2JC2A

The crystal structure of the natural f112l human sorcin mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISLDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORCIN
publication title Molecular Basis for the Impaired Function of the Natural F112L Sorcin Mutant: X-Ray Crystal Structure, Calcium Affinity, and Interaction with Annexin Vii and the Ryanodine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 48
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jc2A02
1NCXA 4PE1A 1C07A 2LE9B 1IQ5A 2EHBA 4XYNA 2ZN9A 3D0YA 3VRRA 4DCKA 1PRWA 2WCEA 5DKNA 1ZACA 3OB1B 2L4IA 2F33A 1S6JA 1KQMB 1QIVA 1WY9A 2L51A 5G08A 4PDZA 2ZKMX 5I2QA 1S5GY 3OHMB 3PFVA 4PHJA 4WRIA 1B4CA 2KQ6A 1C7WA 2F2OA 4YBHB 1JBAA 1N2DA 1F55A 1OMRA 3SG4A 3KHEA 2JPTA 1J7QA 1B8CA 1A2XA 1QX7A 2PMYA 3IQOA 3GK2A 4QJ3B 4YGBB 2BE6A 1H4BA 1K9KA 2WC8A 2K7DA 3BUMB 1IJ5A 3WXAA 2GGZA 1K93D 3LK1A 3BOWB 3I5HB 2QACA 1M46A 1G8IA 2OTGB 1DJGA 1TNPA 3LLEA 4QJ4B 5I2OA 4PE0A 1EXRA 4GBAA 1PK0D 2H2KA 2I2RE 4R1EA 1RJVA 1CLBA 2KFHA 3BYAA 3CGAA 1TNXA 1NUBA 3DF0B 2KYCA 3TZ1A 4AQIA 1LA0A 1GGWA 4CIDA 5AFPA 1PSBA 4NDCA 1BLQA 1KFUS 2H61C 3CZTX 3I5IC 1DVIA 1ZMZA 1QTXA 1GGZA 1AUIB 3EK8A 1Y1UA 2M3WA 5K89A 3RM1A 1KQMC 3BUNB 2MA2A 1TRFA 4ZCVA 2KAVA 4PHKA 1K2HA 3EKHA 1ALWA 3SG2A 1CDLA 3WNXB 4HSZA 4MRXA 4I5NB 4CLNA 2KGBC 2M8UA 1SYMA 4L9MA 3SJSA 2H61A 2M97A 2E6WA 2FCEA 2M1UA 2O60A 2I18A 2F3ZA 3SIAA 2I94A 2JQ6A 1F8HA 4PALA 4GGNA 1J55A 1IKUA 1SW8A 5D69A 2LMTA 1PALA 2NLNA 1IWQA 1B9AA 1NX3A 2Y5IA 4GFTA 1YTZC 5BPJA 2F3YA 2JOJA 3BUWB 2OTGC 2BE4A 1SMGA 1UHKA 2JT0A 1DTLA 2A4JA 4M2QA 1AK8A 3CLNA 3IF7A 2M29A 3FWCA 1K9UA 2G2BA 3I5FC 1ODBA 1PVBA 3NXAA 3TDIA 5IBWA 2KI6D 1UURA 1S6IA 1WDCC 1QVIZ 4OCIA 1BT6A 4P2YB 1B8RA 4FTGA 1U5IA 5FYXA 2BBNA 1CLLA 2O5GA 1J7OA 2JT3A 1S6CA 1N0YA 2ZFDA 1XFVO 3EK4A 3E3RA 2KFGA 4BY4A 1S3PA 1LINA 1M63B 2CTNA 2KYFA 3DF0A 3DVEA 1QJTA 1K94A 4GNKB 4M2PA 1DF0B 4WQ2A 1TNWA 1ZUZA 5KTYA 2LHIA 1L2OC 3KO0A 2NXQA 2M7NA 3TDZA 2MRDA 4MVFA 1MWNA 2ISDA 3H4SE 3DD4A 1NCYA 2LM5A 5HKWA 3ZNIA 1X02A 2K2AA 2L50A 3KEVA 1CNPA 4USLA 1GQMA 1Y0VH 2FOTA 4HRHA 1M39A 2LUCA 1S5GZ 1XO5A 1MUXA 3VRPA 1SR6B 1JUOA 2EGDA 2K7OA 2KI6C 1EG4A 1OZOA 1XA5A 1CDMA 4C0JA 4PHMA 1F4QA 3M0WA 1DGUA 2BKHB 5ER5A 2IS9A 1CB1A 4YRUA 1GJYA 5AANA 1K90D 3QRXA 3DVMA 2HETA 5J3XA 3BUXB 2RGIA 3BUOB 3BXKA 1BG1A 1TNQA 1DJHA 1KSMA 1NWDA 5HKYA 4UPGA 1QASA 1DT7B 1KWOB 1IRJA 2JC2A 3PN7B 1XFXO 2E30A 2WNDA 1ZFSA 3GOFA 1JFKA 2LMVA 4GPLB 1R2UA 4N5XA 4PCWA 4C0KA 4I5KA 2AMIA 2Q91A 5JOLA 2JULA 1F71A 1CLMA 3O2PA 3CS1A 2JRFA 5HKZA 2HQ8A 3C1VA 1UHNA 1QS7A 5DKQA 4GUKA 2LVJA 3EVVA 2V53A 3NSLA 4NQGA 1XVJA 2I7AA 4Q04A 3CR2A 4C0LA 4YGDB 4ORAB 2L4HA 4U8DA 3AKAA 1DF0A 1LVCD 3SG3A 1S1EA 5D7FA 2NZ0A 1RROA 3SG7A 1DJYA 1NIWA 4P5OE 1V1FA 1A29A 2LNKA 1WLMA 4XJKB 3O6BA 1QLSA 1SK6D 1F4OA 2JU0A 2LVKA 1F54A 5TNCA 1MXEA 2JXLA 2LHLA 1IG5A 1DJIA 1MXLC 1KSOA 1QV1A 2DOQA 3GK1A 1BOCA 2KBIA 3SIBA 4CPVA 1TOPA 1B47A 2LCPA 3ICBA 1BMOA 2KAXA 1OMDA 2TN4A 4OV2A 2PVBA 1YR5A 5CSJA 2KAYA 3BQ3A 1KWOC 1RK9A 1YRUB 4N1GA 1XFZO 1SPYA 1NX2A 3PN7C 1CKKA 1HQVA 2JNFA 1DGVA 2F8PA 3O4YA 2EC6B 4BY5A 4JQ0D 1N65A 2SASA 2NCPA 3I5GB 3AAJA 2OS8B 4MLWA 1YVLA 2QPTA 4YGEB 4QJ5B 3SG6A 1KK8B 2M0RA 1FI5A 2BCBA 2BBMA 3FIAA 4CFRA 2PASA 2ZRTA 3MSEB 2AUCA 4DRWA 3VRQA 2CT9A 1BJFA 2HQWA 3I5HC 1AJ5A 4MRYA 2MJWB 1AVSA 5HYDA 3D10A 3KPXA 1NPQA 3CR4X 2HPSA 5DKRA 1OQPA 1QLKA 1SL7A 1XFYO 2GV5A 5F6TA 5B8IB 1J7PA 4A4CA 4F0ZB 3F45A 2MLEC 2GGMA 2FCDA 1QXPA 3BOWA 4OVNF 2KFFA 1V1GA 3A4UB 2PALA 1CDPA 1MQ1A 1AP4A 1WRLA 4D1EA 2G9BA 5HLOA 3TDUA 3CR5X 3TUYB 1B8LA 3PLFB 4I5JA 1TTXA 2L5XB 1MR8A 3NSKA 5I2LA 4PHNA 1UHHA 1XYDA 4MN0A 1BU3A 4GAOA 1J1EA 2WCBA 2MAZA 1YX7A 2CBLA 2L0PA 1H8BA 5AERA 1EL4A 4XJKA 1L7ZA 2JTZA 2WORA 3AKBA 4OR9B 4MZKA 1CFPA 1C7VA 2PSRA 1UHIA 2P6BB 1A4PA 1OOJA 1LXFC 2KGRA 2JWWA 2CCMA 2EC6C 2LV7A 3DVJA 4YGCB 2OS8C 2LVIA 3TS5B 1EG3A 1Y1AA 3JVTB 1AJ4A 3KF9A 3FWBA 2Q4UA 1IQ3A 1Y1XA 1OE9B 1FPWA 1CFDA 4MZLA 1IGVA 4YI8A 3EVUA 1LKJA 1VRKA 2KHNA 1WRKA 1JF2A 1QATA 1SL9A 1CMFA 1A75B 1S36A 4A4BA 4N1FA 3HX4A 1NX0A 4JWQA 2LLSA 3FS7A 1ALVA 2CXJA 2M9GA 2F2PA 2LP3A 1TIZA 4GGFC 3LCPC 5HLVA 3K21A 2K7BA 1SCMB 3EK7A 2LP2A 3TUYC 1DJWA 2MBXA 1R6PA 3WHUB 1YUUA 2AAOA 2JNXA 1YUSA 1J7RA 1IH0A 3NSIA 3IQQA 1RFJA 1W7IB 2LAPA 5ER4X 2BKIB 2NCOA 4FQOA 4GGFA 4DIRA 3I5IB 1B7TY 1IJ6A 1LA3A 1OZSA 1KK7Y 4ZCUA 1CM4A 2LANA 3PM8A 1DJZA 2M1KB 2M7LA 1XFUO 2CNPA 1JC2A 2KSPA 3TS5C 3OX6A 3JVTC 2MLFC 2M49B 1K8UA 4CFQA 1TCOB 1UUSA 1CDNA 1AHRA 1RECA 4ICBA 1MHOA 1KFUL 1SR6C 2BL0B 5JJGA 3JTDB 4MEWA 1J1DA 2KOTA 4ORCB 2R2IA 1JSAA 2KBMA 1BR4B 1YRTB 1BR1B 5PALA 1RTP1 5KSZA 3DVKA 3VROA 1U5IB 2OPOA 5AXIA 1D1OA 2COLB 4MSPA 2HF5A 2LVVA 1SL8A 1PSRA 3EKJA 1ZOTB 4OKHA 1SCMC 2BCXA 2JTTA 1KQVA 3I5FB 1A75A 4MBEA 1G4YR 1NCZA 1YX8A 1NSHA 3GK4X 1WDCB 3VRNA 1Q80A 1TCFA 4NDDA 2LC5A 1DJXA 2FJUB 1OMVA 1W7JB 5CSIA 2LMUA 4AOMA 2K61A 1QIWA 2Y4QA 1G33A 1PULA 3RLZA 4AQJA 2MHHA 4DUQA 1OSAA 1WLZA 4ORBB 1JWDA 2D8NA 2K7CA 1FW4A 1SRAA 2KDHA 3CTNA 4I5LB 1KFXL 1CFFA 4MZJA 1MF8B 1UHJA 4PE4A 1F70A 3ZWHA 1DMOA 1UWOA 3PALA 1CFCA 2BCAA 3NSOA 3VGOA 1YVHA 1FI6A 1SBJA 2BL0C 1L2OB 4TNCA 3LK0A 2KI4B 1PVAA 3JTDC 4HREE 1K95A 3EVRA 2LLTA 1XK4C 5KU1A 2WCFA 4E68A 3D0YB 4IL1A 2JZIA 2WOSA 2ZNEA 1BODA 1BF5A 2ZNDA 1XFWO 1QX5B 2JXCA 3O78A 1SKTA 1A03A 3HCMA 1K9PA 3WHTB 1CMGA 1SY9A 2LLUA 2PRUA 1XK4A 3LL8B 1KFXS 1JFJA 1S26D 1B1GA 2ZN8A 1KCYA 1SCVA 2KQYA 3SG5A 2ZRSA 1E8AA 1K96A 3I5GC 4ETOA 2K2FA 1QX2A 1TN4A 1KK8C 1EJ3A 3OB2B 1HT9A 1FBVA 2K0JA 1YURA 4YI9A 3OP0A 1M45A 2KNEA 4NDBA 2Y1NA 1UP5A 1Y6WA 3PATA 3OX5A 4DS7A 3CWGA 5CSFA 1NYAA 2L98A 4YGAA 1WRZA 2SCPA 1QVIY 4JPZB 1CTRA 1CM1A 1QV0A 1SNLA 3A8RA 1EH2A 5GQQC 1B7TZ 2KI4C 1KK7Z 4PE7A 5I8NA 3PSRA 1RWYA 1M31A 2JT8A 4HRGA 2B1UA 1NX1A 5CPVA 2BECA 2VRGA 1NP8A 1FF1A 2LUXA 4M2OA 4WQ3A 3AAKA 2L2EA 2Y1MA 5AEQA 1JF0A 5CSNA 1YUTA 2K8MB
