2JC2A

The crystal structure of the natural f112l human sorcin mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISLDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORCIN
publication title Molecular Basis for the Impaired Function of the Natural F112L Sorcin Mutant: X-Ray Crystal Structure, Calcium Affinity, and Interaction with Annexin Vii and the Ryanodine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 48
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jc2A02
3M0WA 1M45A 2LNKA 1VRKA 1JUOA 2LVIA 5DKRA 2ZFDA 1KQMC 1K95A 1YUUA 3CR2A 1B8RA 3BOWB 4MZJA 4P2YB 2P6BB 2KGBC 2KI6C 1WY9A 5F6TA 5PALA 2DOQA 1JWDA 1S3PA 2FCEA 2KBIA 1A29A 3BXKA 3PALA 5G08A 1RTP1 4N5XA 2BCAA 1G8IA 3LL8B 4XJKA 1NX2A 1G4YR 3AKBA 4YRUA 3PN7B 2AMIA 2MLEC 2RGIA 3SG3A 3FS7A 2OS8B 2E30A 2HPSA 3KHEA 1M39A 3CS1A 3DVEA 2MJWB 2BL0C 1DJWA 1Y1UA 1PVAA 2K7DA 2MA2A 4YGDB 2LP2A 4A4CA 2EGDA 1KFUS 5HYDA 2KAXA 3VRNA 4HSZA 4YGAA 3VROA 4L9MA 2GV5A 3O6BA 2LANA 1ALWA 4PDZA 1NPQA 2Y4QA 2F3ZA 2MLFC 3H4SE 2COLB 3I5HB 1IKUA 3TUYC 4WQ3A 1DGVA 2JQ6A 2KYFA 5HKWA 4CFQA 4TNCA 1AP4A 1N65A 4MRYA 1BG1A 1HT9A 2BBNA 2KBMA 1AJ4A 4AOMA 1UHNA 5KU1A 2IS9A 1JSAA 1X02A 1XFWO 2KQ6A 1WRLA 1YR5A 4I5LB 3VRPA 2K8MB 3SG2A 1MHOA 2LV7A 1LINA 3VGOA 3ICBA 1CLMA 5JOLA 4ORCB 3LK0A 2L0PA 1YUSA 4MRXA 1K2HA 1GGWA 1DVIA 1RROA 1NP8A 1CLLA 1NSHA 2M97A 5ER5A 1IJ5A 5AEQA 2JU0A 2I94A 2F3YA 1NCZA 4FTGA 2M8UA 3AKAA 1UHHA 1TNWA 1SCVA 1IG5A 1SR6B 3I5IC 1A75B 3OX6A 1UUSA 1IQ5A 1DGUA 4DS7A 1DT7B 1A4PA 1L2OB 1UHIA 1S6JA 4C0KA 1YRUB 4NDBA 3DD4A 2WCFA 2G2BA 2KYCA 1CFDA 1F4QA 5AFPA 1SCMB 1SPYA 2BL0B 3TDIA 2LVVA 2D8NA 3SJSA 1CMGA 1DF0A 5I2QA 4PCWA 1MF8B 4M2OA 2AAOA 2AUCA 2BCBA 1UHKA 1W7IB 1GJYA 3BYAA 1YTZC 2H61C 3LLEA 1S5GY 3TUYB 2ZN9A 2K0JA 1MXLC 1WDCC 2Y1NA 2ZNDA 4MLWA 3SIBA 1B9AA 3PSRA 3TDUA 2BE6A 2KAVA 1QXPA 1XFZO 3I5FC 1OMVA 1KSMA 4CLNA 3F45A 2M7LA 3CLNA 4HRHA 1GQMA 1NX0A 4MZLA 1OE9B 1R6PA 5HLOA 4CPVA 2PMYA 1BOCA 4DUQA 1B1GA 2JNFA 1QASA 2KHNA 1F55A 2E6WA 2F8PA 1J7OA 4I5NB 1S1EA 1SKTA 4YGEB 4ORAB 2FJUB 3BQ3A 3I5IB 2MAZA 1NCXA 4FQOA 2JXLA 2KI4B 1OMRA 1K93D 3HX4A 4YBHB 4PHNA 2CT9A 3DF0B 4I5KA 2QPTA 3EKJA 5CPVA 1XO5A 2LMTA 4DRWA 1PULA 2GGZA 1PSRA 1TNXA 3HCMA 1XK4C 3ZWHA 4GFTA 1XVJA 2G9BA 2KGRA 4OKHA 3WHUB 1EG4A 2KQYA 3PLFB 3SG6A 1XFXO 2WC8A 3K21A 3CZTX 1C7WA 1QJTA 2L2EA 3KO0A 2JRFA 2L51A 1G33A 2O5GA 3GK4X 4JPZB 3SG5A 1QLSA 2K7OA 1C07A 1BODA 4AQJA 1SR6C 3RM1A 2LUXA 1IGVA 3I5GC 1WDCB 1L2OC 1NX3A 2BKHB 4P5OE 5CSNA 1H4BA 5JJGA 2PASA 1D1OA 1LA0A 2NXQA 3TZ1A 1SCMC 2JTZA 3I5FB 3D0YB 4YI9A 1J7QA 1B47A 1NX1A 3EVRA 1DTLA 2SASA 2SCPA 2CTNA 1K8UA 1BJFA 3SG7A 1K9UA 2M1KB 1TIZA 3IQOA 1BR4B 1OOJA 2LUCA 1LXFC 3FWBA 4DIRA 1AK8A 1S6IA 2F2OA 2VRGA 2LCPA 1QV1A 1KWOB 5KTYA 1F8HA 2PRUA 4N1GA 2CNPA 2HETA 1Y6WA 1U5IB 2M49B 2OTGC 4XYNA 4D1EA 1LA3A 3BUOB 1XFUO 2CXJA 2BKIB 2ZKMX 3KPXA 1L7ZA 4DCKA 2ZRTA 4PHMA 1YRTB 1OSAA 2I7AA 4CFRA 1KSOA 1CLBA 3SG4A 4GNKB 1R2UA 1EL4A 1J1EA 1UWOA 1Y1XA 2LLTA 2NCPA 2WOSA 1EH2A 3A8RA 1YX7A 1M46A 1KQVA 2JOJA 1TNPA 3O4YA 2KOTA 1BR1B 2L4IA 2JTTA 4NDDA 3NSOA 1PK0D 1B7TY 1MXEA 2K2AA 2M0RA 2KI4C 1ZFSA 2QACA 3I5GB 1YUTA 4GGFC 4JQ0D 1SRAA 4MBEA 5CSFA 3CGAA 2JT8A 1PRWA 4AQIA 4XJKB 1RECA 1TOPA 3DVJA 2KSPA 3EVUA 5CSIA 5KSZA 2FCDA 2JXCA 3FIAA 2LP3A 2GGMA 1CM1A 1CTRA 3JVTC 1J55A 1YURA 3ZNIA 2KFFA 1DJGA 4R1EA 2LVJA 4M2PA 1SL8A 1EG3A 3EKHA 2I2RE 3IQQA 4PHKA 4C0JA 5ER4X 1CM4A 3DF0A 2KFGA 1SBJA 2EHBA 1HQVA 1QIVA 1JFKA 1TCOB 1CDPA 2NZ0A 1Y1AA 3AAKA 1KFXL 3OP0A 2JNXA 2BCXA 1IQ3A 1SL7A 2OPOA 1FPWA 2OTGB 1LKJA 3BOWA 4WQ2A 1RWYA 1XYDA 3CTNA 2KDHA 3CR5X 4BY4A 4I5JA 1CDMA 3EK7A 4YI8A 1J7PA 3GK2A 2CBLA 1BLQA 2H61A 2Y5IA 3NSIA 3AAJA 4U8DA 1XA5A 4F0ZB 4MSPA 5I2OA 1S5GZ 4QJ4B 3EK4A 4MEWA 5HLVA 1OZOA 1V1GA 4ICBA 1MR8A 3NXAA 4USLA 1DMOA 1KWOC 2JZIA 4BY5A 4E68A 1QX2A 1QVIY 2WORA 1QX5B 2K7BA 3JTDC 3CR4X 3EVVA 1S6CA 1KK7Y 2KI6D 4MVFA 1W7JB 2LAPA 2K2FA 4WRIA 2LMVA 3PATA 1B8CA 3PFVA 1RJVA 1YX8A 3IF7A 4MN0A 1WRKA 1QLKA 3EK8A 3JVTB 1CDNA 1FI5A 1IRJA 1ZOTB 1QATA 1DJZA 4ETOA 5IBWA 4HRGA 2BECA 1SW8A 4UPGA 1C7VA 1BF5A 1AVSA 2K7CA 5HKZA 4YGBB 2Y1MA 4GPLB 2PVBA 2JT3A 1TRFA 3PM8A 3WXAA 3KF9A 1QX7A 5D7FA 1QTXA 1CFPA 3BUNB 1SMGA 2Q91A 1H8BA 2LHLA 5DKQA 1XK4A 1E8AA 4OR9B 2EC6C 4C0LA 1F54A 1TTXA 3TS5C 1JF2A 1K90D 1LVCD 2L98A 2L4HA 1KK8B 2FOTA 3LCPC 4JWQA 1MUXA 4YGCB 1Q80A 4PHJA 1A75A 5FYXA 5AXIA 1CB1A 5I8NA 1M63B 5I2LA 1K9KA 2B1UA 3D10A 4OV2A 1V1FA 1CFFA 1CNPA 1SY9A 2NLNA 4PE4A 4GAOA 2LVKA 1CMFA 5HKYA 1FI6A 1YVLA 3A4UB 3GOFA 2KNEA 2LHIA 1S26D 4ZCUA 1KFUL 4PE1A 1EXRA 3E3RA 3JTDB 1RK9A 4NQGA 3O2PA 4OCIA 2V53A 2KFHA 1JFJA 2ZNEA 3CWGA 1ODBA 2LE9B 3QRXA 1FW4A 2M9GA 2I18A 1TCFA 2BBMA 2L5XB 1GGZA 3TDZA 2R2IA 4N1FA 1M31A 1A03A 2JC2A 5B8IB 1SK6D 3BUMB 2F2PA 5BPJA 2LC5A 4GBAA 1PSBA 2ZRSA 1SNLA 2M29A 2M3WA 3DVMA 3OHMB 5K89A 2TN4A 1IWQA 1CFCA 2CCMA 2O60A 2WCEA 1XFVO 1NYAA 1IJ6A 1J7RA 2EC6B 2LMUA 1N2DA 4MZKA 1MQ1A 4QJ3B 3SIAA 1PALA 3TS5B 2L50A 5D69A 1KQMB 1YVHA 2JPTA 1ZACA 3RLZA 1DJHA 2PALA 1UP5A 4ORBB 4IL1A 4Q04A 1OZSA 5CSJA 1SL9A 1OMDA 4GGFA 1K9PA 2JULA 1JBAA 1B7TZ 1EJ3A 1DJXA 1DJYA 2HQ8A 2PSRA 2M1UA 4QJ5B 2F33A 4NDCA 5DKNA 3FWCA 3OX5A 3WHTB 2MRDA 2M7NA 1WRZA 2NCOA 4ZCVA 3VRQA 4M2QA 4GGNA 1BMOA 1QIWA 2KAYA 1ZUZA 3O78A 1KFXS 1NCYA 1RFJA 2A4JA 1MWNA 3BUXB 4PALA 1TN4A 1KK8C 3KEVA 4PE7A 4CIDA 1J1DA 1JF0A 1PVBA 2LLUA 3VRRA 3NSLA 3MSEB 2K61A 5AANA 1CKKA 1F71A 1ZMZA 3OB2B 4OVNF 1BT6A 1K96A 2WCBA 3PN7C 1KCYA 2HQWA 1FF1A 2ZN8A 5TNCA 3D0YA 5AERA 1UHJA 2HF5A 1S36A 2OS8C 2JT0A 1NIWA 2H2KA 2JWWA 3C1VA 3GK1A 1IH0A 1AHRA 1XFYO 3OB1B 1F70A 2WNDA 1N0YA 1UURA 1AUIB 1WLZA 1WLMA 3BUWB 1FBVA 4HREE 1Y0VH 1B4CA 2LLSA 1K94A 1AJ5A 1U5IA 3I5HC 1QVIZ 1QV0A 1B8LA 1CDLA 1A2XA 3DVKA 3NSKA 2Q4UA 4PE0A 2LM5A 2ISDA 3LK1A 1DF0B 3WNXB 2MHHA 1TNQA 2MBXA 1SYMA 5J3XA 1KK7Z 4GUKA 1NWDA 5GQQC 2BE4A 1JC2A 1ALVA 1DJIA 1QS7A 1NUBA 1OQPA 1F4OA 1BU3A 4A4BA
