBL A;  3PN7 B;  2FCD A;  2HF5 A;  3D0Y B;  1V1G A;  1L7Z A;  4QJ4 B;  2GTE A;  2LP3 A;  3B86 A;  3DVE A;  4BY4 A;  2QEO A;  1S3P A;  2LM5 A;  1TNX A;  4KYN A;  1TNQ A;  3O6B A;  5I8N A;  3PJI A;  4FTG A;  2H61 A;  2LVV A;  2WCK A;  3EK4 A;  3JVT C;  4PAL A;  3S0F A;  1QAS A;  1QLS A;  4HRH A;  4CFQ A;  2Y1N A;  1QAT A;  1M39 A;  3EVU A;  5FI6 A;  3BFH A;  4DUQ A;  1GGW A;  1JBA A;  2QEH A;  1IJ6 A;  3I5G C;  1FW4 A;  1UHH A;  2LE9 B;  3LL8 B;  1KFX L;  2E30 A;  2PSR A;  1N65 A;  4MRX A;  1DJZ A;  2F3Y A;  1WLM A;  4M2O A;  4U8D A;  1A75 A;  3VRP A;  1CMG A;  1SCM B;  2NCO A;  1X02 A;  1NP8 A;  3S0G A;  5DKQ A;  4PE0 A;  4PE1 A;  5FYX A;  2JPO A;  1Z4H A;  1ORG A;  2B1U A;  1QV0 A;  4OZD A;  2L2C A;  4C0L A;  3B6X A;  4XJK B;  4D1E A;  1EH2 A;  4MRY A;  2I18 A;  3EK7 A;  5HKY A;  5KTY A;  1OMR A;  1YUS A;  1K2H A;  3TZ1 A;  3LK1 A;  4Q04 A;  2M0R A;  1DTL A;  1UUS A;  4JKT A;  3OHM B;  1BOD A;  5AER A;  3N7H A;  3OX5 A;  2M1U A;  5J3X A;  1XK4 A;  1WLZ A;  1S6C A;  1SK6 D;  5DKN A;  4CID A;  1ZOT B;  2LUC A;  3EVR A;  3PSR A;  1H8B A;  1PVA A;  1ZFS A;  3D77 A;  2F33 A;  4BY5 A;  5K89 A;  3I5G B;  3TUY C;  2HQ8 A;  3ICB A;  4JQ0 D;  1K96 A;  2H61 C;  1AUI B;  3NHT A;  5AFP A;  2GV5 A;  2WOS A;  3OBV A;  4M2Q A;  1JF0 A;  1Y6W A;  2NXQ A;  1YR5 A;  1RK9 A;  2JQ6 A;  2LC5 A;  1Q80 A;  5ER4 X;  4DCK A;  1WRZ A;  4IL1 A;  4PHJ A;  1DC1 A;  1SW8 A;  2HQW A;  4PDZ A;  4L9M A;  1JWD A;  1B8L A;  1MUX A;  1PVB A;  2JNF A;  2O5G A;  1OQP A;  2HET A;  3WNX B;  1LA3 A;  2BL0 C;  2JT8 A;  1OMV A;  3SG3 A;  2K8M B;  1NX3 A;  4GBA A;  4DS7 A;  1HQV A;  2ZRT A;  4R1E A;  4PHM A;  3CZ0 A;  1M63 B;  1PK0 D;  4NDC A;  2PMY A;  3D76 A;  3Q8I A;  1C07 A;  1QWV A;  2K7C A;  3SS4 A;  1S6J A;  2PAL A;  3BUX B;  2KPH A;  1BT6 A;  4GGN A;  1IIO A;  2KBI A;  1L2O C;  1KSM A;  4YGA A;  1GJY A;  1YTZ C;  2JT0 A;  2GGZ A;  1IH0 A;  2M3W A;  2L5X B;  1BJF A;  1XK4 C;  2JNX A;  2KFF A;  1IGV A;  3K21 A;  4ZCV A;  2L0P A;  2BCA A;  1YUT A;  2JWW A;  1KCY A;  5ER5 A;  5F6T A;  1BMO A;  1AK8 A;  2P6B B;  1QIW A;  1CFC A;  1B7T Y;  3L4L A;  3CZ1 A;  1U5I A;  3CS1 A;  3I5H C;  1SL8 A;  3DD4 A;  1CLM A;  1R6P A;  3CLN A;  2LLU A;  1F71 A;  1UHI A;  3OX6 