chains in the Genus database with same CATH superfamily
1NCXA 4PE1A 1C07A 2LE9B 1IQ5A 2EHBA 3NHTA 4XYNA 2ZN9A 3D0YA 3VRRA 4DCKA 1PRWA 2WCEA 5DKNA 1ZACA 3OB1B 2L4IA 2F33A 1S6JA 1KQMB 1QIVA 1WY9A 2L51A 5G08A 4PDZA 2ZKMX 5I2QA 1S5GY 3OHMB 3PFVA 4PHJA 4WRIA 1B4CA 2KQ6A 1C7WA 2F2OA 4YBHB 1JBAA 1N2DA 1F55A 1OMRA 3SG4A 3DY9A 3KHEA 2JPTA 1J7QA 1B8CA 1A2XA 1QX7A 2QEHA 2PMYA 3IQOA 3GK2A 4QJ3B 4YGBB 2BE6A 1H4BA 1K9KA 2WC8A 2K7DA 3BUMB 1IJ5A 3WXAA 2GGZA 1K93D 3LK1A 3BOWB 3I5HB 2QACA 1M46A 1G8IA 3B7AA 2OTGB 1DJGA 1TNPA 3LLEA 4QJ4B 5I2OA 4PE0A 1EXRA 2WCMA 4GBAA 1PK0D 2H2KA 2I2RE 4R1EA 1RJVA 1CLBA 2KFHA 3BYAA 3CGAA 1TNXA 1NUBA 3DF0B 2KYCA 3TZ1A 4AQIA 1LA0A 1GGWA 1DELA 4CIDA 3R1VA 5AFPA 1PSBA 1OW4A 4NDCA 1BLQA 2KPHA 1KFUS 2H61C 3CZTX 3I5IC 1DVIA 3SS5A 1ZMZA 1QTXA 1GGZA 1AUIB 3EK8A 1Y1UA 2M3WA 5K89A 3CYZA 3RM1A 1KQMC 1QWVA 3BUNB 2MA2A 1TRFA 4ZCVA 2KAVA 4PHKA 1K2HA 3EKHA 3CZ1A 1ALWA 3SG2A 1CDLA 3WNXB 2L2CA 4HSZA 3B86A 4MRXA 4I5NB 4CLNA 2KGBC 2M8UA 1SYMA 4L9MA 3SJSA 1T14A 2H61A 2M97A 2E6WA 1TWOA 2FCEA 2M1UA 3S0GA 2O60A 2I18A 2F3ZA 3SIAA 2I94A 2JQ6A 1F8HA 4PALA 4GGNA 1J55A 1IKUA 1SW8A 3S0DA 4INXA 5D69A 1ORGA 3PJIA 2LMTA 1PALA 2NLNA 1IWQA 1B9AA 1NX3A 2Y5IA 4GFTA 1YTZC 5BPJA 2F3YA 2JOJA 3BUWB 2OTGC 2BE4A 1SMGA 3IVTA 1UHKA 2JT0A 1DTLA 2A4JA 4M2QA 1AK8A 3CLNA 3IF7A 2M29A 3FWCA 1K9UA 2G2BA 1TUJA 1ODBA 1PVBA 3I5FC 3NXAA 3TDIA 5IBWA 2KI6D 1UURA 1S6IA 1WDCC 1QVIZ 5D3OA 4OCIA 1BT6A 4P2YB 1C3YA 1B8RA 4FTGA 1U5IA 3D77A 5FYXA 1Z4HA 2BBNA 1CLLA 3K1EA 2O5GA 2QDIA 1J7OA 2JT3A 1S6CA 1N0YA 2ZFDA 1XFVO 3EK4A 2WCHA 3E3RA 2P70A 2KFGA 4BY4A 1S3PA 1LINA 3UO9A 1M63B 2CTNA 2KYFA 3DF0A 3BFBA 1DC1A 3DVEA 1QJTA 1K94A 4GNKB 4M2PA 1DF0B 4WQ2A 1TNWA 1ZUZA 5KTYA 2LHIA 1L2OC 3KO0A 2NXQA 2M7NA 3TDZA 2MRDA 4MVFA 1MWNA 2ISDA 3H4SE 3DD4A 4JD9A 1NCYA 2LM5A 5HKWA 3ZNIA 1X02A 3SS4A 2K2AA 2L50A 3KEVA 1CNPA 4USLA 1GQMA 1Y0VH 2FOTA 4HRHA 1M39A 2LUCA 1S5GZ 1XO5A 1MUXA 3VRPA 1SR6B 1JUOA 2EGDA 2K7OA 2KI6C 1EG4A 1OZOA 1XA5A 4PT1A 1CDMA 2JPOA 4C0JA 3OBVA 3L47A 4PHMA 1F4QA 3M0WA 1DGUA 2QEOA 2BKHB 3UNWA 5FI7A 5ER5A 2IS9A 1CB1A 4YRUA 1GJYA 5AANA 3L4AA 1K90D 3QRXA 3DVMA 2HETA 5J3XA 3BUXB 2RGIA 3BUOB 3BXKA 1BG1A 1TNQA 1DJHA 1KSMA 1NWDA 5HKYA 4UPGA 3R1OA 1QASA 1DT7B 1SSEB 1KWOB 3S0FA 1IRJA 2JC2A 3PN7B 1XFXO 4FQTA 2E30A 2WNDA 1ZFSA 3GOFA 1JFKA 2LMVA 2KLEA 1R2UA 4GPLB 4N5XA 4PCWA 4C0KA 4I5KA 2AMIA 2Q91A 5JOLA 2JULA 1F71A 1CLMA 3O2PA 3CS1A 3Q8IA 2JRFA 5HKZA 2HQ8A 3C1VA 1UHNA 5FI2A 1QS7A 5DKQA 4GUKA 2LVJA 3EVVA 2V53A 3NSLA 2K60A 4NQGA 1XVJA 2I7AA 4Q04A 3CR2A 4C0LA 4YGDB 4ORAB 3DZTA 2L4HA 4U8DA 3AKAA 1DF0A 1LVCD 3SG3A 1S1EA 5D7FA 2NZ0A 1RROA 3SG7A 1DJYA 1NIWA 4P5OE 1V1FA 1A29A 2LNKA 1WLMA 4XJKB 3O6BA 1QLSA 1SK6D 1F4OA 2JU0A 2LVKA 1F54A 5TNCA 1MXEA 2JXLA 2LHLA 1IG5A 1DJIA 1MXLC 3B6XA 1KSOA 3D74A 1QV1A 2DOQA 3GK1A 1BOCA 2KBIA 3SIBA 3B88A 4CPVA 1TOPA 1B47A 2LCPA 3ICBA 3FE8A 3NHIA 1BMOA 2KAXA 1OMDA 2TN4A 3D75A 3CZ0A 4OV2A 2PVBA 1YR5A 5CSJA 2KAYA 3BQ3A 1KWOC 1RK9A 1YRUB 4N1GA 1XFZO 1SPYA 1NX2A 3PN7C 1CKKA 1HQVA 2JNFA 1DGVA 2F8PA 3O4YA 2EC6B 4BY5A 4JQ0D 3FE6A 1N65A 2SASA 2NCPA 3I5GB 3AAJA 2OS8B 4MLWA 1YVLA 2QPTA 4YGEB 4QJ5B 3SG6A 1KK8B 2M0RA 5I94A 2BCBA 2BBMA 3FIAA 1FI5A 3S0BA 2PASA 2ZRTA 3MSEB 4CFRA 2AUCA 4DRWA 3VRQA 2CT9A 1BJFA 2HQWA 3I5HC 1AJ5A 4MRYA 2MJWB 1AVSA 5HYDA 3D10A 3KPXA 1NPQA 3CR4X 2HPSA 5DKRA 1OQPA 1QLKA 1SL7A 1XFYO 2GV5A 5F6TA 5B8IB 1J7PA 2H8VA 4A4CA 4F0ZB 3DXLA 3F45A 2MLEC 2GGMA 2FCDA 1QXPA 3BOWA 4OVNF 2KFFA 1V1GA 3A4UB 2PALA 1CDPA 1MQ1A 1AP4A 1WRLA 4D1EA 2G9BA 5HLOA 3TDUA 3CR5X 3TUYB 1B8LA 3PLFB 4I5JA 1TTXA 2L5XB 1MR8A 3NSKA 4IJ7A 4PHNA 5I2LA 1UHHA 1XYDA 4MN0A 1BU3A 4GAOA 1J1EA 2WCBA 2MAZA 1YX7A 2CBLA 2L0PA 3DYEA 3D76A 1H8BA 5AERA 1EL4A 4XJKA 1L7ZA 2JTZA 2WORA 3VB1A 3AKBA 4OR9B 4MZKA 1CFPA 1C7VA 2PSRA 1UHIA 3CABA 2P6BB 1A4PA 1OOJA 1LXFC 2KGRA 2JWWA 2CCMA 2EC6C 2LV7A 3DVJA 4YGCB 1OOIX 2OS8C 2LVIA 3TS5B 1EG3A 1Y1AA 2YGUA 3JVTB 1AJ4A 3KF9A 3FWBA 3D73A 2Q4UA 3BJHA 1IQ3A 1Y1XA 1OE9B 1XFRA 1CFDA 2PYQA 1FPWA 4MZLA 1IGVA 4YI8A 3EVUA 1LKJA 1W9ZA 1VRKA 2KHNA 1WRKA 1JF2A 1QATA 3EG5B 3QMEA 1SL9A 4F7FA 1A75B 1S36A 4A4BA 4N1FA 3HX4A 5FI6A 1CMFA 1IIOA 3B87A 4JKTA 1NX0A 4JWQA 2LLSA 3FS7A 1ALVA 2CXJA 2M9GA 2F2PA 2LP3A 1TIZA 4GGFC 3LCPC 5HLVA 3K21A 2K7BA 1SCMB 3EK7A 2LP2A 3TUYC 1DJWA 3R1PA 2MBXA 1R6PA 3WHUB 1YUUA 2AAOA 2JNXA 1YUSA 1J7RA 1GM0A 1IH0A 3NSIA 3IQQA 1RFJA 1W7IB 2LAPA 5ER4X 2BKIB 2PQLA 2NCOA 4FQOA 4GGFA 4DIRA 3I5IB 1B7TY 1IJ6A 1LA3A 1OZSA 1KK7Y 3OGNA 4ZCUA 1CM4A 2GTEA 2LANA 3PM8A 1DJZA 2M1KB 2M7LA 1XFUO 2CNPA 1JC2A 2KSPA 5HL1A 3TS5C 3OX6A 3JVTC 2MLFC 2M49B 1K8UA 4CFQA 1TCOB 1UUSA 2WC6A 1CDNA 1AHRA 2L5YA 1RECA 2QEBA 4ICBA 1MHOA 1KFUL 1SR6C 2BL0B 5JJGA 3L4LA 3JTDB 4MEWA 1J1DA 2KOTA 4ORCB 2R2IA 3V2LA 3S0AA 1JSAA 2KBMA 1BR4B 1YRTB 1BR1B 5PALA 1RTP1 5KSZA 3DVKA 3VROA 1U5IB 2OPOA 5AXIA 1D1OA 2COLB 4MSPA 2FJYA 2HF5A 2LVVA 1SL8A 1PSRA 3EKJA 1ZOTB 4OKHA 1SCMC 2BCXA 2JTTA 1KQVA 3I5FB 