chains in the Genus database with same CATH superfamily
3M0WA 1M45A 2LNKA 1VRKA 3SS4A 1JUOA 2LVIA 3PM2A 1LS8A 5DKRA 3D74A 2ZFDA 1KQMC 1K95A 1YUUA 3CR2A 1B8RA 3BOWB 4MZJA 2L2CA 2P6BB 4P2YB 2KGBC 2KI6C 1WY9A 5F6TA 5PALA 3S0GA 2DOQA 2WCLA 1JWDA 1S3PA 2FCEA 2KBIA 1A29A 3BXKA 3PALA 5G08A 1RTP1 4N5XA 2BCAA 1G8IA 3B86A 3LL8B 4XJKA 1NX2A 3RZSA 1G4YR 3AKBA 4YRUA 3PN7B 2AMIA 2MLEC 2RGIA 3SG3A 3FS7A 2OS8B 2E30A 2HPSA 3QMEA 3KHEA 1M39A 3CS1A 3DVEA 2MJWB 2BL0C 1XFRA 1DJWA 1Y1UA 1PVAA 2K7DA 1DEKA 2MA2A 4YGDB 2LP2A 4A4CA 2EGDA 1KFUS 4JKTA 5HYDA 2KAXA 3VRNA 4HSZA 2P71A 4YGAA 3VROA 4L9MA 2GV5A 3O6BA 2LANA 3BFHA 1ALWA 4PDZA 1NPQA 1OW4A 2Y4QA 2F3ZA 2MLFC 3H4SE 2COLB 3I5HB 1IKUA 1OOGA 4WQ3A 1DGVA 2JQ6A 2KYFA 5HKWA 4CFQA 3TUYC 4TNCA 1AP4A 1N65A 2QEVA 4MRYA 1BG1A 1HT9A 2BBNA 2KBMA 1AJ4A 2PQLA 4AOMA 1UHNA 5KU1A 2IS9A 1JSAA 1X02A 1XFWO 2KQ6A 1WRLA 1YR5A 4I5LB 1OOFA 3VRPA 3L4LA 3R72A 2K8MB 3SG2A 1MHOA 2LV7A 1LINA 4KYNA 3ICBA 3VGOA 1CLMA 5JOLA 4ORCB 2GTEA 3LK0A 2L0PA 1YUSA 4MRXA 1K2HA 1GGWA 1DVIA 1RROA 1NP8A 1CLLA 1NSHA 2M97A 5ER5A 1IJ5A 5AEQA 2JU0A 2I94A 2F3YA 2QDIA 1NCZA 4FTGA 3B6XA 2M8UA 4IJ7A 3AKAA 1UHHA 1TNWA 1SCVA 1IG5A 1SR6B 3I5IC 1A75B 3OX6A 1UUSA 1IQ5A 1DGUA 2ERBA 4DS7A 1DT7B 1A4PA 1L2OB 1UHIA 1S6JA 3K1EA 4C0KA 1YRUB 4NDBA 3DD4A 2WCFA 1OOHA 2G2BA 2KYCA 1CFDA 1F4QA 5AFPA 1SCMB 1C3YA 1SPYA 2BL0B 3TDIA 2LVVA 2D8NA 3NHIA 3SJSA 1CMGA 1DF0A 2KLEA 5I2QA 4PCWA 1MF8B 4M2OA 2AAOA 2AUCA 2BCBA 1UHKA 1W7IB 1GJYA 5DICA 3BYAA 1YTZC 2H61C 3LLEA 1S5GY 3TUYB 2ZN9A 2K0JA 1MXLC 1WDCC 2Y1NA 2ZNDA 4MLWA 3SIBA 1B9AA 3PSRA 3TDUA 3S0AA 2BE6A 2BNXA 2KAVA 1QXPA 1XFZO 3I5FC 1OMVA 1KSMA 4CLNA 3F45A 2M7LA 3NGVA 3CLNA 4HRHA 1GQMA 1NX0A 4MZLA 1OE9B 1R6PA 5HLOA 4CPVA 2PMYA 1BOCA 4DUQA 1B1GA 3R1VA 2JNFA 3D77A 1QASA 2KHNA 3SS3A 2E6WA 2F8PA 1F55A 1J7OA 4I5NB 1S1EA 1P28A 1IIOA 1SKTA 4YGEB 4ORAB 2FJUB 3BQ3A 3I5IB 2MAZA 1NCXA 3EG5B 4FQOA 2JXLA 2KI4B 1OMRA 1K93D 3HX4A 4YBHB 4PHNA 2CT9A 3DF0B 4I5KA 3L47A 2QPTA 3BFAA 3EKJA 1XO5A 2LMTA 5CPVA 4DRWA 1DQEA 1PULA 2GGZA 1PSRA 1TNXA 3HCMA 1XK4C 3ZWHA 4GFTA 1XVJA 2G9BA 2KGRA 2BAPA 4OKHA 3WHUB 1EG4A 2KQYA 3PLFB 3SG6A 1XFXO 2WC8A 3K21A 3S0BA 3CZTX 1C7WA 2WC6A 1QJTA 2L2EA 3KO0A 2JRFA 2L51A 1G33A 2O5GA 3GK4X 4JPZB 3SG5A 1QLSA 2K7OA 1C07A 1BODA 4AQJA 1SR6C 3RM1A 2LUXA 1IGVA 3I5GC 1WDCB 2WCMA 1L2OC 1NX3A 2BKHB 4P5OE 5CSNA 1H4BA 5JJGA 2PASA 1D1OA 1LA0A 2NXQA 3TZ1A 1SCMC 2JTZA 3I5FB 3D0YB 4YI9A 1J7QA 1Z4HA 1B47A 1NX1A 3EVRA 1DTLA 2SASA 2SCPA 3VB1A 2CTNA 3V2LA 1K8UA 1BJFA 3SG7A 1K9UA 2M1KB 1TIZA 3R1OA 3IQOA 1BR4B 1OOJA 2LUCA 1LXFC 3FWBA 4DIRA 1AK8A 1S6IA 2F2OA 2QEOA 2LCPA 2VRGA 4JD9A 1QV1A 1KWOB 5KTYA 1F8HA 2PRUA 4N1GA 2CNPA 2HETA 1Y6WA 1U5IB 2M49B 2OTGC 1SSEB 4XYNA 4D1EA 1LA3A 3BUOB 1TWOA 1XFUO 2CXJA 2BKIB 2ZKMX 3KPXA 1L7ZA 4DCKA 2ZRTA 3L4AA 4PHMA 1YRTB 1OSAA 2I7AA 4CFRA 1KSOA 1CLBA 3SG4A 3FE6A 4GNKB 1R2UA 1EL4A 4FQTA 1J1EA 1UWOA 1Y1XA 2LLTA 2NCPA 2WOSA 1EH2A 3A8RA 1YX7A 1M46A 1TUZA 1KQVA 2JOJA 1TNPA 3O4YA 2KOTA 1BR1B 2L4IA 2JTTA 4NDDA 3NSOA 1PK0D 1B7TY 1MXEA 2K2AA 2M0RA 2KI4C 1ZFSA 2QACA 3I5GB 1YUTA 4GGFC 4JQ0D 1SRAA 4MBEA 5CSFA 3CGAA 5D3OA 2JT8A 1PRWA 4AQIA 4XJKB 1RECA 1TOPA 3DVJA 2KSPA 3EVUA 5CSIA 5KSZA 2FCDA 2JXCA 3FIAA 2LP3A 2GGMA 1CM1A 1CTRA 3JVTC 1J55A 1YURA 3FE9A 3ZNIA 2KFFA 1DJGA 3BJHA 4R1EA 2LVJA 4M2PA 1OOIX 1SL8A 1EG3A 3EKHA 2I2RE 3IQQA 4PHKA 4C0JA 2JPOA 5ER4X 1CM4A 3DF0A 2KFGA 1SBJA 2EHBA 1HQVA 1QIVA 1JFKA 1TCOB 1CDPA 2NZ0A 1Y1AA 3AAKA 1KFXL 3OP0A 2JNXA 2BCXA 1IQ3A 1SL7A 2OPOA 1FPWA 2OTGB 1LKJA 5FI6A 3BOWA 4WQ2A 1RWYA 2K60A 1XYDA 3CTNA 2YGUA 2KDHA 3CR5X 4BY4A 4I5JA 1CDMA 3EK7A 3PJIA 4YI8A 1J7PA 1GM0A 3GK2A 2CBLA 4F7FA 2H61A 2Y5IA 3NSIA 1BLQA 3AAJA 4U8DA 1XA5A 4F0ZB 4MSPA 5I2OA 1S5GZ 2WC5A 4QJ4B 3EK4A 4MEWA 5HLVA 1OZOA 1V1GA 3UNWA 4ICBA 1MR8A 3NXAA 4USLA 1DMOA 1KWOC 2JZIA 4BY5A 4E68A 3S0DA 1QX2A 1QVIY 2WORA 1QX5B 2K7BA 3JTDC 3CR4X 3EVVA 1S6CA 1ORGA 1KK7Y 2KI6D 4MVFA 1W7JB 2LAPA 2K2FA 1DC1A 4WRIA 2LMVA 3PATA 1B8CA 3PFVA 1RJVA 1YX8A 3IF7A 4MN0A 3S0EA 1WRKA 1QLKA 3EK8A 2WCHA 3JVTB 1CDNA 5EL2A 1IRJA 1FI5A 1ZOTB 1QATA 1DJZA 4ETOA 5IBWA 4HRGA 2BECA 2QEHA 1SW8A 3B88A 4UPGA 1C7VA 1BF5A 3B7AA 3CYZA 1AVSA 2K7CA 5HKZA 4YGBB 2Y1MA 4GPLB 2PVBA 2JT3A 1TRFA 2FJYA 3PM8A 3WXAA 3KF9A 1QX7A 5D7FA 1QTXA 5HL1A 1CFPA 3D75A 3BUNB 1DELA 1SMGA 2Q91A 3Q8IA 2LHLA 2QEBA 1XK4A 5DKQA 1E8AA 1TUJA 1H8BA 2WCKA 2EC6C 4OR9B 4C0LA 1F54A 1TTXA 3TS5C 1JF2A 3OBVA 1K90D 4INWA 1LVCD 2L98A 2L4HA 1KK8B 2FOTA 3LCPC 4JWQA 1MUXA 4YGCB 1Q80A 1C3ZA 4PHJA 1A75A 5FYXA 5AXIA 1CB1A 5I8NA 1M63B 5I2LA 1K9KA 2B1UA 3D10A 4OV2A 1V1FA 3R1PA 1CFFA 1CNPA 3CZ1A 1SY9A 2NLNA 4PE4A 4GAOA 2LVKA 1CMFA 5HKYA 1FI6A 1YVLA 3A4UB 3GOFA 2KNEA 2LHIA 3B87A 1S26D 4ZCUA 1KFUL 4PE1A 3O4XA 2H8VA 1EXRA 3E3RA 3JTDB 2WCJA 3DZTA 3CZ0A 3CABA 1RK9A 4NQGA 3O2PA 4OCIA 2V53A 2KFHA 1JFJA 2ZNEA 3CWGA 1ODBA 2LE9B 3QRXA 1FW4A 3CZ2A 1Z2CB 2M9GA 2I18A 1TCFA 2BBMA 2L5XB 1GGZA 3TDZA 2R2IA 4N1FA 2KLDA 1M31A 