2JC2A

The crystal structure of the natural f112l human sorcin mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISLDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SORCIN
publication title Molecular Basis for the Impaired Function of the Natural F112L Sorcin Mutant: X-Ray Crystal Structure, Calcium Affinity, and Interaction with Annexin Vii and the Ryanodine Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jc2A02
1HQVA 2I7AA 2K7OA 1X02A 1CKKA 3TDIA 1LVCD 3VROA 2BKIB 3BOWB 1DT7B 1IRJA 2H61A 1IWQA 2K0JA 3I5HB 1NX3A 1Y1AA 2LVJA 2OS8C 1SPYA 2LUXA 1KFXS 1PSRA 1CNPA 3SJSA 2F2OA 2QACA 3OB2B 1J1DA 1KFXL 1YX8A 4JPZB 4QJ4B 3DVKA 2CT9A 3VRQA 3LK0A 1F4OA 3CGAA 2JZIA 2Y5IA 3I5IB 3JTDB 2G9BA 3KO0A 1NUBA 1PULA 2COLB 4USLA 1MR8A 1Y1UA 4U8DA 2OTGC 1C7VA 5KU1A 2MAZA 1OOJA 3AAJA 3SIBA 3LK1A 3SG3A 4FQOA 1SL7A 1R2UA 1XFWO 4P2YB 2M0RA 5AXIA 3VRPA 4GPLB 3A4UB 2L2EA 2PSRA 1E8AA 2KBMA 1UHJA 1HT9A 2PALA 4I5NB 4MVFA 1RROA 4I5KA 1OZOA 1CFPA 1B8LA 1XK4C 1IJ6A 1DJIA 2JXLA 3DVJA 1K8UA 1BMOA 1TN4A 2SCPA 1JWDA 1OZSA 1BT6A 2NLNA 2K8MB 1XA5A 2KGBC 4C0LA 5PALA 1BLQA 3WNXB 1A75A 1KWOB 1U5IA 2JT0A 5CSFA 3DF0B 1Q80A 2LP3A 3SG4A 1GQMA 2NCPA 4N1FA 2AMIA 3SG5A 1CFCA 4MN0A 5J3XA 3O6BA 5I2LA 4YGCB 3EK7A 2BL0C 3D0YB 1S6IA 2MA2A 1NP8A 4BY5A 1AUIB 1JBAA 1K9UA 3TS5B 2KGRA 2KBIA 3H4SE 3CR2A 2WOSA 1XVJA 1L2OB 1EJ3A 1KK7Z 1WLZA 1V1FA 1J1EA 1M63B 1PALA 2L4HA 3GK4X 1QIWA 1QX7A 4MZKA 2JTTA 2VRGA 2ZKMX 1C07A 4PE0A 2KI6C 4IL1A 2CXJA 3A8RA 4CLNA 1S5GZ 2BE4A 1ZFSA 1PVBA 1WDCC 1YR5A 4Q04A 1JF2A 1S6CA 1DJWA 1BG1A 5HKWA 1XO5A 1QTXA 1NSHA 5IBWA 1DF0A 2CTNA 2KYCA 3EVVA 4GNKB 1QX5B 4OV2A 5D69A 2L98A 4AQJA 1DJGA 2HETA 2JC2A 1J7QA 1M45A 1J7OA 1RTP1 3FWCA 1OE9B 2DOQA 1SKTA 2KQ6A 5BPJA 3VRNA 1SCMC 3GOFA 3PN7C 4PALA 4MZLA 2JNFA 1J7RA 1SBJA 1XFZO 4ZCUA 3M0WA 3DF0A 5DKRA 1OMRA 4MSPA 3BXKA 1XK4A 2JNXA 4A4BA 2GV5A 1YUTA 1W7JB 2JULA 2LLTA 3BUWB 1BF5A 2FCDA 1K96A 2K2AA 1LA0A 2ZRTA 3I5HC 3JVTB 3HCMA 4NDDA 4ICBA 2K7BA 4PE4A 1LXFC 5HKZA 2G2BA 1QV0A 3NXAA 2EHBA 3ICBA 5B8IB 2JTZA 4JWQA 2LANA 1K93D 5AFPA 4MRXA 1B8RA 2KNEA 2LNKA 1KSMA 2CCMA 5TNCA 1ZOTB 3KPXA 4XJKB 1G4YR 3BUMB 1ZMZA 4MEWA 4ZCVA 1YRTB 4QJ5B 3AAKA 1UP5A 3NSKA 1XFXO 1BOCA 3BUOB 1MXEA 4NQGA 4N5XA 1XFVO 2K7CA 1AJ4A 1TCFA 4HSZA 4MBEA 4DCKA 1JFJA 1CLMA 3ZWHA 1SR6B 1YTZC 5DKNA 2LV7A 4ETOA 1B4CA 1EG4A 2JXCA 1OQPA 1NCYA 3I5FB 3PSRA 3C1VA 2LC5A 2L4IA 1QS7A 1PRWA 1YUUA 3CLNA 4GAOA 1KSOA 2KI4B 1NIWA 1G8IA 3BUNB 2OPOA 3VRRA 1JFKA 1YURA 1QV1A 2F8PA 1V1GA 1WRKA 1UHKA 3I5GB 4L9MA 1GGWA 1DGUA 1WRZA 2CNPA 3PALA 1DJZA 1QIVA 2KSPA 1B7TZ 4OR9B 1CMFA 2F3YA 3PLFB 4ORCB 3PFVA 1CFFA 1KK8B 2SASA 1DTLA 1J55A 1KWOC 4JQ0D 5I2QA 2M3WA 3FS7A 2I2RE 1TRFA 2OS8B 2Y4QA 1K2HA 1M31A 1DJHA 1CB1A 1UURA 2MHHA 2EC6C 1J7PA 4N1GA 1SNLA 2IS9A 2LM5A 4PE7A 1F71A 3TS5C 1IG5A 1DGVA 1FI5A 2L50A 3O2PA 2LVVA 1OSAA 3BOWA 4DRWA 1L2OC 5AEQA 1F54A 1F8HA 1UHHA 5K89A 1VRKA 4A4CA 4OKHA 1BJFA 1S1EA 1JUOA 4C0KA 2NCOA 2JWWA 5D7FA 3RLZA 1D1OA 2MJWB 5I2OA 5HLOA 4PCWA 1RK9A 3OX5A 3EVUA 1UWOA 2LLSA 1IQ5A 3EKJA 1CM1A 1NCXA 2K7DA 2M29A 2KYFA 4YGBB 4MRYA 4PDZA 3LCPC 1MHOA 4UPGA 2L0PA 1CFDA 5F6TA 4DUQA 2Y1NA 2HF5A 1MUXA 2QPTA 2E6WA 1ALWA 3OX6A 2FJUB 2BE6A 2BCAA 4GUKA 1QLSA 3CR4X 4R1EA 1EL4A 2ZN8A 1S3PA 1KQMB 1WY9A 2BKHB 3LLEA 5CSJA 4NDCA 1QXPA 3FIAA 2LE9B 3O78A 1NX0A 3PATA 3VGOA 2ZN9A 1QATA 4PHNA 1KQVA 1Y6WA 3NSLA 3K21A 2WC8A 3IQQA 4OVNF 2MRDA 4M2OA 4DIRA 1MQ1A 1OMVA 2NXQA 2LVIA 1QVIZ 1TNQA 3DD4A 4GGFA 1TNXA 1DJYA 1QLKA 4M2QA 5JOLA 2LUCA 1RWYA 1Y1XA 3IF7A 4D1EA 3KF9A 4I5JA 3TZ1A 1S36A 1R6PA 3NSIA 5I8NA 3TUYC 1KK7Y 2JU0A 1PSBA 1XFYO 1SRAA 4XYNA 1EH2A 1K94A 2LHLA 1CTRA 2BCXA 4HREE 3OB1B 4E68A 2PVBA 5GQQC 5ER4X 2JRFA 4MZJA 2LP2A 2WNDA 1L7ZA 3D0YA 3EKHA 1IKUA 1BR4B 1S5GY 2O60A 2JPTA 2GGZA 4I5LB 4PHJA 3TDZA 1RJVA 2HQ8A 3D10A 4M2PA 2Q4UA 4PHKA 5HLVA 2A4JA 1QX2A 4HRHA 2AUCA 4WRIA 4GBAA 5HYDA 1ALVA 1IQ3A 2JOJA 3DVMA 2HQWA 4YGDB 3ZNIA 1UHIA 2WCBA 2M7NA 3DVEA 1NX2A 3RM1A 3I5IC 1SR6C 3JTDC 1YX7A 2JT8A 4C0JA 4DS7A 3AKBA 1W7IB 3I5FC 2R2IA 1TNPA 1AK8A 1CMGA 3PN7B 4HRGA 1CM4A 1ZUZA 1K9KA 1NX1A 1TCOB 2WORA 1AP4A 1SL9A 3CR5X 1YVLA 1ZACA 3I5GC 1NCZA 1A75B 1U5IB 2F3ZA 2LHIA 1F4QA 1CDMA 1SCVA 2KFHA 4YI9A 1A4PA 2ISDA 2AAOA 2LMUA 1KK8C 1WLMA 5AERA 1IJ5A 1MXLC 1XYDA 2LVKA 2K61A 1TOPA 2LMTA 3F45A 3SG2A 2LAPA 4YGAA 2K2FA 4GGFC 1UUSA 1FF1A 1LINA 1S6JA 1DVIA 3EK8A 1QASA 2GGMA 2KAVA 5DKQA 2ZRSA 1JC2A 1K95A 1TIZA 4AOMA 4YRUA 4WQ2A 1SW8A 2FOTA 3AKAA 4PHMA 2LLUA 4GFTA 1JSAA 2BBMA 4QJ3B 4ORAB 1F70A 1NWDA 3KHEA 2Y1MA 3BQ3A 1TTXA 2KAXA 2KAYA 4WQ3A 4CPVA 4YI8A 2M8UA 2M49B 5HKYA 1PVAA 4FTGA 4BY4A 4CIDA 3BUXB 1CDPA 1DF0B 1CLBA 3GK1A 4XJKA 2OTGB 4YGEB 2LCPA 4NDBA 1M39A 1A29A 3GK2A 1N2DA 3WHTB 1BODA 1MF8B 2L51A 1C7WA 1JF0A 5ER5A 4AQIA 3SIAA 2JT3A 2Q91A 5AANA 1B7TY 3SG6A 2LMVA 5CSNA 2CBLA 2JQ6A 1KQMC 2KQYA 3LL8B 1G33A 3O4YA 2M9GA 2WCEA 2MBXA 1YRUB 1YVHA 2M1KB 2ZFDA 1FPWA 5CPVA 2TN4A 2B1UA 1B9AA 5FYXA 1SMGA 1SYMA 1UHNA 2EC6B 4ORBB 3WXAA 1GGZA 2BCBA 2H61C 1RECA 1KCYA 2E30A 3FWBA 2KHNA 3CTNA 1B47A 2D8NA 2O5GA 1NPQA 3IQOA 1LA3A 4PE1A 1YUSA 1BU3A 2KFFA 1PK0D 1LKJA 2BL0B 4YBHB 2WCFA 4MLWA 3CS1A 2F33A 3PM8A 5CSIA 1DMOA 1F55A 3QRXA 1CDNA 1AJ5A 2RGIA 2M1UA 1IH0A 1SY9A 1AHRA 1H4BA 4GGNA 4P5OE 5JJGA 3JVTC 3HX4A 2FCEA 4CFQA 2M97A 2KOTA 1S26D 1AVSA 2P6BB 1KFUS 1K9PA 3OP0A 4CFRA 1EXRA 2MLFC 4TNCA 5KSZA 3KEVA 1Y0VH 1KFUL 1SK6D 2NZ0A 3E3RA 1OMDA 1FI6A 1WDCB 1XFUO 3EK4A 5G08A 3EVRA 2PASA 3TDUA 1FW4A 1N65A 2PRUA 2I18A 3SG7A 3WHUB 1GJYA 1B1GA 1NYAA 1EG3A 2ZNDA 2I94A 3OHMB 1B8CA 1IGVA 1BR1B 1K90D 1M46A 1CLLA 1H8BA 2KI6D 1RFJA 1FBVA 2M7LA 1ODBA 1WRLA 2HPSA 2KFGA 3CZTX 2F2PA 1N0YA 2PMYA 3BYAA 2V53A 3CWGA 3MSEB 1A03A 1QVIY 1DJXA 2EGDA 2BECA 2BBNA 2ZNEA 1CDLA 1SCMB 4OCIA 2H2KA 5KTYA 1A2XA 2KI4C 3TUYB 1QJTA 1MWNA 1SL8A 4F0ZB 2L5XB 1TNWA 2KDHA 3NSOA 2MLEC