1A75A 2P71A 4MBEA 3SS3A 1G4YR 1NCZA 1YX8A 1NSHA 2WCKA 1WDCB 3GK4X 3VRNA 1Q80A 2KLDA 1TCFA 4NDDA 2LC5A 1DJXA 2FJUB 3O4XA 5DICA 1OMVA 1W7JB 5CSIA 2LMUA 3CZ2A 1OOGA 4AOMA 2K61A 3D78A 1QIWA 2Y4QA 1G33A 1PULA 3RLZA 4AQJA 2MHHA 4DUQA 1OSAA 1WLZA 2WCLA 1P28A 2D8NA 2K7CA 4ORBB 1FW4A 3RZSA 1SRAA 1JWDA 2KDHA 3CTNA 4I5LB 1KFXL 1CFFA 4MZJA 1MF8B 1UHJA 4PE4A 1F70A 3ZWHA 1DMOA 1UWOA 3PALA 1CFCA 2WCJA 2BCAA 3NSOA 3VGOA 1YVHA 1FI6A 1SBJA 1TUZA 2BL0C 1L2OB 4KYNA 5EL2A 4TNCA 3LK0A 2KI4B 1PVAA 3JTDC 4HREE 1K95A 3EVRA 2LLTA 1XK4C 5KU1A 2WCFA 4E68A 1C3ZA 3D0YB 4IL1A 2JZIA 2WOSA 2ZNEA 4OZDA 1BODA 1DEKA 1BF5A 2ZNDA 1XFWO 1QX5B 2JXCA 3O78A 3N7HA 3R72A 1SKTA 1A03A 3HCMA 1K9PA 3WHTB 1CMGA 1SY9A 2BAPA 2LLUA 2PRUA 1XK4A 3BFHA 3CDNA 3LL8B 2ERBA 1KFXS 1JFJA 1S26D 1B1GA 2ZN8A 1KCYA 1SCVA 2KQYA 3SG5A 2ZRSA 1E8AA 1K96A 3I5GC 4ETOA 2K2FA 1QX2A 3NGVA 1TN4A 1KK8C 1EJ3A 3OB2B 1HT9A 1FBVA 2K0JA 1YURA 2BNXA 4YI9A 3OP0A 1M45A 1Z2CB 2KNEA 4NDBA 2Y1NA 1UP5A 1Y6WA 3PM2A 3PATA 3OX5A 4DS7A 3CWGA 1OOFA 5CSFA 1NYAA 2L98A 1OOHA 3FE9A 4YGAA 1WRZA 2QEVA 2SCPA 1QVIY 3BFAA 4JPZB 1CTRA 1CM1A 1QV0A 1SNLA 3A8RA 4INWA 1EH2A 5GQQC 1B7TZ 1DQEA 2KI4C 3S0EA 1KK7Z 4PE7A 5I8NA 3PSRA 1RWYA 1M31A 2JT8A 1LS8A 4HRGA 1NX1A 2B1UA 5CPVA 2BECA 2VRGA 1NP8A 1FF1A 2LUXA 4M2OA 4WQ3A 3AAKA 2WC5A 2L2EA 2Y1MA 5AEQA 1JF0A 5CSNA 1YUTA 2K8MB
chains in the Genus database with same CATH topology
1NCXA 4PE1A 1C07A 2LE9B 1IQ5A 2EHBA 4XYNA 2ZN9A 3D0YA 3VRRA 4DCKA 1PRWA 2WCEA 5DKNA 1ZACA 3OB1B 2L4IA 2F33A 1S6JA 1KQMB 1QIVA 1WY9A 2L51A 5G08A 4PDZA 2ZKMX 5I2QA 1S5GY 3OHMB 3PFVA 4PHJA 4WRIA 1B4CA 2KQ6A 1C7WA 2F2OA 4YBHB 1JBAA 1N2DA 1F55A 1OMRA 3SG4A 3KHEA 2JPTA 1J7QA 1B8CA 1A2XA 1QX7A 2PMYA 3IQOA 3GK2A 4QJ3B 4YGBB 2BE6A 1H4BA 1K9KA 2WC8A 2K7DA 3BUMB 1IJ5A 3WXAA 2GGZA 1K93D 3LK1A 3BOWB 3I5HB 2QACA 1M46A 1G8IA 2OTGB 1DJGA 1TNPA 3LLEA 4QJ4B 5I2OA 4PE0A 1EXRA 4GBAA 1PK0D 2H2KA 2I2RE 4R1EA 1RJVA 1CLBA 2KFHA 3BYAA 3CGAA 1TNXA 1NUBA 3DF0B 2KYCA 3TZ1A 4AQIA 1LA0A 1GGWA 4CIDA 5AFPA 1PSBA 4NDCA 1BLQA 1KFUS 2H61C 3CZTX 3I5IC 1DVIA 1ZMZA 1QTXA 1GGZA 1AUIB 3EK8A 1Y1UA 2M3WA 5K89A 3RM1A 1KQMC 3BUNB 2MA2A 1TRFA 4ZCVA 2KAVA 4PHKA 1K2HA 3EKHA 1ALWA 3SG2A 1CDLA 3WNXB 4HSZA 4MRXA 4I5NB 4CLNA 2KGBC 2M8UA 1SYMA 4L9MA 3SJSA 2H61A 2M97A 2E6WA 2FCEA 2M1UA 2O60A 2I18A 2F3ZA 3SIAA 2I94A 2JQ6A 1F8HA 4PALA 4GGNA 1J55A 1IKUA 1SW8A 5D69A 2LMTA 1PALA 2NLNA 1IWQA 1B9AA 1NX3A 2Y5IA 4GFTA 1YTZC 5BPJA 2F3YA 2JOJA 3BUWB 2OTGC 2BE4A 1SMGA 1UHKA 2JT0A 1DTLA 2A4JA 4M2QA 1AK8A 3CLNA 3IF7A 2M29A 3FWCA 1K9UA 2G2BA 3I5FC 1ODBA 1PVBA 3NXAA 3TDIA 5IBWA 2KI6D 1UURA 1S6IA 1WDCC 1QVIZ 4OCIA 1BT6A 4P2YB 1B8RA 4FTGA 1U5IA 5FYXA 2BBNA 1CLLA 2O5GA 1J7OA 2JT3A 1S6CA 1N0YA 2ZFDA 1XFVO 3EK4A 3E3RA 2KFGA 4BY4A 1S3PA 1LINA 1M63B 2CTNA 2KYFA 3DF0A 3DVEA 1QJTA 1K94A 4GNKB 4M2PA 1DF0B 4WQ2A 1TNWA 1ZUZA 5KTYA 2LHIA 1L2OC 3KO0A 2NXQA 2M7NA 3TDZA 2MRDA 4MVFA 1MWNA 2ISDA 3H4SE 3DD4A 1NCYA 2LM5A 5HKWA 3ZNIA 1X02A 2K2AA 2L50A 3KEVA 1CNPA 4USLA 1GQMA 1Y0VH 2FOTA 4HRHA 1M39A 2LUCA 1S5GZ 1XO5A 1MUXA 3VRPA 1SR6B 1JUOA 2EGDA 2K7OA 2KI6C 1EG4A 1OZOA 1XA5A 1CDMA 4C0JA 4PHMA 1F4QA 3M0WA 1DGUA 2BKHB 5ER5A 2IS9A 1CB1A 4YRUA 1GJYA 5AANA 1K90D 3QRXA 3DVMA 2HETA 5J3XA 3BUXB 2RGIA 3BUOB 3BXKA 1BG1A 1TNQA 1DJHA 1KSMA 1NWDA 5HKYA 4UPGA 1QASA 1DT7B 1KWOB 1IRJA 2JC2A 3PN7B 1XFXO 2E30A 2WNDA 1ZFSA 3GOFA 1JFKA 2LMVA 4GPLB 1R2UA 4N5XA 4PCWA 4C0KA 4I5KA 2AMIA 2Q91A 5JOLA 2JULA 1F71A 1CLMA 3O2PA 3CS1A 2JRFA 5HKZA 2HQ8A 3C1VA 1UHNA 1QS7A 5DKQA 4GUKA 2LVJA 3EVVA 2V53A 3NSLA 4NQGA 1XVJA 2I7AA 4Q04A 3CR2A 4C0LA 4YGDB 4ORAB 2L4HA 4U8DA 3AKAA 1DF0A 1LVCD 3SG3A 1S1EA 5D7FA 2NZ0A 1RROA 3SG7A 1DJYA 1NIWA 4P5OE 1V1FA 1A29A 2LNKA 1WLMA 4XJKB 3O6BA 1QLSA 1SK6D 1F4OA 2JU0A 2LVKA 1F54A 5TNCA 1MXEA 2JXLA 2LHLA 1IG5A 1DJIA 1MXLC 1KSOA 1QV1A 2DOQA 3GK1A 1BOCA 2KBIA 3SIBA 4CPVA 1TOPA 1B47A 2LCPA 3ICBA 1BMOA 2KAXA 1OMDA 2TN4A 4OV2A 2PVBA 1YR5A 5CSJA 2KAYA 3BQ3A 1KWOC 1RK9A 1YRUB 4N1GA 1XFZO 1SPYA 1NX2A 3PN7C 1CKKA 1HQVA 2JNFA 1DGVA 2F8PA 3O4YA 2EC6B 4BY5A 4JQ0D 1N65A 2SASA 2NCPA 3I5GB 3AAJA 2OS8B 4MLWA 1YVLA 2QPTA 4YGEB 4QJ5B 3SG6A 1KK8B 2M0RA 1FI5A 2BCBA 2BBMA 3FIAA 4CFRA 2PASA 2ZRTA 3MSEB 2AUCA 4DRWA 3VRQA 2CT9A 1BJFA 2HQWA 3I5HC 1AJ5A 4MRYA 2MJWB 1AVSA 5HYDA 3D10A 3KPXA 1NPQA 3CR4X 2HPSA 5DKRA 1OQPA 1QLKA 1SL7A 1XFYO 2GV5A 5F6TA 5B8IB 1J7PA 4A4CA 4F0ZB 3F45A 2MLEC 2GGMA 2FCDA 1QXPA 3BOWA 4OVNF 2KFFA 1V1GA 3A4UB 2PALA 1CDPA 1MQ1A 1AP4A 1WRLA 4D1EA 2G9BA 5HLOA 3TDUA 3CR5X 3TUYB 1B8LA 3PLFB 4I5JA 1TTXA 2L5XB 1MR8A 3NSKA 5I2LA 4PHNA 1UHHA 1XYDA 4MN0A 1BU3A 4GAOA 1J1EA 2WCBA 2MAZA 1YX7A 2CBLA 2L0PA 1H8BA 5AERA 1EL4A 4XJKA 1L7ZA 2JTZA 2WORA 3AKBA 4OR9B 4MZKA 1CFPA 1C7VA 2PSRA 1UHIA 2P6BB 1A4PA 1OOJA 1LXFC 2KGRA 2JWWA 2CCMA 2EC6C 2LV7A 3DVJA 4YGCB 2OS8C 2LVIA 3TS5B 1EG3A 1Y1AA 3JVTB 1AJ4A 3KF9A 3FWBA 2Q4UA 1IQ3A 1Y1XA 1OE9B 1FPWA 1CFDA 4MZLA 1IGVA 4YI8A 3EVUA 1LKJA 1VRKA 2KHNA 1WRKA 1JF2A 1QATA 1SL9A 1CMFA 1A75B 1S36A 4A4BA 4N1FA 3HX4A 1NX0A 4JWQA 2LLSA 3FS7A 1ALVA 2CXJA 2M9GA 2F2PA 2LP3A 1TIZA 4GGFC 3LCPC 5HLVA 3K21A 2K7BA 1SCMB 3EK7A 2LP2A 3TUYC 1DJWA 2MBXA 1R6PA 3WHUB 1YUUA 2AAOA 2JNXA 1YUSA 1J7RA 1IH0A 3NSIA 3IQQA 1RFJA 1W7IB 2LAPA 5ER4X 2BKIB 2NCOA 4FQOA 4GGFA 4DIRA 3I5IB 1B7TY 1IJ6A 1LA3A 1OZSA 1KK7Y 4ZCUA 1CM4A 2LANA 3PM8A 1DJZA 2M1KB 2M7LA 1XFUO 2CNPA 1JC2A 2KSPA 3TS5C 3OX6A 3JVTC 2MLFC 2M49B 1K8UA 4CFQA 1TCOB 1UUSA 1CDNA 