A;  3R72 A;  3SIA A;  3AAJ A;  3WXA A;  1SR6 C;  3R1P A;  2WCJ A;  1JFJ A;  1DJW A;  4WQ2 A;  2Q4U A;  2LAN A;  1DEL A;  1AJ4 A;  3CGA A;  3DXL A;  3O78 A;  1A29 A;  1CDM A;  4ORC B;  1DQE A;  1DEK A;  1CM4 A;  1LXF C;  1NIW A;  1OOI X;  1BF5 A;  1XFU O;  3LCP C;  3E3R A;  1NSH A;  1AP4 A;  1QJT A;  1FF1 A;  4PE4 A;  1UUR A;  2OPO A;  1K9K A;  1KFU S;  1YVL A;  1NX0 A;  3UO9 A;  2OTG C;  1XA5 A;  1NX2 A;  2BEC A;  2QEV A;  4DRW A;  1EXR A;  1PRW A;  1K93 D;  2L51 A;  1QX2 A;  2EC6 B;  1KK7 Z;  1DJG A;  1JF2 A;  2O60 A;  1NWD A;  4ORA B;  3CZT X;  1XFZ O;  2HPS A;  2KSP A;  1UHJ A;  3PAT A;  4QJ3 B;  4MZJ A;  1ALW A;  5CPV A;  1NYA A;  1TNP A;  1UP5 A;  2MJW B;  3BQ3 A;  3FWB A;  2RGI A;  2MBX A;  1XFY O;  1ZUZ A;  2MHH A;  1QX5 B;  2JPT A;  2Y4Q A;  3I5H B;  3SG7 A;  1SPY A;  1B1G A;  4FQO A;  3DVK A;  2JU0 A;  3VRO A;  1KQM C;  4MEW A;  3WHT B;  3SG4 A;  1KK8 C;  1OE9 B;  5FI7 A;  3BUW B;  4NDD A;  3KHE A;  1A2X A;  2KAV A;  2KYC A;  1P28 A;  3UNW A;  1LIN A;  3R1O A;  1IJ5 A;  2M1K B;  1SRA A;  1CDL A;  1VRK A;  1WDC C;  5I94 A;  1UHN A;  1QS7 A;  2OS8 C;  3KEV A;  1K9P A;  3CDN A;  1RTP 1;  3F45 A;  2I94 A;  2OTG B;  3D78 A;  3VB1 A;  1BU3 A;  2LHL A;  1OZO A;  1GQM A;  1TCO B;  3I5F C;  1NUB A;  3QME A;  1S36 A;  4WQ3 A;  2L5Y A;  2LMU A;  3CR2 A;  1G33 A;  1TWO A;  3B7A A;  1EJ3 A;  4N1G A;  2BBN A;  1NPQ A;  3GK1 A;  2BKH B;  1LKJ A;  5DIC A;  1Y1X A;  2K7B A;  2LMT A;  2ZFD A;  1YVH A;  2KGB C;  3O2P A;  3NXA A;  1KQM B;  2KLD A;  2ZN8 A;  2VRG A;  1WRK A;  1MHO A;  3FE6 A;  3EKJ A;  1G4Y R;  2L2E A;  4CPV A;  1CDP A;  3JVT B;  1OOF A;  2FOT A;  1TUJ A;  1KFU L;  4YGE B;  5D3O A;  2ZNE A;  5HKW A;  1U5I B;  1AVS A;  4OKH A;  1RFJ A;  3S0B A;  2ISD A;  3SIB A;  2LUX A;  1WDC B;  3DVM A;  3VRN A;  1DGV A;  4A4C A;  1CM1 A;  2AUC A;  1PSB A;  5KSZ A;  3RZS A;  2KNE A;  4XYN A;  3NSI A;  4PE7 A;  1N0Y A;  1NCY A;  1S26 D;  1IWQ A;  1TUZ A;  1UWO A;  3BFB A;  3PM2 A;  2L4I A;  2SCP A;  1MXE A;  2M29 A;  1OZS A;  2TN4 A;  4A4B A;  1F55 A;  2DOQ A;  3B87 A;  3SG6 A;  2EHB A;  1FPW A;  2I7A A;  4GUK A;  1F54 A;  2PVB A;  1W7J B;  2KQY A;  4OVN F;  1SSE B;  1B8C A;  1KWO C;  2LCP A;  4OR9 B;  4ORB B;  3FE9 A;  3PAL