1LA3A

Solution structure of recoverin mutant, e85q
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
188
structure length
188
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKQYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Structure and calcium-binding studies of a recoverin mutant (E85Q) in an allosteric intermediate state.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 37
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2002-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1la3A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1la3A01
5CSNA 1IWQA 4GGFC 1LA3A 1WRZA 2M8UA 2AMIA 1QIVA 4XJKB 5HKWA 4ORCB 1HQVA 1OSAA 4PHMA 1SL7A 1QJTA 2E6WA 1J7OA 2JTZA 4GGFA 5AXIA 1QIWA 1QX7A 1B8LA 3EVRA 2LUCA 1KSOA 1L2OB 4CIDA 1FPWA 1QTXA 1HT9A 1DMOA 1S5GY 1LA0A 1SW8A 1U5IB 1B7TY 3EVVA 1NX2A 1M63B 5HKZA 2I94A 1S6CA 2GGMA 1J7PA 1OOJA 1PSRA 5KSZA 4AQIA 1B7TZ 1XFVO 1WLMA 1RFJA 2FOTA 4ORBB 2LVKA 4E68A 2DOQA 4PDZA 3WHUB 1A2XA 3LCPC 1CDNA 3DVMA 3D0YA 4PHJA 5FYXA 4HRGA 1ZMZA 1KFXS 2Y5IA 4XYNA 1NUBA 1CFDA 2FCDA 2CNPA 1TIZA 2KHNA 3CGAA 3EKHA 2BKHB 5CSFA 1XFYO 1MXEA 2MA2A 3HCMA 2JU0A 4P5OE 4CFRA 5HLVA 2LP3A 4PE4A 2ISDA 1TOPA 4A4CA 4PE0A 4D1EA 2WCBA 4JQ0D 4PE7A 4MZLA 1OZOA 2KI4B 4GPLB 1B8CA 1CTRA 1QS7A 1SL8A 1ZACA 2MAZA 2R2IA 4MSPA 5PALA 3LK0A 1M45A 4PHNA 2JULA 4FTGA 2I2RE 1KQMB 3AKAA 1TTXA 2JNFA 1MR8A 2BCBA 2LM5A 1XK4C 3I5FC 2M1KB 2Y4QA 2BCXA 1Y1XA 3QRXA 2LVIA 4UPGA 1B47A 3KHEA 5DKRA 3I5IB 3WHTB 2F2OA 2K2FA 1XK4A 4GBAA 4MVFA 1YRTB 3RM1A 4ORAB 1FI5A 4NDDA 1J55A 2KGBC 1CB1A 1AJ5A 1EH2A 4Q04A 4R1EA 3I5GC 1JFJA 2LE9B 3KPXA 1H4BA 4PE1A 1Y1UA 4GFTA 2EC6C 4WRIA 3JTDB 3KO0A 1LKJA 1LVCD 3KF9A 1QX5B 2NLNA 1NX0A 3TUYC 2M49B 4OCIA 1GGZA 1BR1B 1F4QA 1A4PA 1OQPA 3O78A 1XFUO 5ER4X 5KU1A 5KTYA 1AVSA 4MBEA 1SNLA 2MJWB 4CPVA 1ALWA 1DGUA 1LINA 1CDMA 2OTGB 3O4YA 2KFGA 1Y6WA 1SYMA 1ALVA 2L98A 2LMUA 1K90D 1OMDA 1SR6B 1N65A 1BU3A 1TCOB 1KK7Y 2BE6A 2I18A 2JXCA 3AKBA 2HETA 2M9GA 4OR9B 4A4BA 1YUUA 3OX5A 5ER5A 1FI6A 1Q80A 4M2OA 2H61C 2ZRTA 1AHRA 1BMOA 1J1DA 4ICBA 3SG5A 1DTLA 5D69A 1VRKA 2H61A 1PVBA 2CXJA 2OS8C 2JC2A 2HPSA 2L5XB 2JNXA 1PK0D 4CLNA 2TN4A 1IRJA 3DF0A 3BUOB 1JUOA 3VRNA 1WRLA 1YTZC 2BL0B 1RJVA 4N1GA 4MZJA 1K9PA 2KFFA 1CNPA 1EG3A 4OV2A 5B8IB 1PULA 1JSAA 4BY4A 3DVKA 1B1GA 4PCWA 3BUWB 2ZKMX 1MHOA 4I5NB 1NX3A 4C0JA 1S36A 1DJHA 1MQ1A 1XVJA 4C0KA 1IH0A 1EJ3A 1YR5A 5BPJA 3CLNA 4YI8A 1F71A 1DJGA 4YI9A 2IS9A 5CSIA 1C7VA 5I8NA 2NCOA 1CMFA 1RK9A 1V1GA 1NP8A 2ZRSA 2WNDA 2KNEA 2M1UA 2Y1NA 3DVEA 1F55A 1BLQA 2KBMA 1DJYA 2ZN8A 1RECA 2K7DA 1CM4A 2WORA 3NSLA 2K7CA 3SJSA 1WDCB 3ZNIA 1KWOB 3OHMB 1KFUL 1MXLC 1CLLA 1B4CA 1IJ5A 3HX4A 2M7LA 3BUXB 3M0WA 1IQ3A 1EL4A 2NZ0A 3NXAA 4MZKA 2L2EA 3TZ1A 1M31A 2FJUB 1K93D 3BUMB 1IGVA 1E8AA 1QLKA 1G4YR 1J7RA 1IKUA 1JC2A 1M46A 2KGRA 1K94A 3PN7C 1K95A 1XYDA 3OX6A 4DIRA 2F33A 2OPOA 4U8DA 3BYAA 1QLSA 1WY9A 3H4SE 2PSRA 4GGNA 1DJZA 4N5XA 2RGIA 3TS5B 5K89A 2LLSA 2L51A 5GQQC 4NQGA 3EK8A 2B1UA 2K8MB 2LHIA 5CSJA 1NSHA 1IG5A 3LK1A 3I5HB 3VRQA 1IJ6A 2SASA 1SCMB 3JVTB 1JWDA 3AAJA 1XA5A 2F3ZA 1SCVA 1S6IA 2F3YA 4GAOA 1TNQA 1H8BA 2G9BA 2M0RA 2CCMA 4BY5A 4HSZA 3SG3A 4F0ZB 2P6BB 1C7WA 2LNKA 3BQ3A 1SL9A 1NYAA 4L9MA 2WCFA 1UHHA 4GNKB 1DGVA 5DKNA 2MRDA 2A4JA 4YGAA 4YBHB 3FIAA 1XFZO 1N0YA 2JQ6A 1NCZA 4ZCUA 3EKJA 1AK8A 1NCYA 1UURA 2LCPA 1FF1A 1BJFA 1F70A 1GGWA 1DVIA 1JF2A 2PVBA 2KAYA 1ODBA 1L2OC 1S1EA 1YURA 4XJKA 1UWOA 2E30A 1TCFA 1R6PA 3D0YB 5JOLA 4JWQA 1DJIA 1ZOTB 2CBLA 4C0LA 4I5JA 4AQJA 3GK4X 1BODA 1CLMA 1CM1A 2ZN9A 1SMGA 4TNCA 2K2AA 1CDPA 4MEWA 1MF8B 2KQYA 4DCKA 1SK6D 1QVIZ 1QX2A 5TNCA 1TNWA 5HKYA 2JWWA 1IQ5A 3PLFB 4QJ4B 4MLWA 2LVVA 2HQWA 1MUXA 2BECA 2JT0A 3VRRA 1M39A 3SG2A 4ZCVA 4NDBA 3NSOA 2MBXA 1DJWA 3OB1B 1BR4B 3CS1A 2KYCA 3KEVA 3TDZA 1DF0A 3NSKA 1KSMA 2Y1MA 4MRYA 1QXPA 4HRHA 2GGZA 2AUCA 2LMTA 2QPTA 1CFFA 1YVLA 1F4OA 4N1FA 1X02A 4CFQA 2LVJA 4OVNF 1N2DA 4USLA 1K9UA 2KI4C 1BG1A 1YUSA 3WXAA 1PALA 4I5KA 1CKKA 1J1EA 1OMVA 3SIAA 3I5FB 1ZFSA 4P2YB 1KQMC 1UHNA 2WCEA 1DJXA 1AUIB 2PALA 1DT7B 1OZSA 3SG4A 2FCEA 2M7NA 2NXQA 4MRXA 3GK1A 1UHIA 4DRWA 3I5GB 3I5IC 1JF0A 1UUSA 3BOWA 2EHBA 2EC6B 2JT8A 2SCPA 3AAKA 5I2QA 1B9AA 1B8RA 1Y1AA 4JPZB 1QV1A 3TUYB 4QJ5B 1CMGA 2BBNA 2JT3A 1GJYA 2LLUA 3JTDC 2LMVA 3TDIA 4PALA 2BCAA 3K21A 2KFHA 3DD4A 4HREE 2K7OA 1YVHA 3VGOA 2KSPA 1NPQA 2QACA 3SG6A 3BUNB 1KFUS 5JJGA 3C1VA 5CPVA 2LV7A 1J7QA 2LHLA 1WRKA 4WQ2A 3OP0A 1PSBA 2OTGC 5AEQA 1GQMA 2BE4A 1A75A 2KOTA 2M97A 2K61A 2JRFA 1R2UA 2CTNA 3GOFA 1YUTA 1SR6C 1TN4A 1TNPA 1JBAA 1S5GZ 1G8IA 4QJ3B 5G08A 5AANA 1KFXL 1WLZA 3FWBA 1QV0A 5IBWA 2K7BA 4M2QA 5J3XA 1K2HA 2JOJA 3PFVA 1W7JB 1A29A 1PRWA 2OS8B 2JXLA 1XO5A 2JZIA 1F8HA 3DF0B 1DF0B 1YX8A 2JPTA 2KAVA 3O6BA 3DVJA 1KK8C 5HLOA 4MN0A 1ZUZA 2H2KA 3LL8B 3D10A 2O60A 1QASA 1UHJA 2MLEC 4WQ3A 2PRUA 1RTP1 2NCPA 3EK7A 3ZWHA 2CT9A 5AFPA 1BT6A 2HF5A 5I2OA 3PSRA 4GUKA 5D7FA 1FBVA 2BL0C 1LXFC 2BKIB 1A03A 2EGDA 3CR2A 1SRAA 3TDUA 1YRUB 1PVAA 1K9KA 1L7ZA 3BOWB 1KQVA 4DS7A 1OMRA 1UP5A 2F2PA 1QATA 1V1FA 3A8RA 3IF7A 3CWGA 3IQQA 3LLEA 4YGDB 3ICBA 4DUQA 2Q91A 1XFWO 2KDHA 5F6TA 1YX7A 1OE9B 2KI6C 1K8UA 4NDCA 1S3PA 1NX1A 3SIBA 2WC8A 2K0JA 4I5LB 1TNXA 2ZFDA 2AAOA 2L4IA 1W7IB 2HQ8A 1RROA 2Q4UA 2I7AA 4YGCB 1RWYA 1QVIY 3CZTX 3RLZA 1WDCC 3O2PA 1BOCA 1A75B 1KWOC 1U5IA 1AJ4A 2KBIA 4OKHA 3CTNA 2M3WA 4YGBB 1BF5A 3SG7A 2VRGA 3PATA 1TRFA 2F8PA 3OB2B 3VROA 1CFPA 1AP4A 2BBMA 2M29A 3CR4X 3FS7A 2L50A 1SPYA 5DKQA 1NCXA 4YGEB 3PN7B 1EXRA 2COLB 2LAPA 1S6JA 2WOSA 3EVUA 4FQOA 3VRPA 2LLTA 2L4HA 1KCYA 3F45A 5I2LA 2JTTA 2ZNEA 3GK2A 1CDLA 2LANA 4ETOA 1KK7Z 4PHKA 1CFCA 3PALA 1C07A 3WNXB 2LUXA 1G33A 1XFXO 2KAXA 2KI6D 3BXKA 1SY9A 1KK8B 3TS5C 2MLFC 1MWNA 1EG4A 2D8NA 2O5GA 4AOMA 1NIWA 3MSEB 1CLBA 3EK4A 1NWDA 5HYDA 3I5HC 3E3RA 2L0PA 1D1OA 3IQOA 2KYFA 3FWCA 1SCMC 3JVTC 1UHKA 2V53A 4M2PA 3A4UB 3PM8A 1SKTA 2PASA 2LP2A 1SBJA 2MHHA 3NSIA 1FW4A 2G2BA 1JFKA 2ZNDA 1Y0VH 2GV5A 4IL1A 5AERA 2LC5A 1F54A 1K96A 4YRUA 2KQ6A 3CR5X 1S26D 2PMYA