1AHRA 1RECA 4ICBA 1MHOA 1KFUL 1SR6C 2BL0B 5JJGA 3JTDB 4MEWA 1J1DA 2KOTA 4ORCB 2R2IA 1JSAA 2KBMA 1BR4B 1YRTB 1BR1B 5PALA 1RTP1 5KSZA 3DVKA 3VROA 1U5IB 2OPOA 5AXIA 1D1OA 2COLB 4MSPA 2HF5A 2LVVA 1SL8A 1PSRA 3EKJA 1ZOTB 4OKHA 1SCMC 2BCXA 2JTTA 1KQVA 3I5FB 1A75A 4MBEA 1G4YR 1NCZA 1YX8A 1NSHA 3GK4X 1WDCB 3VRNA 1Q80A 1TCFA 4NDDA 2LC5A 1DJXA 2FJUB 1OMVA 1W7JB 5CSIA 2LMUA 4AOMA 2K61A 1QIWA 2Y4QA 1G33A 1PULA 3RLZA 4AQJA 2MHHA 4DUQA 1OSAA 1WLZA 4ORBB 1JWDA 2D8NA 2K7CA 1FW4A 1SRAA 2KDHA 3CTNA 4I5LB 1KFXL 1CFFA 4MZJA 1MF8B 1UHJA 4PE4A 1F70A 3ZWHA 1DMOA 1UWOA 3PALA 1CFCA 2BCAA 3NSOA 3VGOA 1YVHA 1FI6A 1SBJA 2BL0C 1L2OB 4TNCA 3LK0A 2KI4B 1PVAA 3JTDC 4HREE 1K95A 3EVRA 2LLTA 1XK4C 5KU1A 2WCFA 4E68A 3D0YB 4IL1A 2JZIA 2WOSA 2ZNEA 1BODA 1BF5A 2ZNDA 1XFWO 1QX5B 2JXCA 3O78A 1SKTA 1A03A 3HCMA 1K9PA 3WHTB 1CMGA 1SY9A 2LLUA 2PRUA 1XK4A 3LL8B 1KFXS 1JFJA 1S26D 1B1GA 2ZN8A 1KCYA 1SCVA 2KQYA 3SG5A 2ZRSA 1E8AA 1K96A 3I5GC 4ETOA 2K2FA 1QX2A 1TN4A 1KK8C 1EJ3A 3OB2B 1HT9A 1FBVA 2K0JA 1YURA 4YI9A 3OP0A 1M45A 2KNEA 4NDBA 2Y1NA 1UP5A 1Y6WA 3PATA 3OX5A 4DS7A 3CWGA 5CSFA 1NYAA 2L98A 4YGAA 1WRZA 2SCPA 1QVIY 4JPZB 1CTRA 1CM1A 1QV0A 1SNLA 3A8RA 1EH2A 5GQQC 1B7TZ 2KI4C 1KK7Z 4PE7A 5I8NA 3PSRA 1RWYA 1M31A 2JT8A 4HRGA 2B1UA 1NX1A 5CPVA 2BECA 2VRGA 1NP8A 1FF1A 2LUXA 4M2OA 4WQ3A 3AAKA 2L2EA 2Y1MA 5AEQA 1JF0A 5CSNA 1YUTA 2K8MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCX A;  4PE1 A;  1C07 A;  2LE9 B;  1IQ5 A;  2EHB A;  4XYN A;  2ZN9 A;  3D0Y A;  3VRR A;  4DCK A;  1PRW A;  2WCE A;  5DKN A;  1ZAC A;  3OB1 B;  2L4I A;  2F33 A;  1S6J A;  1KQM B;  1QIV A;  1WY9 A;  2L51 A;  5G08 A;  4PDZ A;  2ZKM X;  5I2Q A;  1S5G Y;  3OHM B;  3PFV A;  4PHJ A;  4WRI A;  1B4C A;  2KQ6 A;  1C7W A;  2F2O A;  4YBH B;  1JBA A;  1N2D A;  1F55 A;  1OMR A;  3SG4 A;  3KHE A;  2JPT A;  1J7Q A;  1B8C A;  1A2X A;  1QX7 A;  2PMY A;  3IQO A;  3GK2 A;  4QJ3 B;  4YGB B;  2BE6 A;  1H4B A;  1K9K A;  2WC8 A;  2K7D A;  3BUM B;  1IJ5 A;  3WXA A;  2GGZ A;  1K93 D;  3LK1 A;  3BOW B;  3I5H B;  2QAC A;  1M46 A;  1G8I A;  2OTG B;  1DJG A;  1TNP A;  3LLE A;  4QJ4 B;  5I2O A;  4PE0 A;  1EXR A;  4GBA A;  1PK0 D;  2H2K A;  2I2R E;  4R1E A;  1RJV A;  1CLB A;  2KFH A;  3BYA A;  3CGA A;  1TNX A;  1NUB A;  3DF0 B;  2KYC A;  3TZ1 A;  4AQI A;  1LA0 A;  1GGW A;  4CID A;  5AFP A;  1PSB A;  4NDC A;  1BLQ A;  1KFU S;  2H61 C;  3CZT X;  3I5I C;  1DVI A;  1ZMZ A;  1QTX A;  1GGZ A;  1AUI B;  3EK8 A;  1Y1U A;  2M3W A;  5K89 A;  3RM1 A;  1KQM C;  3BUN B;  2MA2 A;  1TRF A;  4ZCV A;  2KAV A;  4PHK A;  1K2H A;  3EKH A;  1ALW A;  3SG2 A;  1CDL A;  3WNX B;  4HSZ A;  4MRX A;  4I5N B;  4CLN A;  2KGB C;  2M8U A;  1SYM A;  4L9M A;  3SJS A;  2H61 A;  2M97 A;  2E6W A;  2FCE A;  2M1U A;  2O60 A;  2I18 A;  2F3Z A;  3SIA A;  2I94 A;  2JQ6 A;  1F8H A;  4PAL A;  4GGN A;  1J55 A;  1IKU A;  1SW8 A;  5D69 A;  2LMT A;  1PAL A;  2NLN A;  1IWQ A;  1B9A A;  1NX3 A;  2Y5I A;  4GFT A;  1YTZ C;  5BPJ A;  2F3Y A;  2JOJ A;  3BUW B;  2OTG C;  2BE4 A;  1SMG A;  1UHK A;  2JT0 A;  1DTL A;  2A4J A;  4M2Q A;  1AK8 A;  3CLN A;  3IF7 A;  2M29 A;  3FWC A;  1K9U A;  2G2B A;  3I5F C;  1ODB A;  1PVB A;  3NXA A;  3TDI A;  5IBW A;  2KI6 D;  1UUR A;  1S6I A;  1WDC C;  1QVI Z;  4OCI A;  1BT6 A;  4P2Y B;  1B8R A;  4FTG A;  1U5I A;  5FYX A;  2BBN A;  1CLL A;  2O5G A;  1J7O A;  2JT3 A;  1S6C A;  1N0Y A;  2ZFD A;  1XFV O;  3EK4 A;  3E3R A;  2KFG A;  4BY4 A;  1S3P A;  1LIN A;  1M63 B;  2CTN A;  2KYF A;  3DF0 A;  3DVE A;  1QJT A;  1K94 A;  4GNK B;  4M2P A;  1DF0 B;  4WQ2 A;  1TNW A;  1ZUZ A;  5KTY A;  2LHI A;  1L2O C;  3KO0 A;  2NXQ A;  2M7N A;  3TDZ A;  2MRD A;  4MVF A;  1MWN A;  2ISD A;  3H4S E;  3DD4 A;  1NCY A;  2LM5 A;  5HKW A;  3ZNI A;  1X02 A;  2K2A A;  2L50 A;  3KEV A;  1CNP A;  4USL A;  1GQM A;  1Y0V H;  2FOT A;  4HRH A;  1M39 A;  2LUC A;  1S5G Z;  1XO5 A;  1MUX A;  3VRP A;  1SR6 B;  1JUO A;  2EGD A;  2K7O A;  2KI6 C;  1EG4 A;  1OZO A;  1XA5 A;  1CDM A;  4C0J A;  4PHM A;  1F4Q A;  3M0W A;  1DGU A;  2BKH B;  5ER5 A;  2IS9 A;  1CB1 A;  4YRU A;  1GJY A;  5AAN A;  1K90 D;  3QRX A;  3DVM A;  2HET A;  5J3X A;  3BUX B;  2RGI A;  3BUO B;  3BXK A;  1BG1 A;  1TNQ A;  1DJH A;  1KSM A;  1NWD A;  5HKY A;  4UPG A;  1QAS A;  1DT7 B;  1KWO B;  1IRJ A;  2JC2 A;  3PN7 B;  1XFX O;  2E30 A;  2WND A;  1ZFS A;  3GOF A;  1JFK A;  2LMV A;  4GPL B;  1R2U A;  4N5X A;  4PCW A;  4C0K A;  4I5K A;  2AMI A;  2Q91 A;  5JOL A;  2JUL A;  1F71 A;  1CLM A;  3O2P A;  3CS1 A;  2JRF A;  5HKZ A;  2HQ8 A;  3C1V A;  1UHN A;  1QS7 A;  5DKQ A;  4GUK A;  2LVJ A;  3EVV A;  2V53 A;  3NSL A;  4NQG A;  1XVJ A;  2I7A A;  4Q04 A;  3CR2 A;  4C0L A;  4YGD B;  4ORA B;  2L4H A;  4U8D A;  3AKA A;  1DF0 A;  1LVC D;  3SG3 A;  1S1E A;  5D7F A;  2NZ0 A;  1RRO A;  3SG7 A;  1DJY A;  1NIW A;  4P5O E;  1V1F A;  1A29 A;  2LNK A;  1WLM A;  4XJK B;  3O6B A;  1QLS A;  1SK6 D;  1F4O A;  2JU0 A;  2LVK A;  1F54 A;  5TNC A;  1MXE A;  2JXL A;  2LHL A;  1IG5 A;  1DJI A;  1MXL C;  1KSO A;  1QV1 A;  2DOQ A;  3GK1 A;  1BOC A;  2KBI A;  3SIB A;  4CPV A;  1TOP A;  1B47 A;  2LCP A;  3ICB A;  1BMO A;  2KAX A;  1OMD A;  2TN4 A;  4OV2 A;  2PVB A;  1YR5 A;  5CSJ A;  2KAY A;  3BQ3 A;  1KWO C;  1RK9 A;  1YRU B;  4N1G A;  1XFZ O;  1SPY A;  1NX2 A;  3PN7 C;  1CKK A;  1HQV A;  2JNF A;  1DGV A;  2F8P A;  3O4Y A;  2EC6 B;  4BY5 A;  4JQ0 D;  1N65 A;  2SAS A;  2NCP A;  3I5G