A;  2CXJ A;  4I5N B;  1ODB A;  1C3Z A;  2WC5 A;  3BYA A;  3LK0 A;  4NDB A;  1F70 A;  4WRI A;  3AKA A;  1SNL A;  1T14 A;  2ZRS A;  1ALV A;  1XYD A;  2KAY A;  1BG1 A;  3BOW A;  1CDN A;  3CWG A;  2PAS A;  1MWN A;  5I2Q A;  1SL9 A;  5D69 A;  4CLN A;  1ZMZ A;  3JTD C;  4YGB B;  1FBV A;  1TTX A;  3D74 A;  4JPZ B;  3ZWH A;  1YUU A;  1GGZ A;  3TUY B;  4CFR A;  1R2U A;  2BAP A;  1SCV A;  1XFW O;  2JXL A;  3TS5 C;  5HLV A;  1CLL A;  1MQ1 A;  1J1E A;  3O4X A;  3PM8 A;  3VRR A;  3DVJ A;  1PSR A;  3IQQ A;  3SG5 A;  2H8V A;  1JUO A;  5I2L A;  4MVF A;  1DGU A;  3FIA A;  1D1O A;  1PUL A;  2MLF C;  2H2K A;  2PQL A;  1F4Q A;  3CTN A;  1DMO A;  1UHK A;  1BOC A;  3BUN B;  1A75 B;  1GM0 A;  1K90 D;  2BL0 B;  1SMG A;  2G9B A;  3GK4 X;  3NSL A;  4I5K A;  4PHK A;  4GGF A;  1DJX A;  2KFH A;  2QDI A;  2Q91 A;  2EGD A;  5B8I B;  4IJ7 A;  4XJK A;  5BPJ A;  1J7R A;  3V2L A; 
#chains in the Genus database with same CATH homology
 1TCF A;  4YRU A;  3KO0 A;  1YRT B;  1J7P A;  3JTD B;  2WND A;  2JTT A;  1KFX S;  2D8N A;  1J55 A;  2JT3 A;  4ZCU A;  3A4U B;  1QVI Z;  4YGD B;  3A8R A;  1IQ5 A;  2AAO A;  5GQQ C;  4C0J A;  1DJH A;  2JRF A;  1B8R A;  2LHI A;  1L2O B;  2JUL A;  2Y1M A;  3NSK A;  3O4Y A;  2F8P A;  3PN7 C;  4P5O E;  5CSF A;  4YGC B;  4MBE A;  3PFV A;  1PAL A;  2KHN A;  2K2F A;  1NCX A;  2K7D A;  2KI4 C;  4MZK A;  4OV2 A;  2K2A A;  4GNK B;  2MLE C;  1CFD A;  4GPL B;  5HLO A;  1XVJ A;  2F2O A;  5CSI A;  2LNK A;  4GFT A;  2JXC A;  4P2Y B;  1DJY A;  4JWQ A;  4AQI A;  1C7W A;  1DF0 A;  1S6I A;  2LLT A;  4YI8 A;  1H4B A;  2M97 A;  1SR6 B;  2I2R E;  2KQ6 A;  2BKI B;  1J7O A;  1TNW A;  1KK7 Y;  4USL A;  1QX7 A;  1ZAC A;  2L98 A;  2JOJ A;  4N5X A;  5JJG A;  1MXL C;  1K9U A;  2L50 A;  2PRU A;  5D7F A;  4GGF C;  2LVI A;  3BOW B;  1BLQ A;  1YUR A;  4HRE E;  3DF0 A;  2KBM A;  2LMV A;  1CKK A;  1J7Q A;  2MRD A;  3CR4 X;  1IG5 A;  2KI4 B;  1QLK A;  1WY9 A;  2QAC A;  1XFX O;  1M31 A;  2ZKM X;  1B9A A;  3TDU A;  1DJI A;  2BBM A;  2CT9 A;  3EK8 A;  2M49 B;  2K7O A;  1RRO A;  3RM1 A;  5I2O A;  1JFK A;  2K0J A;  1TRF A;  3AAK A;  1S5G Z;  2COL B;  4ETO A;  2K61 A;  5CSN A;  4QJ5 B;  1TN4 A;  4AOM A;  1IRJ A;  4C0K A;  3BUO B;  1KK8 B;  1SKT A;  2BE4 A;  4M2P