chains in the Genus database with same CATH superfamily
5CSNA 1IWQA 4GGFC 3S0GA 1LA3A 1WRZA 1TWOA 2M8UA 2AMIA 1QIVA 4XJKB 5HKWA 4ORCB 1HQVA 1OSAA 4PHMA 1SL7A 1QJTA 2E6WA 3BFHA 1J7OA 2JTZA 4GGFA 5AXIA 1QIWA 1QX7A 1B8LA 1OOHA 3EVRA 2BNXA 2LUCA 1KSOA 1L2OB 4CIDA 1FPWA 1QTXA 1HT9A 1DMOA 1S5GY 1LA0A 1SW8A 2L5YA 1U5IB 4IJ7A 1B7TY 3EVVA 1NX2A 1M63B 5HKZA 2I94A 3S0BA 1S6CA 2GGMA 3FE8A 1OOJA 1PSRA 3BFBA 5KSZA 1J7PA 4AQIA 1B7TZ 1XFVO 1WLMA 1RFJA 2FOTA 4ORBB 2LVKA 4E68A 2DOQA 4PDZA 3WHUB 1A2XA 3LCPC 1CDNA 3L47A 3DVMA 3D0YA 4PHJA 5FYXA 3NHIA 4HRGA 1ZMZA 1KFXS 2Y5IA 4XYNA 1NUBA 3DXLA 3B6XA 1DEKA 3OBVA 1CFDA 2FCDA 2CNPA 1TIZA 2KHNA 2QEVA 3CGAA 3EKHA 2BKHB 5CSFA 3SS3A 1XFYO 1MXEA 2MA2A 2WCHA 3HCMA 1LS8A 2JU0A 4P5OE 5HLVA 4CFRA 2LP3A 4PE4A 2ISDA 1TOPA 4A4CA 4PE0A 4D1EA 2WCBA 4JQ0D 4PE7A 4MZLA 1OZOA 5EL2A 2KI4B 4GPLB 1B8CA 1CTRA 1QS7A 1SL8A 1ZACA 2MAZA 2R2IA 2GTEA 3B88A 3LK0A 4MSPA 5PALA 1M45A 4PHNA 2JULA 4FTGA 1OW4A 2I2RE 3V2LA 3CYZA 1KQMB 2P71A 3AKAA 1TTXA 2JNFA 1MR8A 2BCBA 2LM5A 1XK4C 3I5FC 4INXA 2M1KB 2Y4QA 2BCXA 1Y1XA 3QRXA 2LVIA 4UPGA 1B47A 3KHEA 5DKRA 3I5IB 3OGNA 3WHTB 2F2OA 2K2FA 1XK4A 4GBAA 4MVFA 1YRTB 3RM1A 4ORAB 1FI5A 4NDDA 1J55A 2KGBC 1CB1A 1AJ5A 1EH2A 4Q04A 4R1EA 3I5GC 1JFJA 3S0DA 2LE9B 4JD9A 3KPXA 1H4BA 4PE1A 1Y1UA 4GFTA 3B87A 2EC6C 4WRIA 3JTDB 3KO0A 1LKJA 1LVCD 1P28A 2WC6A 3KF9A 1QX5B 2WCLA 2NLNA 1NX0A 3TUYC 2M49B 4OCIA 1GGZA 1BR1B 1F4QA 1A4PA 1OQPA 3N7HA 3O78A 1XFUO 2WCJA 5ER4X 5KU1A 4OZDA 5KTYA 1AVSA 4MBEA 1SNLA 2MJWB 3DYEA 4CPVA 1ALWA 1DGUA 1LINA 1CDMA 2OTGB 3O4YA 2KFGA 1Y6WA 1SYMA 1ALVA 2L98A 2LMUA 1K90D 1OMDA 1SR6B 3CZ2A 1N65A 1BU3A 1TCOB 1C3YA 1KK7Y 2BE6A 2I18A 2JXCA 3AKBA 2HETA 2M9GA 4OR9B 4A4BA 1YUUA 3OX5A 5ER5A 1FI6A 1Q80A 4M2OA 2H61C 2ZRTA 1AHRA 1BMOA 1J1DA 4ICBA 4JKTA 3SG5A 1DTLA 5D69A 1VRKA 4FQTA 2KLDA 2KLEA 2H61A 2L2CA 1PVBA 2CXJA 2OS8C 2JC2A 2HPSA 2L5XB 2JNXA 1PK0D 4CLNA 2TN4A 1IRJA 3DF0A 3BUOB 1JUOA 3VRNA 1WRLA 1YTZC 2BL0B 3DY9A 1RJVA 4N1GA 4MZJA 1K9PA 2KFFA 1CNPA 1EG3A 4OV2A 5B8IB 1PULA 1JSAA 2KPHA 4BY4A 3DVKA 1B1GA 3D73A 3NHTA 1XFRA 3BUWB 2ZKMX 4PCWA 1MHOA 4I5NB 1NX3A 3EG5B 1C3ZA 4C0JA 1S36A 3L4LA 1DJHA 1MQ1A 1XVJA 4C0KA 1IH0A 1EJ3A 1YR5A 5BPJA 3CLNA 4YI8A 1F71A 1DJGA 4YI9A 2IS9A 5CSIA 1C7VA 5I8NA 2NCOA 1CMFA 1RK9A 1V1GA 1NP8A 2ZRSA 2WNDA 2KNEA 2M1UA 2Y1NA 3DVEA 1F55A 1BLQA 2KBMA 1DJYA 2ZN8A 2P70A 3BJHA 1RECA 2K7DA 1CM4A 1OOGA 2WORA 2K7CA 3NSLA 3SJSA 1WDCB 3ZNIA 3DZTA 1KWOB 3OHMB 1KFUL 1MXLC 1CLLA 1OOFA 1IJ5A 3HX4A 3IVTA 2M7LA 1B4CA 3BUXB 3M0WA 1IQ3A 1EL4A 2NZ0A 3NXAA 4MZKA 2L2EA 3TZ1A 1M31A 2FJUB 1K93D 3BUMB 1IGVA 1TUJA 3QMEA 1E8AA 2WC5A 1DELA 1QLKA 1G4YR 1J7RA 1IKUA 1JC2A 1M46A 2KGRA 1K94A 3PN7C 1K95A 1XYDA 3OX6A 3SS4A 4DIRA 2F33A 2OPOA 2PQLA 4U8DA 3BYAA 1QLSA 1WY9A 3H4SE 2PSRA 4GGNA 1DJZA 1SSEB 4N5XA 2RGIA 3TS5B 3SS5A 5K89A 2LLSA 2L51A 5GQQC 4NQGA 3EK8A 2B1UA 2K8MB 2LHIA 5CSJA 1NSHA 5D3OA 1IG5A 3LK1A 3D77A 3I5HB 3VRQA 1IJ6A 2SASA 1SCMB 3JVTB 4KYNA 1JWDA 3AAJA 1XA5A 2F3ZA 1SCVA 1S6IA 2F3YA 4GAOA 1TNQA 1H8BA 2G9BA 2M0RA 4F7FA 2CCMA 4BY5A 4HSZA 3SG3A 4F0ZB 2P6BB 1C7WA 3R1VA 2LNKA 5FI6A 3BQ3A 1SL9A 1NYAA 4L9MA 3B7AA 2WCFA 1UHHA 2QEHA 3R1PA 1Z2CB 4GNKB 1DGVA 5DKNA 2MRDA 2A4JA 4YGAA 5FI2A 4YBHB 1GM0A 3FIAA 1XFZO 1N0YA 2JQ6A 1NCZA 4ZCUA 3EKJA 1AK8A 1NCYA 1UURA 2LCPA 1FF1A 1BJFA 1F70A 1GGWA 1DVIA 1JF2A 2PVBA 2KAYA 1ODBA 1L2OC 1S1EA 1YURA 4XJKA 1UWOA 2E30A 1TCFA 1R6PA 3D0YB 4PT1A 5JOLA 2H8VA 1OOIX 4JWQA 1DJIA 1ZOTB 2CBLA 4C0LA 4I5JA 3B86A 4AQJA 3GK4X 1BODA 1CLMA 1CM1A 2ZN9A 1SMGA 4TNCA 2K2AA 1DC1A 1CDPA 4MEWA 1MF8B 2KQYA 4DCKA 1SK6D 1QVIZ 2QEOA 1QX2A 5TNCA 1TNWA 5HKYA 3CDNA 2JWWA 1IQ5A 3PLFB 4QJ4B 4MLWA 2LVVA 2HQWA 1MUXA 2BECA 2JT0A 3VRRA 1M39A 3SG2A 4ZCVA 4NDBA 3NSOA 2MBXA 1DJWA 3OB1B 1BR4B 3CS1A 2KYCA 3KEVA 3TDZA 1DF0A 3NSKA 1KSMA 2Y1MA 4MRYA 1QXPA 4HRHA 2GGZA 2AUCA 2LMTA 2QPTA 1CFFA 1YVLA 1F4OA 4N1FA 1X02A 4CFQA 2LVJA 4OVNF 1N2DA 4USLA 1K9UA 2KI4C 1BG1A 1YUSA 2QEBA 3WXAA 1PALA 4I5KA 1CKKA 1J1EA 1OMVA 3SIAA 3I5FB 1ZFSA 4P2YB 1KQMC 1UHNA 2WCEA 1DJXA 2BAPA 1AUIB 2PALA 1DT7B 1OZSA 3SG4A 2FCEA 2M7NA 2NXQA 5HL1A 4MRXA 3GK1A 1UHIA 4DRWA 3I5GB 3I5IC 1JF0A 1UUSA 3BOWA 2EHBA 2EC6B 1DQEA 2JT8A 2SCPA 3AAKA 5I2QA 1B9AA 1B8RA 1Y1AA 4JPZB 1QV1A 3TUYB 4QJ5B 1CMGA 2BBNA 2JT3A 5I94A 1GJYA 2LLUA 3JTDC 2LMVA 1TUZA 4PALA 3TDIA 2BCAA 3K21A 2KFHA 3DD4A 4HREE 2K7OA 1YVHA 3VGOA 2KSPA 1NPQA 2QACA 3SG6A 3BUNB 1KFUS 5JJGA 3C1VA 2ERBA 3R1OA 5CPVA 2LV7A 1J7QA 3Q8IA 2LHLA 1WRKA 4WQ2A 3OP0A 1PSBA 2OTGC 5AEQA 1GQMA 2BE4A 1A75A 2KOTA 2M97A 3D75A 2K61A 2JRFA 1R2UA 3UO9A 2CTNA 3GOFA 1YUTA 1SR6C 1TN4A 3CABA 1TNPA 1JBAA 1S5GZ 1G8IA 4QJ3B 5G08A 5AANA 1KFXL 3CZ1A 1WLZA 3FWBA 1QV0A 3L4AA 5IBWA 2K7BA 4M2QA 5J3XA 1K2HA 2JOJA 3PJIA 3PFVA 1W7JB 1A29A 1PRWA 2OS8B 2JXLA 1XO5A 2JZIA 1F8HA 3DF0B 1DF0B 1YX8A 2JPTA 2KAVA 3D76A 3DVJA 1KK8C 3O6BA 4MN0A 5HLOA 1ZUZA 2H2KA 