chains in the Genus database with same CATH superfamily
1HQVA 2I7AA 2K7OA 1X02A 3FE6A 1CKKA 3TDIA 1LVCD 3VROA 2BKIB 3BOWB 1DT7B 1IRJA 3S0BA 2H61A 1IWQA 2K0JA 3I5HB 1NX3A 1Y1AA 2LVJA 2OS8C 1SPYA 2LUXA 1KFXS 1PSRA 3CYZA 1CNPA 5HL1A 3SJSA 2F2OA 2QACA 3OB2B 1J1DA 1KFXL 1YX8A 3D74A 4JPZB 3DVKA 2CT9A 4QJ4B 3VRQA 3LK0A 1F4OA 3CGAA 5EL2A 3NHTA 2JZIA 3UNWA 2Y5IA 3I5IB 3JTDB 2G9BA 3KO0A 3B87A 1NUBA 1PULA 2COLB 3R1OA 4USLA 1MR8A 1Y1UA 4U8DA 2OTGC 1C7VA 5KU1A 2MAZA 1OOJA 3AAJA 3SIBA 3LK1A 3SG3A 4FQOA 1SL7A 1R2UA 1XFWO 4P2YB 2M0RA 5AXIA 3D78A 3VRPA 4GPLB 3A4UB 2L2EA 2PSRA 1E8AA 1OW4A 2KBMA 4INXA 1TUZA 1UHJA 1HT9A 2PALA 3EG5B 4I5NB 2H8VA 4MVFA 1RROA 4I5KA 1OZOA 1CFPA 1B8LA 1XK4C 1IJ6A 1DJIA 2JXLA 3DVJA 3R1VA 1K8UA 1BMOA 1TN4A 2SCPA 1JWDA 1OZSA 1BT6A 2NLNA 2K8MB 1XA5A 2KGBC 4C0LA 5PALA 1BLQA 3WNXB 1A75A 1KWOB 1U5IA 2JT0A 3D73A 5CSFA 3UO9A 3DF0B 1Q80A 2LP3A 3SG4A 1GQMA 2NCPA 3OBVA 4N1FA 2AMIA 3SG5A 1CFCA 4MN0A 5J3XA 3O6BA 5I2LA 4YGCB 3EK7A 2BL0C 3D0YB 1S6IA 2MA2A 3IVTA 4JKTA 1NP8A 4BY5A 1AUIB 1JBAA 1K9UA 3TS5B 2KGRA 2KBIA 3H4SE 3CR2A 3R72A 2WOSA 1XVJA 1L2OB 1W9ZA 1EJ3A 1KK7Z 1WLZA 1V1FA 1J1EA 1M63B 1PALA 2L4HA 3GK4X 1QIWA 1QX7A 5D3OA 4MZKA 2JTTA 1DELA 2VRGA 2ZKMX 1C07A 3BFAA 3B7AA 1GM0A 1DEKA 4PE0A 2KI6C 4IL1A 2CXJA 3A8RA 3OGNA 1S5GZ 2BE4A 2WCMA 4CLNA 1ZFSA 1PVBA 1WDCC 1YR5A 4Q04A 1JF2A 1S6CA 1DJWA 3B86A 1BG1A 5HKWA 1XO5A 4F7FA 1QTXA 1NSHA 5IBWA 1DF0A 2CTNA 2KYCA 2KPHA 3EVVA 4GNKB 1QX5B 4OV2A 5D69A 1ORGA 2L98A 4AQJA 3DZTA 1DJGA 2HETA 3NGVA 2JC2A 1J7QA 1M45A 1J7OA 1RTP1 3FWCA 1OE9B 2DOQA 1SKTA 2KQ6A 5BPJA 1P28A 1OOGA 1SCMC 3GOFA 3PN7C 4MZLA 4PALA 3VRNA 2JNFA 1J7RA 1SBJA 1XFZO 4ZCUA 3M0WA 3DF0A 5DKRA 1OMRA 4MSPA 3BXKA 1XK4A 2JNXA 4A4BA 3L4AA 2GV5A 1YUTA 3CABA 1W7JB 5FI6A 2JULA 3L4LA 2LLTA 2WC5A 3BUWB 1BF5A 2FCDA 4KYNA 1K96A 2K2AA 1LA0A 2ZRTA 3I5HC 2QEHA 3JVTB 3HCMA 4NDDA 4ICBA 2K7BA 4PE4A 2QDIA 1LXFC 5HKZA 2G2BA 1QV0A 3NXAA 2EHBA 3ICBA 5B8IB 2JTZA 1T14A 2KLEA 2LANA 1K93D 2P70A 4JWQA 5AFPA 4MRXA 1B8RA 2KNEA 2LNKA 1KSMA 1OOFA 3S0FA 2KLDA 2CCMA 5TNCA 1ZOTB 3KPXA 4XJKB 1G4YR 3BUMB 1ZMZA 4MEWA 4PT1A 4ZCVA 1YRTB 4QJ5B 3AAKA 1UP5A 3NSKA 1XFXO 3VB1A 1BOCA 3BUOB 1MXEA 4NQGA 1TWOA 4N5XA 1XFVO 2PYQA 2K7CA 1AJ4A 1TCFA 4HSZA 4MBEA 4DCKA 1JFJA 1CLMA 3ZWHA 1SR6B 1YTZC 5DKNA 2LV7A 4ETOA 1B4CA 1EG4A 2JXCA 1C3ZA 1NCYA 1OQPA 3DXLA 3I5FB 3PSRA 3C1VA 2LC5A 2L4IA 1QS7A 1PRWA 1YUUA 3CLNA 3CZ1A 4GAOA 1KSOA 2KI4B 1NIWA 1G8IA 3BUNB 2OPOA 3VRRA 1JFKA 1YURA 1QV1A 2F8PA 1V1GA 1WRKA 1UHKA 3D75A 3I5GB 4L9MA 1DGUA 1GGWA 1WRZA 2CNPA 3O4XA 1DJZA 3PALA 1QIVA 2KSPA 1B7TZ 4OR9B 1CMFA 3NHIA 2F3YA 3PLFB 4ORCB 3PFVA 1CFFA 1KK8B 2SASA 1DTLA 1J55A 1KWOC 4JQ0D 5I2QA 2M3WA 3FS7A 2I2RE 1TRFA 2OS8B 2WCLA 3L47A 2Y4QA 1Z4HA 1K2HA 1M31A 1DJHA 2BAPA 1CB1A 1UURA 2MHHA 2EC6C 1J7PA 4N1GA 1SNLA 2IS9A 2LM5A 4PE7A 5FI2A 1F71A 3TS5C 1IG5A 1DC1A 1C3YA 1DGVA 1FI5A 2L50A 3O2PA 2LVVA 3PJIA 1OSAA 3BOWA 4DRWA 1L2OC 5AEQA 1F54A 1F8HA 1UHHA 2P71A 5K89A 1VRKA 4A4CA 4OKHA 1BJFA 1S1EA 2QEVA 1JUOA 4C0KA 5I94A 2NCOA 2JWWA 2L5YA 5D7FA 3RLZA 1D1OA 2MJWB 5I2OA 5HLOA 3FE8A 4PCWA 1RK9A 3OX5A 3EVUA 2WC6A 1UWOA 2LLSA 3CZ2A 2PQLA 3CDNA 1IQ5A 3EKJA 1CM1A 1NCXA 2K7DA 2M29A 2KYFA 4YGBB 4MRYA 4PDZA 3LCPC 1MHOA 4UPGA 2L0PA 1CFDA 5F6TA 4DUQA 2Y1NA 2HF5A 1MUXA 2QPTA 2E6WA 1ALWA 3OX6A 4FQTA 2FJUB 3BFHA 2BE6A 2BCAA 5FI7A 4GUKA 1QLSA 3CR4X 4R1EA 1EL4A 2ZN8A 1S3PA 1KQMB 1WY9A 2BKHB 3LLEA 5CSJA 4NDCA 1QXPA 3FIAA 2LE9B 3O78A 1NX0A 3DY9A 3PATA 3VGOA 1QWVA 2ZN9A 1QATA 4PHNA 1KQVA 1Y6WA 3NSLA 3K21A 2WC8A 3IQQA 4OVNF 2MRDA 4M2OA 4DIRA 1MQ1A 1OMVA 2NXQA 2LVIA 1QVIZ 1TNQA 3DD4A 4GGFA 1TNXA 1DJYA 1QLKA 4M2QA 5JOLA 2LUCA 1RWYA 1Y1XA 3IF7A 4D1EA 3KF9A 4I5JA 3TZ1A 1S36A 1R6PA 2WCHA 3NSIA 5I8NA 1KK7Y 2JU0A 1PSBA 1XFYO 3TUYC 1SRAA 4XYNA 1EH2A 1K94A 2LHLA 1CTRA 2BCXA 4HREE 3OB1B 4E68A 2PVBA 5GQQC 5ER4X 2JRFA 4MZJA 2LP2A 2WNDA 1L7ZA 3D0YA 3EKHA 1IKUA 1BR4B 1S5GY 2O60A 3QMEA 1TUJA 2GGZA 2JPTA 4I5LB 3RZSA 4PHJA 3TDZA 1RJVA 2HQ8A 3D10A 4M2PA 2Q4UA 3V2LA 4PHKA 5HLVA 2A4JA 1QX2A 4HRHA 2AUCA 4WRIA 4GBAA 5HYDA 1ALVA 1IQ3A 3CZ0A 2JOJA 3DVMA 2HQWA 4YGDB 3ZNIA 1UHIA 2WCBA 2M7NA 3DVEA 1NX2A 2K60A 3RM1A 3I5IC 1DQEA 1SR6C 3JTDC 1YX7A 2JT8A 4C0JA 4DS7A 3AKBA 1W7IB 3B6XA 3I5FC 2R2IA 1TNPA 1AK8A 1CMGA 3S0AA 3PN7B 4HRGA 1CM4A 1ZUZA 1K9KA 1NX1A 1TCOB 2WORA 1AP4A 1SL9A 3CR5X 1YVLA 1ZACA 3I5GC 1NCZA 1A75B 2JPOA 1U5IB 2F3ZA 4OZDA 2LHIA 1F4QA 1CDMA 1SCVA 2KFHA 2QEOA 1A4PA 4YI9A 2ISDA 2AAOA 3D77A 2FJYA 4JD9A 3FE9A 2LMUA 1KK8C 1WLMA 3K1EA 1IJ5A 1MXLC 1XYDA 2LVKA 5AERA 2ERBA 2K61A 1OOHA 1TOPA 2LMTA 3F45A 1SSEB 3SG2A 2LAPA 4IJ7A 4YGAA 2K2FA 4GGFC 1UUSA 1FF1A 1LINA 1S6JA 1DVIA 3N7HA 3EK8A 1QASA 2GGMA 2KAVA 5DKQA 2ZRSA 1JC2A 1K95A 1TIZA 2WCJA 4AOMA 4YRUA 4WQ2A 3B88A 1SW8A 2FOTA 3AKAA 5DICA 2WCKA 4PHMA 2L2CA 2LLUA 4GFTA 1JSAA 2BBMA 3R1PA 4QJ3B 2QEBA 4ORAB 1F70A 1NWDA 3D76A 3KHEA 2Y1MA 3BQ3A 1TTXA 2KAXA 2KAYA 4WQ3A 4CPVA 4YI8A 2M8UA 2M49B 5HKYA 1PVAA 4FTGA 4BY4A 4CIDA 3BUXB 3SS3A 1CDPA 1DF0B 