A;  2M7L A;  3SG2 A;  1EG4 A;  4PCW A;  1NCZ A;  1M46 A;  1WRL A;  5AEQ A;  1FI6 A;  3BUM B;  1B4C A;  1F8H A;  1E8A A;  1XFV O;  1SY9 A;  5AAN A;  4DIR A;  1FI5 A;  2OS8 B;  1RWY A;  2KOT A;  1J1D A;  2M9G A;  2MA2 A;  1LVC D;  4TNC A;  4UPG A;  3IQO A;  1SL7 A;  2V53 A;  4ICB A;  1S5G Y;  1IQ3 A;  1CB1 A;  1N2D A;  2AMI A;  3I5F B;  2E6W A;  3ZNI A;  5HKZ A;  1OMD A;  2WCE A;  5CSJ A;  4AQJ A;  2WCF A;  3TDZ A;  3VRQ A;  3HX4 A;  4YI9 A;  2WC8 A;  3OB2 B;  5PAL A;  1V1F A;  1OOJ A;  3KF9 A;  4MLW A;  5DKR A;  1MF8 B;  2LLS A;  1Y1U A;  2KDH A;  3D0Y A;  3WHU B;  5JOL A;  2G2B A;  2JTZ A;  3FS7 A;  2CCM A;  2F3Z A;  2KFG A;  4MZL A;  2BE6 A;  4PHN A;  1MR8 A;  1DF0 B;  2MAZ A;  2GGM A;  3GK2 A;  5HYD A;  1SYM A;  5AXI A;  3QRX A;  2FCE A;  1JSA A;  2JZI A;  2KGR A;  1SBJ A;  2BCB A;  2BCX A;  1BR1 B;  1AJ5 A;  1XO5 A;  2Y5I A;  3GOF A;  4HRG A;  1IKU A;  2LV7 A;  1KQV A;  2A4J A;  3I5I C;  4MSP A;  1B47 A;  1Y0V H;  3NSO A;  2NZ0 A;  1HT9 A;  1KWO B;  1W7I B;  3TDI A;  1RJV A;  3BXK A;  1QTX A;  3DF0 B;  3MSE B;  2LVJ A;  4E68 A;  1B7T Z;  1G8I A;  2R2I A;  3CR5 X;  5IBW A;  1QV1 A;  3C1V A;  3LLE A;  4HSZ A;  3IF7 A;  2L4H A;  3OP0 A;  4NQG A;  1LA0 A;  1CFP A;  2M7N A;  2NCP A;  5KU1 A;  1BR4 B;  1DT7 B;  2EC6 C;  3RLZ A;  1CLB A;  2KAX A;  1CTR A;  1KSO A;  1JC2 A;  3SJS A;  3HCM A;  2JC2 A;  3TS5 B;  2KYF A;  2ZND A;  2CNP A;  1CFF A;  2LAP A;  2F2P A;  5TNC A;  1C7V A;  1TOP A;  4N1F A;  2M8U A;  4I5L B;  1AHR A;  1CMF A;  1TIZ A;  4MN0 A;  2IS9 A;  3VGO A;  4OCI A;  1DVI A;  2LP2 A;  2CTN A;  3I5I B;  1OSA A;  1CNP A;  1A4P A;  3M0W A;  2QPT A;  5G08 A;  1K95 A;  1QVI Y;  3EVV A;  4F0Z B;  4GAO A;  1REC A;  2NLN A;  3D10 A;  4I5J A;  1F4O A;  1YX7 A;  1EG3 A;  1M45 A;  1QXP A;  1QIV A;  2SAS A;  2KI6 C;  2WCB A;  3KPX A;  1K8U A;  3FWC A;  3EKH A;  4YBH B;  1K94 A;  3H4S E;  3OB1 B;  3PLF B;  3AKB A;  1SCM C;  1S1E A;  1NX1 A;  2KI6 D;  2ZN9 A;  1EL4 A;  2LVK A;  1Y1A A;  1YRU B;  1YX8 A;  2FJU B;  2WOR A;  1A03 A;  2CBL A;  3PN7 B;  2FCD A;  2HF5 A;  3D0Y B;  1V1G A;  1L7Z A;  4QJ4 B;  2LP3 A;  3DVE A;  4BY4 A;  1S3P A;  2LM5 A;  1TNX A;  1TNQ A;  3O6B A;  5I8N A;  4FTG A;  2H61 A;  2LVV A;  3EK4 A;  3JVT