3LL8B 3D10A 5FI7A 2O60A 3VB1A 1QASA 1UHJA 2MLEC 4WQ3A 2PRUA 2PYQA 1RTP1 2NCPA 3EK7A 3ZWHA 2CT9A 5AFPA 1BT6A 2HF5A 5I2OA 3PSRA 4GUKA 3O4XA 5D7FA 1FBVA 2BL0C 1LXFC 2BKIB 1A03A 2EGDA 3CR2A 1SRAA 3TDUA 3RZSA 1YRUB 1PVAA 1K9KA 1L7ZA 3BOWB 1KQVA 4DS7A 1OMRA 1UP5A 3FE9A 2F2PA 1QATA 1V1FA 3A8RA 3IF7A 3CWGA 3IQQA 3LLEA 4YGDB 3ICBA 4DUQA 3R72A 2Q91A 1XFWO 3PM2A 2KDHA 5F6TA 1YX7A 1OE9B 2KI6C 1K8UA 4NDCA 1S3PA 3S0EA 1IIOA 1NX1A 3SIBA 2YGUA 2WC8A 2K0JA 4I5LB 1TNXA 2ZFDA 2AAOA 2L4IA 1W7IB 2HQ8A 1RROA 2Q4UA 2I7AA 4YGCB 1RWYA 1QVIY 3CZTX 1ORGA 3RLZA 3FE6A 1WDCC 3O2PA 1BOCA 1A75B 1KWOC 1U5IA 1AJ4A 2KBIA 4OKHA 3CTNA 5DICA 2M3WA 4YGBB 1BF5A 3SG7A 2VRGA 3PATA 1TRFA 2F8PA 3OB2B 1Z4HA 3VROA 1CFPA 1AP4A 2BBMA 2M29A 3CR4X 3FS7A 1T14A 2L50A 1SPYA 5DKQA 1NCXA 4YGEB 3NGVA 1QWVA 2JPOA 3PN7B 1EXRA 2COLB 2QDIA 2LAPA 1S6JA 2WOSA 3EVUA 4FQOA 3VRPA 2LLTA 2L4HA 1KCYA 3F45A 5I2LA 2JTTA 2ZNEA 3D78A 3GK2A 1CDLA 2LANA 4ETOA 1KK7Z 4PHKA 1CFCA 3PALA 4INWA 1C07A 3WNXB 2LUXA 1G33A 1XFXO 2KAXA 2KI6D 3BXKA 1SY9A 1KK8B 3K1EA 3D74A 2MLFC 3TS5C 1MWNA 2WCMA 1EG4A 3BFAA 2D8NA 2O5GA 4AOMA 1NIWA 3MSEB 1CLBA 3EK4A 1NWDA 5HYDA 3I5HC 3E3RA 2L0PA 1D1OA 3IQOA 3UNWA 2KYFA 1W9ZA 3FWCA 1SCMC 3JVTC 1UHKA 2V53A 4M2PA 3A4UB 3PM8A 1SKTA 2K60A 2PASA 2LP2A 1SBJA 2MHHA 3NSIA 2WCKA 1FW4A 2G2BA 1JFKA 2ZNDA 1Y0VH 2GV5A 4IL1A 5AERA 3CZ0A 3S0AA 2LC5A 1F54A 3S0FA 1K96A 4YRUA 2KQ6A 3CR5X 1S26D 2FJYA 2PMYA
chains in the Genus database with same CATH topology
5CSNA 1IWQA 4GGFC 1LA3A 1WRZA 2M8UA 2AMIA 1QIVA 4XJKB 5HKWA 4ORCB 1HQVA 1OSAA 4PHMA 1SL7A 1QJTA 2E6WA 1J7OA 2JTZA 4GGFA 5AXIA 1QIWA 1QX7A 1B8LA 3EVRA 2LUCA 1KSOA 1L2OB 4CIDA 1FPWA 1QTXA 1HT9A 1DMOA 1S5GY 1LA0A 1SW8A 1U5IB 1B7TY 3EVVA 1NX2A 1M63B 5HKZA 2I94A 1S6CA 2GGMA 1J7PA 1OOJA 1PSRA 5KSZA 4AQIA 1B7TZ 1XFVO 1WLMA 1RFJA 2FOTA 4ORBB 2LVKA 4E68A 2DOQA 4PDZA 3WHUB 1A2XA 3LCPC 1CDNA 3DVMA 3D0YA 4PHJA 5FYXA 4HRGA 1ZMZA 1KFXS 2Y5IA 4XYNA 1NUBA 1CFDA 2FCDA 2CNPA 1TIZA 2KHNA 3CGAA 3EKHA 2BKHB 5CSFA 1XFYO 1MXEA 2MA2A 3HCMA 2JU0A 4P5OE 4CFRA 5HLVA 2LP3A 4PE4A 2ISDA 1TOPA 4A4CA 4PE0A 4D1EA 2WCBA 4JQ0D 4PE7A 4MZLA 1OZOA 2KI4B 4GPLB 1B8CA 1CTRA 1QS7A 1SL8A 1ZACA 2MAZA 2R2IA 4MSPA 5PALA 3LK0A 1M45A 4PHNA 2JULA 4FTGA 2I2RE 1KQMB 3AKAA 1TTXA 2JNFA 1MR8A 2BCBA 2LM5A 1XK4C 3I5FC 2M1KB 2Y4QA 2BCXA 1Y1XA 3QRXA 2LVIA 4UPGA 1B47A 3KHEA 5DKRA 3I5IB 3WHTB 2F2OA 2K2FA 1XK4A 4GBAA 4MVFA 1YRTB 3RM1A 4ORAB 1FI5A 4NDDA 1J55A 2KGBC 1CB1A 1AJ5A 1EH2A 4Q04A 4R1EA 3I5GC 1JFJA 2LE9B 3KPXA 1H4BA 4PE1A 1Y1UA 4GFTA 2EC6C 4WRIA 3JTDB 3KO0A 1LKJA 1LVCD 3KF9A 1QX5B 2NLNA 1NX0A 3TUYC 2M49B 4OCIA 1GGZA 1BR1B 1F4QA 1A4PA 1OQPA 3O78A 1XFUO 5ER4X 5KU1A 5KTYA 1AVSA 4MBEA 1SNLA 2MJWB 4CPVA 1ALWA 1DGUA 1LINA 1CDMA 2OTGB 3O4YA 2KFGA 1Y6WA 1SYMA 1ALVA 2L98A 2LMUA 1K90D 1OMDA 1SR6B 1N65A 1BU3A 1TCOB 1KK7Y 2BE6A 2I18A 2JXCA 3AKBA 2HETA 2M9GA 4OR9B 4A4BA 1YUUA 3OX5A 5ER5A 1FI6A 1Q80A 4M2OA 2H61C 2ZRTA 1AHRA 1BMOA 1J1DA 4ICBA 3SG5A 1DTLA 5D69A 1VRKA 2H61A 1PVBA 2CXJA 2OS8C 2JC2A 2HPSA 2L5XB 2JNXA 1PK0D 4CLNA 2TN4A 1IRJA 3DF0A 3BUOB 1JUOA 3VRNA 1WRLA 1YTZC 2BL0B 1RJVA 4N1GA 4MZJA 1K9PA 2KFFA 1CNPA 1EG3A 4OV2A 5B8IB 1PULA 1JSAA 4BY4A 3DVKA 1B1GA 4PCWA 3BUWB 2ZKMX 1MHOA 4I5NB 1NX3A 4C0JA 1S36A 1DJHA 1MQ1A 1XVJA 4C0KA 1IH0A 1EJ3A 1YR5A 5BPJA 3CLNA 4YI8A 1F71A 1DJGA 4YI9A 2IS9A 5CSIA 1C7VA 5I8NA 2NCOA 1CMFA 1RK9A 1V1GA 1NP8A 2ZRSA 2WNDA 2KNEA 2M1UA 2Y1NA 3DVEA 1F55A 1BLQA 2KBMA 1DJYA 2ZN8A 1RECA 2K7DA 1CM4A 2WORA 3NSLA 2K7CA 3SJSA 1WDCB 3ZNIA 1KWOB 3OHMB 1KFUL 1MXLC 1CLLA 1B4CA 1IJ5A 3HX4A 2M7LA 3BUXB 3M0WA 1IQ3A 1EL4A 2NZ0A 3NXAA 4MZKA 2L2EA 3TZ1A 1M31A 2FJUB 1K93D 3BUMB 1IGVA 1E8AA 1QLKA 1G4YR 1J7RA 1IKUA 1JC2A 1M46A 2KGRA 1K94A 3PN7C 1K95A 1XYDA 3OX6A 4DIRA 2F33A 2OPOA 4U8DA 3BYAA 1QLSA 1WY9A 3H4SE 2PSRA 4GGNA 1DJZA 4N5XA 2RGIA 3TS5B 5K89A 2LLSA 2L51A 5GQQC 4NQGA 3EK8A 2B1UA 2K8MB 2LHIA 5CSJA 1NSHA 1IG5A 3LK1A 3I5HB 3VRQA 1IJ6A 2SASA 1SCMB 3JVTB 1JWDA 3AAJA 1XA5A 2F3ZA 1SCVA 1S6IA 2F3YA 4GAOA 1TNQA 1H8BA 2G9BA 2M0RA 2CCMA 4BY5A 4HSZA 3SG3A 4F0ZB 2P6BB 1C7WA 2LNKA 3BQ3A 1SL9A 1NYAA 4L9MA 2WCFA 1UHHA 4GNKB 1DGVA 5DKNA 2MRDA 2A4JA 4YGAA 4YBHB 3FIAA 1XFZO 1N0YA 2JQ6A 1NCZA 4ZCUA 3EKJA 1AK8A 1NCYA 1UURA 2LCPA 1FF1A 1BJFA 1F70A 1GGWA 1DVIA 1JF2A 2PVBA 2KAYA 1ODBA 1L2OC 1S1EA 1YURA 4XJKA 1UWOA 2E30A 1TCFA 1R6PA 3D0YB 5JOLA 4JWQA 1DJIA 1ZOTB 2CBLA 4C0LA 4I5JA 4AQJA 3GK4X 1BODA 1CLMA 1CM1A 2ZN9A 1SMGA 4TNCA 2K2AA 1CDPA 4MEWA 1MF8B 2KQYA 4DCKA 1SK6D 1QVIZ 1QX2A 5TNCA 1TNWA 5HKYA 2JWWA 1IQ5A 3PLFB 4QJ4B 4MLWA 2LVVA 2HQWA 1MUXA 2BECA 2JT0A 3VRRA 1M39A 3SG2A 4ZCVA 4NDBA 3NSOA 2MBXA 1DJWA 3OB1B 1BR4B 3CS1A 2KYCA 3KEVA 3TDZA 1DF0A 3NSKA 1KSMA 2Y1MA 4MRYA 1QXPA 4HRHA 2GGZA 2AUCA 2LMTA 2QPTA 1CFFA 1YVLA 1F4OA 4N1FA 1X02A 4CFQA 2LVJA 4OVNF 1N2DA 4USLA 1K9UA 2KI4C 1BG1A 1YUSA 3WXAA 1PALA 4I5KA 1CKKA 1J1EA 1OMVA 3SIAA 3I5FB 1ZFSA 4P2YB 1KQMC 1UHNA 2WCEA 1DJXA 1AUIB 2PALA 1DT7B 1OZSA 3SG4A 2FCEA 2M7NA 2NXQA 4MRXA 3GK1A 1UHIA 4DRWA 3I5GB 3I5IC 1JF0A 1UUSA 3BOWA 2EHBA 2EC6B 2JT8A 2SCPA 3AAKA 5I2QA 1B9AA 1B8RA 1Y1AA 4JPZB 1QV1A 3TUYB 4QJ5B 1CMGA 2BBNA 2JT3A 1GJYA 2LLUA 3JTDC 2LMVA 3TDIA 4PALA 2BCAA 3K21A 2KFHA 3DD4A 4HREE 2K7OA 1YVHA 3VGOA 2KSPA 1NPQA 2QACA 3SG6A 3BUNB 1KFUS 5JJGA 3C1VA 5CPVA 2LV7A 1J7QA 2LHLA 1WRKA 4WQ2A 3OP0A 1PSBA 2OTGC 5AEQA 1GQMA 2BE4A 1A75A 2KOTA 2M97A 2K61A 2JRFA 1R2UA 2CTNA 3GOFA 1YUTA 1SR6C 1TN4A 1TNPA 1JBAA 1S5GZ 1G8IA 