B;  3AAJ A;  2OS8 B;  4MLW A;  1YVL A;  2QPT A;  4YGE B;  4QJ5 B;  3SG6 A;  1KK8 B;  2M0R A;  1FI5 A;  2BCB A;  2BBM A;  3FIA A;  4CFR A;  2PAS A;  2ZRT A;  3MSE B;  2AUC A;  4DRW A;  3VRQ A;  2CT9 A;  1BJF A;  2HQW A;  3I5H C;  1AJ5 A;  4MRY A;  2MJW B;  1AVS A;  5HYD A;  3D10 A;  3KPX A;  1NPQ A;  3CR4 X;  2HPS A;  5DKR A;  1OQP A;  1QLK A;  1SL7 A;  1XFY O;  2GV5 A;  5F6T A;  5B8I B;  1J7P A;  4A4C A;  4F0Z B;  3F45 A;  2MLE C;  2GGM A;  2FCD A;  1QXP A;  3BOW A;  4OVN F;  2KFF A;  1V1G A;  3A4U B;  2PAL A;  1CDP A;  1MQ1 A;  1AP4 A;  1WRL A;  4D1E A;  2G9B A;  5HLO A;  3TDU A;  3CR5 X;  3TUY B;  1B8L A;  3PLF B;  4I5J A;  1TTX A;  2L5X B;  1MR8 A;  3NSK A;  5I2L A;  4PHN A;  1UHH A;  1XYD A;  4MN0 A;  1BU3 A;  4GAO A;  1J1E A;  2WCB A;  2MAZ A;  1YX7 A;  2CBL A;  2L0P A;  1H8B A;  5AER A;  1EL4 A;  4XJK A;  1L7Z A;  2JTZ A;  2WOR A;  3AKB A;  4OR9 B;  4MZK A;  1CFP A;  1C7V A;  2PSR A;  1UHI A;  2P6B B;  1A4P A;  1OOJ A;  1LXF C;  2KGR A;  2JWW A;  2CCM A;  2EC6 C;  2LV7 A;  3DVJ A;  4YGC B;  2OS8 C;  2LVI A;  3TS5 B;  1EG3 A;  1Y1A A;  3JVT B;  1AJ4 A;  3KF9 A;  3FWB A;  2Q4U A;  1IQ3 A;  1Y1X A;  1OE9 B;  1FPW A;  1CFD A;  4MZL A;  1IGV A;  4YI8 A;  3EVU A;  1LKJ A;  1VRK A;  2KHN A;  1WRK A;  1JF2 A;  1QAT A;  1SL9 A;  1CMF A;  1A75 B;  1S36 A;  4A4B A;  4N1F A;  3HX4 A;  1NX0 A;  4JWQ A;  2LLS A;  3FS7 A;  1ALV A;  2CXJ A;  2M9G A;  2F2P A;  2LP3 A;  1TIZ A;  4GGF C;  3LCP C;  5HLV A;  3K21 A;  2K7B A;  1SCM B;  3EK7 A;  2LP2 A;  3TUY C;  1DJW A;  2MBX A;  1R6P A;  3WHU B;  1YUU A;  2AAO A;  2JNX A;  1YUS A;  1J7R A;  1IH0 A;  3NSI A;  3IQQ A;  1RFJ A;  1W7I B;  2LAP A;  5ER4 X;  2BKI B;  2NCO A;  4FQO A;  4GGF A;  4DIR A;  3I5I B;  1B7T Y;  1IJ6 A;  1LA3 A;  1OZS A;  1KK7 Y;  4ZCU A;  1CM4 A;  2LAN A;  3PM8 A;  1DJZ A;  2M1K B;  2M7L A;  1XFU O;  2CNP A;  1JC2 A;  2KSP A;  3TS5 C;  3OX6 A;  3JVT C;  2MLF C;  2M49 B;  1K8U A;  4CFQ A;  1TCO B;  1UUS A;  1CDN A;  1AHR A;  1REC A;  4ICB A;  1MHO A;  1KFU L;  1SR6 C;  2BL0 B;  5JJG A;  3JTD B;  4MEW A;  1J1D A;  2KOT A;  4ORC B;  2R2I A;  1JSA A;  2KBM A;  1BR4 B;  1YRT B;  1BR1 B;  5PAL A;  1RTP 1;  5KSZ A;  3DVK A;  3VRO A;  1U5I B;  2OPO A;  5AXI A;  1D1O A;  2COL B;  4MSP A;  2HF5 A;  2LVV A;  1SL8 A;  1PSR A;  3EKJ A;  1ZOT B;  4OKH A;  1SCM C;  2BCX A;  2JTT A;  1KQV A;  3I5F B;  1A75 A;  4MBE A;  1G4Y R;  1NCZ A;  1YX8 A;  1NSH A;  3GK4 X;  1WDC B;  3VRN A;  1Q80 A;  1TCF A;  4NDD A;  2LC5 A;  1DJX A;  2FJU B;  1OMV A;  1W7J B;  5CSI A;  2LMU A;  4AOM A;  2K61 A;  1QIW A;  2Y4Q A;  1G33 A;  1PUL A;  3RLZ A;  4AQJ A;  2MHH A;  4DUQ A;  1OSA A;  1WLZ A;  4ORB B;  1JWD A;  2D8N A;  2K7C A;  1FW4 A;  1SRA A;  2KDH A;  3CTN A;  4I5L B;  1KFX L;  1CFF A;  4MZJ A;  1MF8 B;  1UHJ A;  4PE4 A;  1F70 A;  3ZWH A;  1DMO A;  1UWO A;  3PAL A;  1CFC A;  2BCA A;  3NSO A;  3VGO A;  1YVH A;  1FI6 A;  1SBJ A;  2BL0 C;  1L2O B;  4TNC A;  3LK0 A;  2KI4 B;  1PVA A;  3JTD C;  4HRE E;  1K95 A;  3EVR A;  2LLT A;  1XK4 C;  5KU1 A;  2WCF A;  4E68 A;  3D0Y B;  4IL1 A;  2JZI A;  2WOS A;  2ZNE A;  1BOD A;  1BF5 A;  2ZND A;  1XFW O;  1QX5 B;  2JXC A;  3O78 A;  1SKT A;  1A03 A;  3HCM A;  1K9P A;  3WHT B;  1CMG A;  1SY9 A;  2LLU A;  2PRU A;  1XK4 A;  3LL8 B;  1KFX S;  1JFJ A;  1S26 D;  1B1G A;  2ZN8 A;  1KCY A;  1SCV A;  2KQY A;  3SG5 A;  2ZRS A;  1E8A A;  1K96 A;  3I5G C;  4ETO A;  2K2F A;  1QX2 A;  1TN4 A;  1KK8 C;  1EJ3 A;  3OB2 B;  1HT9 A;  1FBV A;  2K0J A;  1YUR A;  4YI9 A;  3OP0 A;  1M45 A;  2KNE A;  4NDB A;  2Y1N A;  1UP5 A;  1Y6W A;  3PAT A;  3OX5 A;  4DS7 A;  3CWG A;  5CSF A;  1NYA A;  2L98 A;  4YGA A;  1WRZ A;  2SCP A;  1QVI Y;  4JPZ B;  1CTR A;  1CM1 A;  1QV0 A;  1SNL A;  3A8R A;  1EH2 A;  5GQQ C;  1B7T Z;  2KI4 C;  1KK7 Z;  4PE7 A;  5I8N A;  3PSR A;  1RWY A;  1M31 A;  2JT8 A;  4HRG A;  2B1U A;  1NX1 A;  5CPV A;  2BEC A;  2VRG A;  1NP8 A;  1FF1 A;  2LUX A;  4M2O A;  4WQ3 A;  3AAK A;  2L2E A;  2Y1M A;  5AEQ A;  1JF0 A;  5CSN A;  1YUT A;  2K8M B; 
#chains in the Genus database with same CATH topology
 1NCX A;  4PE1 A;  1C07 A;  2LE9 B;  1IQ5 A;  2EHB A;  3NHT A;  4XYN A;  2ZN9 A;  3D0Y A;  3VRR A;  4DCK A;  1PRW A;  2WCE A;  5DKN A;  1ZAC A;  3OB1 B;  2L4I A;  2F33 A;  1S6J A;  1KQM B;  1QIV A;  1WY9 A;  2L51 A;  5G08 A;  4PDZ A;  2ZKM X;  5I2Q A;  1S5G Y;  3OHM B;  3PFV A;  4PHJ A;  4WRI A;  1B4C A;  2KQ6 A;  1C7W A;  2F2O A;  4YBH B;  1JBA A;  1N2D A;  1F55 A;  1OMR A;  3SG4 A;  3DY9 A;  3KHE A;  2JPT A;  1J7Q A;  1B8C A;  1A2X A;  1QX7 A;  2QEH A;  2PMY A;  3IQO A;  3GK2 A;  4QJ3 B;  4YGB B;  2BE6 A;  1H4B A;  1K9K A;  2WC8 A;  2K7D A;  3BUM B;  1IJ5 A;  3WXA A;  2GGZ A;  1K93 D;  3LK1 A;  3BOW B;  3I5H B;  2QAC A;  1M46 A;  1G8I A;  3B7A A;  2OTG B;  1DJG A;  1TNP A;  3LLE A;  4QJ4 B;  5I2O A;  4PE0 A;  1EXR A;  2WCM A;  4GBA A;  1PK0 D;  2H2K A;  2I2R E;  4R1E A;  1RJV A;  1CLB A;  2KFH A;  3BYA A;  3CGA A;  1TNX A;  1NUB A;  3DF0 B;  2KYC A;  3TZ1 A;  4AQI A;  1LA0 A;  1GGW A;  1DEL A;  4CID A;  3R1V A;  5AFP A;  1PSB A;  1OW4 A;  4NDC A;  1BLQ A;  2KPH A;  1KFU S;  2H61 C;  3CZT X;  3I5I C;  1DVI A;  3SS5 A;  1ZMZ A;  1QTX A;  1GGZ A;  1AUI B;  3EK8 A;  1Y1U A;  2M3W A;  5K89 A;  3CYZ A;  3RM1 A;  1KQM C;  1QWV A;  3BUN B;  2MA2 A;  1TRF A;  4ZCV A;  2KAV A;  4PHK A;  1K2H A;  3EKH A;  3CZ1 