1CLBA 3GK1A 4XJKA 2OTGB 4YGEB 2LCPA 4NDBA 1M39A 1A29A 3GK2A 1N2DA 3S0GA 3WHTB 1BODA 1MF8B 2L51A 1C7WA 1JF0A 5ER5A 4AQIA 3SIAA 2JT3A 2Q91A 5AANA 1B7TY 3SG6A 2LMVA 5CSNA 1OOIX 2CBLA 2JQ6A 1KQMC 2KQYA 3LL8B 1G33A 3O4YA 2M9GA 2WCEA 2MBXA 1XFRA 1YRUB 1YVHA 2M1KB 2ZFDA 1FPWA 5CPVA 2TN4A 2B1UA 1B9AA 5FYXA 1SMGA 1SYMA 1UHNA 2EC6B 4ORBB 3WXAA 1GGZA 2BCBA 2BNXA 1RECA 2H61C 1KCYA 2E30A 3FWBA 2KHNA 3CTNA 1B47A 2D8NA 2O5GA 3BJHA 1NPQA 3IQOA 1LA3A 4PE1A 1YUSA 1BU3A 2KFFA 1PK0D 1LKJA 2BL0B 3DYEA 4YBHB 2WCFA 4MLWA 3CS1A 2F33A 3PM8A 5CSIA 1DMOA 2YGUA 1F55A 3QRXA 1CDNA 1AJ5A 3Q8IA 2RGIA 2M1UA 1IH0A 1SY9A 1AHRA 1H4BA 4GGNA 4P5OE 5JJGA 3JVTC 3HX4A 2FCEA 4CFQA 2M97A 2KOTA 1S26D 1AVSA 2P6BB 1KFUS 3PM2A 1K9PA 3OP0A 4CFRA 1EXRA 2MLFC 4INWA 4TNCA 5KSZA 3KEVA 1Y0VH 1KFUL 1SK6D 2NZ0A 3E3RA 1OMDA 1FI6A 1WDCB 1XFUO 3EK4A 5G08A 3EVRA 2PASA 3TDUA 1FW4A 1N65A 2PRUA 2I18A 3SG7A 3WHUB 1GJYA 1B1GA 1NYAA 1EG3A 2ZNDA 2I94A 3OHMB 1B8CA 1IGVA 1BR1B 1K90D 1M46A 1CLLA 1H8BA 2KI6D 1IIOA 1RFJA 2GTEA 1FBVA 1Z2CB 1ODBA 2M7LA 1WRLA 2HPSA 2KFGA 3S0DA 3CZTX 2F2PA 1N0YA 2PMYA 1LS8A 2V53A 3BYAA 3CWGA 3MSEB 1A03A 1QVIY 1DJXA 2EGDA 3SS4A 2BECA 2BBNA 3S0EA 2ZNEA 1CDLA 3SS5A 1SCMB 4OCIA 2H2KA 5KTYA 1A2XA 2KI4C 3TUYB 1QJTA 1MWNA 1SL8A 4F0ZB 2L5XB 1TNWA 2KDHA 3NSOA 3BFBA 2MLEC
chains in the Genus database with same CATH topology
1HQVA 2I7AA 2K7OA 1X02A 1CKKA 3TDIA 1LVCD 3VROA 2BKIB 3BOWB 1DT7B 1IRJA 2H61A 1IWQA 2K0JA 3I5HB 1NX3A 1Y1AA 2LVJA 2OS8C 1SPYA 2LUXA 1KFXS 1PSRA 1CNPA 3SJSA 2F2OA 2QACA 3OB2B 1J1DA 1KFXL 1YX8A 4JPZB 4QJ4B 3DVKA 2CT9A 3VRQA 3LK0A 1F4OA 3CGAA 2JZIA 2Y5IA 3I5IB 3JTDB 2G9BA 3KO0A 1NUBA 1PULA 2COLB 4USLA 1MR8A 1Y1UA 4U8DA 2OTGC 1C7VA 5KU1A 2MAZA 1OOJA 3AAJA 3SIBA 3LK1A 3SG3A 4FQOA 1SL7A 1R2UA 1XFWO 4P2YB 2M0RA 5AXIA 3VRPA 4GPLB 3A4UB 2L2EA 2PSRA 1E8AA 2KBMA 1UHJA 1HT9A 2PALA 4I5NB 4MVFA 1RROA 4I5KA 1OZOA 1CFPA 1B8LA 1XK4C 1IJ6A 1DJIA 2JXLA 3DVJA 1K8UA 1BMOA 1TN4A 2SCPA 1JWDA 1OZSA 1BT6A 2NLNA 2K8MB 1XA5A 2KGBC 4C0LA 5PALA 1BLQA 3WNXB 1A75A 1KWOB 1U5IA 2JT0A 5CSFA 3DF0B 1Q80A 2LP3A 3SG4A 1GQMA 2NCPA 4N1FA 2AMIA 3SG5A 1CFCA 4MN0A 5J3XA 3O6BA 5I2LA 4YGCB 3EK7A 2BL0C 3D0YB 1S6IA 2MA2A 1NP8A 4BY5A 1AUIB 1JBAA 1K9UA 3TS5B 2KGRA 2KBIA 3H4SE 3CR2A 2WOSA 1XVJA 1L2OB 1EJ3A 1KK7Z 1WLZA 1V1FA 1J1EA 1M63B 1PALA 2L4HA 3GK4X 1QIWA 1QX7A 4MZKA 2JTTA 2VRGA 2ZKMX 1C07A 4PE0A 2KI6C 4IL1A 2CXJA 3A8RA 4CLNA 1S5GZ 2BE4A 1ZFSA 1PVBA 1WDCC 1YR5A 4Q04A 1JF2A 1S6CA 1DJWA 1BG1A 5HKWA 1XO5A 1QTXA 1NSHA 5IBWA 1DF0A 2CTNA 2KYCA 3EVVA 4GNKB 1QX5B 4OV2A 5D69A 2L98A 4AQJA 1DJGA 2HETA 2JC2A 1J7QA 1M45A 1J7OA 1RTP1 3FWCA 1OE9B 2DOQA 1SKTA 2KQ6A 5BPJA 3VRNA 1SCMC 3GOFA 3PN7C 4PALA 4MZLA 2JNFA 1J7RA 1SBJA 1XFZO 4ZCUA 3M0WA 3DF0A 5DKRA 1OMRA 4MSPA 3BXKA 1XK4A 2JNXA 4A4BA 2GV5A 1YUTA 1W7JB 2JULA 2LLTA 3BUWB 1BF5A 2FCDA 1K96A 2K2AA 1LA0A 2ZRTA 3I5HC 3JVTB 3HCMA 4NDDA 4ICBA 2K7BA 4PE4A 1LXFC 5HKZA 2G2BA 1QV0A 3NXAA 2EHBA 3ICBA 5B8IB 2JTZA 4JWQA 2LANA 1K93D 5AFPA 4MRXA 1B8RA 2KNEA 2LNKA 1KSMA 2CCMA 5TNCA 1ZOTB 3KPXA 4XJKB 1G4YR 3BUMB 1ZMZA 4MEWA 4ZCVA 1YRTB 4QJ5B 3AAKA 1UP5A 3NSKA 1XFXO 1BOCA 3BUOB 1MXEA 4NQGA 4N5XA 1XFVO 2K7CA 1AJ4A 1TCFA 4HSZA 4MBEA 4DCKA 1JFJA 1CLMA 3ZWHA 1SR6B 1YTZC 5DKNA 2LV7A 4ETOA 1B4CA 1EG4A 2JXCA 1OQPA 1NCYA 3I5FB 3PSRA 3C1VA 2LC5A 2L4IA 1QS7A 1PRWA 1YUUA 3CLNA 4GAOA 1KSOA 2KI4B 1NIWA 1G8IA 3BUNB 2OPOA 3VRRA 1JFKA 1YURA 1QV1A 2F8PA 1V1GA 1WRKA 1UHKA 3I5GB 4L9MA 1GGWA 1DGUA 1WRZA 2CNPA 3PALA 1DJZA 1QIVA 2KSPA 1B7TZ 4OR9B 1CMFA 2F3YA 3PLFB 4ORCB 3PFVA 1CFFA 1KK8B 2SASA 1DTLA 1J55A 1KWOC 4JQ0D 5I2QA 2M3WA 3FS7A 2I2RE 1TRFA 2OS8B 2Y4QA 1K2HA 1M31A 1DJHA 1CB1A 1UURA 2MHHA 2EC6C 1J7PA 4N1GA 1SNLA 2IS9A 2LM5A 4PE7A 1F71A 3TS5C 1IG5A 1DGVA 1FI5A 2L50A 3O2PA 2LVVA 1OSAA 3BOWA 4DRWA 1L2OC 5AEQA 1F54A 1F8HA 1UHHA 5K89A 1VRKA 4A4CA 4OKHA 1BJFA 1S1EA 1JUOA 4C0KA 2NCOA 2JWWA 5D7FA 3RLZA 1D1OA 2MJWB 5I2OA 5HLOA 4PCWA 1RK9A 3OX5A 3EVUA 1UWOA 2LLSA 1IQ5A 3EKJA 1CM1A 1NCXA 2K7DA 2M29A 2KYFA 4YGBB 4MRYA 4PDZA 3LCPC 1MHOA 4UPGA 2L0PA 1CFDA 5F6TA 4DUQA 2Y1NA 2HF5A 1MUXA 2QPTA 2E6WA 1ALWA 3OX6A 2FJUB 2BE6A 2BCAA 4GUKA 1QLSA 3CR4X 4R1EA 1EL4A 2ZN8A 1S3PA 1KQMB 1WY9A 2BKHB 3LLEA 5CSJA 4NDCA 1QXPA 3FIAA 2LE9B 3O78A 1NX0A 3PATA 3VGOA 2ZN9A 1QATA 4PHNA 1KQVA 1Y6WA 3NSLA 3K21A 2WC8A 3IQQA 4OVNF 2MRDA 4M2OA 4DIRA 1MQ1A 1OMVA 2NXQA 2LVIA 1QVIZ 1TNQA 3DD4A 4GGFA 1TNXA 1DJYA 1QLKA 4M2QA 5JOLA 2LUCA 1RWYA 1Y1XA 3IF7A 4D1EA 3KF9A 4I5JA 3TZ1A 1S36A 1R6PA 3NSIA 5I8NA 3TUYC 1KK7Y 2JU0A 1PSBA 1XFYO 1SRAA 4XYNA 1EH2A 1K94A 2LHLA 1CTRA 2BCXA 4HREE 3OB1B 4E68A 2PVBA 5GQQC 5ER4X 2JRFA 4MZJA 2LP2A 2WNDA 1L7ZA 3D0YA 3EKHA 1IKUA 1BR4B 1S5GY 2O60A 2JPTA 2GGZA 4I5LB 4PHJA 3TDZA 1RJVA 2HQ8A 3D10A 4M2PA 2Q4UA 4PHKA 5HLVA 2A4JA 1QX2A 4HRHA 2AUCA 4WRIA 4GBAA 5HYDA 1ALVA 1IQ3A 2JOJA 3DVMA 2HQWA 4YGDB 3ZNIA 1UHIA 2WCBA 2M7NA 3DVEA 1NX2A 3RM1A 3I5IC 1SR6C 3JTDC 1YX7A 2JT8A 4C0JA 4DS7A 3AKBA 1W7IB 3I5FC 2R2IA 1TNPA 1AK8A 1CMGA 3PN7B 4HRGA 1CM4A 1ZUZA 1K9KA 1NX1A 1TCOB 2WORA 1AP4A 1SL9A 3CR5X 1YVLA 1ZACA 3I5GC 1NCZA 1A75B 1U5IB 2F3ZA 2LHIA 1F4QA 1CDMA 1SCVA 2KFHA 4YI9A 1A4PA 2ISDA 2AAOA 2LMUA 1KK8C 1WLMA 5AERA 1IJ5A 1MXLC 1XYDA 2LVKA 2K61A 1TOPA 2LMTA 3F45A 3SG2A 2LAPA 4YGAA 2K2FA 4GGFC 1UUSA 1FF1A 1LINA 1S6JA 1DVIA 3EK8A 1QASA 2GGMA 2KAVA 5DKQA 2ZRSA 1JC2A 1K95A 1TIZA 4AOMA 4YRUA 4WQ2A 1SW8A 2FOTA 3AKAA 4PHMA 2LLUA 4GFTA 1JSAA 2BBMA 