4QJ3B 5G08A 5AANA 1KFXL 1WLZA 3FWBA 1QV0A 5IBWA 2K7BA 4M2QA 5J3XA 1K2HA 2JOJA 3PFVA 1W7JB 1A29A 1PRWA 2OS8B 2JXLA 1XO5A 2JZIA 1F8HA 3DF0B 1DF0B 1YX8A 2JPTA 2KAVA 3O6BA 3DVJA 1KK8C 5HLOA 4MN0A 1ZUZA 2H2KA 3LL8B 3D10A 2O60A 1QASA 1UHJA 2MLEC 4WQ3A 2PRUA 1RTP1 2NCPA 3EK7A 3ZWHA 2CT9A 5AFPA 1BT6A 2HF5A 5I2OA 3PSRA 4GUKA 5D7FA 1FBVA 2BL0C 1LXFC 2BKIB 1A03A 2EGDA 3CR2A 1SRAA 3TDUA 1YRUB 1PVAA 1K9KA 1L7ZA 3BOWB 1KQVA 4DS7A 1OMRA 1UP5A 2F2PA 1QATA 1V1FA 3A8RA 3IF7A 3CWGA 3IQQA 3LLEA 4YGDB 3ICBA 4DUQA 2Q91A 1XFWO 2KDHA 5F6TA 1YX7A 1OE9B 2KI6C 1K8UA 4NDCA 1S3PA 1NX1A 3SIBA 2WC8A 2K0JA 4I5LB 1TNXA 2ZFDA 2AAOA 2L4IA 1W7IB 2HQ8A 1RROA 2Q4UA 2I7AA 4YGCB 1RWYA 1QVIY 3CZTX 3RLZA 1WDCC 3O2PA 1BOCA 1A75B 1KWOC 1U5IA 1AJ4A 2KBIA 4OKHA 3CTNA 2M3WA 4YGBB 1BF5A 3SG7A 2VRGA 3PATA 1TRFA 2F8PA 3OB2B 3VROA 1CFPA 1AP4A 2BBMA 2M29A 3CR4X 3FS7A 2L50A 1SPYA 5DKQA 1NCXA 4YGEB 3PN7B 1EXRA 2COLB 2LAPA 1S6JA 2WOSA 3EVUA 4FQOA 3VRPA 2LLTA 2L4HA 1KCYA 3F45A 5I2LA 2JTTA 2ZNEA 3GK2A 1CDLA 2LANA 4ETOA 1KK7Z 4PHKA 1CFCA 3PALA 1C07A 3WNXB 2LUXA 1G33A 1XFXO 2KAXA 2KI6D 3BXKA 1SY9A 1KK8B 3TS5C 2MLFC 1MWNA 1EG4A 2D8NA 2O5GA 4AOMA 1NIWA 3MSEB 1CLBA 3EK4A 1NWDA 5HYDA 3I5HC 3E3RA 2L0PA 1D1OA 3IQOA 2KYFA 3FWCA 1SCMC 3JVTC 1UHKA 2V53A 4M2PA 3A4UB 3PM8A 1SKTA 2PASA 2LP2A 1SBJA 2MHHA 3NSIA 1FW4A 2G2BA 1JFKA 2ZNDA 1Y0VH 2GV5A 4IL1A 5AERA 2LC5A 1F54A 1K96A 4YRUA 2KQ6A 3CR5X 1S26D 2PMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSN A;  1IWQ A;  4GGF C;  1LA3 A;  1WRZ A;  2M8U A;  2AMI A;  1QIV A;  4XJK B;  5HKW A;  4ORC B;  1HQV A;  1OSA A;  4PHM A;  1SL7 A;  1QJT A;  2E6W A;  1J7O A;  2JTZ A;  4GGF A;  5AXI A;  1QIW A;  1QX7 A;  1B8L A;  3EVR A;  2LUC A;  1KSO A;  1L2O B;  4CID A;  1FPW A;  1QTX A;  1HT9 A;  1DMO A;  1S5G Y;  1LA0 A;  1SW8 A;  1U5I B;  1B7T Y;  3EVV A;  1NX2 A;  1M63 B;  5HKZ A;  2I94 A;  1S6C A;  2GGM A;  1J7P A;  1OOJ A;  1PSR A;  5KSZ A;  4AQI A;  1B7T Z;  1XFV O;  1WLM A;  1RFJ A;  2FOT A;  4ORB B;  2LVK A;  4E68 A;  2DOQ A;  4PDZ A;  3WHU B;  1A2X A;  3LCP C;  1CDN A;  3DVM A;  3D0Y A;  4PHJ A;  5FYX A;  4HRG A;  1ZMZ A;  1KFX S;  2Y5I A;  4XYN A;  1NUB A;  1CFD A;  2FCD A;  2CNP A;  1TIZ A;  2KHN A;  3CGA A;  3EKH A;  2BKH B;  5CSF A;  1XFY O;  1MXE A;  2MA2 A;  3HCM A;  2JU0 A;  4P5O E;  4CFR A;  5HLV A;  2LP3 A;  4PE4 A;  2ISD A;  1TOP A;  4A4C A;  4PE0 A;  4D1E A;  2WCB A;  4JQ0 D;  4PE7 A;  4MZL A;  1OZO A;  2KI4 B;  4GPL B;  1B8C A;  1CTR A;  1QS7 A;  1SL8 A;  1ZAC A;  2MAZ A;  2R2I A;  4MSP A;  5PAL A;  3LK0 A;  1M45 A;  4PHN A;  2JUL A;  4FTG A;  2I2R E;  1KQM B;  3AKA A;  1TTX A;  2JNF A;  1MR8 A;  2BCB A;  2LM5 A;  1XK4 C;  3I5F C;  2M1K B;  2Y4Q A;  2BCX A;  1Y1X A;  3QRX A;  2LVI A;  4UPG A;  1B47 A;  3KHE A;  5DKR A;  3I5I B;  3WHT B;  2F2O A;  2K2F A;  1XK4 A;  4GBA A;  4MVF A;  1YRT B;  3RM1 A;  4ORA B;  1FI5 A;  4NDD A;  1J55 A;  2KGB C;  1CB1 A;  1AJ5 A;  1EH2 A;  4Q04 A;  4R1E A;  3I5G C;  1JFJ A;  2LE9 B;  3KPX A;  1H4B A;  4PE1 A;  1Y1U A;  4GFT A;  2EC6 C;  4WRI A;  3JTD B;  3KO0 A;  1LKJ A;  1LVC D;  3KF9 A;  1QX5 B;  2NLN A;  1NX0 A;  3TUY C;  2M49 B;  4OCI A;  1GGZ A;  1BR1 B;  1F4Q A;  1A4P A;  1OQP A;  3O78 A;  1XFU O;  5ER4 X;  5KU1 A;  5KTY A;  1AVS A;  4MBE A;  1SNL A;  2MJW B;  4CPV A;  1ALW A;  1DGU A;  1LIN A;  1CDM A;  2OTG B;  3O4Y A;  2KFG A;  1Y6W A;  1SYM A;  1ALV A;  2L98 A;  2LMU A;  1K90 D;  1OMD A;  1SR6 B;  1N65 A;  1BU3 A;  1TCO B;  1KK7 Y;  2BE6 A;  2I18 A;  2JXC A;  3AKB A;  2HET A;  2M9G A;  4OR9 B;  4A4B A;  1YUU A;  3OX5 A;  5ER5 A;  1FI6 A;  1Q80 A;  4M2O A;  2H61 C;  2ZRT A;  1AHR A;  1BMO A;  1J1D A;  4ICB A;  3SG5 A;  1DTL A;  5D69 A;  1VRK A;  2H61 A;  1PVB A;  2CXJ A;  2OS8 C;  2JC2 A;  2HPS A;  2L5X B;  2JNX A;  1PK0 D;  4CLN A;  2TN4 A;  1IRJ A;  3DF0 A;  3BUO B;  1JUO A;  3VRN A;  1WRL A;  1YTZ C;  2BL0 B;  1RJV A;  4N1G A;  4MZJ A;  1K9P A;  2KFF A;  1CNP A;  1EG3 A;  4OV2 A;  5B8I B;  1PUL A;  1JSA A;  4BY4 A;  3DVK A;  1B1G A;  4PCW A;  3BUW B;  2ZKM X;  1MHO A;  4I5N B;  1NX3 A;  4C0J A;  1S36 A;  1DJH A;  1MQ1 A;  1XVJ A;  4C0K A;  1IH0 A;  1EJ3 A;  1YR5 A;  5BPJ A;  3CLN A;  4YI8 A;  1F71 A;  1DJG A;  4YI9 A;  2IS9 A;  5CSI A;  1C7V A;  5I8N A;  2NCO A;  1CMF A;  1RK9 A;  1V1G A;  1NP8 A;  2ZRS A;  2WND A;  2KNE A;  2M1U A;  2Y1N A;  3DVE A;  1F55 A;  1BLQ A;  2KBM A;  1DJY A;  2ZN8 A;  1REC A;  2K7D A;  1CM4 A;  2WOR A;  3NSL A;  2K7C A;  3SJS A;  1WDC B;  3ZNI A;  1KWO B;  3OHM B;  1KFU L;  1MXL C;  1CLL A;  1B4C A;  1IJ5 A;  3HX4 A;  2M7L A;  3BUX B;  3M0W A;  1IQ3 A;  1EL4 A;  2NZ0 A;  3NXA A;  4MZK A;  2L2E A;  3TZ1 A;  1M31 A;  2FJU B;  1K93 D;  3BUM B;  1IGV A;  1E8A A;  1QLK A;  1G4Y R;  1J7R A;  1IKU A;  1JC2 A;  1M46 A;  2KGR A;  1K94 A;  3PN7 C;  1K95 A;  1XYD A;  3OX6 A;  4DIR A;  2F33 A;  2OPO A;  4U8D A;  3BYA A;  1QLS A;  1WY9 A;  3H4S E;  2PSR A;  4GGN A;  1DJZ A;  4N5X A;  2RGI A;  3TS5 B;  5K89 A;  2LLS A;  2L51 A;  5GQQ C;  4NQG A;  3EK8 A;  2B1U A;  2K8M B;  2LHI A;  5CSJ A;  1NSH A;  1IG5 A;  3LK1 A;  3I5H B;  3VRQ A;  1IJ6 A;  2SAS A;  1SCM B;  3JVT B;  1JWD A;  3AAJ A;  1XA5 A;  2F3Z A;  1SCV A;  1S6I A;  2F3Y A;  4GAO A;  1TNQ A;  1H8B A;  2G9B A;  2M0R A;  2CCM A;  4BY5 A;  4HSZ A;  3SG3 A;  4F0Z B;  2P6B B;  1C7W A;  2LNK A;  3BQ3 A;  1SL9 A;  1NYA A;  4L9M A;  2WCF A;  1UHH A;  4GNK