A;  1ALW A;  3SG2 A;  1CDL A;  3WNX B;  2L2C A;  4HSZ A;  3B86 A;  4MRX A;  4I5N B;  4CLN A;  2KGB C;  2M8U A;  1SYM A;  4L9M A;  3SJS A;  1T14 A;  2H61 A;  2M97 A;  2E6W A;  1TWO A;  2FCE A;  2M1U A;  3S0G A;  2O60 A;  2I18 A;  2F3Z A;  3SIA A;  2I94 A;  2JQ6 A;  1F8H A;  4PAL A;  4GGN A;  1J55 A;  1IKU A;  1SW8 A;  3S0D A;  4INX A;  5D69 A;  1ORG A;  3PJI A;  2LMT A;  1PAL A;  2NLN A;  1IWQ A;  1B9A A;  1NX3 A;  2Y5I A;  4GFT A;  1YTZ C;  5BPJ A;  2F3Y A;  2JOJ A;  3BUW B;  2OTG C;  2BE4 A;  1SMG A;  3IVT A;  1UHK A;  2JT0 A;  1DTL A;  2A4J A;  4M2Q A;  1AK8 A;  3CLN A;  3IF7 A;  2M29 A;  3FWC A;  1K9U A;  2G2B A;  1TUJ A;  1ODB A;  1PVB A;  3I5F C;  3NXA A;  3TDI A;  5IBW A;  2KI6 D;  1UUR A;  1S6I A;  1WDC C;  1QVI Z;  5D3O A;  4OCI A;  1BT6 A;  4P2Y B;  1C3Y A;  1B8R A;  4FTG A;  1U5I A;  3D77 A;  5FYX A;  1Z4H A;  2BBN A;  1CLL A;  3K1E A;  2O5G A;  2QDI A;  1J7O A;  2JT3 A;  1S6C A;  1N0Y A;  2ZFD A;  1XFV O;  3EK4 A;  2WCH A;  3E3R A;  2P70 A;  2KFG A;  4BY4 A;  1S3P A;  1LIN A;  3UO9 A;  1M63 B;  2CTN A;  2KYF A;  3DF0 A;  3BFB A;  1DC1 A;  3DVE A;  1QJT A;  1K94 A;  4GNK B;  4M2P A;  1DF0 B;  4WQ2 A;  1TNW A;  1ZUZ A;  5KTY A;  2LHI A;  1L2O C;  3KO0 A;  2NXQ A;  2M7N A;  3TDZ A;  2MRD A;  4MVF A;  1MWN A;  2ISD A;  3H4S E;  3DD4 A;  4JD9 A;  1NCY A;  2LM5 A;  5HKW A;  3ZNI A;  1X02 A;  3SS4 A;  2K2A A;  2L50 A;  3KEV A;  1CNP A;  4USL A;  1GQM A;  1Y0V H;  2FOT A;  4HRH A;  1M39 A;  2LUC A;  1S5G Z;  1XO5 A;  1MUX A;  3VRP A;  1SR6 B;  1JUO A;  2EGD A;  2K7O A;  2KI6 C;  1EG4 A;  1OZO A;  1XA5 A;  4PT1 A;  1CDM A;  2JPO A;  4C0J A;  3OBV A;  3L47 A;  4PHM A;  1F4Q A;  3M0W A;  1DGU A;  2QEO A;  2BKH B;  3UNW A;  5FI7 A;  5ER5 A;  2IS9 A;  1CB1 A;  4YRU A;  1GJY A;  5AAN A;  3L4A A;  1K90 D;  3QRX A;  3DVM A;  2HET A;  5J3X A;  3BUX B;  2RGI A;  3BUO B;  3BXK A;  1BG1 A;  1TNQ A;  1DJH A;  1KSM A;  1NWD A;  5HKY A;  4UPG A;  3R1O A;  1QAS A;  1DT7 B;  1SSE B;  1KWO B;  3S0F A;  1IRJ A;  2JC2 A;  3PN7 B;  1XFX O;  4FQT A;  2E30 A;  2WND A;  1ZFS A;  3GOF A;  1JFK A;  2LMV A;  2KLE A;  1R2U A;  4GPL B;  4N5X A;  4PCW A;  4C0K A;  4I5K A;  2AMI A;  2Q91 A;  5JOL A;  2JUL A;  1F71 A;  1CLM A;  3O2P A;  3CS1 A;  3Q8I A;  2JRF A;  5HKZ A;  2HQ8 A;  3C1V A;  1UHN A;  5FI2 A;  1QS7 A;  5DKQ A;  4GUK A;  2LVJ A;  3EVV A;  2V53 A;  3NSL A;  2K60 A;  4NQG A;  1XVJ A;  2I7A A;  4Q04 A;  3CR2 A;  4C0L A;  4YGD B;  4ORA B;  3DZT A;  2L4H A;  4U8D A;  3AKA A;  1DF0 A;  1LVC D;  3SG3 A;  1S1E A;  5D7F A;  2NZ0 A;  1RRO A;  3SG7 A;  1DJY A;  1NIW A;  4P5O E;  1V1F A;  1A29 A;  2LNK A;  1WLM A;  4XJK B;  3O6B A;  1QLS A;  1SK6 D;  1F4O A;  2JU0 A;  2LVK A;  1F54 A;  5TNC A;  1MXE A;  2JXL A;  2LHL A;  1IG5 A;  1DJI A;  1MXL C;  3B6X A;  1KSO A;  3D74 A;  1QV1 A;  2DOQ A;  3GK1 A;  1BOC A;  2KBI A;  3SIB A;  3B88 A;  4CPV A;  1TOP A;  1B47 A;  2LCP A;  3ICB A;  3FE8 A;  3NHI A;  1BMO A;  2KAX A;  1OMD A;  2TN4 A;  3D75 A;  3CZ0 A;  4OV2 A;  2PVB A;  1YR5 A;  5CSJ A;  2KAY A;  3BQ3 A;  1KWO C;  1RK9 A;  1YRU B;  4N1G A;  1XFZ O;  1SPY A;  1NX2 A;  3PN7 C;  1CKK A;  1HQV A;  2JNF A;  1DGV A;  2F8P A;  3O4Y A;  2EC6 B;  4BY5 A;  4JQ0 D;  3FE6 A;  1N65 A;  2SAS A;  2NCP A;  3I5G B;  3AAJ A;  2OS8 B;  4MLW A;  1YVL A;  2QPT A;  4YGE B;  4QJ5 B;  3SG6 A;  1KK8 B;  2M0R A;  5I94 A;  2BCB A;  2BBM A;  3FIA A;  1FI5 A;  3S0B A;  2PAS A;  2ZRT A;  3MSE B;  4CFR A;  2AUC A;  4DRW A;  3VRQ A;  2CT9 A;  1BJF A;  2HQW A;  3I5H C;  1AJ5 A;  4MRY A;  2MJW B;  1AVS A;  5HYD A;  3D10 A;  3KPX A;  1NPQ A;  3CR4 X;  2HPS A;  5DKR A;  1OQP A;  1QLK A;  1SL7 A;  1XFY O;  2GV5 A;  5F6T A;  5B8I B;  1J7P A;  2H8V A;  4A4C A;  4F0Z B;  3DXL A;  3F45 A;  2MLE C;  2GGM A;  2FCD A;  1QXP A;  3BOW A;  4OVN F;  2KFF A;  1V1G A;  3A4U B;  2PAL A;  1CDP A;  1MQ1 A;  1AP4 A;  1WRL A;  4D1E A;  2G9B A;  5HLO A;  3TDU A;  3CR5 X;  3TUY B;  1B8L A;  3PLF B;  4I5J A;  1TTX A;  2L5X B;  1MR8 A;  3NSK A;  4IJ7 A;  4PHN A;  5I2L A;  1UHH A;  1XYD A;  4MN0 A;  1BU3 A;  4GAO A;  1J1E A;  2WCB A;  2MAZ A;  1YX7 A;  2CBL A;  2L0P A;  3DYE A;  3D76 A;  1H8B A;  5AER A;  1EL4 A;  4XJK A;  1L7Z A;  2JTZ A;  2WOR A;  3VB1 A;  3AKB A;  4OR9 B;  4MZK A;  1CFP A;  1C7V A;  2PSR A;  1UHI A;  3CAB A;  2P6B B;  1A4P A;  1OOJ A;  1LXF C;  2KGR A;  2JWW A;  2CCM A;  2EC6 C;  2LV7 A;  3DVJ A;  4YGC B;  1OOI X;  2OS8 C;  2LVI A;  3TS5 B;  1EG3 A;  1Y1A A;  2YGU A;  3JVT B;  1AJ4 A;  3KF9 A;  3FWB A;  3D73 A;  2Q4U A;  3BJH A;  1IQ3 A;  1Y1X A;  1OE9 B;  1XFR A;  1CFD A;  2PYQ A;  1FPW A;  4MZL A;  1IGV A;  4YI8 A;  3EVU A;  1LKJ A;  1W9Z A;  1VRK A;  2KHN A;  1WRK A;  1JF2 A;  1QAT A;  3EG5 B;  3QME A;  1SL9 A;  4F7F A;  1A75 B;  1S36 A;  4A4B A;  4N1F A;  3HX4 A;  5FI6 A;  1CMF A;  1IIO A;  3B87 A;  4JKT A;  1NX0 A;  4JWQ A;  2LLS A;  3FS7 A;  1ALV A;  2CXJ A;  2M9G A;  2F2P A;  2LP3 A;  1TIZ A;  4GGF C;  3LCP C;  5HLV A;  3K21 A;  2K7B A;  1SCM B;  3EK7 A;  2LP2 A;  3TUY C;  1DJW A;  3R1P A;  2MBX A;  1R6P A;  3WHU B;  1YUU A;  2AAO A;  2JNX A;  1YUS A;  1J7R A;  1GM0 A;  1IH0 A;  3NSI A;  3IQQ A;  1RFJ A;  1W7I B;  2LAP A;  5ER4 X;  2BKI B;  2PQL A;  2NCO A;  4FQO A;  4GGF A;  4DIR A;  3I5I B;  1B7T Y;  1IJ6 A;  1LA3 A;  1OZS A;  1KK7 Y;  3OGN A;  4ZCU A;  1CM4 A;  2GTE A;  2LAN A;  3PM8 A;  1DJZ A;  