1A03A 2JC2A 5B8IB 1SK6D 3BUMB 2F2PA 5BPJA 3BFBA 2LC5A 4GBAA 1PSBA 2ZRSA 1SNLA 2M29A 2M3WA 3DVMA 3OHMB 5K89A 2TN4A 1IWQA 1CFCA 2CCMA 2O60A 2WCEA 1XFVO 1NYAA 1IJ6A 1J7RA 2EC6B 2LMUA 1N2DA 2L5YA 3CDNA 1MQ1A 4MZKA 4QJ3B 3SIAA 1PALA 3TS5B 2L50A 5D69A 1KQMB 1YVHA 2JPTA 1ZACA 3RLZA 1DJHA 2PALA 3UO9A 1UP5A 4ORBB 4IL1A 4Q04A 1OZSA 5CSJA 1SL9A 1OMDA 4GGFA 1K9PA 2JULA 1JBAA 1B7TZ 1EJ3A 3D78A 1DJXA 1DJYA 2HQ8A 2PSRA 2M1UA 4QJ5B 2F33A 4NDCA 5DKNA 3FWCA 3OX5A 3WHTB 2MRDA 2PYQA 4INXA 2M7NA 1WRZA 2NCOA 4ZCVA 3VRQA 4M2QA 4GGNA 1BMOA 1QIWA 3D73A 2KPHA 3SS5A 2KAYA 1ZUZA 3O78A 1KFXS 1NCYA 1RFJA 2A4JA 1MWNA 3BUXB 3DYEA 4PALA 5I94A 5FI2A 3D76A 1TN4A 1KK8C 3KEVA 4PE7A 4CIDA 2P70A 1J1DA 1W9ZA 1JF0A 1PVBA 2LLUA 3VRRA 3IVTA 3NSLA 3MSEB 2K61A 5AANA 1CKKA 1T14A 1ZMZA 3OB2B 1F71A 4OVNF 3DXLA 1BT6A 1K96A 2WCBA 3PN7C 1KCYA 2HQWA 1FF1A 2ZN8A 5TNCA 3D0YA 5AERA 3NHTA 1UHJA 2HF5A 1S36A 2OS8C 2JT0A 1NIWA 2H2KA 4OZDA 2JWWA 3C1VA 3GK1A 1IH0A 1AHRA 1XFYO 1QWVA 3OB1B 1F70A 2WNDA 1N0YA 3DY9A 1UURA 1AUIB 1WLZA 1WLMA 3BUWB 1FBVA 4HREE 1Y0VH 1B4CA 2LLSA 1K94A 1AJ5A 1U5IA 3I5HC 1QVIZ 1QV0A 4PT1A 3S0FA 1B8LA 1CDLA 1A2XA 3DVKA 3NSKA 2Q4UA 4PE0A 2LM5A 2ISDA 3LK1A 1DF0B 3WNXB 2MHHA 1TNQA 2MBXA 1SYMA 5J3XA 1KK7Z 4GUKA 1NWDA 5GQQC 2BE4A 1JC2A 1ALVA 1DJIA 1QS7A 3FE8A 1NUBA 3OGNA 5FI7A 1OQPA 1F4OA 1BU3A 4A4BA 3N7HA
chains in the Genus database with same CATH topology
3M0WA 1M45A 2LNKA 1VRKA 1JUOA 2LVIA 5DKRA 2ZFDA 1KQMC 1K95A 1YUUA 3CR2A 1B8RA 3BOWB 4MZJA 4P2YB 2P6BB 2KGBC 2KI6C 1WY9A 5F6TA 5PALA 2DOQA 1JWDA 1S3PA 2FCEA 2KBIA 1A29A 3BXKA 3PALA 5G08A 1RTP1 4N5XA 2BCAA 1G8IA 3LL8B 4XJKA 1NX2A 1G4YR 3AKBA 4YRUA 3PN7B 2AMIA 2MLEC 2RGIA 3SG3A 3FS7A 2OS8B 2E30A 2HPSA 3KHEA 1M39A 3CS1A 3DVEA 2MJWB 2BL0C 1DJWA 1Y1UA 1PVAA 2K7DA 2MA2A 4YGDB 2LP2A 4A4CA 2EGDA 1KFUS 5HYDA 2KAXA 3VRNA 4HSZA 4YGAA 3VROA 4L9MA 2GV5A 3O6BA 2LANA 1ALWA 4PDZA 1NPQA 2Y4QA 2F3ZA 2MLFC 3H4SE 2COLB 3I5HB 1IKUA 3TUYC 4WQ3A 1DGVA 2JQ6A 2KYFA 5HKWA 4CFQA 4TNCA 1AP4A 1N65A 4MRYA 1BG1A 1HT9A 2BBNA 2KBMA 1AJ4A 4AOMA 1UHNA 5KU1A 2IS9A 1JSAA 1X02A 1XFWO 2KQ6A 1WRLA 1YR5A 4I5LB 3VRPA 2K8MB 3SG2A 1MHOA 2LV7A 1LINA 3VGOA 3ICBA 1CLMA 5JOLA 4ORCB 3LK0A 2L0PA 1YUSA 4MRXA 1K2HA 1GGWA 1DVIA 1RROA 1NP8A 1CLLA 1NSHA 2M97A 5ER5A 1IJ5A 5AEQA 2JU0A 2I94A 2F3YA 1NCZA 4FTGA 2M8UA 3AKAA 1UHHA 1TNWA 1SCVA 1IG5A 1SR6B 3I5IC 1A75B 3OX6A 1UUSA 1IQ5A 1DGUA 4DS7A 1DT7B 1A4PA 1L2OB 1UHIA 1S6JA 4C0KA 1YRUB 4NDBA 3DD4A 2WCFA 2G2BA 2KYCA 1CFDA 1F4QA 5AFPA 1SCMB 1SPYA 2BL0B 3TDIA 2LVVA 2D8NA 3SJSA 1CMGA 1DF0A 5I2QA 4PCWA 1MF8B 4M2OA 2AAOA 2AUCA 2BCBA 1UHKA 1W7IB 1GJYA 3BYAA 1YTZC 2H61C 3LLEA 1S5GY 3TUYB 2ZN9A 2K0JA 1MXLC 1WDCC 2Y1NA 2ZNDA 4MLWA 3SIBA 1B9AA 3PSRA 3TDUA 2BE6A 2KAVA 1QXPA 1XFZO 3I5FC 1OMVA 1KSMA 4CLNA 3F45A 2M7LA 3CLNA 4HRHA 1GQMA 1NX0A 4MZLA 1OE9B 1R6PA 5HLOA 4CPVA 2PMYA 1BOCA 4DUQA 1B1GA 2JNFA 1QASA 2KHNA 1F55A 2E6WA 2F8PA 1J7OA 4I5NB 1S1EA 1SKTA 4YGEB 4ORAB 2FJUB 3BQ3A 3I5IB 2MAZA 1NCXA 4FQOA 2JXLA 2KI4B 1OMRA 1K93D 3HX4A 4YBHB 4PHNA 2CT9A 3DF0B 4I5KA 2QPTA 3EKJA 5CPVA 1XO5A 2LMTA 4DRWA 1PULA 2GGZA 1PSRA 1TNXA 3HCMA 1XK4C 3ZWHA 4GFTA 1XVJA 2G9BA 2KGRA 4OKHA 3WHUB 1EG4A 2KQYA 3PLFB 3SG6A 1XFXO 2WC8A 3K21A 3CZTX 1C7WA 1QJTA 2L2EA 3KO0A 2JRFA 2L51A 1G33A 2O5GA 3GK4X 4JPZB 3SG5A 1QLSA 2K7OA 1C07A 1BODA 4AQJA 1SR6C 3RM1A 2LUXA 1IGVA 3I5GC 1WDCB 1L2OC 1NX3A 2BKHB 4P5OE 5CSNA 1H4BA 5JJGA 2PASA 1D1OA 1LA0A 2NXQA 3TZ1A 1SCMC 2JTZA 3I5FB 3D0YB 4YI9A 1J7QA 1B47A 1NX1A 3EVRA 1DTLA 2SASA 2SCPA 2CTNA 1K8UA 1BJFA 3SG7A 1K9UA 2M1KB 1TIZA 3IQOA 1BR4B 1OOJA 2LUCA 1LXFC 3FWBA 4DIRA 1AK8A 1S6IA 2F2OA 2VRGA 2LCPA 1QV1A 1KWOB 5KTYA 1F8HA 2PRUA 4N1GA 2CNPA 2HETA 1Y6WA 1U5IB 2M49B 2OTGC 4XYNA 4D1EA 1LA3A 3BUOB 1XFUO 2CXJA 2BKIB 2ZKMX 3KPXA 1L7ZA 4DCKA 2ZRTA 4PHMA 1YRTB 1OSAA 2I7AA 4CFRA 1KSOA 1CLBA 3SG4A 4GNKB 1R2UA 1EL4A 1J1EA 1UWOA 1Y1XA 2LLTA 2NCPA 2WOSA 1EH2A 3A8RA 1YX7A 1M46A 1KQVA 2JOJA 1TNPA 3O4YA 2KOTA 1BR1B 2L4IA 2JTTA 4NDDA 3NSOA 1PK0D 1B7TY 1MXEA 2K2AA 2M0RA 2KI4C 1ZFSA 2QACA 3I5GB 1YUTA 4GGFC 4JQ0D 1SRAA 4MBEA 5CSFA 3CGAA 2JT8A 1PRWA 4AQIA 4XJKB 1RECA 1TOPA 3DVJA 2KSPA 3EVUA 5CSIA 5KSZA 2FCDA 2JXCA 3FIAA 2LP3A 2GGMA 1CM1A 1CTRA 3JVTC 1J55A 1YURA 3ZNIA 2KFFA 1DJGA 4R1EA 2LVJA 4M2PA 1SL8A 1EG3A 3EKHA 2I2RE 3IQQA 4PHKA 4C0JA 5ER4X 1CM4A 3DF0A 2KFGA 1SBJA 2EHBA 1HQVA 1QIVA 1JFKA 1TCOB 1CDPA 2NZ0A 1Y1AA 3AAKA 1KFXL 3OP0A 2JNXA 2BCXA 1IQ3A 1SL7A 2OPOA 1FPWA 2OTGB 1LKJA 3BOWA 4WQ2A 1RWYA 1XYDA 3CTNA 2KDHA 3CR5X 4BY4A 4I5JA 1CDMA 3EK7A 4YI8A 1J7PA 3GK2A 2CBLA 1BLQA 2H61A 2Y5IA 3NSIA 3AAJA 4U8DA 1XA5A 4F0ZB 4MSPA 5I2OA 1S5GZ 4QJ4B 3EK4A 4MEWA 5HLVA 1OZOA 1V1GA 4ICBA 1MR8A 3NXAA 4USLA 1DMOA 1KWOC 2JZIA 4BY5A 4E68A 1QX2A 1QVIY 2WORA 1QX5B 2K7BA 3JTDC 3CR4X 3EVVA 1S6CA 1KK7Y 2KI6D 4MVFA 1W7JB 2LAPA 2K2FA 4WRIA 2LMVA 3PATA 1B8CA 3PFVA 1RJVA 1YX8A 3IF7A 4MN0A 1WRKA 1QLKA 3EK8A 3JVTB 1CDNA 1FI5A 1IRJA 1ZOTB 1QATA 1DJZA 4ETOA 5IBWA 4HRGA 2BECA 1SW8A 4UPGA 1C7VA 1BF5A 1AVSA 2K7CA 5HKZA 4YGBB 2Y1MA 4GPLB 2PVBA 2JT3A 1TRFA 3PM8A 3WXAA 3KF9A 1QX7A 5D7FA 1QTXA 1CFPA 3BUNB 1SMGA 2Q91A 1H8BA 2LHLA 5DKQA 1XK4A 1E8AA 4OR9B 2EC6C 4C0LA 1F54A 1TTXA 3TS5C 1JF2A 1K90D 1LVCD 2L98A 2L4HA 1KK8B 2FOTA 3LCPC 4JWQA 1MUXA 4YGCB 1Q80A 4PHJA 1A75A 5FYXA 5AXIA 1CB1A 5I8NA 1M63B 5I2LA 1K9KA 2B1UA 3D10A 4OV2A 1V1FA 1CFFA 1CNPA 1SY9A 2NLNA 4PE4A 4GAOA 2LVKA 1CMFA 5HKYA 1FI6A 1YVLA 3A4UB 3GOFA 