B;  1DGV A;  5DKN A;  2MRD A;  2A4J A;  4YGA A;  4YBH B;  3FIA A;  1XFZ O;  1N0Y A;  2JQ6 A;  1NCZ A;  4ZCU A;  3EKJ A;  1AK8 A;  1NCY A;  1UUR A;  2LCP A;  1FF1 A;  1BJF A;  1F70 A;  1GGW A;  1DVI A;  1JF2 A;  2PVB A;  2KAY A;  1ODB A;  1L2O C;  1S1E A;  1YUR A;  4XJK A;  1UWO A;  2E30 A;  1TCF A;  1R6P A;  3D0Y B;  5JOL A;  4JWQ A;  1DJI A;  1ZOT B;  2CBL A;  4C0L A;  4I5J A;  4AQJ A;  3GK4 X;  1BOD A;  1CLM A;  1CM1 A;  2ZN9 A;  1SMG A;  4TNC A;  2K2A A;  1CDP A;  4MEW A;  1MF8 B;  2KQY A;  4DCK A;  1SK6 D;  1QVI Z;  1QX2 A;  5TNC A;  1TNW A;  5HKY A;  2JWW A;  1IQ5 A;  3PLF B;  4QJ4 B;  4MLW A;  2LVV A;  2HQW A;  1MUX A;  2BEC A;  2JT0 A;  3VRR A;  1M39 A;  3SG2 A;  4ZCV A;  4NDB A;  3NSO A;  2MBX A;  1DJW A;  3OB1 B;  1BR4 B;  3CS1 A;  2KYC A;  3KEV A;  3TDZ A;  1DF0 A;  3NSK A;  1KSM A;  2Y1M A;  4MRY A;  1QXP A;  4HRH A;  2GGZ A;  2AUC A;  2LMT A;  2QPT A;  1CFF A;  1YVL A;  1F4O A;  4N1F A;  1X02 A;  4CFQ A;  2LVJ A;  4OVN F;  1N2D A;  4USL A;  1K9U A;  2KI4 C;  1BG1 A;  1YUS A;  3WXA A;  1PAL A;  4I5K A;  1CKK A;  1J1E A;  1OMV A;  3SIA A;  3I5F B;  1ZFS A;  4P2Y B;  1KQM C;  1UHN A;  2WCE A;  1DJX A;  1AUI B;  2PAL A;  1DT7 B;  1OZS A;  3SG4 A;  2FCE A;  2M7N A;  2NXQ A;  4MRX A;  3GK1 A;  1UHI A;  4DRW A;  3I5G B;  3I5I C;  1JF0 A;  1UUS A;  3BOW A;  2EHB A;  2EC6 B;  2JT8 A;  2SCP A;  3AAK A;  5I2Q A;  1B9A A;  1B8R A;  1Y1A A;  4JPZ B;  1QV1 A;  3TUY B;  4QJ5 B;  1CMG A;  2BBN A;  2JT3 A;  1GJY A;  2LLU A;  3JTD C;  2LMV A;  3TDI A;  4PAL A;  2BCA A;  3K21 A;  2KFH A;  3DD4 A;  4HRE E;  2K7O A;  1YVH A;  3VGO A;  2KSP A;  1NPQ A;  2QAC A;  3SG6 A;  3BUN B;  1KFU S;  5JJG A;  3C1V A;  5CPV A;  2LV7 A;  1J7Q A;  2LHL A;  1WRK A;  4WQ2 A;  3OP0 A;  1PSB A;  2OTG C;  5AEQ A;  1GQM A;  2BE4 A;  1A75 A;  2KOT A;  2M97 A;  2K61 A;  2JRF A;  1R2U A;  2CTN A;  3GOF A;  1YUT A;  1SR6 C;  1TN4 A;  1TNP A;  1JBA A;  1S5G Z;  1G8I A;  4QJ3 B;  5G08 A;  5AAN A;  1KFX L;  1WLZ A;  3FWB A;  1QV0 A;  5IBW A;  2K7B A;  4M2Q A;  5J3X A;  1K2H A;  2JOJ A;  3PFV A;  1W7J B;  1A29 A;  1PRW A;  2OS8 B;  2JXL A;  1XO5 A;  2JZI A;  1F8H A;  3DF0 B;  1DF0 B;  1YX8 A;  2JPT A;  2KAV A;  3O6B A;  3DVJ A;  1KK8 C;  5HLO A;  4MN0 A;  1ZUZ A;  2H2K A;  3LL8 B;  3D10 A;  2O60 A;  1QAS A;  1UHJ A;  2MLE C;  4WQ3 A;  2PRU A;  1RTP 1;  2NCP A;  3EK7 A;  3ZWH A;  2CT9 A;  5AFP A;  1BT6 A;  2HF5 A;  5I2O A;  3PSR A;  4GUK A;  5D7F A;  1FBV A;  2BL0 C;  1LXF C;  2BKI B;  1A03 A;  2EGD A;  3CR2 A;  1SRA A;  3TDU A;  1YRU B;  1PVA A;  1K9K A;  1L7Z A;  3BOW B;  1KQV A;  4DS7 A;  1OMR A;  1UP5 A;  2F2P A;  1QAT A;  1V1F A;  3A8R A;  3IF7 A;  3CWG A;  3IQQ A;  3LLE A;  4YGD B;  3ICB A;  4DUQ A;  2Q91 A;  1XFW O;  2KDH A;  5F6T A;  1YX7 A;  1OE9 B;  2KI6 C;  1K8U A;  4NDC A;  1S3P A;  1NX1 A;  3SIB A;  2WC8 A;  2K0J A;  4I5L B;  1TNX A;  2ZFD A;  2AAO A;  2L4I A;  1W7I B;  2HQ8 A;  1RRO A;  2Q4U A;  2I7A A;  4YGC B;  1RWY A;  1QVI Y;  3CZT X;  3RLZ A;  1WDC C;  3O2P A;  1BOC A;  1A75 B;  1KWO C;  1U5I A;  1AJ4 A;  2KBI A;  4OKH A;  3CTN A;  2M3W A;  4YGB B;  1BF5 A;  3SG7 A;  2VRG A;  3PAT A;  1TRF A;  2F8P A;  3OB2 B;  3VRO A;  1CFP A;  1AP4 A;  2BBM A;  2M29 A;  3CR4 X;  3FS7 A;  2L50 A;  1SPY A;  5DKQ A;  1NCX A;  4YGE B;  3PN7 B;  1EXR A;  2COL B;  2LAP A;  1S6J A;  2WOS A;  3EVU A;  4FQO A;  3VRP A;  2LLT A;  2L4H A;  1KCY A;  3F45 A;  5I2L A;  2JTT A;  2ZNE A;  3GK2 A;  1CDL A;  2LAN A;  4ETO A;  1KK7 Z;  4PHK A;  1CFC A;  3PAL A;  1C07 A;  3WNX B;  2LUX A;  1G33 A;  1XFX O;  2KAX A;  2KI6 D;  3BXK A;  1SY9 A;  1KK8 B;  3TS5 C;  2MLF C;  1MWN A;  1EG4 A;  2D8N A;  2O5G A;  4AOM A;  1NIW A;  3MSE B;  1CLB A;  3EK4 A;  1NWD A;  5HYD A;  3I5H C;  3E3R A;  2L0P A;  1D1O A;  3IQO A;  2KYF A;  3FWC A;  1SCM C;  3JVT C;  1UHK A;  2V53 A;  4M2P A;  3A4U B;  3PM8 A;  1SKT A;  2PAS A;  2LP2 A;  1SBJ A;  2MHH A;  3NSI A;  1FW4 A;  2G2B A;  1JFK A;  2ZND A;  1Y0V H;  2GV5 A;  4IL1 A;  5AER A;  2LC5 A;  1F54 A;  1K96 A;  4YRU A;  2KQ6 A;  3CR5 X;  1S26 D;  2PMY A; 
#chains in the Genus database with same CATH topology
 5CSN A;  1IWQ A;  4GGF C;  3S0G A;  1LA3 A;  1WRZ A;  1TWO A;  2M8U A;  2AMI A;  1QIV A;  4XJK B;  5HKW A;  4ORC B;  1HQV A;  1OSA A;  4PHM A;  1SL7 A;  1QJT A;  2E6W A;  3BFH A;  1J7O A;  2JTZ A;  4GGF A;  5AXI A;  1QIW A;  1QX7 A;  1B8L A;  1OOH A;  3EVR A;  2BNX A;  2LUC A;  1KSO A;  1L2O B;  4CID A;  1FPW A;  1QTX A;  1HT9 A;  1DMO A;  1S5G Y;  1LA0 A;  1SW8 A;  2L5Y A;  1U5I B;  4IJ7 A;  1B7T Y;  3EVV A;  1NX2 A;  1M63 B;  5HKZ A;  2I94 A;  3S0B A;  1S6C A;  2GGM A;  3FE8 A;  1OOJ A;  1PSR A;  3BFB A;  5KSZ A;  1J7P A;  4AQI A;  1B7T Z;  1XFV O;  1WLM A;  1RFJ A;  2FOT A;  4ORB B;  2LVK A;  4E68 A;  2DOQ A;  4PDZ A;  3WHU B;  1A2X A;  3LCP C;  1CDN A;  3L47 A;  3DVM A;  3D0Y A;  4PHJ A;  5FYX A;  3NHI A;  4HRG A;  1ZMZ A;  1KFX S;  2Y5I A;  4XYN A;  1NUB A;  3DXL A;  3B6X A;  1DEK A;  3OBV A;  1CFD A;  2FCD A;  2CNP A;  1TIZ A;  2KHN A;  2QEV A;  3CGA A;  3EKH A;  2BKH B;  5CSF A;  3SS3 A;  1XFY O;  1MXE A;  2MA2 A;  2WCH A;  3HCM A;  1LS8 A;  2JU0 A;  4P5O E;  5HLV A;  4CFR A;  2LP3 A;  4PE4 A;  2ISD A;  1TOP A;  4A4C A;  4PE0 A;  4D1E A;  2WCB A;  4JQ0 D;  4PE7 A;  4MZL A;  1OZO A;  5EL2 A;  2KI4 B;  4GPL B;  1B8C A;  1CTR A;  1QS7 A;  1SL8 A;  1ZAC A;  2MAZ A;  