4QJ3B 4ORAB 1F70A 1NWDA 3KHEA 2Y1MA 3BQ3A 1TTXA 2KAXA 2KAYA 4WQ3A 4CPVA 4YI8A 2M8UA 2M49B 5HKYA 1PVAA 4FTGA 4BY4A 4CIDA 3BUXB 1CDPA 1DF0B 1CLBA 3GK1A 4XJKA 2OTGB 4YGEB 2LCPA 4NDBA 1M39A 1A29A 3GK2A 1N2DA 3WHTB 1BODA 1MF8B 2L51A 1C7WA 1JF0A 5ER5A 4AQIA 3SIAA 2JT3A 2Q91A 5AANA 1B7TY 3SG6A 2LMVA 5CSNA 2CBLA 2JQ6A 1KQMC 2KQYA 3LL8B 1G33A 3O4YA 2M9GA 2WCEA 2MBXA 1YRUB 1YVHA 2M1KB 2ZFDA 1FPWA 5CPVA 2TN4A 2B1UA 1B9AA 5FYXA 1SMGA 1SYMA 1UHNA 2EC6B 4ORBB 3WXAA 1GGZA 2BCBA 2H61C 1RECA 1KCYA 2E30A 3FWBA 2KHNA 3CTNA 1B47A 2D8NA 2O5GA 1NPQA 3IQOA 1LA3A 4PE1A 1YUSA 1BU3A 2KFFA 1PK0D 1LKJA 2BL0B 4YBHB 2WCFA 4MLWA 3CS1A 2F33A 3PM8A 5CSIA 1DMOA 1F55A 3QRXA 1CDNA 1AJ5A 2RGIA 2M1UA 1IH0A 1SY9A 1AHRA 1H4BA 4GGNA 4P5OE 5JJGA 3JVTC 3HX4A 2FCEA 4CFQA 2M97A 2KOTA 1S26D 1AVSA 2P6BB 1KFUS 1K9PA 3OP0A 4CFRA 1EXRA 2MLFC 4TNCA 5KSZA 3KEVA 1Y0VH 1KFUL 1SK6D 2NZ0A 3E3RA 1OMDA 1FI6A 1WDCB 1XFUO 3EK4A 5G08A 3EVRA 2PASA 3TDUA 1FW4A 1N65A 2PRUA 2I18A 3SG7A 3WHUB 1GJYA 1B1GA 1NYAA 1EG3A 2ZNDA 2I94A 3OHMB 1B8CA 1IGVA 1BR1B 1K90D 1M46A 1CLLA 1H8BA 2KI6D 1RFJA 1FBVA 2M7LA 1ODBA 1WRLA 2HPSA 2KFGA 3CZTX 2F2PA 1N0YA 2PMYA 3BYAA 2V53A 3CWGA 3MSEB 1A03A 1QVIY 1DJXA 2EGDA 2BECA 2BBNA 2ZNEA 1CDLA 1SCMB 4OCIA 2H2KA 5KTYA 1A2XA 2KI4C 3TUYB 1QJTA 1MWNA 1SL8A 4F0ZB 2L5XB 1TNWA 2KDHA 3NSOA 2MLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQV A;  2I7A A;  2K7O A;  1X02 A;  1CKK A;  3TDI A;  1LVC D;  3VRO A;  2BKI B;  3BOW B;  1DT7 B;  1IRJ A;  2H61 A;  1IWQ A;  2K0J A;  3I5H B;  1NX3 A;  1Y1A A;  2LVJ A;  2OS8 C;  1SPY A;  2LUX A;  1KFX S;  1PSR A;  1CNP A;  3SJS A;  2F2O A;  2QAC A;  3OB2 B;  1J1D A;  1KFX L;  1YX8 A;  4JPZ B;  4QJ4 B;  3DVK A;  2CT9 A;  3VRQ A;  3LK0 A;  1F4O A;  3CGA A;  2JZI A;  2Y5I A;  3I5I B;  3JTD B;  2G9B A;  3KO0 A;  1NUB A;  1PUL A;  2COL B;  4USL A;  1MR8 A;  1Y1U A;  4U8D A;  2OTG C;  1C7V A;  5KU1 A;  2MAZ A;  1OOJ A;  3AAJ A;  3SIB A;  3LK1 A;  3SG3 A;  4FQO A;  1SL7 A;  1R2U A;  1XFW O;  4P2Y B;  2M0R A;  5AXI A;  3VRP A;  4GPL B;  3A4U B;  2L2E A;  2PSR A;  1E8A A;  2KBM A;  1UHJ A;  1HT9 A;  2PAL A;  4I5N B;  4MVF A;  1RRO A;  4I5K A;  1OZO A;  1CFP A;  1B8L A;  1XK4 C;  1IJ6 A;  1DJI A;  2JXL A;  3DVJ A;  1K8U A;  1BMO A;  1TN4 A;  2SCP A;  1JWD A;  1OZS A;  1BT6 A;  2NLN A;  2K8M B;  1XA5 A;  2KGB C;  4C0L A;  5PAL A;  1BLQ A;  3WNX B;  1A75 A;  1KWO B;  1U5I A;  2JT0 A;  5CSF A;  3DF0 B;  1Q80 A;  2LP3 A;  3SG4 A;  1GQM A;  2NCP A;  4N1F A;  2AMI A;  3SG5 A;  1CFC A;  4MN0 A;  5J3X A;  3O6B A;  5I2L A;  4YGC B;  3EK7 A;  2BL0 C;  3D0Y B;  1S6I A;  2MA2 A;  1NP8 A;  4BY5 A;  1AUI B;  1JBA A;  1K9U A;  3TS5 B;  2KGR A;  2KBI A;  3H4S E;  3CR2 A;  2WOS A;  1XVJ A;  1L2O B;  1EJ3 A;  1KK7 Z;  1WLZ A;  1V1F A;  1J1E A;  1M63 B;  1PAL A;  2L4H A;  3GK4 X;  1QIW A;  1QX7 A;  4MZK A;  2JTT A;  2VRG A;  2ZKM X;  1C07 A;  4PE0 A;  2KI6 C;  4IL1 A;  2CXJ A;  3A8R A;  4CLN A;  1S5G Z;  2BE4 A;  1ZFS A;  1PVB A;  1WDC C;  1YR5 A;  4Q04 A;  1JF2 A;  1S6C A;  1DJW A;  1BG1 A;  5HKW A;  1XO5 A;  1QTX A;  1NSH A;  5IBW A;  1DF0 A;  2CTN A;  2KYC A;  3EVV A;  4GNK B;  1QX5 B;  4OV2 A;  5D69 A;  2L98 A;  4AQJ A;  1DJG A;  2HET A;  2JC2 A;  1J7Q A;  1M45 A;  1J7O A;  1RTP 1;  3FWC A;  1OE9 B;  2DOQ A;  1SKT A;  2KQ6 A;  5BPJ A;  3VRN A;  1SCM C;  3GOF A;  3PN7 C;  4PAL A;  4MZL A;  2JNF A;  1J7R A;  1SBJ A;  1XFZ O;  4ZCU A;  3M0W A;  3DF0 A;  5DKR A;  1OMR A;  4MSP A;  3BXK A;  1XK4 A;  2JNX A;  4A4B A;  2GV5 A;  1YUT A;  1W7J B;  2JUL A;  2LLT A;  3BUW B;  1BF5 A;  2FCD A;  1K96 A;  2K2A A;  1LA0 A;  2ZRT A;  3I5H C;  3JVT B;  3HCM A;  4NDD A;  4ICB A;  2K7B A;  4PE4 A;  1LXF C;  5HKZ A;  2G2B A;  1QV0 A;  3NXA A;  2EHB A;  3ICB A;  5B8I B;  2JTZ A;  4JWQ A;  2LAN A;  1K93 D;  5AFP A;  4MRX A;  1B8R A;  2KNE A;  2LNK A;  1KSM A;  2CCM A;  5TNC A;  1ZOT B;  3KPX A;  4XJK B;  1G4Y R;  3BUM B;  1ZMZ A;  4MEW A;  4ZCV A;  1YRT B;  4QJ5 B;  3AAK A;  1UP5 A;  3NSK A;  1XFX O;  1BOC A;  3BUO B;  1MXE A;  4NQG A;  4N5X A;  1XFV O;  2K7C A;  1AJ4 A;  1TCF A;  4HSZ A;  4MBE A;  4DCK A;  1JFJ A;  1CLM A;  3ZWH A;  1SR6 B;  1YTZ C;  5DKN A;  2LV7 A;  4ETO A;  1B4C A;  1EG4 A;  2JXC A;  1OQP A;  1NCY A;  3I5F B;  3PSR A;  3C1V A;  2LC5 A;  2L4I A;  1QS7 A;  1PRW A;  1YUU A;  3CLN A;  4GAO A;  1KSO A;  2KI4 B;  1NIW A;  1G8I A;  3BUN B;  2OPO A;  3VRR A;  1JFK A;  1YUR A;  1QV1 A;  2F8P A;  1V1G A;  1WRK A;  1UHK A;  3I5G B;  4L9M A;  1GGW A;  1DGU A;  1WRZ A;  2CNP A;  3PAL A;  1DJZ A;  1QIV A;  2KSP A;  1B7T Z;  4OR9 B;  1CMF A;  2F3Y A;  3PLF B;  4ORC B;  3PFV A;  1CFF A;  1KK8 B;  2SAS A;  1DTL A;  1J55 A;  1KWO C;  4JQ0 D;  5I2Q A;  2M3W A;  3FS7 A;  2I2R E;  1TRF A;  2OS8 B;  2Y4Q A;  1K2H A;  1M31 A;  1DJH A;  1CB1 A;  1UUR A;  2MHH A;  2EC6 C;  1J7P A;  4N1G A;  1SNL A;  2IS9 A;  2LM5 A;  4PE7 A;  1F71 A;  3TS5 C;  1IG5 A;  1DGV A;  1FI5 A;  2L50 A;  3O2P A;  2LVV A;  1OSA A;  3BOW A;  4DRW A;  1L2O C;  5AEQ A;  1F54 A;  1F8H A;  1UHH A;  5K89 A;  1VRK A;  4A4C A;  4OKH A;  1BJF A;  1S1E A;  1JUO A;  4C0K A;  2NCO A;  2JWW A;  5D7F A;  3RLZ A;  1D1O A;  2MJW B;  5I2O A;  5HLO A;  4PCW A;  1RK9 A;  3OX5 A;  3EVU A;  1UWO A;  2LLS A;  1IQ5 A;  3EKJ A;  1CM1 A;  1NCX A;  2K7D A;  2M29 A;  2KYF A;  4YGB B;  4MRY A;  4PDZ A;  3LCP C;  1MHO A;  4UPG A;  2L0P A;  1CFD