2KNEA 2LHIA 1S26D 4ZCUA 1KFUL 4PE1A 1EXRA 3E3RA 3JTDB 1RK9A 4NQGA 3O2PA 4OCIA 2V53A 2KFHA 1JFJA 2ZNEA 3CWGA 1ODBA 2LE9B 3QRXA 1FW4A 2M9GA 2I18A 1TCFA 2BBMA 2L5XB 1GGZA 3TDZA 2R2IA 4N1FA 1M31A 1A03A 2JC2A 5B8IB 1SK6D 3BUMB 2F2PA 5BPJA 2LC5A 4GBAA 1PSBA 2ZRSA 1SNLA 2M29A 2M3WA 3DVMA 3OHMB 5K89A 2TN4A 1IWQA 1CFCA 2CCMA 2O60A 2WCEA 1XFVO 1NYAA 1IJ6A 1J7RA 2EC6B 2LMUA 1N2DA 4MZKA 1MQ1A 4QJ3B 3SIAA 1PALA 3TS5B 2L50A 5D69A 1KQMB 1YVHA 2JPTA 1ZACA 3RLZA 1DJHA 2PALA 1UP5A 4ORBB 4IL1A 4Q04A 1OZSA 5CSJA 1SL9A 1OMDA 4GGFA 1K9PA 2JULA 1JBAA 1B7TZ 1EJ3A 1DJXA 1DJYA 2HQ8A 2PSRA 2M1UA 4QJ5B 2F33A 4NDCA 5DKNA 3FWCA 3OX5A 3WHTB 2MRDA 2M7NA 1WRZA 2NCOA 4ZCVA 3VRQA 4M2QA 4GGNA 1BMOA 1QIWA 2KAYA 1ZUZA 3O78A 1KFXS 1NCYA 1RFJA 2A4JA 1MWNA 3BUXB 4PALA 1TN4A 1KK8C 3KEVA 4PE7A 4CIDA 1J1DA 1JF0A 1PVBA 2LLUA 3VRRA 3NSLA 3MSEB 2K61A 5AANA 1CKKA 1F71A 1ZMZA 3OB2B 4OVNF 1BT6A 1K96A 2WCBA 3PN7C 1KCYA 2HQWA 1FF1A 2ZN8A 5TNCA 3D0YA 5AERA 1UHJA 2HF5A 1S36A 2OS8C 2JT0A 1NIWA 2H2KA 2JWWA 3C1VA 3GK1A 1IH0A 1AHRA 1XFYO 3OB1B 1F70A 2WNDA 1N0YA 1UURA 1AUIB 1WLZA 1WLMA 3BUWB 1FBVA 4HREE 1Y0VH 1B4CA 2LLSA 1K94A 1AJ5A 1U5IA 3I5HC 1QVIZ 1QV0A 1B8LA 1CDLA 1A2XA 3DVKA 3NSKA 2Q4UA 4PE0A 2LM5A 2ISDA 3LK1A 1DF0B 3WNXB 2MHHA 1TNQA 2MBXA 1SYMA 5J3XA 1KK7Z 4GUKA 1NWDA 5GQQC 2BE4A 1JC2A 1ALVA 1DJIA 1QS7A 1NUBA 1OQPA 1F4OA 1BU3A 4A4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0W A;  1M45 A;  2LNK A;  1VRK A;  1JUO A;  2LVI A;  5DKR A;  2ZFD A;  1KQM C;  1K95 A;  1YUU A;  3CR2 A;  1B8R A;  3BOW B;  4MZJ A;  4P2Y B;  2P6B B;  2KGB C;  2KI6 C;  1WY9 A;  5F6T A;  5PAL A;  2DOQ A;  1JWD A;  1S3P A;  2FCE A;  2KBI A;  1A29 A;  3BXK A;  3PAL A;  5G08 A;  1RTP 1;  4N5X A;  2BCA A;  1G8I A;  3LL8 B;  4XJK A;  1NX2 A;  1G4Y R;  3AKB A;  4YRU A;  3PN7 B;  2AMI A;  2MLE C;  2RGI A;  3SG3 A;  3FS7 A;  2OS8 B;  2E30 A;  2HPS A;  3KHE A;  1M39 A;  3CS1 A;  3DVE A;  2MJW B;  2BL0 C;  1DJW A;  1Y1U A;  1PVA A;  2K7D A;  2MA2 A;  4YGD B;  2LP2 A;  4A4C A;  2EGD A;  1KFU S;  5HYD A;  2KAX A;  3VRN A;  4HSZ A;  4YGA A;  3VRO A;  4L9M A;  2GV5 A;  3O6B A;  2LAN A;  1ALW A;  4PDZ A;  1NPQ A;  2Y4Q A;  2F3Z A;  2MLF C;  3H4S E;  2COL B;  3I5H B;  1IKU A;  3TUY C;  4WQ3 A;  1DGV A;  2JQ6 A;  2KYF A;  5HKW A;  4CFQ A;  4TNC A;  1AP4 A;  1N65 A;  4MRY A;  1BG1 A;  1HT9 A;  2BBN A;  2KBM A;  1AJ4 A;  4AOM A;  1UHN A;  5KU1 A;  2IS9 A;  1JSA A;  1X02 A;  1XFW O;  2KQ6 A;  1WRL A;  1YR5 A;  4I5L B;  3VRP A;  2K8M B;  3SG2 A;  1MHO A;  2LV7 A;  1LIN A;  3VGO A;  3ICB A;  1CLM A;  5JOL A;  4ORC B;  3LK0 A;  2L0P A;  1YUS A;  4MRX A;  1K2H A;  1GGW A;  1DVI A;  1RRO A;  1NP8 A;  1CLL A;  1NSH A;  2M97 A;  5ER5 A;  1IJ5 A;  5AEQ A;  2JU0 A;  2I94 A;  2F3Y A;  1NCZ A;  4FTG A;  2M8U A;  3AKA A;  1UHH A;  1TNW A;  1SCV A;  1IG5 A;  1SR6 B;  3I5I C;  1A75 B;  3OX6 A;  1UUS A;  1IQ5 A;  1DGU A;  4DS7 A;  1DT7 B;  1A4P A;  1L2O B;  1UHI A;  1S6J A;  4C0K A;  1YRU B;  4NDB A;  3DD4 A;  2WCF A;  2G2B A;  2KYC A;  1CFD A;  1F4Q A;  5AFP A;  1SCM B;  1SPY A;  2BL0 B;  3TDI A;  2LVV A;  2D8N A;  3SJS A;  1CMG A;  1DF0 A;  5I2Q A;  4PCW A;  1MF8 B;  4M2O A;  2AAO A;  2AUC A;  2BCB A;  1UHK A;  1W7I B;  1GJY A;  3BYA A;  1YTZ C;  2H61 C;  3LLE A;  1S5G Y;  3TUY B;  2ZN9 A;  2K0J A;  1MXL C;  1WDC C;  2Y1N A;  2ZND A;  4MLW A;  3SIB A;  1B9A A;  3PSR A;  3TDU A;  2BE6 A;  2KAV A;  1QXP A;  1XFZ O;  3I5F C;  1OMV A;  1KSM A;  4CLN A;  3F45 A;  2M7L A;  3CLN A;  4HRH A;  1GQM A;  1NX0 A;  4MZL A;  1OE9 B;  1R6P A;  5HLO A;  4CPV A;  2PMY A;  1BOC A;  4DUQ A;  1B1G A;  2JNF A;  1QAS A;  2KHN A;  1F55 A;  2E6W A;  2F8P A;  1J7O A;  4I5N B;  1S1E A;  1SKT A;  4YGE B;  4ORA B;  2FJU B;  3BQ3 A;  3I5I B;  2MAZ A;  1NCX A;  4FQO A;  2JXL A;  2KI4 B;  1OMR A;  1K93 D;  3HX4 A;  4YBH B;  4PHN A;  2CT9 A;  3DF0 B;  4I5K A;  2QPT A;  3EKJ A;  5CPV A;  1XO5 A;  2LMT A;  4DRW A;  1PUL A;  2GGZ A;  1PSR A;  1TNX A;  3HCM A;  1XK4 C;  3ZWH A;  4GFT A;  1XVJ A;  2G9B A;  2KGR A;  4OKH A;  3WHU B;  1EG4 A;  2KQY A;  3PLF B;  3SG6 A;  1XFX O;  2WC8 A;  3K21 A;  3CZT X;  1C7W A;  1QJT A;  2L2E A;  3KO0 A;  2JRF A;  2L51 A;  1G33 A;  2O5G A;  3GK4 X;  4JPZ B;  3SG5 A;  1QLS A;  2K7O A;  1C07 A;  1BOD A;  4AQJ A;  1SR6 C;  3RM1 A;  2LUX A;  1IGV A;  3I5G C;  1WDC B;  1L2O C;  1NX3 A;  2BKH B;  4P5O E;  5CSN A;  1H4B A;  5JJG A;  2PAS A;  1D1O A;  1LA0 A;  2NXQ A;  3TZ1 A;  1SCM C;  2JTZ A;  3I5F B;  3D0Y B;  4YI9 A;  1J7Q A;  1B47 A;  1NX1 A;  3EVR A;  1DTL A;  2SAS A;  2SCP A;  2CTN A;  1K8U A;  1BJF A;  3SG7 A;  1K9U A;  2M1K B;  1TIZ A;  3IQO A;  1BR4 B;  1OOJ A;  2LUC A;  1LXF C;  3FWB A;  4DIR A;  1AK8 A;  1S6I A;  2F2O A;  2VRG A;  2LCP A;  1QV1 A;  1KWO B;  5KTY A;  1F8H A;  2PRU A;  4N1G A;  2CNP A;  2HET A;  1Y6W A;  1U5I B;  2M49 B;  2OTG C;  4XYN A;  4D1E A;  1LA3 A;  3BUO B;  1XFU O;  2CXJ A;  2BKI B;  2ZKM X;  3KPX A;  1L7Z A;  4DCK A;  2ZRT A;  4PHM A;  1YRT B;  1OSA A;  2I7A A;  4CFR A;  1KSO A;  1CLB A;  3SG4 A;  4GNK B;  1R2U A;  1EL4 A;  1J1E A;  1UWO A;  1Y1X A;  2LLT A;  2NCP A;  2WOS A;  1EH2 A;  3A8R A;  1YX7 A;  1M46 A;  1KQV A;  2JOJ A;  1TNP A;  3O4Y A;  2KOT A;  1BR1 B;  2L4I A;  2JTT A;  4NDD A;  3NSO A;  1PK0 D;  1B7T Y;  1MXE A;  2K2A A;  2M0R A;  2KI4 C;  1ZFS A;  2QAC A;  3I5G B;  1YUT A;  4GGF C;  4JQ0 D;  1SRA A;  4MBE