2R2I A;  2GTE A;  3B88 A;  3LK0 A;  4MSP A;  5PAL A;  1M45 A;  4PHN A;  2JUL A;  4FTG A;  1OW4 A;  2I2R E;  3V2L A;  3CYZ A;  1KQM B;  2P71 A;  3AKA A;  1TTX A;  2JNF A;  1MR8 A;  2BCB A;  2LM5 A;  1XK4 C;  3I5F C;  4INX A;  2M1K B;  2Y4Q A;  2BCX A;  1Y1X A;  3QRX A;  2LVI A;  4UPG A;  1B47 A;  3KHE A;  5DKR A;  3I5I B;  3OGN A;  3WHT B;  2F2O A;  2K2F A;  1XK4 A;  4GBA A;  4MVF A;  1YRT B;  3RM1 A;  4ORA B;  1FI5 A;  4NDD A;  1J55 A;  2KGB C;  1CB1 A;  1AJ5 A;  1EH2 A;  4Q04 A;  4R1E A;  3I5G C;  1JFJ A;  3S0D A;  2LE9 B;  4JD9 A;  3KPX A;  1H4B A;  4PE1 A;  1Y1U A;  4GFT A;  3B87 A;  2EC6 C;  4WRI A;  3JTD B;  3KO0 A;  1LKJ A;  1LVC D;  1P28 A;  2WC6 A;  3KF9 A;  1QX5 B;  2WCL A;  2NLN A;  1NX0 A;  3TUY C;  2M49 B;  4OCI A;  1GGZ A;  1BR1 B;  1F4Q A;  1A4P A;  1OQP A;  3N7H A;  3O78 A;  1XFU O;  2WCJ A;  5ER4 X;  5KU1 A;  4OZD A;  5KTY A;  1AVS A;  4MBE A;  1SNL A;  2MJW B;  3DYE A;  4CPV A;  1ALW A;  1DGU A;  1LIN A;  1CDM A;  2OTG B;  3O4Y A;  2KFG A;  1Y6W A;  1SYM A;  1ALV A;  2L98 A;  2LMU A;  1K90 D;  1OMD A;  1SR6 B;  3CZ2 A;  1N65 A;  1BU3 A;  1TCO B;  1C3Y A;  1KK7 Y;  2BE6 A;  2I18 A;  2JXC A;  3AKB A;  2HET A;  2M9G A;  4OR9 B;  4A4B A;  1YUU A;  3OX5 A;  5ER5 A;  1FI6 A;  1Q80 A;  4M2O A;  2H61 C;  2ZRT A;  1AHR A;  1BMO A;  1J1D A;  4ICB A;  4JKT A;  3SG5 A;  1DTL A;  5D69 A;  1VRK A;  4FQT A;  2KLD A;  2KLE A;  2H61 A;  2L2C A;  1PVB A;  2CXJ A;  2OS8 C;  2JC2 A;  2HPS A;  2L5X B;  2JNX A;  1PK0 D;  4CLN A;  2TN4 A;  1IRJ A;  3DF0 A;  3BUO B;  1JUO A;  3VRN A;  1WRL A;  1YTZ C;  2BL0 B;  3DY9 A;  1RJV A;  4N1G A;  4MZJ A;  1K9P A;  2KFF A;  1CNP A;  1EG3 A;  4OV2 A;  5B8I B;  1PUL A;  1JSA A;  2KPH A;  4BY4 A;  3DVK A;  1B1G A;  3D73 A;  3NHT A;  1XFR A;  3BUW B;  2ZKM X;  4PCW A;  1MHO A;  4I5N B;  1NX3 A;  3EG5 B;  1C3Z A;  4C0J A;  1S36 A;  3L4L A;  1DJH A;  1MQ1 A;  1XVJ A;  4C0K A;  1IH0 A;  1EJ3 A;  1YR5 A;  5BPJ A;  3CLN A;  4YI8 A;  1F71 A;  1DJG A;  4YI9 A;  2IS9 A;  5CSI A;  1C7V A;  5I8N A;  2NCO A;  1CMF A;  1RK9 A;  1V1G A;  1NP8 A;  2ZRS A;  2WND A;  2KNE A;  2M1U A;  2Y1N A;  3DVE A;  1F55 A;  1BLQ A;  2KBM A;  1DJY A;  2ZN8 A;  2P70 A;  3BJH A;  1REC A;  2K7D A;  1CM4 A;  1OOG A;  2WOR A;  2K7C A;  3NSL A;  3SJS A;  1WDC B;  3ZNI A;  3DZT A;  1KWO B;  3OHM B;  1KFU L;  1MXL C;  1CLL A;  1OOF A;  1IJ5 A;  3HX4 A;  3IVT A;  2M7L A;  1B4C A;  3BUX B;  3M0W A;  1IQ3 A;  1EL4 A;  2NZ0 A;  3NXA A;  4MZK A;  2L2E A;  3TZ1 A;  1M31 A;  2FJU B;  1K93 D;  3BUM B;  1IGV A;  1TUJ A;  3QME A;  1E8A A;  2WC5 A;  1DEL A;  1QLK A;  1G4Y R;  1J7R A;  1IKU A;  1JC2 A;  1M46 A;  2KGR A;  1K94 A;  3PN7 C;  1K95 A;  1XYD A;  3OX6 A;  3SS4 A;  4DIR A;  2F33 A;  2OPO A;  2PQL A;  4U8D A;  3BYA A;  1QLS A;  1WY9 A;  3H4S E;  2PSR A;  4GGN A;  1DJZ A;  1SSE B;  4N5X A;  2RGI A;  3TS5 B;  3SS5 A;  5K89 A;  2LLS A;  2L51 A;  5GQQ C;  4NQG A;  3EK8 A;  2B1U A;  2K8M B;  2LHI A;  5CSJ A;  1NSH A;  5D3O A;  1IG5 A;  3LK1 A;  3D77 A;  3I5H B;  3VRQ A;  1IJ6 A;  2SAS A;  1SCM B;  3JVT B;  4KYN A;  1JWD A;  3AAJ A;  1XA5 A;  2F3Z A;  1SCV A;  1S6I A;  2F3Y A;  4GAO A;  1TNQ A;  1H8B A;  2G9B A;  2M0R A;  4F7F A;  2CCM A;  4BY5 A;  4HSZ A;  3SG3 A;  4F0Z B;  2P6B B;  1C7W A;  3R1V A;  2LNK A;  5FI6 A;  3BQ3 A;  1SL9 A;  1NYA A;  4L9M A;  3B7A A;  2WCF A;  1UHH A;  2QEH A;  3R1P A;  1Z2C B;  4GNK B;  1DGV A;  5DKN A;  2MRD A;  2A4J A;  4YGA A;  5FI2 A;  4YBH B;  1GM0 A;  3FIA A;  1XFZ O;  1N0Y A;  2JQ6 A;  1NCZ A;  4ZCU A;  3EKJ A;  1AK8 A;  1NCY A;  1UUR A;  2LCP A;  1FF1 A;  1BJF A;  1F70 A;  1GGW A;  1DVI A;  1JF2 A;  2PVB A;  2KAY A;  1ODB A;  1L2O C;  1S1E A;  1YUR A;  4XJK A;  1UWO A;  2E30 A;  1TCF A;  1R6P A;  3D0Y B;  4PT1 A;  5JOL A;  2H8V A;  1OOI X;  4JWQ A;  1DJI A;  1ZOT B;  2CBL A;  4C0L A;  4I5J A;  3B86 A;  4AQJ A;  3GK4 X;  1BOD A;  1CLM A;  1CM1 A;  2ZN9 A;  1SMG A;  4TNC A;  2K2A A;  1DC1 A;  1CDP A;  4MEW A;  1MF8 B;  2KQY A;  4DCK A;  1SK6 D;  1QVI Z;  2QEO A;  1QX2 A;  5TNC A;  1TNW A;  5HKY A;  3CDN A;  2JWW A;  1IQ5 A;  3PLF B;  4QJ4 B;  4MLW A;  2LVV A;  2HQW A;  1MUX A;  2BEC A;  2JT0 A;  3VRR A;  1M39 A;  3SG2 A;  4ZCV A;  4NDB A;  3NSO A;  2MBX A;  1DJW A;  3OB1 B;  1BR4 B;  3CS1 A;  2KYC A;  3KEV A;  3TDZ A;  1DF0 A;  3NSK A;  1KSM A;  2Y1M A;  4MRY A;  1QXP A;  4HRH A;  2GGZ A;  2AUC A;  2LMT A;  2QPT A;  1CFF A;  1YVL A;  1F4O A;  4N1F A;  1X02 A;  4CFQ A;  2LVJ A;  4OVN F;  1N2D A;  4USL A;  1K9U A;  2KI4 C;  1BG1 A;  1YUS A;  2QEB A;  3WXA A;  1PAL A;  4I5K A;  1CKK A;  1J1E A;  1OMV A;  3SIA A;  3I5F B;  1ZFS A;  4P2Y B;  1KQM C;  1UHN A;  2WCE A;  1DJX A;  2BAP A;  1AUI B;  2PAL A;  1DT7 B;  1OZS A;  3SG4 A;  2FCE A;  2M7N A;  2NXQ A;  5HL1 A;  4MRX A;  3GK1 A;  1UHI A;  4DRW A;  3I5G B;  3I5I C;  1JF0 A;  1UUS A;  3BOW A;  2EHB A;  2EC6 B;  1DQE A;  2JT8 A;  2SCP A;  3AAK A;  5I2Q A;  1B9A A;  1B8R A;  1Y1A A;  4JPZ B;  1QV1 A;  3TUY B;  4QJ5 B;  1CMG A;  2BBN A;  2JT3 A;  5I94 A;  1GJY A;  2LLU A;  3JTD C;  2LMV A;  1TUZ A;  4PAL A;  3TDI A;  2BCA A;  3K21 A;  2KFH A;  3DD4 A;  4HRE E;  2K7O A;  1YVH A;  3VGO A;  2KSP A;  1NPQ A;  2QAC A;  3SG6 A;  3BUN B;  1KFU S;  5JJG A;  3C1V A;  2ERB A;  3R1O A;  5CPV A;  2LV7 A;  1J7Q A;  3Q8I A;  2LHL A;  1WRK A;  4WQ2 A;  3OP0 A;  1PSB A;  2OTG C;  5AEQ A;  1GQM A;  2BE4 