A;  5F6T A;  4DUQ A;  2Y1N A;  2HF5 A;  1MUX A;  2QPT A;  2E6W A;  1ALW A;  3OX6 A;  2FJU B;  2BE6 A;  2BCA A;  4GUK A;  1QLS A;  3CR4 X;  4R1E A;  1EL4 A;  2ZN8 A;  1S3P A;  1KQM B;  1WY9 A;  2BKH B;  3LLE A;  5CSJ A;  4NDC A;  1QXP A;  3FIA A;  2LE9 B;  3O78 A;  1NX0 A;  3PAT A;  3VGO A;  2ZN9 A;  1QAT A;  4PHN A;  1KQV A;  1Y6W A;  3NSL A;  3K21 A;  2WC8 A;  3IQQ A;  4OVN F;  2MRD A;  4M2O A;  4DIR A;  1MQ1 A;  1OMV A;  2NXQ A;  2LVI A;  1QVI Z;  1TNQ A;  3DD4 A;  4GGF A;  1TNX A;  1DJY A;  1QLK A;  4M2Q A;  5JOL A;  2LUC A;  1RWY A;  1Y1X A;  3IF7 A;  4D1E A;  3KF9 A;  4I5J A;  3TZ1 A;  1S36 A;  1R6P A;  3NSI A;  5I8N A;  3TUY C;  1KK7 Y;  2JU0 A;  1PSB A;  1XFY O;  1SRA A;  4XYN A;  1EH2 A;  1K94 A;  2LHL A;  1CTR A;  2BCX A;  4HRE E;  3OB1 B;  4E68 A;  2PVB A;  5GQQ C;  5ER4 X;  2JRF A;  4MZJ A;  2LP2 A;  2WND A;  1L7Z A;  3D0Y A;  3EKH A;  1IKU A;  1BR4 B;  1S5G Y;  2O60 A;  2JPT A;  2GGZ A;  4I5L B;  4PHJ A;  3TDZ A;  1RJV A;  2HQ8 A;  3D10 A;  4M2P A;  2Q4U A;  4PHK A;  5HLV A;  2A4J A;  1QX2 A;  4HRH A;  2AUC A;  4WRI A;  4GBA A;  5HYD A;  1ALV A;  1IQ3 A;  2JOJ A;  3DVM A;  2HQW A;  4YGD B;  3ZNI A;  1UHI A;  2WCB A;  2M7N A;  3DVE A;  1NX2 A;  3RM1 A;  3I5I C;  1SR6 C;  3JTD C;  1YX7 A;  2JT8 A;  4C0J A;  4DS7 A;  3AKB A;  1W7I B;  3I5F C;  2R2I A;  1TNP A;  1AK8 A;  1CMG A;  3PN7 B;  4HRG A;  1CM4 A;  1ZUZ A;  1K9K A;  1NX1 A;  1TCO B;  2WOR A;  1AP4 A;  1SL9 A;  3CR5 X;  1YVL A;  1ZAC A;  3I5G C;  1NCZ A;  1A75 B;  1U5I B;  2F3Z A;  2LHI A;  1F4Q A;  1CDM A;  1SCV A;  2KFH A;  4YI9 A;  1A4P A;  2ISD A;  2AAO A;  2LMU A;  1KK8 C;  1WLM A;  5AER A;  1IJ5 A;  1MXL C;  1XYD A;  2LVK A;  2K61 A;  1TOP A;  2LMT A;  3F45 A;  3SG2 A;  2LAP A;  4YGA A;  2K2F A;  4GGF C;  1UUS A;  1FF1 A;  1LIN A;  1S6J A;  1DVI A;  3EK8 A;  1QAS A;  2GGM A;  2KAV A;  5DKQ A;  2ZRS A;  1JC2 A;  1K95 A;  1TIZ A;  4AOM A;  4YRU A;  4WQ2 A;  1SW8 A;  2FOT A;  3AKA A;  4PHM A;  2LLU A;  4GFT A;  1JSA A;  2BBM A;  4QJ3 B;  4ORA B;  1F70 A;  1NWD A;  3KHE A;  2Y1M A;  3BQ3 A;  1TTX A;  2KAX A;  2KAY A;  4WQ3 A;  4CPV A;  4YI8 A;  2M8U A;  2M49 B;  5HKY A;  1PVA A;  4FTG A;  4BY4 A;  4CID A;  3BUX B;  1CDP A;  1DF0 B;  1CLB A;  3GK1 A;  4XJK A;  2OTG B;  4YGE B;  2LCP A;  4NDB A;  1M39 A;  1A29 A;  3GK2 A;  1N2D A;  3WHT B;  1BOD A;  1MF8 B;  2L51 A;  1C7W A;  1JF0 A;  5ER5 A;  4AQI A;  3SIA A;  2JT3 A;  2Q91 A;  5AAN A;  1B7T Y;  3SG6 A;  2LMV A;  5CSN A;  2CBL A;  2JQ6 A;  1KQM C;  2KQY A;  3LL8 B;  1G33 A;  3O4Y A;  2M9G A;  2WCE A;  2MBX A;  1YRU B;  1YVH A;  2M1K B;  2ZFD A;  1FPW A;  5CPV A;  2TN4 A;  2B1U A;  1B9A A;  5FYX A;  1SMG A;  1SYM A;  1UHN A;  2EC6 B;  4ORB B;  3WXA A;  1GGZ A;  2BCB A;  2H61 C;  1REC A;  1KCY A;  2E30 A;  3FWB A;  2KHN A;  3CTN A;  1B47 A;  2D8N A;  2O5G A;  1NPQ A;  3IQO A;  1LA3 A;  4PE1 A;  1YUS A;  1BU3 A;  2KFF A;  1PK0 D;  1LKJ A;  2BL0 B;  4YBH B;  2WCF A;  4MLW A;  3CS1 A;  2F33 A;  3PM8 A;  5CSI A;  1DMO A;  1F55 A;  3QRX A;  1CDN A;  1AJ5 A;  2RGI A;  2M1U A;  1IH0 A;  1SY9 A;  1AHR A;  1H4B A;  4GGN A;  4P5O E;  5JJG A;  3JVT C;  3HX4 A;  2FCE A;  4CFQ A;  2M97 A;  2KOT A;  1S26 D;  1AVS A;  2P6B B;  1KFU S;  1K9P A;  3OP0 A;  4CFR A;  1EXR A;  2MLF C;  4TNC A;  5KSZ A;  3KEV A;  1Y0V H;  1KFU L;  1SK6 D;  2NZ0 A;  3E3R A;  1OMD A;  1FI6 A;  1WDC B;  1XFU O;  3EK4 A;  5G08 A;  3EVR A;  2PAS A;  3TDU A;  1FW4 A;  1N65 A;  2PRU A;  2I18 A;  3SG7 A;  3WHU B;  1GJY A;  1B1G A;  1NYA A;  1EG3 A;  2ZND A;  2I94 A;  3OHM B;  1B8C A;  1IGV A;  1BR1 B;  1K90 D;  1M46 A;  1CLL A;  1H8B A;  2KI6 D;  1RFJ A;  1FBV A;  2M7L A;  1ODB A;  1WRL A;  2HPS A;  2KFG A;  3CZT X;  2F2P A;  1N0Y A;  2PMY A;  3BYA A;  2V53 A;  3CWG A;  3MSE B;  1A03 A;  1QVI Y;  1DJX A;  2EGD A;  2BEC A;  2BBN A;  2ZNE A;  1CDL A;  1SCM B;  4OCI A;  2H2K A;  5KTY A;  1A2X A;  2KI4 C;  3TUY B;  1QJT A;  1MWN A;  1SL8 A;  4F0Z B;  2L5X B;  1TNW A;  2KDH A;  3NSO A;  2MLE C; 
#chains in the Genus database with same CATH topology
 1HQV A;  2I7A A;  2K7O A;  1X02 A;  3FE6 A;  1CKK A;  3TDI A;  1LVC D;  3VRO A;  2BKI B;  3BOW B;  1DT7 B;  1IRJ A;  3S0B A;  2H61 A;  1IWQ A;  2K0J A;  3I5H B;  1NX3 A;  1Y1A A;  2LVJ A;  2OS8 C;  1SPY A;  2LUX A;  1KFX S;  1PSR A;  3CYZ A;  1CNP A;  5HL1 A;  3SJS A;  2F2O A;  2QAC A;  3OB2 B;  1J1D A;  1KFX L;  1YX8 A;  3D74 A;  4JPZ B;  3DVK A;  2CT9 A;  4QJ4 B;  3VRQ A;  3LK0 A;  1F4O A;  3CGA A;  5EL2 A;  3NHT A;  2JZI A;  3UNW A;  2Y5I A;  3I5I B;  3JTD B;  2G9B A;  3KO0 A;  3B87 A;  1NUB A;  1PUL A;  2COL B;  3R1O A;  4USL A;  1MR8 A;  1Y1U A;  4U8D A;  2OTG C;  1C7V A;  5KU1 A;  2MAZ A;  1OOJ A;  3AAJ A;  3SIB A;  3LK1 A;  3SG3 A;  4FQO A;  1SL7 A;  1R2U A;  1XFW O;  4P2Y B;  2M0R A;  5AXI A;  3D78 A;  3VRP A;  4GPL B;  3A4U B;  2L2E A;  2PSR A;  1E8A A;  1OW4 A;  2KBM A;  4INX A;  1TUZ A;  1UHJ A;  1HT9 A;  2PAL A;  3EG5 B;  4I5N B;  2H8V A;  4MVF A;  1RRO A;  4I5K A;  1OZO A;  1CFP A;  1B8L A;  1XK4 C;  1IJ6 A;  1DJI A;  2JXL A;  3DVJ A;  3R1V A;  1K8U A;  1BMO A;  1TN4 A;  2SCP A;  1JWD A;  1OZS A;  1BT6 A;  2NLN A;  2K8M B;  1XA5 A;  2KGB C;  4C0L A;  5PAL A;  1BLQ A;  3WNX B;  1A75 A;  1KWO B;  1U5I A;  2JT0 A;  3D73 A;  5CSF A;  3UO9 A;  3DF0 B;  1Q80 A;  2LP3 A;  3SG4 A;  1GQM A;  2NCP A;  3OBV A;  4N1F A;  