A;  5CSF A;  3CGA A;  2JT8 A;  1PRW A;  4AQI A;  4XJK B;  1REC A;  1TOP A;  3DVJ A;  2KSP A;  3EVU A;  5CSI A;  5KSZ A;  2FCD A;  2JXC A;  3FIA A;  2LP3 A;  2GGM A;  1CM1 A;  1CTR A;  3JVT C;  1J55 A;  1YUR A;  3ZNI A;  2KFF A;  1DJG A;  4R1E A;  2LVJ A;  4M2P A;  1SL8 A;  1EG3 A;  3EKH A;  2I2R E;  3IQQ A;  4PHK A;  4C0J A;  5ER4 X;  1CM4 A;  3DF0 A;  2KFG A;  1SBJ A;  2EHB A;  1HQV A;  1QIV A;  1JFK A;  1TCO B;  1CDP A;  2NZ0 A;  1Y1A A;  3AAK A;  1KFX L;  3OP0 A;  2JNX A;  2BCX A;  1IQ3 A;  1SL7 A;  2OPO A;  1FPW A;  2OTG B;  1LKJ A;  3BOW A;  4WQ2 A;  1RWY A;  1XYD A;  3CTN A;  2KDH A;  3CR5 X;  4BY4 A;  4I5J A;  1CDM A;  3EK7 A;  4YI8 A;  1J7P A;  3GK2 A;  2CBL A;  1BLQ A;  2H61 A;  2Y5I A;  3NSI A;  3AAJ A;  4U8D A;  1XA5 A;  4F0Z B;  4MSP A;  5I2O A;  1S5G Z;  4QJ4 B;  3EK4 A;  4MEW A;  5HLV A;  1OZO A;  1V1G A;  4ICB A;  1MR8 A;  3NXA A;  4USL A;  1DMO A;  1KWO C;  2JZI A;  4BY5 A;  4E68 A;  1QX2 A;  1QVI Y;  2WOR A;  1QX5 B;  2K7B A;  3JTD C;  3CR4 X;  3EVV A;  1S6C A;  1KK7 Y;  2KI6 D;  4MVF A;  1W7J B;  2LAP A;  2K2F A;  4WRI A;  2LMV A;  3PAT A;  1B8C A;  3PFV A;  1RJV A;  1YX8 A;  3IF7 A;  4MN0 A;  1WRK A;  1QLK A;  3EK8 A;  3JVT B;  1CDN A;  1FI5 A;  1IRJ A;  1ZOT B;  1QAT A;  1DJZ A;  4ETO A;  5IBW A;  4HRG A;  2BEC A;  1SW8 A;  4UPG A;  1C7V A;  1BF5 A;  1AVS A;  2K7C A;  5HKZ A;  4YGB B;  2Y1M A;  4GPL B;  2PVB A;  2JT3 A;  1TRF A;  3PM8 A;  3WXA A;  3KF9 A;  1QX7 A;  5D7F A;  1QTX A;  1CFP A;  3BUN B;  1SMG A;  2Q91 A;  1H8B A;  2LHL A;  5DKQ A;  1XK4 A;  1E8A A;  4OR9 B;  2EC6 C;  4C0L A;  1F54 A;  1TTX A;  3TS5 C;  1JF2 A;  1K90 D;  1LVC D;  2L98 A;  2L4H A;  1KK8 B;  2FOT A;  3LCP C;  4JWQ A;  1MUX A;  4YGC B;  1Q80 A;  4PHJ A;  1A75 A;  5FYX A;  5AXI A;  1CB1 A;  5I8N A;  1M63 B;  5I2L A;  1K9K A;  2B1U A;  3D10 A;  4OV2 A;  1V1F A;  1CFF A;  1CNP A;  1SY9 A;  2NLN A;  4PE4 A;  4GAO A;  2LVK A;  1CMF A;  5HKY A;  1FI6 A;  1YVL A;  3A4U B;  3GOF A;  2KNE A;  2LHI A;  1S26 D;  4ZCU A;  1KFU L;  4PE1 A;  1EXR A;  3E3R A;  3JTD B;  1RK9 A;  4NQG A;  3O2P A;  4OCI A;  2V53 A;  2KFH A;  1JFJ A;  2ZNE A;  3CWG A;  1ODB A;  2LE9 B;  3QRX A;  1FW4 A;  2M9G A;  2I18 A;  1TCF A;  2BBM A;  2L5X B;  1GGZ A;  3TDZ A;  2R2I A;  4N1F A;  1M31 A;  1A03 A;  2JC2 A;  5B8I B;  1SK6 D;  3BUM B;  2F2P A;  5BPJ A;  2LC5 A;  4GBA A;  1PSB A;  2ZRS A;  1SNL A;  2M29 A;  2M3W A;  3DVM A;  3OHM B;  5K89 A;  2TN4 A;  1IWQ A;  1CFC A;  2CCM A;  2O60 A;  2WCE A;  1XFV O;  1NYA A;  1IJ6 A;  1J7R A;  2EC6 B;  2LMU A;  1N2D A;  4MZK A;  1MQ1 A;  4QJ3 B;  3SIA A;  1PAL A;  3TS5 B;  2L50 A;  5D69 A;  1KQM B;  1YVH A;  2JPT A;  1ZAC A;  3RLZ A;  1DJH A;  2PAL A;  1UP5 A;  4ORB B;  4IL1 A;  4Q04 A;  1OZS A;  5CSJ A;  1SL9 A;  1OMD A;  4GGF A;  1K9P A;  2JUL A;  1JBA A;  1B7T Z;  1EJ3 A;  1DJX A;  1DJY A;  2HQ8 A;  2PSR A;  2M1U A;  4QJ5 B;  2F33 A;  4NDC A;  5DKN A;  3FWC A;  3OX5 A;  3WHT B;  2MRD A;  2M7N A;  1WRZ A;  2NCO A;  4ZCV A;  3VRQ A;  4M2Q A;  4GGN A;  1BMO A;  1QIW A;  2KAY A;  1ZUZ A;  3O78 A;  1KFX S;  1NCY A;  1RFJ A;  2A4J A;  1MWN A;  3BUX B;  4PAL A;  1TN4 A;  1KK8 C;  3KEV A;  4PE7 A;  4CID A;  1J1D A;  1JF0 A;  1PVB A;  2LLU A;  3VRR A;  3NSL A;  3MSE B;  2K61 A;  5AAN A;  1CKK A;  1F71 A;  1ZMZ A;  3OB2 B;  4OVN F;  1BT6 A;  1K96 A;  2WCB A;  3PN7 C;  1KCY A;  2HQW A;  1FF1 A;  2ZN8 A;  5TNC A;  3D0Y A;  5AER A;  1UHJ A;  2HF5 A;  1S36 A;  2OS8 C;  2JT0 A;  1NIW A;  2H2K A;  2JWW A;  3C1V A;  3GK1 A;  1IH0 A;  1AHR A;  1XFY O;  3OB1 B;  1F70 A;  2WND A;  1N0Y A;  1UUR A;  1AUI B;  1WLZ A;  1WLM A;  3BUW B;  1FBV A;  4HRE E;  1Y0V H;  1B4C A;  2LLS A;  1K94 A;  1AJ5 A;  1U5I A;  3I5H C;  1QVI Z;  1QV0 A;  1B8L A;  1CDL A;  1A2X A;  3DVK A;  3NSK A;  2Q4U A;  4PE0 A;  2LM5 A;  2ISD A;  3LK1 A;  1DF0 B;  3WNX B;  2MHH A;  1TNQ A;  2MBX A;  1SYM A;  5J3X A;  1KK7 Z;  4GUK A;  1NWD A;  5GQQ C;  2BE4 A;  1JC2 A;  1ALV A;  1DJI A;  1QS7 A;  1NUB A;  1OQP A;  1F4O A;  1BU3 A;  4A4B A; 
#chains in the Genus database with same CATH topology
 3M0W A;  1M45 A;  2LNK A;  1VRK A;  3SS4 A;  1JUO A;  2LVI A;  3PM2 A;  1LS8 A;  5DKR A;  3D74 A;  2ZFD A;  1KQM C;  1K95 A;  1YUU A;  3CR2 A;  1B8R A;  3BOW B;  4MZJ A;  2L2C A;  2P6B B;  4P2Y B;  2KGB C;  2KI6 C;  1WY9 A;  5F6T A;  5PAL A;  3S0G A;  2DOQ A;  2WCL A;  1JWD A;  1S3P A;  2FCE A;  2KBI A;  1A29 A;  3BXK A;  3PAL A;  5G08 A;  1RTP 1;  4N5X A;  2BCA A;  1G8I A;  3B86 A;  3LL8 B;  4XJK A;  1NX2 A;  3RZS A;  1G4Y R;  3AKB A;  4YRU A;  3PN7 B;  2AMI A;  2MLE C;  2RGI A;  3SG3 A;  3FS7 A;  2OS8 B;  2E30 A;  2HPS A;  3QME A;  3KHE A;  1M39 A;  3CS1 A;  3DVE A;  2MJW B;  2BL0 C;  1XFR A;  1DJW A;  1Y1U A;  1PVA A;  2K7D A;  1DEK A;  2MA2 A;  4YGD B;  2LP2 A;  4A4C A;  2EGD A;  1KFU S;  4JKT A;  5HYD A;  2KAX A;  3VRN A;  4HSZ A;  2P71 A;  4YGA A;  3VRO A;  4L9M A;  2GV5 A;  3O6B A;  2LAN A;  3BFH A;  1ALW A;  4PDZ A;  1NPQ A;  1OW4 A;  2Y4Q A;  2F3Z A;  2MLF C;  3H4S E;  2COL B;  3I5H B;  1IKU A;  1OOG A;  4WQ3 A;  1DGV A;  2JQ6 A;  2KYF A;  5HKW A;  4CFQ A;  3TUY C;  4TNC A;  1AP4 A;  1N65 A;  2QEV A;  4MRY A;  1BG1 A;  1HT9 A;  2BBN A;  2KBM A;  1AJ4 A;  2PQL A;  4AOM A;  1UHN A;  5KU1 A;  2IS9 A;  1JSA A;  1X02 A;  1XFW O;  2KQ6 A;  1WRL A;  1YR5 A;  4I5L B;  1OOF A;  3VRP A;  3L4L A;  3R72 