A;  1A75 A;  2KOT A;  2M97 A;  3D75 A;  2K61 A;  2JRF A;  1R2U A;  3UO9 A;  2CTN A;  3GOF A;  1YUT A;  1SR6 C;  1TN4 A;  3CAB A;  1TNP A;  1JBA A;  1S5G Z;  1G8I A;  4QJ3 B;  5G08 A;  5AAN A;  1KFX L;  3CZ1 A;  1WLZ A;  3FWB A;  1QV0 A;  3L4A A;  5IBW A;  2K7B A;  4M2Q A;  5J3X A;  1K2H A;  2JOJ A;  3PJI A;  3PFV A;  1W7J B;  1A29 A;  1PRW A;  2OS8 B;  2JXL A;  1XO5 A;  2JZI A;  1F8H A;  3DF0 B;  1DF0 B;  1YX8 A;  2JPT A;  2KAV A;  3D76 A;  3DVJ A;  1KK8 C;  3O6B A;  4MN0 A;  5HLO A;  1ZUZ A;  2H2K A;  3LL8 B;  3D10 A;  5FI7 A;  2O60 A;  3VB1 A;  1QAS A;  1UHJ A;  2MLE C;  4WQ3 A;  2PRU A;  2PYQ A;  1RTP 1;  2NCP A;  3EK7 A;  3ZWH A;  2CT9 A;  5AFP A;  1BT6 A;  2HF5 A;  5I2O A;  3PSR A;  4GUK A;  3O4X A;  5D7F A;  1FBV A;  2BL0 C;  1LXF C;  2BKI B;  1A03 A;  2EGD A;  3CR2 A;  1SRA A;  3TDU A;  3RZS A;  1YRU B;  1PVA A;  1K9K A;  1L7Z A;  3BOW B;  1KQV A;  4DS7 A;  1OMR A;  1UP5 A;  3FE9 A;  2F2P A;  1QAT A;  1V1F A;  3A8R A;  3IF7 A;  3CWG A;  3IQQ A;  3LLE A;  4YGD B;  3ICB A;  4DUQ A;  3R72 A;  2Q91 A;  1XFW O;  3PM2 A;  2KDH A;  5F6T A;  1YX7 A;  1OE9 B;  2KI6 C;  1K8U A;  4NDC A;  1S3P A;  3S0E A;  1IIO A;  1NX1 A;  3SIB A;  2YGU A;  2WC8 A;  2K0J A;  4I5L B;  1TNX A;  2ZFD A;  2AAO A;  2L4I A;  1W7I B;  2HQ8 A;  1RRO A;  2Q4U A;  2I7A A;  4YGC B;  1RWY A;  1QVI Y;  3CZT X;  1ORG A;  3RLZ A;  3FE6 A;  1WDC C;  3O2P A;  1BOC A;  1A75 B;  1KWO C;  1U5I A;  1AJ4 A;  2KBI A;  4OKH A;  3CTN A;  5DIC A;  2M3W A;  4YGB B;  1BF5 A;  3SG7 A;  2VRG A;  3PAT A;  1TRF A;  2F8P A;  3OB2 B;  1Z4H A;  3VRO A;  1CFP A;  1AP4 A;  2BBM A;  2M29 A;  3CR4 X;  3FS7 A;  1T14 A;  2L50 A;  1SPY A;  5DKQ A;  1NCX A;  4YGE B;  3NGV A;  1QWV A;  2JPO A;  3PN7 B;  1EXR A;  2COL B;  2QDI A;  2LAP A;  1S6J A;  2WOS A;  3EVU A;  4FQO A;  3VRP A;  2LLT A;  2L4H A;  1KCY A;  3F45 A;  5I2L A;  2JTT A;  2ZNE A;  3D78 A;  3GK2 A;  1CDL A;  2LAN A;  4ETO A;  1KK7 Z;  4PHK A;  1CFC A;  3PAL A;  4INW A;  1C07 A;  3WNX B;  2LUX A;  1G33 A;  1XFX O;  2KAX A;  2KI6 D;  3BXK A;  1SY9 A;  1KK8 B;  3K1E A;  3D74 A;  2MLF C;  3TS5 C;  1MWN A;  2WCM A;  1EG4 A;  3BFA A;  2D8N A;  2O5G A;  4AOM A;  1NIW A;  3MSE B;  1CLB A;  3EK4 A;  1NWD A;  5HYD A;  3I5H C;  3E3R A;  2L0P A;  1D1O A;  3IQO A;  3UNW A;  2KYF A;  1W9Z A;  3FWC A;  1SCM C;  3JVT C;  1UHK A;  2V53 A;  4M2P A;  3A4U B;  3PM8 A;  1SKT A;  2K60 A;  2PAS A;  2LP2 A;  1SBJ A;  2MHH A;  3NSI A;  2WCK A;  1FW4 A;  2G2B A;  1JFK A;  2ZND A;  1Y0V H;  2GV5 A;  4IL1 A;  5AER A;  3CZ0 A;  3S0A A;  2LC5 A;  1F54 A;  3S0F A;  1K96 A;  4YRU A;  2KQ6 A;  3CR5 X;  1S26 D;  2FJY A;  2PMY A; 
#chains in the Genus database with same CATH homology
 5CSN A;  1IWQ A;  4GGF C;  1LA3 A;  1WRZ A;  2M8U A;  2AMI A;  1QIV A;  4XJK B;  5HKW A;  4ORC B;  1HQV A;  1OSA A;  4PHM A;  1SL7 A;  1QJT A;  2E6W A;  1J7O A;  2JTZ A;  4GGF A;  5AXI A;  1QIW A;  1QX7 A;  1B8L A;  3EVR A;  2LUC A;  1KSO A;  1L2O B;  4CID A;  1FPW A;  1QTX A;  1HT9 A;  1DMO A;  1S5G Y;  1LA0 A;  1SW8 A;  1U5I B;  1B7T Y;  3EVV A;  1NX2 A;  1M63 B;  5HKZ A;  2I94 A;  1S6C A;  2GGM A;  1J7P A;  1OOJ A;  1PSR A;  5KSZ A;  4AQI A;  1B7T Z;  1XFV O;  1WLM A;  1RFJ A;  2FOT A;  4ORB B;  2LVK A;  4E68 A;  2DOQ A;  4PDZ A;  3WHU B;  1A2X A;  3LCP C;  1CDN A;  3DVM A;  3D0Y A;  4PHJ A;  5FYX A;  4HRG A;  1ZMZ A;  1KFX S;  2Y5I A;  4XYN A;  1NUB A;  1CFD A;  2FCD A;  2CNP A;  1TIZ A;  2KHN A;  3CGA A;  3EKH A;  2BKH B;  5CSF A;  1XFY O;  1MXE A;  2MA2 A;  3HCM A;  2JU0 A;  4P5O E;  4CFR A;  5HLV A;  2LP3 A;  4PE4 A;  2ISD A;  1TOP A;  4A4C A;  4PE0 A;  4D1E A;  2WCB A;  4JQ0 D;  4PE7 A;  4MZL A;  1OZO A;  2KI4 B;  4GPL B;  1B8C A;  1CTR A;  1QS7 A;  1SL8 A;  1ZAC A;  2MAZ A;  2R2I A;  4MSP A;  5PAL A;  3LK0 A;  1M45 A;  4PHN A;  2JUL A;  4FTG A;  2I2R E;  1KQM B;  3AKA A;  1TTX A;  2JNF A;  1MR8 A;  2BCB A;  2LM5 A;  1XK4 C;  3I5F C;  2M1K B;  2Y4Q A;  2BCX A;  1Y1X A;  3QRX A;  2LVI A;  4UPG A;  1B47 A;  3KHE A;  5DKR A;  3I5I B;  3WHT B;  2F2O A;  2K2F A;  1XK4 A;  4GBA A;  4MVF A;  1YRT B;  3RM1 A;  4ORA B;  1FI5 A;  4NDD A;  1J55 A;  2KGB C;  1CB1 A;  1AJ5 A;  1EH2 A;  4Q04 A;  4R1E A;  3I5G C;  1JFJ A;  2LE9 B;  3KPX A;  1H4B A;  4PE1 A;  1Y1U A;  4GFT A;  2EC6 C;  4WRI A;  3JTD B;  3KO0 A;  1LKJ A;  1LVC D;  3KF9 A;  1QX5 B;  2NLN A;  1NX0 A;  3TUY C;  2M49 B;  4OCI A;  1GGZ A;  1BR1 B;  1F4Q A;  1A4P A;  1OQP A;  3O78 A;  1XFU O;  5ER4 X;  5KU1 A;  5KTY A;  1AVS A;  4MBE A;  1SNL A;  2MJW B;  4CPV A;  1ALW A;  1DGU A;  1LIN A;  1CDM A;  2OTG B;  3O4Y A;  2KFG A;  1Y6W A;  1SYM A;  1ALV A;  2L98 A;  2LMU A;  1K90 D;  1OMD A;  1SR6 B;  1N65 A;  1BU3 A;  1TCO B;  1KK7 Y;  2BE6 A;  2I18 A;  2JXC A;  3AKB A;  2HET A;  2M9G A;  4OR9 B;  4A4B A;  1YUU A;  3OX5 A;  5ER5 A;  1FI6 A;  1Q80 A;  4M2O A;  2H61 C;  2ZRT A;  1AHR A;  1BMO A;  1J1D A;  4ICB A;  3SG5 A;  1DTL A;  5D69 A;  1VRK A;  2H61 A;  1PVB A;  2CXJ A;  2OS8 C;  2JC2 A;  2HPS A;  2L5X B;  2JNX A;  1PK0 D;  4CLN A;  2TN4 A;  1IRJ A;  3DF0 A;  3BUO B;  1JUO A;  3VRN A;  1WRL A;  1YTZ C;  2BL0 B;  1RJV A;  4N1G A;  4MZJ A;  1K9P A;  2KFF A;  1CNP A;  1EG3 A;  4OV2 A;  5B8I B;  1PUL A;  1JSA A;  4BY4 A;  3DVK A;  1B1G A;  4PCW A;  3BUW B;  2ZKM X;  1MHO A;  4I5N B;  1NX3 A;  4C0J A;  1S36 A;  1DJH A;  1MQ1 A;  1XVJ A;  4C0K A;  1IH0 A;  