2AMI A;  3SG5 A;  1CFC A;  4MN0 A;  5J3X A;  3O6B A;  5I2L A;  4YGC B;  3EK7 A;  2BL0 C;  3D0Y B;  1S6I A;  2MA2 A;  3IVT A;  4JKT A;  1NP8 A;  4BY5 A;  1AUI B;  1JBA A;  1K9U A;  3TS5 B;  2KGR A;  2KBI A;  3H4S E;  3CR2 A;  3R72 A;  2WOS A;  1XVJ A;  1L2O B;  1W9Z A;  1EJ3 A;  1KK7 Z;  1WLZ A;  1V1F A;  1J1E A;  1M63 B;  1PAL A;  2L4H A;  3GK4 X;  1QIW A;  1QX7 A;  5D3O A;  4MZK A;  2JTT A;  1DEL A;  2VRG A;  2ZKM X;  1C07 A;  3BFA A;  3B7A A;  1GM0 A;  1DEK A;  4PE0 A;  2KI6 C;  4IL1 A;  2CXJ A;  3A8R A;  3OGN A;  1S5G Z;  2BE4 A;  2WCM A;  4CLN A;  1ZFS A;  1PVB A;  1WDC C;  1YR5 A;  4Q04 A;  1JF2 A;  1S6C A;  1DJW A;  3B86 A;  1BG1 A;  5HKW A;  1XO5 A;  4F7F A;  1QTX A;  1NSH A;  5IBW A;  1DF0 A;  2CTN A;  2KYC A;  2KPH A;  3EVV A;  4GNK B;  1QX5 B;  4OV2 A;  5D69 A;  1ORG A;  2L98 A;  4AQJ A;  3DZT A;  1DJG A;  2HET A;  3NGV A;  2JC2 A;  1J7Q A;  1M45 A;  1J7O A;  1RTP 1;  3FWC A;  1OE9 B;  2DOQ A;  1SKT A;  2KQ6 A;  5BPJ A;  1P28 A;  1OOG A;  1SCM C;  3GOF A;  3PN7 C;  4MZL A;  4PAL A;  3VRN A;  2JNF A;  1J7R A;  1SBJ A;  1XFZ O;  4ZCU A;  3M0W A;  3DF0 A;  5DKR A;  1OMR A;  4MSP A;  3BXK A;  1XK4 A;  2JNX A;  4A4B A;  3L4A A;  2GV5 A;  1YUT A;  3CAB A;  1W7J B;  5FI6 A;  2JUL A;  3L4L A;  2LLT A;  2WC5 A;  3BUW B;  1BF5 A;  2FCD A;  4KYN A;  1K96 A;  2K2A A;  1LA0 A;  2ZRT A;  3I5H C;  2QEH A;  3JVT B;  3HCM A;  4NDD A;  4ICB A;  2K7B A;  4PE4 A;  2QDI A;  1LXF C;  5HKZ A;  2G2B A;  1QV0 A;  3NXA A;  2EHB A;  3ICB A;  5B8I B;  2JTZ A;  1T14 A;  2KLE A;  2LAN A;  1K93 D;  2P70 A;  4JWQ A;  5AFP A;  4MRX A;  1B8R A;  2KNE A;  2LNK A;  1KSM A;  1OOF A;  3S0F A;  2KLD A;  2CCM A;  5TNC A;  1ZOT B;  3KPX A;  4XJK B;  1G4Y R;  3BUM B;  1ZMZ A;  4MEW A;  4PT1 A;  4ZCV A;  1YRT B;  4QJ5 B;  3AAK A;  1UP5 A;  3NSK A;  1XFX O;  3VB1 A;  1BOC A;  3BUO B;  1MXE A;  4NQG A;  1TWO A;  4N5X A;  1XFV O;  2PYQ A;  2K7C A;  1AJ4 A;  1TCF A;  4HSZ A;  4MBE A;  4DCK A;  1JFJ A;  1CLM A;  3ZWH A;  1SR6 B;  1YTZ C;  5DKN A;  2LV7 A;  4ETO A;  1B4C A;  1EG4 A;  2JXC A;  1C3Z A;  1NCY A;  1OQP A;  3DXL A;  3I5F B;  3PSR A;  3C1V A;  2LC5 A;  2L4I A;  1QS7 A;  1PRW A;  1YUU A;  3CLN A;  3CZ1 A;  4GAO A;  1KSO A;  2KI4 B;  1NIW A;  1G8I A;  3BUN B;  2OPO A;  3VRR A;  1JFK A;  1YUR A;  1QV1 A;  2F8P A;  1V1G A;  1WRK A;  1UHK A;  3D75 A;  3I5G B;  4L9M A;  1DGU A;  1GGW A;  1WRZ A;  2CNP A;  3O4X A;  1DJZ A;  3PAL A;  1QIV A;  2KSP A;  1B7T Z;  4OR9 B;  1CMF A;  3NHI A;  2F3Y A;  3PLF B;  4ORC B;  3PFV A;  1CFF A;  1KK8 B;  2SAS A;  1DTL A;  1J55 A;  1KWO C;  4JQ0 D;  5I2Q A;  2M3W A;  3FS7 A;  2I2R E;  1TRF A;  2OS8 B;  2WCL A;  3L47 A;  2Y4Q A;  1Z4H A;  1K2H A;  1M31 A;  1DJH A;  2BAP A;  1CB1 A;  1UUR A;  2MHH A;  2EC6 C;  1J7P A;  4N1G A;  1SNL A;  2IS9 A;  2LM5 A;  4PE7 A;  5FI2 A;  1F71 A;  3TS5 C;  1IG5 A;  1DC1 A;  1C3Y A;  1DGV A;  1FI5 A;  2L50 A;  3O2P A;  2LVV A;  3PJI A;  1OSA A;  3BOW A;  4DRW A;  1L2O C;  5AEQ A;  1F54 A;  1F8H A;  1UHH A;  2P71 A;  5K89 A;  1VRK A;  4A4C A;  4OKH A;  1BJF A;  1S1E A;  2QEV A;  1JUO A;  4C0K A;  5I94 A;  2NCO A;  2JWW A;  2L5Y A;  5D7F A;  3RLZ A;  1D1O A;  2MJW B;  5I2O A;  5HLO A;  3FE8 A;  4PCW A;  1RK9 A;  3OX5 A;  3EVU A;  2WC6 A;  1UWO A;  2LLS A;  3CZ2 A;  2PQL A;  3CDN A;  1IQ5 A;  3EKJ A;  1CM1 A;  1NCX A;  2K7D A;  2M29 A;  2KYF A;  4YGB B;  4MRY A;  4PDZ A;  3LCP C;  1MHO A;  4UPG A;  2L0P A;  1CFD A;  5F6T A;  4DUQ A;  2Y1N A;  2HF5 A;  1MUX A;  2QPT A;  2E6W A;  1ALW A;  3OX6 A;  4FQT A;  2FJU B;  3BFH A;  2BE6 A;  2BCA A;  5FI7 A;  4GUK A;  1QLS A;  3CR4 X;  4R1E A;  1EL4 A;  2ZN8 A;  1S3P A;  1KQM B;  1WY9 A;  2BKH B;  3LLE A;  5CSJ A;  4NDC A;  1QXP A;  3FIA A;  2LE9 B;  3O78 A;  1NX0 A;  3DY9 A;  3PAT A;  3VGO A;  1QWV A;  2ZN9 A;  1QAT A;  4PHN A;  1KQV A;  1Y6W A;  3NSL A;  3K21 A;  2WC8 A;  3IQQ A;  4OVN F;  2MRD A;  4M2O A;  4DIR A;  1MQ1 A;  1OMV A;  2NXQ A;  2LVI A;  1QVI Z;  1TNQ A;  3DD4 A;  4GGF A;  1TNX A;  1DJY A;  1QLK A;  4M2Q A;  5JOL A;  2LUC A;  1RWY A;  1Y1X A;  3IF7 A;  4D1E A;  3KF9 A;  4I5J A;  3TZ1 A;  1S36 A;  1R6P A;  2WCH A;  3NSI A;  5I8N A;  1KK7 Y;  2JU0 A;  1PSB A;  1XFY O;  3TUY C;  1SRA A;  4XYN A;  1EH2 A;  1K94 A;  2LHL A;  1CTR A;  2BCX A;  4HRE E;  3OB1 B;  4E68 A;  2PVB A;  5GQQ C;  5ER4 X;  2JRF A;  4MZJ A;  2LP2 A;  2WND A;  1L7Z A;  3D0Y A;  3EKH A;  1IKU A;  1BR4 B;  1S5G Y;  2O60 A;  3QME A;  1TUJ A;  2GGZ A;  2JPT A;  4I5L B;  3RZS A;  4PHJ A;  3TDZ A;  1RJV A;  2HQ8 A;  3D10 A;  4M2P A;  2Q4U A;  3V2L A;  4PHK A;  5HLV A;  2A4J A;  1QX2 A;  4HRH A;  2AUC A;  4WRI A;  4GBA A;  5HYD A;  1ALV A;  1IQ3 A;  3CZ0 A;  2JOJ A;  3DVM A;  2HQW A;  4YGD B;  3ZNI A;  1UHI A;  2WCB A;  2M7N A;  3DVE A;  1NX2 A;  2K60 A;  3RM1 A;  3I5I C;  1DQE A;  1SR6 C;  3JTD C;  1YX7 A;  2JT8 A;  4C0J A;  4DS7 A;  3AKB A;  1W7I B;  3B6X A;  3I5F C;  2R2I A;  1TNP A;  1AK8 A;  1CMG A;  3S0A A;  3PN7 B;  4HRG A;  1CM4 A;  1ZUZ A;  1K9K A;  1NX1 A;  1TCO B;  2WOR A;  1AP4 A;  1SL9 A;  3CR5 X;  1YVL A;  1ZAC A;  3I5G C;  1NCZ A;  1A75 B;  2JPO A;  1U5I B;  2F3Z A;  4OZD A;  2LHI A;  1F4Q A;  1CDM A;  1SCV A;  2KFH A;  2QEO A;  1A4P A;  4YI9 A;  2ISD A;  2AAO A;  3D77 A;  2FJY A;  4JD9 A;  3FE9 A;  2LMU A;  1KK8 C;  1WLM A;  3K1E A;  1IJ5 A;  1MXL C;  1XYD A;  2LVK A;  5AER