2M1K B;  2M7L A;  1XFU O;  2CNP A;  1JC2 A;  2KSP A;  5HL1 A;  3TS5 C;  3OX6 A;  3JVT C;  2MLF C;  2M49 B;  1K8U A;  4CFQ A;  1TCO B;  1UUS A;  2WC6 A;  1CDN A;  1AHR A;  2L5Y A;  1REC A;  2QEB A;  4ICB A;  1MHO A;  1KFU L;  1SR6 C;  2BL0 B;  5JJG A;  3L4L A;  3JTD B;  4MEW A;  1J1D A;  2KOT A;  4ORC B;  2R2I A;  3V2L A;  3S0A A;  1JSA A;  2KBM A;  1BR4 B;  1YRT B;  1BR1 B;  5PAL A;  1RTP 1;  5KSZ A;  3DVK A;  3VRO A;  1U5I B;  2OPO A;  5AXI A;  1D1O A;  2COL B;  4MSP A;  2FJY A;  2HF5 A;  2LVV A;  1SL8 A;  1PSR A;  3EKJ A;  1ZOT B;  4OKH A;  1SCM C;  2BCX A;  2JTT A;  1KQV A;  3I5F B;  1A75 A;  2P71 A;  4MBE A;  3SS3 A;  1G4Y R;  1NCZ A;  1YX8 A;  1NSH A;  2WCK A;  1WDC B;  3GK4 X;  3VRN A;  1Q80 A;  2KLD A;  1TCF A;  4NDD A;  2LC5 A;  1DJX A;  2FJU B;  3O4X A;  5DIC A;  1OMV A;  1W7J B;  5CSI A;  2LMU A;  3CZ2 A;  1OOG A;  4AOM A;  2K61 A;  3D78 A;  1QIW A;  2Y4Q A;  1G33 A;  1PUL A;  3RLZ A;  4AQJ A;  2MHH A;  4DUQ A;  1OSA A;  1WLZ A;  2WCL A;  1P28 A;  2D8N A;  2K7C A;  4ORB B;  1FW4 A;  3RZS A;  1SRA A;  1JWD A;  2KDH A;  3CTN A;  4I5L B;  1KFX L;  1CFF A;  4MZJ A;  1MF8 B;  1UHJ A;  4PE4 A;  1F70 A;  3ZWH A;  1DMO A;  1UWO A;  3PAL A;  1CFC A;  2WCJ A;  2BCA A;  3NSO A;  3VGO A;  1YVH A;  1FI6 A;  1SBJ A;  1TUZ A;  2BL0 C;  1L2O B;  4KYN A;  5EL2 A;  4TNC A;  3LK0 A;  2KI4 B;  1PVA A;  3JTD C;  4HRE E;  1K95 A;  3EVR A;  2LLT A;  1XK4 C;  5KU1 A;  2WCF A;  4E68 A;  1C3Z A;  3D0Y B;  4IL1 A;  2JZI A;  2WOS A;  2ZNE A;  4OZD A;  1BOD A;  1DEK A;  1BF5 A;  2ZND A;  1XFW O;  1QX5 B;  2JXC A;  3O78 A;  3N7H A;  3R72 A;  1SKT A;  1A03 A;  3HCM A;  1K9P A;  3WHT B;  1CMG A;  1SY9 A;  2BAP A;  2LLU A;  2PRU A;  1XK4 A;  3BFH A;  3CDN A;  3LL8 B;  2ERB A;  1KFX S;  1JFJ A;  1S26 D;  1B1G A;  2ZN8 A;  1KCY A;  1SCV A;  2KQY A;  3SG5 A;  2ZRS A;  1E8A A;  1K96 A;  3I5G C;  4ETO A;  2K2F A;  1QX2 A;  3NGV A;  1TN4 A;  1KK8 C;  1EJ3 A;  3OB2 B;  1HT9 A;  1FBV A;  2K0J A;  1YUR A;  2BNX A;  4YI9 A;  3OP0 A;  1M45 A;  1Z2C B;  2KNE A;  4NDB A;  2Y1N A;  1UP5 A;  1Y6W A;  3PM2 A;  3PAT A;  3OX5 A;  4DS7 A;  3CWG A;  1OOF A;  5CSF A;  1NYA A;  2L98 A;  1OOH A;  3FE9 A;  4YGA A;  1WRZ A;  2QEV A;  2SCP A;  1QVI Y;  3BFA A;  4JPZ B;  1CTR A;  1CM1 A;  1QV0 A;  1SNL A;  3A8R A;  4INW A;  1EH2 A;  5GQQ C;  1B7T Z;  1DQE A;  2KI4 C;  3S0E A;  1KK7 Z;  4PE7 A;  5I8N A;  3PSR A;  1RWY A;  1M31 A;  2JT8 A;  1LS8 A;  4HRG A;  1NX1 A;  2B1U A;  5CPV A;  2BEC A;  2VRG A;  1NP8 A;  1FF1 A;  2LUX A;  4M2O A;  4WQ3 A;  3AAK A;  2WC5 A;  2L2E A;  2Y1M A;  5AEQ A;  1JF0 A;  5CSN A;  1YUT A;  2K8M B; 
#chains in the Genus database with same CATH homology
 1NCX A;  4PE1 A;  1C07 A;  2LE9 B;  1IQ5 A;  2EHB A;  4XYN A;  2ZN9 A;  3D0Y A;  3VRR A;  4DCK A;  1PRW A;  2WCE A;  5DKN A;  1ZAC A;  3OB1 B;  2L4I A;  2F33 A;  1S6J A;  1KQM B;  1QIV A;  1WY9 A;  2L51 A;  5G08 A;  4PDZ A;  2ZKM X;  5I2Q A;  1S5G Y;  3OHM B;  3PFV A;  4PHJ A;  4WRI A;  1B4C A;  2KQ6 A;  1C7W A;  2F2O A;  4YBH B;  1JBA A;  1N2D A;  1F55 A;  1OMR A;  3SG4 A;  3KHE A;  2JPT A;  1J7Q A;  1B8C A;  1A2X A;  1QX7 A;  2PMY A;  3IQO A;  3GK2 A;  4QJ3 B;  4YGB B;  2BE6 A;  1H4B A;  1K9K A;  2WC8 A;  2K7D A;  3BUM B;  1IJ5 A;  3WXA A;  2GGZ A;  1K93 D;  3LK1 A;  3BOW B;  3I5H B;  2QAC A;  1M46 A;  1G8I A;  2OTG B;  1DJG A;  1TNP A;  3LLE A;  4QJ4 B;  5I2O A;  4PE0 A;  1EXR A;  4GBA A;  1PK0 D;  2H2K A;  2I2R E;  4R1E A;  1RJV A;  1CLB A;  2KFH A;  3BYA A;  3CGA A;  1TNX A;  1NUB A;  3DF0 B;  2KYC A;  3TZ1 A;  4AQI A;  1LA0 A;  1GGW A;  4CID A;  5AFP A;  1PSB A;  4NDC A;  1BLQ A;  1KFU S;  2H61 C;  3CZT X;  3I5I C;  1DVI A;  1ZMZ A;  1QTX A;  1GGZ A;  1AUI B;  3EK8 A;  1Y1U A;  2M3W A;  5K89 A;  3RM1 A;  1KQM C;  3BUN B;  2MA2 A;  1TRF A;  4ZCV A;  2KAV A;  4PHK A;  1K2H A;  3EKH A;  1ALW A;  3SG2 A;  1CDL A;  3WNX B;  4HSZ A;  4MRX A;  4I5N B;  4CLN A;  2KGB C;  2M8U A;  1SYM A;  4L9M A;  3SJS A;  2H61 A;  2M97 A;  2E6W A;  2FCE A;  2M1U A;  2O60 A;  2I18 A;  2F3Z A;  3SIA A;  2I94 A;  2JQ6 A;  1F8H A;  4PAL A;  4GGN A;  1J55 A;  1IKU A;  1SW8 A;  5D69 A;  2LMT A;  1PAL A;  2NLN A;  1IWQ A;  1B9A A;  1NX3 A;  2Y5I A;  4GFT A;  1YTZ C;  5BPJ A;  2F3Y A;  2JOJ A;  3BUW B;  2OTG C;  2BE4 A;  1SMG A;  1UHK A;  2JT0 A;  1DTL A;  2A4J A;  4M2Q A;  1AK8 A;  3CLN A;  3IF7 A;  2M29 A;  3FWC A;  1K9U A;  2G2B A;  3I5F C;  1ODB A;  1PVB A;  3NXA A;  3TDI A;  5IBW A;  2KI6 D;  1UUR A;  1S6I A;  1WDC C;  1QVI Z;  4OCI A;  1BT6 A;  4P2Y B;  1B8R A;  4FTG A;  1U5I A;  5FYX A;  2BBN A;  1CLL A;  2O5G A;  1J7O A;  2JT3 A;  1S6C A;  1N0Y A;  2ZFD A;  1XFV O;  3EK4 A;  3E3R A;  2KFG A;  4BY4 A;  1S3P A;  1LIN A;  1M63 B;  2CTN A;  2KYF A;  3DF0 A;  3DVE A;  1QJT A;  1K94 A;  4GNK B;  4M2P A;  1DF0 B;  4WQ2 A;  1TNW A;  1ZUZ A;  5KTY A;  2LHI A;  1L2O C;  3KO0 A;  2NXQ A;  2M7N A;  3TDZ A;  2MRD A;  4MVF A;  1MWN A;  2ISD A;  3H4S E;  3DD4 A;  1NCY A;  2LM5 A;  5HKW A;  3ZNI A;  1X02 A;  2K2A A;  2L50 A;  3KEV A;  1CNP A;  4USL A;  1GQM A;  1Y0V H;  2FOT A;  4HRH A;  1M39 A;  2LUC A;  1S5G Z;  1XO5 A;  1MUX A;  3VRP A;  1SR6 B;  1JUO A;  2EGD A;  2K7O A;  2KI6 C;  1EG4 A;  1OZO A;  1XA5 A;  1CDM A;  4C0J A;  4PHM A;  1F4Q A;  3M0W A;  1DGU A;  2BKH B;  5ER5 A;  2IS9 A;  1CB1 A;  4YRU A;  1GJY A;  5AAN A;  1K90 D;  3QRX A;  3DVM