1EJ3 A;  1YR5 A;  5BPJ A;  3CLN A;  4YI8 A;  1F71 A;  1DJG A;  4YI9 A;  2IS9 A;  5CSI A;  1C7V A;  5I8N A;  2NCO A;  1CMF A;  1RK9 A;  1V1G A;  1NP8 A;  2ZRS A;  2WND A;  2KNE A;  2M1U A;  2Y1N A;  3DVE A;  1F55 A;  1BLQ A;  2KBM A;  1DJY A;  2ZN8 A;  1REC A;  2K7D A;  1CM4 A;  2WOR A;  3NSL A;  2K7C A;  3SJS A;  1WDC B;  3ZNI A;  1KWO B;  3OHM B;  1KFU L;  1MXL C;  1CLL A;  1B4C A;  1IJ5 A;  3HX4 A;  2M7L A;  3BUX B;  3M0W A;  1IQ3 A;  1EL4 A;  2NZ0 A;  3NXA A;  4MZK A;  2L2E A;  3TZ1 A;  1M31 A;  2FJU B;  1K93 D;  3BUM B;  1IGV A;  1E8A A;  1QLK A;  1G4Y R;  1J7R A;  1IKU A;  1JC2 A;  1M46 A;  2KGR A;  1K94 A;  3PN7 C;  1K95 A;  1XYD A;  3OX6 A;  4DIR A;  2F33 A;  2OPO A;  4U8D A;  3BYA A;  1QLS A;  1WY9 A;  3H4S E;  2PSR A;  4GGN A;  1DJZ A;  4N5X A;  2RGI A;  3TS5 B;  5K89 A;  2LLS A;  2L51 A;  5GQQ C;  4NQG A;  3EK8 A;  2B1U A;  2K8M B;  2LHI A;  5CSJ A;  1NSH A;  1IG5 A;  3LK1 A;  3I5H B;  3VRQ A;  1IJ6 A;  2SAS A;  1SCM B;  3JVT B;  1JWD A;  3AAJ A;  1XA5 A;  2F3Z A;  1SCV A;  1S6I A;  2F3Y A;  4GAO A;  1TNQ A;  1H8B A;  2G9B A;  2M0R A;  2CCM A;  4BY5 A;  4HSZ A;  3SG3 A;  4F0Z B;  2P6B B;  1C7W A;  2LNK A;  3BQ3 A;  1SL9 A;  1NYA A;  4L9M A;  2WCF A;  1UHH A;  4GNK B;  1DGV A;  5DKN A;  2MRD A;  2A4J A;  4YGA A;  4YBH B;  3FIA A;  1XFZ O;  1N0Y A;  2JQ6 A;  1NCZ A;  4ZCU A;  3EKJ A;  1AK8 A;  1NCY A;  1UUR A;  2LCP A;  1FF1 A;  1BJF A;  1F70 A;  1GGW A;  1DVI A;  1JF2 A;  2PVB A;  2KAY A;  1ODB A;  1L2O C;  1S1E A;  1YUR A;  4XJK A;  1UWO A;  2E30 A;  1TCF A;  1R6P A;  3D0Y B;  5JOL A;  4JWQ A;  1DJI A;  1ZOT B;  2CBL A;  4C0L A;  4I5J A;  4AQJ A;  3GK4 X;  1BOD A;  1CLM A;  1CM1 A;  2ZN9 A;  1SMG A;  4TNC A;  2K2A A;  1CDP A;  4MEW A;  1MF8 B;  2KQY A;  4DCK A;  1SK6 D;  1QVI Z;  1QX2 A;  5TNC A;  1TNW A;  5HKY A;  2JWW A;  1IQ5 A;  3PLF B;  4QJ4 B;  4MLW A;  2LVV A;  2HQW A;  1MUX A;  2BEC A;  2JT0 A;  3VRR A;  1M39 A;  3SG2 A;  4ZCV A;  4NDB A;  3NSO A;  2MBX A;  1DJW A;  3OB1 B;  1BR4 B;  3CS1 A;  2KYC A;  3KEV A;  3TDZ A;  1DF0 A;  3NSK A;  1KSM A;  2Y1M A;  4MRY A;  1QXP A;  4HRH A;  2GGZ A;  2AUC A;  2LMT A;  2QPT A;  1CFF A;  1YVL A;  1F4O A;  4N1F A;  1X02 A;  4CFQ A;  2LVJ A;  4OVN F;  1N2D A;  4USL A;  1K9U A;  2KI4 C;  1BG1 A;  1YUS A;  3WXA A;  1PAL A;  4I5K A;  1CKK A;  1J1E A;  1OMV A;  3SIA A;  3I5F B;  1ZFS A;  4P2Y B;  1KQM C;  1UHN A;  2WCE A;  1DJX A;  1AUI B;  2PAL A;  1DT7 B;  1OZS A;  3SG4 A;  2FCE A;  2M7N A;  2NXQ A;  4MRX A;  3GK1 A;  1UHI A;  4DRW A;  3I5G B;  3I5I C;  1JF0 A;  1UUS A;  3BOW A;  2EHB A;  2EC6 B;  2JT8 A;  2SCP A;  3AAK A;  5I2Q A;  1B9A A;  1B8R A;  1Y1A A;  4JPZ B;  1QV1 A;  3TUY B;  4QJ5 B;  1CMG A;  2BBN A;  2JT3 A;  1GJY A;  2LLU A;  3JTD C;  2LMV A;  3TDI A;  4PAL A;  2BCA A;  3K21 A;  2KFH A;  3DD4 A;  4HRE E;  2K7O A;  1YVH A;  3VGO A;  2KSP A;  1NPQ A;  2QAC A;  3SG6 A;  3BUN B;  1KFU S;  5JJG A;  3C1V A;  5CPV A;  2LV7 A;  1J7Q A;  2LHL A;  1WRK A;  4WQ2 A;  3OP0 A;  1PSB A;  2OTG C;  5AEQ A;  1GQM A;  2BE4 A;  1A75 A;  2KOT A;  2M97 A;  2K61 A;  2JRF A;  1R2U A;  2CTN A;  3GOF A;  1YUT A;  1SR6 C;  1TN4 A;  1TNP A;  1JBA A;  1S5G Z;  1G8I A;  4QJ3 B;  5G08 A;  5AAN A;  1KFX L;  1WLZ A;  3FWB A;  1QV0 A;  5IBW A;  2K7B A;  4M2Q A;  5J3X A;  1K2H A;  2JOJ A;  3PFV A;  1W7J B;  1A29 A;  1PRW A;  2OS8 B;  2JXL A;  1XO5 A;  2JZI A;  1F8H A;  3DF0 B;  1DF0 B;  1YX8 A;  2JPT A;  2KAV A;  3O6B A;  3DVJ A;  1KK8 C;  5HLO A;  4MN0 A;  1ZUZ A;  2H2K A;  3LL8 B;  3D10 A;  2O60 A;  1QAS A;  1UHJ A;  2MLE C;  4WQ3 A;  2PRU A;  1RTP 1;  2NCP A;  3EK7 A;  3ZWH A;  2CT9 A;  5AFP A;  1BT6 A;  2HF5 A;  5I2O A;  3PSR A;  4GUK A;  5D7F A;  1FBV A;  2BL0 C;  1LXF C;  2BKI B;  1A03 A;  2EGD A;  3CR2 A;  1SRA A;  3TDU A;  1YRU B;  1PVA A;  1K9K A;  1L7Z A;  3BOW B;  1KQV A;  4DS7 A;  1OMR A;  1UP5 A;  2F2P A;  1QAT A;  1V1F A;  3A8R A;  3IF7 A;  3CWG A;  3IQQ A;  3LLE A;  4YGD B;  3ICB A;  4DUQ A;  2Q91 A;  1XFW O;  2KDH A;  5F6T A;  1YX7 A;  1OE9 B;  2KI6 C;  1K8U A;  4NDC A;  1S3P A;  1NX1 A;  3SIB A;  2WC8 A;  2K0J A;  4I5L B;  1TNX A;  2ZFD A;  2AAO A;  2L4I A;  1W7I B;  2HQ8 A;  1RRO A;  2Q4U A;  2I7A A;  4YGC B;  1RWY A;  1QVI Y;  3CZT X;  3RLZ A;  1WDC C;  3O2P A;  1BOC A;  1A75 B;  1KWO C;  1U5I A;  1AJ4 A;  2KBI A;  4OKH A;  3CTN A;  2M3W A;  4YGB B;  1BF5 A;  3SG7 A;  2VRG A;  3PAT A;  1TRF A;  2F8P A;  3OB2 B;  3VRO A;  1CFP A;  1AP4 A;  2BBM A;  2M29 A;  3CR4 X;  3FS7 A;  2L50 A;  1SPY A;  5DKQ A;  1NCX A;  4YGE B;  3PN7 B;  1EXR A;  2COL B;  2LAP A;  1S6J A;  2WOS A;  3EVU A;  4FQO A;  3VRP A;  2LLT A;  2L4H A;  1KCY A;  3F45 A;  5I2L A;  2JTT A;  2ZNE A;  3GK2 A;  1CDL A;  2LAN A;  4ETO A;  1KK7 Z;  4PHK A;  1CFC A;  3PAL A;  1C07 A;  3WNX B;  2LUX A;  1G33 A;  1XFX O;  2KAX A;  2KI6 D;  3BXK A;  1SY9 A;  1KK8 B;  3TS5 C;  2MLF C;  1MWN A;  1EG4 A;  2D8N A;  2O5G A;  4AOM A;  1NIW A;  3MSE B;  1CLB A;  3EK4 A;  1NWD A;  5HYD A;  3I5H C;  3E3R A;  2L0P A;  1D1O A;  3IQO A;  2KYF A;  3FWC A;  1SCM C;  3JVT C;  1UHK A;  2V53 A;  4M2P A;  3A4U B;  3PM8 A;  1SKT A;  2PAS A;  2LP2 A;  1SBJ A;  2MHH A;  3NSI A;  1FW4 A;  2G2B A;  1JFK A;  2ZND A;  1Y0V H;  2GV5 A;  4IL1 A;  5AER A;  2LC5 A;  1F54 A;  1K96 A;  4YRU A;  2KQ6 A;  3CR5 X;  1S26 D;  2PMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...