A;  2ERB A;  2K61 A;  1OOH A;  1TOP A;  2LMT A;  3F45 A;  1SSE B;  3SG2 A;  2LAP A;  4IJ7 A;  4YGA A;  2K2F A;  4GGF C;  1UUS A;  1FF1 A;  1LIN A;  1S6J A;  1DVI A;  3N7H A;  3EK8 A;  1QAS A;  2GGM A;  2KAV A;  5DKQ A;  2ZRS A;  1JC2 A;  1K95 A;  1TIZ A;  2WCJ A;  4AOM A;  4YRU A;  4WQ2 A;  3B88 A;  1SW8 A;  2FOT A;  3AKA A;  5DIC A;  2WCK A;  4PHM A;  2L2C A;  2LLU A;  4GFT A;  1JSA A;  2BBM A;  3R1P A;  4QJ3 B;  2QEB A;  4ORA B;  1F70 A;  1NWD A;  3D76 A;  3KHE A;  2Y1M A;  3BQ3 A;  1TTX A;  2KAX A;  2KAY A;  4WQ3 A;  4CPV A;  4YI8 A;  2M8U A;  2M49 B;  5HKY A;  1PVA A;  4FTG A;  4BY4 A;  4CID A;  3BUX B;  3SS3 A;  1CDP A;  1DF0 B;  1CLB A;  3GK1 A;  4XJK A;  2OTG B;  4YGE B;  2LCP A;  4NDB A;  1M39 A;  1A29 A;  3GK2 A;  1N2D A;  3S0G A;  3WHT B;  1BOD A;  1MF8 B;  2L51 A;  1C7W A;  1JF0 A;  5ER5 A;  4AQI A;  3SIA A;  2JT3 A;  2Q91 A;  5AAN A;  1B7T Y;  3SG6 A;  2LMV A;  5CSN A;  1OOI X;  2CBL A;  2JQ6 A;  1KQM C;  2KQY A;  3LL8 B;  1G33 A;  3O4Y A;  2M9G A;  2WCE A;  2MBX A;  1XFR A;  1YRU B;  1YVH A;  2M1K B;  2ZFD A;  1FPW A;  5CPV A;  2TN4 A;  2B1U A;  1B9A A;  5FYX A;  1SMG A;  1SYM A;  1UHN A;  2EC6 B;  4ORB B;  3WXA A;  1GGZ A;  2BCB A;  2BNX A;  1REC A;  2H61 C;  1KCY A;  2E30 A;  3FWB A;  2KHN A;  3CTN A;  1B47 A;  2D8N A;  2O5G A;  3BJH A;  1NPQ A;  3IQO A;  1LA3 A;  4PE1 A;  1YUS A;  1BU3 A;  2KFF A;  1PK0 D;  1LKJ A;  2BL0 B;  3DYE A;  4YBH B;  2WCF A;  4MLW A;  3CS1 A;  2F33 A;  3PM8 A;  5CSI A;  1DMO A;  2YGU A;  1F55 A;  3QRX A;  1CDN A;  1AJ5 A;  3Q8I A;  2RGI A;  2M1U A;  1IH0 A;  1SY9 A;  1AHR A;  1H4B A;  4GGN A;  4P5O E;  5JJG A;  3JVT C;  3HX4 A;  2FCE A;  4CFQ A;  2M97 A;  2KOT A;  1S26 D;  1AVS A;  2P6B B;  1KFU S;  3PM2 A;  1K9P A;  3OP0 A;  4CFR A;  1EXR A;  2MLF C;  4INW A;  4TNC A;  5KSZ A;  3KEV A;  1Y0V H;  1KFU L;  1SK6 D;  2NZ0 A;  3E3R A;  1OMD A;  1FI6 A;  1WDC B;  1XFU O;  3EK4 A;  5G08 A;  3EVR A;  2PAS A;  3TDU A;  1FW4 A;  1N65 A;  2PRU A;  2I18 A;  3SG7 A;  3WHU B;  1GJY A;  1B1G A;  1NYA A;  1EG3 A;  2ZND A;  2I94 A;  3OHM B;  1B8C A;  1IGV A;  1BR1 B;  1K90 D;  1M46 A;  1CLL A;  1H8B A;  2KI6 D;  1IIO A;  1RFJ A;  2GTE A;  1FBV A;  1Z2C B;  1ODB A;  2M7L A;  1WRL A;  2HPS A;  2KFG A;  3S0D A;  3CZT X;  2F2P A;  1N0Y A;  2PMY A;  1LS8 A;  2V53 A;  3BYA A;  3CWG A;  3MSE B;  1A03 A;  1QVI Y;  1DJX A;  2EGD A;  3SS4 A;  2BEC A;  2BBN A;  3S0E A;  2ZNE A;  1CDL A;  3SS5 A;  1SCM B;  4OCI A;  2H2K A;  5KTY A;  1A2X A;  2KI4 C;  3TUY B;  1QJT A;  1MWN A;  1SL8 A;  4F0Z B;  2L5X B;  1TNW A;  2KDH A;  3NSO A;  3BFB A;  2MLE C; 
#chains in the Genus database with same CATH homology
 1HQV A;  2I7A A;  2K7O A;  1X02 A;  1CKK A;  3TDI A;  1LVC D;  3VRO A;  2BKI B;  3BOW B;  1DT7 B;  1IRJ A;  2H61 A;  1IWQ A;  2K0J A;  3I5H B;  1NX3 A;  1Y1A A;  2LVJ A;  2OS8 C;  1SPY A;  2LUX A;  1KFX S;  1PSR A;  1CNP A;  3SJS A;  2F2O A;  2QAC A;  3OB2 B;  1J1D A;  1KFX L;  1YX8 A;  4JPZ B;  4QJ4 B;  3DVK A;  2CT9 A;  3VRQ A;  3LK0 A;  1F4O A;  3CGA A;  2JZI A;  2Y5I A;  3I5I B;  3JTD B;  2G9B A;  3KO0 A;  1NUB A;  1PUL A;  2COL B;  4USL A;  1MR8 A;  1Y1U A;  4U8D A;  2OTG C;  1C7V A;  5KU1 A;  2MAZ A;  1OOJ A;  3AAJ A;  3SIB A;  3LK1 A;  3SG3 A;  4FQO A;  1SL7 A;  1R2U A;  1XFW O;  4P2Y B;  2M0R A;  5AXI A;  3VRP A;  4GPL B;  3A4U B;  2L2E A;  2PSR A;  1E8A A;  2KBM A;  1UHJ A;  1HT9 A;  2PAL A;  4I5N B;  4MVF A;  1RRO A;  4I5K A;  1OZO A;  1CFP A;  1B8L A;  1XK4 C;  1IJ6 A;  1DJI A;  2JXL A;  3DVJ A;  1K8U A;  1BMO A;  1TN4 A;  2SCP A;  1JWD A;  1OZS A;  1BT6 A;  2NLN A;  2K8M B;  1XA5 A;  2KGB C;  4C0L A;  5PAL A;  1BLQ A;  3WNX B;  1A75 A;  1KWO B;  1U5I A;  2JT0 A;  5CSF A;  3DF0 B;  1Q80 A;  2LP3 A;  3SG4 A;  1GQM A;  2NCP A;  4N1F A;  2AMI A;  3SG5 A;  1CFC A;  4MN0 A;  5J3X A;  3O6B A;  5I2L A;  4YGC B;  3EK7 A;  2BL0 C;  3D0Y B;  1S6I A;  2MA2 A;  1NP8 A;  4BY5 A;  1AUI B;  1JBA A;  1K9U A;  3TS5 B;  2KGR A;  2KBI A;  3H4S E;  3CR2 A;  2WOS A;  1XVJ A;  1L2O B;  1EJ3 A;  1KK7 Z;  1WLZ A;  1V1F A;  1J1E A;  1M63 B;  1PAL A;  2L4H A;  3GK4 X;  1QIW A;  1QX7 A;  4MZK A;  2JTT A;  2VRG A;  2ZKM X;  1C07 A;  4PE0 A;  2KI6 C;  4IL1 A;  2CXJ A;  3A8R A;  4CLN A;  1S5G Z;  2BE4 A;  1ZFS A;  1PVB A;  1WDC C;  1YR5 A;  4Q04 A;  1JF2 A;  1S6C A;  1DJW A;  1BG1 A;  5HKW A;  1XO5 A;  1QTX A;  1NSH A;  5IBW A;  1DF0 A;  2CTN A;  2KYC A;  3EVV A;  4GNK B;  1QX5 B;  4OV2 A;  5D69 A;  2L98 A;  4AQJ A;  1DJG A;  2HET A;  2JC2 A;  1J7Q A;  1M45 A;  1J7O A;  1RTP 1;  3FWC A;  1OE9 B;  2DOQ A;  1SKT A;  2KQ6 A;  5BPJ A;  3VRN A;  1SCM C;  3GOF A;  3PN7 C;  4PAL A;  4MZL A;  2JNF A;  1J7R A;  1SBJ A;  1XFZ O;  4ZCU A;  3M0W A;  3DF0 A;  5DKR A;  1OMR A;  4MSP A;  3BXK A;  1XK4 A;  2JNX A;  4A4B A;  2GV5 A;  1YUT A;  1W7J B;  2JUL A;  2LLT A;  3BUW B;  1BF5 A;  2FCD A;  1K96 A;  2K2A A;  1LA0 A;  2ZRT A;  3I5H C;  3JVT B;  3HCM A;  4NDD A;  4ICB A;  2K7B A;  4PE4 A;  1LXF C;  5HKZ A;  2G2B A;  1QV0 A;  3NXA A;  2EHB A;  3ICB A;  5B8I B;  2JTZ A;  4JWQ A;  2LAN A;  1K93 D;  5AFP A;  4MRX A;  1B8R A;  2KNE A;  2LNK A;  1KSM A;  2CCM A;  5TNC A;  1ZOT B;  3KPX A;  4XJK B;  1G4Y R;  3BUM B;  1ZMZ A;  4MEW A;  4ZCV A;  1YRT B;  4QJ5 B;  3AAK A;  1UP5 A;  3NSK A;  1XFX O;  1BOC A;  3BUO B;  1MXE A;  4NQG A;  4N5X A;  1XFV O;  2K7C A;  