A;  2K8M B;  3SG2 A;  1MHO A;  2LV7 A;  1LIN A;  4KYN A;  3ICB A;  3VGO A;  1CLM A;  5JOL A;  4ORC B;  2GTE A;  3LK0 A;  2L0P A;  1YUS A;  4MRX A;  1K2H A;  1GGW A;  1DVI A;  1RRO A;  1NP8 A;  1CLL A;  1NSH A;  2M97 A;  5ER5 A;  1IJ5 A;  5AEQ A;  2JU0 A;  2I94 A;  2F3Y A;  2QDI A;  1NCZ A;  4FTG A;  3B6X A;  2M8U A;  4IJ7 A;  3AKA A;  1UHH A;  1TNW A;  1SCV A;  1IG5 A;  1SR6 B;  3I5I C;  1A75 B;  3OX6 A;  1UUS A;  1IQ5 A;  1DGU A;  2ERB A;  4DS7 A;  1DT7 B;  1A4P A;  1L2O B;  1UHI A;  1S6J A;  3K1E A;  4C0K A;  1YRU B;  4NDB A;  3DD4 A;  2WCF A;  1OOH A;  2G2B A;  2KYC A;  1CFD A;  1F4Q A;  5AFP A;  1SCM B;  1C3Y A;  1SPY A;  2BL0 B;  3TDI A;  2LVV A;  2D8N A;  3NHI A;  3SJS A;  1CMG A;  1DF0 A;  2KLE A;  5I2Q A;  4PCW A;  1MF8 B;  4M2O A;  2AAO A;  2AUC A;  2BCB A;  1UHK A;  1W7I B;  1GJY A;  5DIC A;  3BYA A;  1YTZ C;  2H61 C;  3LLE A;  1S5G Y;  3TUY B;  2ZN9 A;  2K0J A;  1MXL C;  1WDC C;  2Y1N A;  2ZND A;  4MLW A;  3SIB A;  1B9A A;  3PSR A;  3TDU A;  3S0A A;  2BE6 A;  2BNX A;  2KAV A;  1QXP A;  1XFZ O;  3I5F C;  1OMV A;  1KSM A;  4CLN A;  3F45 A;  2M7L A;  3NGV A;  3CLN A;  4HRH A;  1GQM A;  1NX0 A;  4MZL A;  1OE9 B;  1R6P A;  5HLO A;  4CPV A;  2PMY A;  1BOC A;  4DUQ A;  1B1G A;  3R1V A;  2JNF A;  3D77 A;  1QAS A;  2KHN A;  3SS3 A;  2E6W A;  2F8P A;  1F55 A;  1J7O A;  4I5N B;  1S1E A;  1P28 A;  1IIO A;  1SKT A;  4YGE B;  4ORA B;  2FJU B;  3BQ3 A;  3I5I B;  2MAZ A;  1NCX A;  3EG5 B;  4FQO A;  2JXL A;  2KI4 B;  1OMR A;  1K93 D;  3HX4 A;  4YBH B;  4PHN A;  2CT9 A;  3DF0 B;  4I5K A;  3L47 A;  2QPT A;  3BFA A;  3EKJ A;  1XO5 A;  2LMT A;  5CPV A;  4DRW A;  1DQE A;  1PUL A;  2GGZ A;  1PSR A;  1TNX A;  3HCM A;  1XK4 C;  3ZWH A;  4GFT A;  1XVJ A;  2G9B A;  2KGR A;  2BAP A;  4OKH A;  3WHU B;  1EG4 A;  2KQY A;  3PLF B;  3SG6 A;  1XFX O;  2WC8 A;  3K21 A;  3S0B A;  3CZT X;  1C7W A;  2WC6 A;  1QJT A;  2L2E A;  3KO0 A;  2JRF A;  2L51 A;  1G33 A;  2O5G A;  3GK4 X;  4JPZ B;  3SG5 A;  1QLS A;  2K7O A;  1C07 A;  1BOD A;  4AQJ A;  1SR6 C;  3RM1 A;  2LUX A;  1IGV A;  3I5G C;  1WDC B;  2WCM A;  1L2O C;  1NX3 A;  2BKH B;  4P5O E;  5CSN A;  1H4B A;  5JJG A;  2PAS A;  1D1O A;  1LA0 A;  2NXQ A;  3TZ1 A;  1SCM C;  2JTZ A;  3I5F B;  3D0Y B;  4YI9 A;  1J7Q A;  1Z4H A;  1B47 A;  1NX1 A;  3EVR A;  1DTL A;  2SAS A;  2SCP A;  3VB1 A;  2CTN A;  3V2L A;  1K8U A;  1BJF A;  3SG7 A;  1K9U A;  2M1K B;  1TIZ A;  3R1O A;  3IQO A;  1BR4 B;  1OOJ A;  2LUC A;  1LXF C;  3FWB A;  4DIR A;  1AK8 A;  1S6I A;  2F2O A;  2QEO A;  2LCP A;  2VRG A;  4JD9 A;  1QV1 A;  1KWO B;  5KTY A;  1F8H A;  2PRU A;  4N1G A;  2CNP A;  2HET A;  1Y6W A;  1U5I B;  2M49 B;  2OTG C;  1SSE B;  4XYN A;  4D1E A;  1LA3 A;  3BUO B;  1TWO A;  1XFU O;  2CXJ A;  2BKI B;  2ZKM X;  3KPX A;  1L7Z A;  4DCK A;  2ZRT A;  3L4A A;  4PHM A;  1YRT B;  1OSA A;  2I7A A;  4CFR A;  1KSO A;  1CLB A;  3SG4 A;  3FE6 A;  4GNK B;  1R2U A;  1EL4 A;  4FQT A;  1J1E A;  1UWO A;  1Y1X A;  2LLT A;  2NCP A;  2WOS A;  1EH2 A;  3A8R A;  1YX7 A;  1M46 A;  1TUZ A;  1KQV A;  2JOJ A;  1TNP A;  3O4Y A;  2KOT A;  1BR1 B;  2L4I A;  2JTT A;  4NDD A;  3NSO A;  1PK0 D;  1B7T Y;  1MXE A;  2K2A A;  2M0R A;  2KI4 C;  1ZFS A;  2QAC A;  3I5G B;  1YUT A;  4GGF C;  4JQ0 D;  1SRA A;  4MBE A;  5CSF A;  3CGA A;  5D3O A;  2JT8 A;  1PRW A;  4AQI A;  4XJK B;  1REC A;  1TOP A;  3DVJ A;  2KSP A;  3EVU A;  5CSI A;  5KSZ A;  2FCD A;  2JXC A;  3FIA A;  2LP3 A;  2GGM A;  1CM1 A;  1CTR A;  3JVT C;  1J55 A;  1YUR A;  3FE9 A;  3ZNI A;  2KFF A;  1DJG A;  3BJH A;  4R1E A;  2LVJ A;  4M2P A;  1OOI X;  1SL8 A;  1EG3 A;  3EKH A;  2I2R E;  3IQQ A;  4PHK A;  4C0J A;  2JPO A;  5ER4 X;  1CM4 A;  3DF0 A;  2KFG A;  1SBJ A;  2EHB A;  1HQV A;  1QIV A;  1JFK A;  1TCO B;  1CDP A;  2NZ0 A;  1Y1A A;  3AAK A;  1KFX L;  3OP0 A;  2JNX A;  2BCX A;  1IQ3 A;  1SL7 A;  2OPO A;  1FPW A;  2OTG B;  1LKJ A;  5FI6 A;  3BOW A;  4WQ2 A;  1RWY A;  2K60 A;  1XYD A;  3CTN A;  2YGU A;  2KDH A;  3CR5 X;  4BY4 A;  4I5J A;  1CDM A;  3EK7 A;  3PJI A;  4YI8 A;  1J7P A;  1GM0 A;  3GK2 A;  2CBL A;  4F7F A;  2H61 A;  2Y5I A;  3NSI A;  1BLQ A;  3AAJ A;  4U8D A;  1XA5 A;  4F0Z B;  4MSP A;  5I2O A;  1S5G Z;  2WC5 A;  4QJ4 B;  3EK4 A;  4MEW A;  5HLV A;  1OZO A;  1V1G A;  3UNW A;  4ICB A;  1MR8 A;  3NXA A;  4USL A;  1DMO A;  1KWO C;  2JZI A;  4BY5 A;  4E68 A;  3S0D A;  1QX2 A;  1QVI Y;  2WOR A;  1QX5 B;  2K7B A;  3JTD C;  3CR4 X;  3EVV A;  1S6C A;  1ORG A;  1KK7 Y;  2KI6 D;  4MVF A;  1W7J B;  2LAP A;  2K2F A;  1DC1 A;  4WRI A;  2LMV A;  3PAT A;  1B8C A;  3PFV A;  1RJV A;  1YX8 A;  3IF7 A;  4MN0 A;  3S0E A;  1WRK A;  1QLK A;  3EK8 A;  2WCH A;  3JVT B;  1CDN A;  5EL2 A;  1IRJ A;  1FI5 A;  1ZOT B;  1QAT A;  1DJZ A;  4ETO A;  5IBW A;  4HRG A;  2BEC A;  2QEH A;  1SW8 A;  3B88 A;  4UPG A;  1C7V A;  1BF5 A;  3B7A A;  3CYZ A;  1AVS A;  2K7C A;  5HKZ A;  4YGB B;  2Y1M A;  4GPL B;  2PVB A;  2JT3 A;  1TRF A;  2FJY A;  3PM8 A;  3WXA A;  3KF9 A;  1QX7 A;  5D7F A;  1QTX A;  5HL1 A;  1CFP A;  3D75 A;  3BUN B;  1DEL A;  1SMG A;  2Q91 A;  3Q8I A;  2LHL A;  2QEB A;  1XK4 A;  5DKQ A;  1E8A A;  1TUJ A;  1H8B A;  2WCK A;  2EC6 C;  4OR9 B;  4C0L A;  1F54 A;  1TTX A;  3TS5 C;  1JF2 A;  3OBV A;  1K90 D;  4INW A;  1LVC D;  2L98 A;  2L4H A;  1KK8 B;  2FOT A;  3LCP C;  4JWQ A;  1MUX A;  4YGC B;  1Q80 A;  1C3Z A;  4PHJ A;  1A75 A;  5FYX A;  5AXI A;  