C;  4PAL A;  1QAS A;  1QLS A;  4HRH A;  4CFQ A;  2Y1N A;  1QAT A;  1M39 A;  3EVU A;  4DUQ A;  1GGW A;  1JBA A;  1IJ6 A;  3I5G C;  1FW4 A;  1UHH A;  2LE9 B;  3LL8 B;  1KFX L;  2E30 A;  2PSR A;  1N65 A;  4MRX A;  1DJZ A;  2F3Y A;  1WLM A;  4M2O A;  4U8D A;  1A75 A;  3VRP A;  1CMG A;  1SCM B;  2NCO A;  1X02 A;  1NP8 A;  5DKQ A;  4PE0 A;  4PE1 A;  5FYX A;  2B1U A;  1QV0 A;  4C0L A;  4D1E A;  4XJK B;  1EH2 A;  4MRY A;  2I18 A;  3EK7 A;  5HKY A;  5KTY A;  1OMR A;  1YUS A;  1K2H A;  3TZ1 A;  3LK1 A;  4Q04 A;  2M0R A;  1DTL A;  1UUS A;  3OHM B;  1BOD A;  5AER A;  3OX5 A;  2M1U A;  5J3X A;  1XK4 A;  1WLZ A;  1S6C A;  1SK6 D;  5DKN A;  4CID A;  1ZOT B;  2LUC A;  3EVR A;  3PSR A;  1H8B A;  1PVA A;  1ZFS A;  2F33 A;  4BY5 A;  5K89 A;  3I5G B;  3TUY C;  2HQ8 A;  3ICB A;  4JQ0 D;  1K96 A;  2H61 C;  1AUI B;  5AFP A;  2GV5 A;  2WOS A;  4M2Q A;  1JF0 A;  1Y6W A;  2NXQ A;  1YR5 A;  1RK9 A;  2JQ6 A;  2LC5 A;  1Q80 A;  5ER4 X;  4DCK A;  1WRZ A;  4IL1 A;  4PHJ A;  1SW8 A;  2HQW A;  4PDZ A;  4L9M A;  1JWD A;  1B8L A;  1MUX A;  1PVB A;  2JNF A;  2O5G A;  1OQP A;  2HET A;  3WNX B;  1LA3 A;  2BL0 C;  2JT8 A;  1OMV A;  3SG3 A;  2K8M B;  1NX3 A;  4GBA A;  4DS7 A;  1HQV A;  2ZRT A;  4R1E A;  4PHM A;  1M63 B;  1PK0 D;  4NDC A;  2PMY A;  1C07 A;  2K7C A;  1S6J A;  2PAL A;  3BUX B;  4GGN A;  1BT6 A;  2KBI A;  1L2O C;  1KSM A;  4YGA A;  1GJY A;  1YTZ C;  2JT0 A;  2GGZ A;  1IH0 A;  2M3W A;  2L5X B;  1BJF A;  1XK4 C;  2JNX A;  2KFF A;  1IGV A;  3K21 A;  4ZCV A;  2L0P A;  2BCA A;  1YUT A;  2JWW A;  1KCY A;  5ER5 A;  5F6T A;  1BMO A;  1AK8 A;  2P6B B;  1QIW A;  1CFC A;  1B7T Y;  1U5I A;  3CS1 A;  3I5H C;  1SL8 A;  3DD4 A;  1CLM A;  1R6P A;  3CLN A;  2LLU A;  1F71 A;  1UHI A;  3OX6 A;  3SIA A;  3AAJ A;  3WXA A;  1SR6 C;  1JFJ A;  1DJW A;  4WQ2 A;  2Q4U A;  2LAN A;  3CGA A;  1AJ4 A;  3O78 A;  1A29 A;  1CDM A;  4ORC B;  1LXF C;  1CM4 A;  1NIW A;  1BF5 A;  1XFU O;  3LCP C;  3E3R A;  1NSH A;  1AP4 A;  1QJT A;  1FF1 A;  4PE4 A;  1UUR A;  2OPO A;  1K9K A;  1KFU S;  1YVL A;  1NX0 A;  2OTG C;  1XA5 A;  1NX2 A;  2BEC A;  4DRW A;  1EXR A;  1PRW A;  1K93 D;  2L51 A;  1QX2 A;  2EC6 B;  1KK7 Z;  1DJG A;  1JF2 A;  2O60 A;  1NWD A;  4ORA B;  3CZT X;  1XFZ O;  2HPS