1AJ4 A;  1TCF A;  4HSZ A;  4MBE A;  4DCK A;  1JFJ A;  1CLM A;  3ZWH A;  1SR6 B;  1YTZ C;  5DKN A;  2LV7 A;  4ETO A;  1B4C A;  1EG4 A;  2JXC A;  1OQP A;  1NCY A;  3I5F B;  3PSR A;  3C1V A;  2LC5 A;  2L4I A;  1QS7 A;  1PRW A;  1YUU A;  3CLN A;  4GAO A;  1KSO A;  2KI4 B;  1NIW A;  1G8I A;  3BUN B;  2OPO A;  3VRR A;  1JFK A;  1YUR A;  1QV1 A;  2F8P A;  1V1G A;  1WRK A;  1UHK A;  3I5G B;  4L9M A;  1GGW A;  1DGU A;  1WRZ A;  2CNP A;  3PAL A;  1DJZ A;  1QIV A;  2KSP A;  1B7T Z;  4OR9 B;  1CMF A;  2F3Y A;  3PLF B;  4ORC B;  3PFV A;  1CFF A;  1KK8 B;  2SAS A;  1DTL A;  1J55 A;  1KWO C;  4JQ0 D;  5I2Q A;  2M3W A;  3FS7 A;  2I2R E;  1TRF A;  2OS8 B;  2Y4Q A;  1K2H A;  1M31 A;  1DJH A;  1CB1 A;  1UUR A;  2MHH A;  2EC6 C;  1J7P A;  4N1G A;  1SNL A;  2IS9 A;  2LM5 A;  4PE7 A;  1F71 A;  3TS5 C;  1IG5 A;  1DGV A;  1FI5 A;  2L50 A;  3O2P A;  2LVV A;  1OSA A;  3BOW A;  4DRW A;  1L2O C;  5AEQ A;  1F54 A;  1F8H A;  1UHH A;  5K89 A;  1VRK A;  4A4C A;  4OKH A;  1BJF A;  1S1E A;  1JUO A;  4C0K A;  2NCO A;  2JWW A;  5D7F A;  3RLZ A;  1D1O A;  2MJW B;  5I2O A;  5HLO A;  4PCW A;  1RK9 A;  3OX5 A;  3EVU A;  1UWO A;  2LLS A;  1IQ5 A;  3EKJ A;  1CM1 A;  1NCX A;  2K7D A;  2M29 A;  2KYF A;  4YGB B;  4MRY A;  4PDZ A;  3LCP C;  1MHO A;  4UPG A;  2L0P A;  1CFD A;  5F6T A;  4DUQ A;  2Y1N A;  2HF5 A;  1MUX A;  2QPT A;  2E6W A;  1ALW A;  3OX6 A;  2FJU B;  2BE6 A;  2BCA A;  4GUK A;  1QLS A;  3CR4 X;  4R1E A;  1EL4 A;  2ZN8 A;  1S3P A;  1KQM B;  1WY9 A;  2BKH B;  3LLE A;  5CSJ A;  4NDC A;  1QXP A;  3FIA A;  2LE9 B;  3O78 A;  1NX0 A;  3PAT A;  3VGO A;  2ZN9 A;  1QAT A;  4PHN A;  1KQV A;  1Y6W A;  3NSL A;  3K21 A;  2WC8 A;  3IQQ A;  4OVN F;  2MRD A;  4M2O A;  4DIR A;  1MQ1 A;  1OMV A;  2NXQ A;  2LVI A;  1QVI Z;  1TNQ A;  3DD4 A;  4GGF A;  1TNX A;  1DJY A;  1QLK A;  4M2Q A;  5JOL A;  2LUC A;  1RWY A;  1Y1X A;  3IF7 A;  4D1E A;  3KF9 A;  4I5J A;  3TZ1 A;  1S36 A;  1R6P A;  3NSI A;  5I8N A;  3TUY C;  1KK7 Y;  2JU0 A;  1PSB A;  1XFY O;  1SRA A;  4XYN A;  1EH2 A;  1K94 A;  2LHL A;  1CTR A;  2BCX A;  4HRE E;  3OB1 B;  4E68 A;  2PVB A;  5GQQ C;  5ER4 X;  2JRF A;  4MZJ A;  2LP2 A;  2WND A;  1L7Z A;  3D0Y A;  3EKH A;  1IKU A;  1BR4 B;  1S5G Y;  2O60 A;  2JPT A;  2GGZ A;  4I5L B;  4PHJ A;  3TDZ A;  1RJV A;  2HQ8 A;  3D10 A;  4M2P A;  2Q4U A;  4PHK A;  5HLV A;  2A4J A;  1QX2 A;  4HRH A;  2AUC A;  4WRI A;  4GBA A;  5HYD A;  1ALV A;  1IQ3 A;  2JOJ A;  3DVM A;  2HQW A;  4YGD B;  3ZNI A;  1UHI A;  2WCB A;  2M7N A;  3DVE A;  1NX2 A;  3RM1 A;  3I5I C;  1SR6 C;  3JTD C;  1YX7 A;  2JT8 A;  4C0J A;  4DS7 A;  3AKB A;  1W7I B;  3I5F C;  2R2I A;  1TNP A;  1AK8 A;  1CMG A;  3PN7 B;  4HRG A;  1CM4 A;  1ZUZ A;  1K9K A;  1NX1 A;  1TCO B;  2WOR A;  1AP4 A;  1SL9 A;  3CR5 X;  1YVL A;  1ZAC A;  3I5G C;  1NCZ A;  1A75 B;  1U5I B;  2F3Z A;  2LHI A;  1F4Q A;  1CDM A;  1SCV A;  2KFH A;  4YI9 A;  1A4P A;  2ISD A;  2AAO A;  2LMU A;  1KK8 C;  1WLM A;  5AER A;  1IJ5 A;  1MXL C;  1XYD A;  2LVK A;  2K61 A;  1TOP A;  2LMT A;  3F45 A;  3SG2 A;  2LAP A;  4YGA A;  2K2F A;  4GGF C;  1UUS A;  1FF1 A;  1LIN A;  1S6J A;  1DVI A;  3EK8 A;  1QAS A;  2GGM A;  2KAV A;  5DKQ A;  2ZRS A;  1JC2 A;  1K95 A;  1TIZ A;  4AOM A;  4YRU A;  4WQ2 A;  1SW8 A;  2FOT A;  3AKA A;  4PHM A;  2LLU A;  4GFT A;  1JSA A;  2BBM A;  4QJ3 B;  4ORA B;  1F70 A;  1NWD A;  3KHE A;  2Y1M A;  3BQ3 A;  1TTX A;  2KAX A;  2KAY A;  4WQ3 A;  4CPV A;  4YI8 A;  2M8U A;  2M49 B;  5HKY A;  1PVA A;  4FTG A;  4BY4 A;  4CID A;  3BUX B;  1CDP A;  1DF0 B;  1CLB A;  3GK1 A;  4XJK A;  2OTG B;  4YGE B;  2LCP A;  4NDB A;  1M39 A;  1A29 A;  3GK2 A;  1N2D A;  3WHT B;  1BOD A;  1MF8 B;  2L51 A;  1C7W A;  1JF0 A;  5ER5 A;  4AQI A;  3SIA A;  2JT3 A;  2Q91 A;  5AAN A;  1B7T Y;  3SG6 A;  2LMV A;  5CSN A;  2CBL A;  2JQ6 A;  1KQM C;  2KQY A;  3LL8 B;  1G33 A;  3O4Y A;  2M9G A;  2WCE A;  2MBX A;  1YRU B;  1YVH A;  2M1K B;  2ZFD A;  1FPW A;  5CPV A;  2TN4 A;  2B1U A;  1B9A A;  5FYX A;  1SMG A;  1SYM A;  1UHN A;  2EC6 B;  4ORB B;  3WXA A;  1GGZ A;  2BCB A;  2H61 C;  1REC A;  1KCY A;  2E30 A;  3FWB A;  2KHN A;  3CTN A;  1B47 A;  2D8N A;  2O5G A;  1NPQ A;  3IQO A;  1LA3 A;  4PE1 A;  1YUS A;  1BU3 A;  2KFF A;  1PK0 D;  1LKJ A;  2BL0 B;  4YBH B;  2WCF A;  4MLW A;  3CS1 A;  2F33 A;  3PM8 A;  5CSI A;  1DMO A;  1F55 A;  3QRX A;  1CDN A;  1AJ5 A;  2RGI A;  2M1U A;  1IH0 A;  1SY9 A;  1AHR A;  1H4B A;  4GGN A;  4P5O E;  5JJG A;  3JVT C;  3HX4 A;  2FCE A;  4CFQ A;  2M97 A;  2KOT A;  1S26 D;  1AVS A;  2P6B B;  1KFU S;  1K9P A;  3OP0 A;  4CFR A;  1EXR A;  2MLF C;  4TNC A;  5KSZ A;  3KEV A;  1Y0V H;  1KFU L;  1SK6 D;  2NZ0 A;  3E3R A;  1OMD A;  1FI6 A;  1WDC B;  1XFU O;  3EK4 A;  5G08 A;  3EVR A;  2PAS A;  3TDU A;  1FW4 A;  1N65 A;  2PRU A;  2I18 A;  3SG7 A;  3WHU B;  1GJY A;  1B1G A;  1NYA A;  1EG3 A;  2ZND A;  2I94 A;  3OHM B;  1B8C A;  1IGV A;  1BR1 B;  1K90 D;  1M46 A;  1CLL A;  1H8B A;  2KI6 D;  1RFJ A;  1FBV A;  2M7L A;  1ODB A;  1WRL A;  2HPS A;  2KFG A;  3CZT X;  2F2P A;  1N0Y A;  2PMY A;  3BYA A;  2V53 A;  3CWG A;  3MSE B;  1A03 A;  1QVI Y;  1DJX A;  2EGD A;  2BEC A;  2BBN A;  2ZNE A;  1CDL A;  1SCM B;  4OCI A;  2H2K A;  5KTY A;  1A2X A;  2KI4 C;  3TUY B;  1QJT A;  1MWN A;  1SL8 A;  4F0Z B;  2L5X B;  1TNW A;  2KDH A;  3NSO A;  2MLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...