1CB1 A;  5I8N A;  1M63 B;  5I2L A;  1K9K A;  2B1U A;  3D10 A;  4OV2 A;  1V1F A;  3R1P A;  1CFF A;  1CNP A;  3CZ1 A;  1SY9 A;  2NLN A;  4PE4 A;  4GAO A;  2LVK A;  1CMF A;  5HKY A;  1FI6 A;  1YVL A;  3A4U B;  3GOF A;  2KNE A;  2LHI A;  3B87 A;  1S26 D;  4ZCU A;  1KFU L;  4PE1 A;  3O4X A;  2H8V A;  1EXR A;  3E3R A;  3JTD B;  2WCJ A;  3DZT A;  3CZ0 A;  3CAB A;  1RK9 A;  4NQG A;  3O2P A;  4OCI A;  2V53 A;  2KFH A;  1JFJ A;  2ZNE A;  3CWG A;  1ODB A;  2LE9 B;  3QRX A;  1FW4 A;  3CZ2 A;  1Z2C B;  2M9G A;  2I18 A;  1TCF A;  2BBM A;  2L5X B;  1GGZ A;  3TDZ A;  2R2I A;  4N1F A;  2KLD A;  1M31 A;  1A03 A;  2JC2 A;  5B8I B;  1SK6 D;  3BUM B;  2F2P A;  5BPJ A;  3BFB A;  2LC5 A;  4GBA A;  1PSB A;  2ZRS A;  1SNL A;  2M29 A;  2M3W A;  3DVM A;  3OHM B;  5K89 A;  2TN4 A;  1IWQ A;  1CFC A;  2CCM A;  2O60 A;  2WCE A;  1XFV O;  1NYA A;  1IJ6 A;  1J7R A;  2EC6 B;  2LMU A;  1N2D A;  2L5Y A;  3CDN A;  1MQ1 A;  4MZK A;  4QJ3 B;  3SIA A;  1PAL A;  3TS5 B;  2L50 A;  5D69 A;  1KQM B;  1YVH A;  2JPT A;  1ZAC A;  3RLZ A;  1DJH A;  2PAL A;  3UO9 A;  1UP5 A;  4ORB B;  4IL1 A;  4Q04 A;  1OZS A;  5CSJ A;  1SL9 A;  1OMD A;  4GGF A;  1K9P A;  2JUL A;  1JBA A;  1B7T Z;  1EJ3 A;  3D78 A;  1DJX A;  1DJY A;  2HQ8 A;  2PSR A;  2M1U A;  4QJ5 B;  2F33 A;  4NDC A;  5DKN A;  3FWC A;  3OX5 A;  3WHT B;  2MRD A;  2PYQ A;  4INX A;  2M7N A;  1WRZ A;  2NCO A;  4ZCV A;  3VRQ A;  4M2Q A;  4GGN A;  1BMO A;  1QIW A;  3D73 A;  2KPH A;  3SS5 A;  2KAY A;  1ZUZ A;  3O78 A;  1KFX S;  1NCY A;  1RFJ A;  2A4J A;  1MWN A;  3BUX B;  3DYE A;  4PAL A;  5I94 A;  5FI2 A;  3D76 A;  1TN4 A;  1KK8 C;  3KEV A;  4PE7 A;  4CID A;  2P70 A;  1J1D A;  1W9Z A;  1JF0 A;  1PVB A;  2LLU A;  3VRR A;  3IVT A;  3NSL A;  3MSE B;  2K61 A;  5AAN A;  1CKK A;  1T14 A;  1ZMZ A;  3OB2 B;  1F71 A;  4OVN F;  3DXL A;  1BT6 A;  1K96 A;  2WCB A;  3PN7 C;  1KCY A;  2HQW A;  1FF1 A;  2ZN8 A;  5TNC A;  3D0Y A;  5AER A;  3NHT A;  1UHJ A;  2HF5 A;  1S36 A;  2OS8 C;  2JT0 A;  1NIW A;  2H2K A;  4OZD A;  2JWW A;  3C1V A;  3GK1 A;  1IH0 A;  1AHR A;  1XFY O;  1QWV A;  3OB1 B;  1F70 A;  2WND A;  1N0Y A;  3DY9 A;  1UUR A;  1AUI B;  1WLZ A;  1WLM A;  3BUW B;  1FBV A;  4HRE E;  1Y0V H;  1B4C A;  2LLS A;  1K94 A;  1AJ5 A;  1U5I A;  3I5H C;  1QVI Z;  1QV0 A;  4PT1 A;  3S0F A;  1B8L A;  1CDL A;  1A2X A;  3DVK A;  3NSK A;  2Q4U A;  4PE0 A;  2LM5 A;  2ISD A;  3LK1 A;  1DF0 B;  3WNX B;  2MHH A;  1TNQ A;  2MBX A;  1SYM A;  5J3X A;  1KK7 Z;  4GUK A;  1NWD A;  5GQQ C;  2BE4 A;  1JC2 A;  1ALV A;  1DJI A;  1QS7 A;  3FE8 A;  1NUB A;  3OGN A;  5FI7 A;  1OQP A;  1F4O A;  1BU3 A;  4A4B A;  3N7H A; 
#chains in the Genus database with same CATH homology
 3M0W A;  1M45 A;  2LNK A;  1VRK A;  1JUO A;  2LVI A;  5DKR A;  2ZFD A;  1KQM C;  1K95 A;  1YUU A;  3CR2 A;  1B8R A;  3BOW B;  4MZJ A;  4P2Y B;  2P6B B;  2KGB C;  2KI6 C;  1WY9 A;  5F6T A;  5PAL A;  2DOQ A;  1JWD A;  1S3P A;  2FCE A;  2KBI A;  1A29 A;  3BXK A;  3PAL A;  5G08 A;  1RTP 1;  4N5X A;  2BCA A;  1G8I A;  3LL8 B;  4XJK A;  1NX2 A;  1G4Y R;  3AKB A;  4YRU A;  3PN7 B;  2AMI A;  2MLE C;  2RGI A;  3SG3 A;  3FS7 A;  2OS8 B;  2E30 A;  2HPS A;  3KHE A;  1M39 A;  3CS1 A;  3DVE A;  2MJW B;  2BL0 C;  1DJW A;  1Y1U A;  1PVA A;  2K7D A;  2MA2 A;  4YGD B;  2LP2 A;  4A4C A;  2EGD A;  1KFU S;  5HYD A;  2KAX A;  3VRN A;  4HSZ A;  4YGA A;  3VRO A;  4L9M A;  2GV5 A;  3O6B A;  2LAN A;  1ALW A;  4PDZ A;  1NPQ A;  2Y4Q A;  2F3Z A;  2MLF C;  3H4S E;  2COL B;  3I5H B;  1IKU A;  3TUY C;  4WQ3 A;  1DGV A;  2JQ6 A;  2KYF A;  5HKW A;  4CFQ A;  4TNC A;  1AP4 A;  1N65 A;  4MRY A;  1BG1 A;  1HT9 A;  2BBN A;  2KBM A;  1AJ4 A;  4AOM A;  1UHN A;  5KU1 A;  2IS9 A;  1JSA A;  1X02 A;  1XFW O;  2KQ6 A;  1WRL A;  1YR5 A;  4I5L B;  3VRP A;  2K8M B;  3SG2 A;  1MHO A;  2LV7 A;  1LIN A;  3VGO A;  3ICB A;  1CLM A;  5JOL A;  4ORC B;  3LK0 A;  2L0P A;  1YUS A;  4MRX A;  1K2H A;  1GGW A;  1DVI A;  1RRO A;  1NP8 A;  1CLL A;  1NSH A;  2M97 A;  5ER5 A;  1IJ5 A;  5AEQ A;  2JU0 A;  2I94 A;  2F3Y A;  1NCZ A;  4FTG A;  2M8U A;  3AKA A;  1UHH A;  1TNW A;  1SCV A;  1IG5 A;  1SR6 B;  3I5I C;  1A75 B;  3OX6 A;  1UUS A;  1IQ5 A;  1DGU A;  4DS7 A;  1DT7 B;  1A4P A;  1L2O B;  1UHI A;  1S6J A;  4C0K A;  1YRU B;  4NDB A;  3DD4 A;  2WCF A;  2G2B A;  2KYC A;  1CFD A;  1F4Q A;  5AFP A;  1SCM B;  1SPY A;  2BL0 B;  3TDI A;  2LVV A;  2D8N A;  3SJS A;  1CMG A;  1DF0 A;  5I2Q A;  4PCW A;  1MF8 B;  4M2O A;  2AAO A;  2AUC A;  2BCB A;  1UHK A;  1W7I B;  1GJY A;  3BYA A;  1YTZ C;  2H61 C;  3LLE A;  1S5G Y;  3TUY B;  2ZN9 A;  2K0J A;  1MXL C;  1WDC C;  2Y1N A;  2ZND A;  4MLW A;  3SIB A;  1B9A A;  3PSR A;  3TDU A;  2BE6 A;  2KAV A;  1QXP A;  1XFZ O;  3I5F C;  1OMV A;  1KSM A;  4CLN A;  3F45 A;  2M7L A;  3CLN A;  4HRH A;  1GQM A;  1NX0 A;  4MZL A;  1OE9 B;  1R6P A;  5HLO A;  4CPV A;  2PMY A;  1BOC A;  4DUQ A;  1B1G A;  2JNF A;  1QAS A;  2KHN A;  1F55 A;  2E6W A;  2F8P A;  1J7O A;  4I5N B;  1S1E A;  1SKT A;  4YGE B;  4ORA B;  2FJU B;  3BQ3 A;  3I5I B;  2MAZ A;  1NCX A;  4FQO A;  2JXL A;  2KI4 B;  1OMR A;  1K93 D;  3HX4 A;  4YBH B;  4PHN A;  2CT9 A;  3DF0 B;  4I5K A;  2QPT A;  3EKJ A;  5CPV A;  1XO5 A;  2LMT A;  4DRW A;  1PUL A;  2GGZ A;  1PSR A;  1TNX A;  3HCM A;  1XK4 C;  3ZWH A;  4GFT A;  1XVJ A;  2G9B A;  2KGR A;  4OKH A;  3WHU B;  1EG4 A;  2KQY A;  3PLF B;  3SG6 A;  1XFX O;  