A;  2HET A;  5J3X A;  3BUX B;  2RGI A;  3BUO B;  3BXK A;  1BG1 A;  1TNQ A;  1DJH A;  1KSM A;  1NWD A;  5HKY A;  4UPG A;  1QAS A;  1DT7 B;  1KWO B;  1IRJ A;  2JC2 A;  3PN7 B;  1XFX O;  2E30 A;  2WND A;  1ZFS A;  3GOF A;  1JFK A;  2LMV A;  4GPL B;  1R2U A;  4N5X A;  4PCW A;  4C0K A;  4I5K A;  2AMI A;  2Q91 A;  5JOL A;  2JUL A;  1F71 A;  1CLM A;  3O2P A;  3CS1 A;  2JRF A;  5HKZ A;  2HQ8 A;  3C1V A;  1UHN A;  1QS7 A;  5DKQ A;  4GUK A;  2LVJ A;  3EVV A;  2V53 A;  3NSL A;  4NQG A;  1XVJ A;  2I7A A;  4Q04 A;  3CR2 A;  4C0L A;  4YGD B;  4ORA B;  2L4H A;  4U8D A;  3AKA A;  1DF0 A;  1LVC D;  3SG3 A;  1S1E A;  5D7F A;  2NZ0 A;  1RRO A;  3SG7 A;  1DJY A;  1NIW A;  4P5O E;  1V1F A;  1A29 A;  2LNK A;  1WLM A;  4XJK B;  3O6B A;  1QLS A;  1SK6 D;  1F4O A;  2JU0 A;  2LVK A;  1F54 A;  5TNC A;  1MXE A;  2JXL A;  2LHL A;  1IG5 A;  1DJI A;  1MXL C;  1KSO A;  1QV1 A;  2DOQ A;  3GK1 A;  1BOC A;  2KBI A;  3SIB A;  4CPV A;  1TOP A;  1B47 A;  2LCP A;  3ICB A;  1BMO A;  2KAX A;  1OMD A;  2TN4 A;  4OV2 A;  2PVB A;  1YR5 A;  5CSJ A;  2KAY A;  3BQ3 A;  1KWO C;  1RK9 A;  1YRU B;  4N1G A;  1XFZ O;  1SPY A;  1NX2 A;  3PN7 C;  1CKK A;  1HQV A;  2JNF A;  1DGV A;  2F8P A;  3O4Y A;  2EC6 B;  4BY5 A;  4JQ0 D;  1N65 A;  2SAS A;  2NCP A;  3I5G B;  3AAJ A;  2OS8 B;  4MLW A;  1YVL A;  2QPT A;  4YGE B;  4QJ5 B;  3SG6 A;  1KK8 B;  2M0R A;  1FI5 A;  2BCB A;  2BBM A;  3FIA A;  4CFR A;  2PAS A;  2ZRT A;  3MSE B;  2AUC A;  4DRW A;  3VRQ A;  2CT9 A;  1BJF A;  2HQW A;  3I5H C;  1AJ5 A;  4MRY A;  2MJW B;  1AVS A;  5HYD A;  3D10 A;  3KPX A;  1NPQ A;  3CR4 X;  2HPS A;  5DKR A;  1OQP A;  1QLK A;  1SL7 A;  1XFY O;  2GV5 A;  5F6T A;  5B8I B;  1J7P A;  4A4C A;  4F0Z B;  3F45 A;  2MLE C;  2GGM A;  2FCD A;  1QXP A;  3BOW A;  4OVN F;  2KFF A;  1V1G A;  3A4U B;  2PAL A;  1CDP A;  1MQ1 A;  1AP4 A;  1WRL A;  4D1E A;  2G9B A;  5HLO A;  3TDU A;  3CR5 X;  3TUY B;  1B8L A;  3PLF B;  4I5J A;  1TTX A;  2L5X B;  1MR8 A;  3NSK A;  5I2L A;  4PHN A;  1UHH A;  1XYD A;  4MN0 A;  1BU3 A;  4GAO A;  1J1E A;  2WCB A;  2MAZ A;  1YX7 A;  2CBL A;  2L0P A;  1H8B A;  5AER A;  1EL4 A;  4XJK A;  1L7Z A;  2JTZ A;  2WOR A;  3AKB A;  4OR9 B;  4MZK A;  1CFP A;  1C7V A;  2PSR A;  1UHI A;  2P6B B;  1A4P A;  1OOJ A;  1LXF C;  2KGR A;  2JWW A;  2CCM A;  2EC6 C;  2LV7 A;  3DVJ A;  4YGC B;  2OS8 C;  2LVI A;  3TS5 B;  1EG3 A;  1Y1A A;  3JVT B;  1AJ4 A;  3KF9 A;  3FWB A;  2Q4U A;  1IQ3 A;  1Y1X A;  1OE9 B;  1FPW A;  1CFD A;  4MZL A;  1IGV A;  4YI8 A;  3EVU A;  1LKJ A;  1VRK A;  2KHN A;  1WRK A;  1JF2 A;  1QAT A;  1SL9 A;  1CMF A;  1A75 B;  1S36 A;  4A4B A;  4N1F A;  3HX4 A;  1NX0 A;  4JWQ A;  2LLS A;  3FS7 A;  1ALV A;  2CXJ A;  2M9G A;  2F2P A;  2LP3 A;  1TIZ A;  4GGF C;  3LCP C;  5HLV A;  3K21 A;  2K7B A;  1SCM B;  3EK7 A;  2LP2 A;  3TUY C;  1DJW A;  2MBX A;  1R6P A;  3WHU B;  1YUU A;  2AAO A;  2JNX A;  1YUS A;  1J7R A;  1IH0 A;  3NSI A;  3IQQ A;  1RFJ A;  1W7I B;  2LAP A;  5ER4 X;  2BKI B;  2NCO A;  4FQO A;  4GGF A;  4DIR A;  3I5I B;  1B7T Y;  1IJ6 A;  1LA3 A;  1OZS A;  1KK7 Y;  4ZCU A;  1CM4 A;  2LAN A;  3PM8 A;  1DJZ A;  2M1K B;  2M7L A;  1XFU O;  2CNP A;  1JC2 A;  2KSP A;  3TS5 C;  3OX6 A;  3JVT C;  2MLF C;  2M49 B;  1K8U A;  4CFQ A;  1TCO B;  1UUS A;  1CDN A;  1AHR A;  1REC A;  4ICB A;  1MHO A;  1KFU L;  1SR6 C;  2BL0 B;  5JJG A;  3JTD B;  4MEW A;  1J1D A;  2KOT A;  4ORC B;  2R2I A;  1JSA A;  2KBM A;  1BR4 B;  1YRT B;  1BR1 B;  5PAL A;  1RTP 1;  5KSZ A;  3DVK A;  3VRO A;  1U5I B;  2OPO A;  5AXI A;  1D1O A;  2COL B;  4MSP A;  2HF5 A;  2LVV A;  1SL8 A;  1PSR A;  3EKJ A;  1ZOT B;  4OKH A;  1SCM C;  2BCX A;  2JTT A;  1KQV A;  3I5F B;  1A75 A;  4MBE A;  1G4Y R;  1NCZ A;  1YX8 A;  1NSH A;  3GK4 X;  1WDC B;  3VRN A;  1Q80 A;  1TCF A;  4NDD A;  2LC5 A;  1DJX A;  2FJU B;  1OMV A;  1W7J B;  5CSI A;  2LMU A;  4AOM A;  2K61 A;  1QIW A;  2Y4Q A;  1G33 A;  1PUL A;  3RLZ A;  4AQJ A;  2MHH A;  4DUQ A;  1OSA A;  1WLZ A;  4ORB B;  1JWD A;  2D8N A;  2K7C A;  1FW4 A;  1SRA A;  2KDH A;  3CTN A;  4I5L B;  1KFX L;  1CFF A;  4MZJ A;  1MF8 B;  1UHJ A;  4PE4 A;  1F70 A;  3ZWH A;  1DMO A;  1UWO A;  3PAL A;  1CFC A;  2BCA A;  3NSO A;  3VGO A;  1YVH A;  1FI6 A;  1SBJ A;  2BL0 C;  1L2O B;  4TNC A;  3LK0 A;  2KI4 B;  1PVA A;  3JTD C;  4HRE E;  1K95 A;  3EVR A;  2LLT A;  1XK4 C;  5KU1 A;  2WCF A;  4E68 A;  3D0Y B;  4IL1 A;  2JZI A;  2WOS A;  2ZNE A;  1BOD A;  1BF5 A;  2ZND A;  1XFW O;  1QX5 B;  2JXC A;  3O78 A;  1SKT A;  1A03 A;  3HCM A;  1K9P A;  3WHT B;  1CMG A;  1SY9 A;  2LLU A;  2PRU A;  1XK4 A;  3LL8 B;  1KFX S;  1JFJ A;  1S26 D;  1B1G A;  2ZN8 A;  1KCY A;  1SCV A;  2KQY A;  3SG5 A;  2ZRS A;  1E8A A;  1K96 A;  3I5G C;  4ETO A;  2K2F A;  1QX2 A;  1TN4 A;  1KK8 C;  1EJ3 A;  3OB2 B;  1HT9 A;  1FBV A;  2K0J A;  1YUR A;  4YI9 A;  3OP0 A;  1M45 A;  2KNE A;  4NDB A;  2Y1N A;  1UP5 A;  1Y6W A;  3PAT A;  3OX5 A;  4DS7 A;  3CWG A;  5CSF A;  1NYA A;  2L98 A;  4YGA A;  1WRZ A;  2SCP A;  1QVI Y;  4JPZ B;  1CTR A;  1CM1 A;  1QV0 A;  1SNL A;  3A8R A;  1EH2 A;  5GQQ C;  1B7T Z;  2KI4 C;  1KK7 Z;  4PE7 A;  5I8N A;  3PSR A;  1RWY A;  1M31 A;  2JT8 A;  4HRG A;  2B1U A;  1NX1 A;  5CPV A;  2BEC A;  2VRG A;  1NP8 A;  1FF1 A;  2LUX A;  4M2O A;  4WQ3 A;  3AAK A;  2L2E A;  2Y1M A;  5AEQ A;  1JF0 A;  5CSN A;  1YUT A;  2K8M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...