A;  2KSP A;  1UHJ A;  3PAT A;  4QJ3 B;  4MZJ A;  1ALW A;  5CPV A;  1NYA A;  1TNP A;  1UP5 A;  2MJW B;  3BQ3 A;  3FWB A;  2RGI A;  2MBX A;  1XFY O;  1ZUZ A;  2MHH A;  1QX5 B;  2JPT A;  2Y4Q A;  3I5H B;  3SG7 A;  1SPY A;  1B1G A;  4FQO A;  3DVK A;  2JU0 A;  3VRO A;  1KQM C;  4MEW A;  3WHT B;  3SG4 A;  1KK8 C;  1OE9 B;  3BUW B;  4NDD A;  3KHE A;  1A2X A;  2KAV A;  2KYC A;  1LIN A;  1IJ5 A;  2M1K B;  1SRA A;  1CDL A;  1VRK A;  1WDC C;  1UHN A;  1QS7 A;  2OS8 C;  3KEV A;  1K9P A;  1RTP 1;  3F45 A;  2I94 A;  2OTG B;  1BU3 A;  2LHL A;  1OZO A;  1GQM A;  1TCO B;  3I5F C;  1NUB A;  1S36 A;  4WQ3 A;  2LMU A;  3CR2 A;  1G33 A;  1EJ3 A;  4N1G A;  2BBN A;  1NPQ A;  3GK1 A;  2BKH B;  1LKJ A;  1Y1X A;  2K7B A;  2LMT A;  2ZFD A;  1YVH A;  2KGB C;  3O2P A;  3NXA A;  1KQM B;  2ZN8 A;  2VRG A;  1WRK A;  1MHO A;  3EKJ A;  1G4Y R;  2L2E A;  4CPV A;  1CDP A;  3JVT B;  2FOT A;  4YGE B;  1KFU L;  5HKW A;  2ZNE A;  1U5I B;  1AVS A;  4OKH A;  1RFJ A;  2ISD A;  3SIB A;  2LUX A;  1WDC B;  3DVM A;  3VRN A;  1DGV A;  4A4C A;  1CM1 A;  2AUC A;  1PSB A;  5KSZ A;  2KNE A;  4XYN A;  3NSI A;  4PE7 A;  1N0Y A;  1NCY A;  1S26 D;  1IWQ A;  1UWO A;  2L4I A;  2SCP A;  1MXE A;  2M29 A;  1OZS A;  2TN4 A;  4A4B A;  1F55 A;  2DOQ A;  3SG6 A;  2EHB A;  1FPW A;  2I7A A;  4GUK A;  1F54 A;  2PVB A;  1W7J B;  2KQY A;  4OVN F;  1B8C A;  1KWO C;  2LCP A;  4OR9 B;  4ORB B;  3PAL A;  2CXJ A;  4I5N B;  1ODB A;  3BYA A;  3LK0 A;  4NDB A;  1F70 A;  4WRI A;  3AKA A;  1SNL A;  2ZRS A;  1ALV A;  1XYD A;  2KAY A;  1BG1 A;  3BOW A;  1CDN A;  3CWG A;  2PAS A;  1MWN A;  5I2Q A;  1SL9 A;  5D69 A;  4CLN A;  1ZMZ A;  3JTD C;  4YGB B;  1FBV A;  1TTX A;  4JPZ B;  3ZWH A;  1YUU A;  1GGZ A;  3TUY B;  4CFR A;  1R2U A;  1SCV A;  1XFW O;  2JXL A;  3TS5 C;  5HLV A;  1CLL A;  1MQ1 A;  1J1E A;  3PM8 A;  3VRR A;  3DVJ A;  1PSR A;  3IQQ A;  3SG5 A;  1JUO A;  5I2L A;  4MVF A;  1DGU A;  3FIA A;  1D1O A;  1PUL A;  2MLF C;  2H2K A;  1F4Q A;  3CTN A;  1DMO A;  1UHK A;  1BOC A;  3BUN B;  1A75 B;  1K90 D;  2BL0 B;  1SMG A;  2G9B A;  3GK4 X;  3NSL A;  4I5K A;  4PHK A;  4GGF A;  1DJX A;  2KFH A;  2Q91 A;  2EGD A;  5B8I B;  4XJK A;  5BPJ A;  1J7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...