2WC8 A;  3K21 A;  3CZT X;  1C7W A;  1QJT A;  2L2E A;  3KO0 A;  2JRF A;  2L51 A;  1G33 A;  2O5G A;  3GK4 X;  4JPZ B;  3SG5 A;  1QLS A;  2K7O A;  1C07 A;  1BOD A;  4AQJ A;  1SR6 C;  3RM1 A;  2LUX A;  1IGV A;  3I5G C;  1WDC B;  1L2O C;  1NX3 A;  2BKH B;  4P5O E;  5CSN A;  1H4B A;  5JJG A;  2PAS A;  1D1O A;  1LA0 A;  2NXQ A;  3TZ1 A;  1SCM C;  2JTZ A;  3I5F B;  3D0Y B;  4YI9 A;  1J7Q A;  1B47 A;  1NX1 A;  3EVR A;  1DTL A;  2SAS A;  2SCP A;  2CTN A;  1K8U A;  1BJF A;  3SG7 A;  1K9U A;  2M1K B;  1TIZ A;  3IQO A;  1BR4 B;  1OOJ A;  2LUC A;  1LXF C;  3FWB A;  4DIR A;  1AK8 A;  1S6I A;  2F2O A;  2VRG A;  2LCP A;  1QV1 A;  1KWO B;  5KTY A;  1F8H A;  2PRU A;  4N1G A;  2CNP A;  2HET A;  1Y6W A;  1U5I B;  2M49 B;  2OTG C;  4XYN A;  4D1E A;  1LA3 A;  3BUO B;  1XFU O;  2CXJ A;  2BKI B;  2ZKM X;  3KPX A;  1L7Z A;  4DCK A;  2ZRT A;  4PHM A;  1YRT B;  1OSA A;  2I7A A;  4CFR A;  1KSO A;  1CLB A;  3SG4 A;  4GNK B;  1R2U A;  1EL4 A;  1J1E A;  1UWO A;  1Y1X A;  2LLT A;  2NCP A;  2WOS A;  1EH2 A;  3A8R A;  1YX7 A;  1M46 A;  1KQV A;  2JOJ A;  1TNP A;  3O4Y A;  2KOT A;  1BR1 B;  2L4I A;  2JTT A;  4NDD A;  3NSO A;  1PK0 D;  1B7T Y;  1MXE A;  2K2A A;  2M0R A;  2KI4 C;  1ZFS A;  2QAC A;  3I5G B;  1YUT A;  4GGF C;  4JQ0 D;  1SRA A;  4MBE A;  5CSF A;  3CGA A;  2JT8 A;  1PRW A;  4AQI A;  4XJK B;  1REC A;  1TOP A;  3DVJ A;  2KSP A;  3EVU A;  5CSI A;  5KSZ A;  2FCD A;  2JXC A;  3FIA A;  2LP3 A;  2GGM A;  1CM1 A;  1CTR A;  3JVT C;  1J55 A;  1YUR A;  3ZNI A;  2KFF A;  1DJG A;  4R1E A;  2LVJ A;  4M2P A;  1SL8 A;  1EG3 A;  3EKH A;  2I2R E;  3IQQ A;  4PHK A;  4C0J A;  5ER4 X;  1CM4 A;  3DF0 A;  2KFG A;  1SBJ A;  2EHB A;  1HQV A;  1QIV A;  1JFK A;  1TCO B;  1CDP A;  2NZ0 A;  1Y1A A;  3AAK A;  1KFX L;  3OP0 A;  2JNX A;  2BCX A;  1IQ3 A;  1SL7 A;  2OPO A;  1FPW A;  2OTG B;  1LKJ A;  3BOW A;  4WQ2 A;  1RWY A;  1XYD A;  3CTN A;  2KDH A;  3CR5 X;  4BY4 A;  4I5J A;  1CDM A;  3EK7 A;  4YI8 A;  1J7P A;  3GK2 A;  2CBL A;  1BLQ A;  2H61 A;  2Y5I A;  3NSI A;  3AAJ A;  4U8D A;  1XA5 A;  4F0Z B;  4MSP A;  5I2O A;  1S5G Z;  4QJ4 B;  3EK4 A;  4MEW A;  5HLV A;  1OZO A;  1V1G A;  4ICB A;  1MR8 A;  3NXA A;  4USL A;  1DMO A;  1KWO C;  2JZI A;  4BY5 A;  4E68 A;  1QX2 A;  1QVI Y;  2WOR A;  1QX5 B;  2K7B A;  3JTD C;  3CR4 X;  3EVV A;  1S6C A;  1KK7 Y;  2KI6 D;  4MVF A;  1W7J B;  2LAP A;  2K2F A;  4WRI A;  2LMV A;  3PAT A;  1B8C A;  3PFV A;  1RJV A;  1YX8 A;  3IF7 A;  4MN0 A;  1WRK A;  1QLK A;  3EK8 A;  3JVT B;  1CDN A;  1FI5 A;  1IRJ A;  1ZOT B;  1QAT A;  1DJZ A;  4ETO A;  5IBW A;  4HRG A;  2BEC A;  1SW8 A;  4UPG A;  1C7V A;  1BF5 A;  1AVS A;  2K7C A;  5HKZ A;  4YGB B;  2Y1M A;  4GPL B;  2PVB A;  2JT3 A;  1TRF A;  3PM8 A;  3WXA A;  3KF9 A;  1QX7 A;  5D7F A;  1QTX A;  1CFP A;  3BUN B;  1SMG A;  2Q91 A;  1H8B A;  2LHL A;  5DKQ A;  1XK4 A;  1E8A A;  4OR9 B;  2EC6 C;  4C0L A;  1F54 A;  1TTX A;  3TS5 C;  1JF2 A;  1K90 D;  1LVC D;  2L98 A;  2L4H A;  1KK8 B;  2FOT A;  3LCP C;  4JWQ A;  1MUX A;  4YGC B;  1Q80 A;  4PHJ A;  1A75 A;  5FYX A;  5AXI A;  1CB1 A;  5I8N A;  1M63 B;  5I2L A;  1K9K A;  2B1U A;  3D10 A;  4OV2 A;  1V1F A;  1CFF A;  1CNP A;  1SY9 A;  2NLN A;  4PE4 A;  4GAO A;  2LVK A;  1CMF A;  5HKY A;  1FI6 A;  1YVL A;  3A4U B;  3GOF A;  2KNE A;  2LHI A;  1S26 D;  4ZCU A;  1KFU L;  4PE1 A;  1EXR A;  3E3R A;  3JTD B;  1RK9 A;  4NQG A;  3O2P A;  4OCI A;  2V53 A;  2KFH A;  1JFJ A;  2ZNE A;  3CWG A;  1ODB A;  2LE9 B;  3QRX A;  1FW4 A;  2M9G A;  2I18 A;  1TCF A;  2BBM A;  2L5X B;  1GGZ A;  3TDZ A;  2R2I A;  4N1F A;  1M31 A;  1A03 A;  2JC2 A;  5B8I B;  1SK6 D;  3BUM B;  2F2P A;  5BPJ A;  2LC5 A;  4GBA A;  1PSB A;  2ZRS A;  1SNL A;  2M29 A;  2M3W A;  3DVM A;  3OHM B;  5K89 A;  2TN4 A;  1IWQ A;  1CFC A;  2CCM A;  2O60 A;  2WCE A;  1XFV O;  1NYA A;  1IJ6 A;  1J7R A;  2EC6 B;  2LMU A;  1N2D A;  4MZK A;  1MQ1 A;  4QJ3 B;  3SIA A;  1PAL A;  3TS5 B;  2L50 A;  5D69 A;  1KQM B;  1YVH A;  2JPT A;  1ZAC A;  3RLZ A;  1DJH A;  2PAL A;  1UP5 A;  4ORB B;  4IL1 A;  4Q04 A;  1OZS A;  5CSJ A;  1SL9 A;  1OMD A;  4GGF A;  1K9P A;  2JUL A;  1JBA A;  1B7T Z;  1EJ3 A;  1DJX A;  1DJY A;  2HQ8 A;  2PSR A;  2M1U A;  4QJ5 B;  2F33 A;  4NDC A;  5DKN A;  3FWC A;  3OX5 A;  3WHT B;  2MRD A;  2M7N A;  1WRZ A;  2NCO A;  4ZCV A;  3VRQ A;  4M2Q A;  4GGN A;  1BMO A;  1QIW A;  2KAY A;  1ZUZ A;  3O78 A;  1KFX S;  1NCY A;  1RFJ A;  2A4J A;  1MWN A;  3BUX B;  4PAL A;  1TN4 A;  1KK8 C;  3KEV A;  4PE7 A;  4CID A;  1J1D A;  1JF0 A;  1PVB A;  2LLU A;  3VRR A;  3NSL A;  3MSE B;  2K61 A;  5AAN A;  1CKK A;  1F71 A;  1ZMZ A;  3OB2 B;  4OVN F;  1BT6 A;  1K96 A;  2WCB A;  3PN7 C;  1KCY A;  2HQW A;  1FF1 A;  2ZN8 A;  5TNC A;  3D0Y A;  5AER A;  1UHJ A;  2HF5 A;  1S36 A;  2OS8 C;  2JT0 A;  1NIW A;  2H2K A;  2JWW A;  3C1V A;  3GK1 A;  1IH0 A;  1AHR A;  1XFY O;  3OB1 B;  1F70 A;  2WND A;  1N0Y A;  1UUR A;  1AUI B;  1WLZ A;  1WLM A;  3BUW B;  1FBV A;  4HRE E;  1Y0V H;  1B4C A;  2LLS A;  1K94 A;  1AJ5 A;  1U5I A;  3I5H C;  1QVI Z;  1QV0 A;  1B8L A;  1CDL A;  1A2X A;  3DVK A;  3NSK A;  2Q4U A;  4PE0 A;  2LM5 A;  2ISD A;  3LK1 A;  1DF0 B;  3WNX B;  2MHH A;  1TNQ A;  2MBX A;  1SYM A;  5J3X A;  1KK7 Z;  4GUK A;  1NWD A;  5GQQ C;  2BE4 A;  1JC2 A;  1ALV A;  1DJI A;  1QS7 A;  1NUB A;  1OQP A;  1F4O A;  1BU3 A;  4A4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...