3I5IB

The crystal structure of squid myosin s1 in the presence of so4 2-
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain isoform A
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB01
1WDCC 5ER5A 1DJXA 1QIWA 4MRYA 1EJ3A 2O60A 1QASA 4I5LB 4NDDA 2IS9A 1XFVO 2JTTA 1PSBA 1F4QA 3SG7A 5I2QA 3F45A 1DJZA 1H8BA 2BL0B 2OTGC 3PM8A 2KI6D 2M49B 3M0WA 1NSHA 4PE4A 1DF0B 5HLOA 1CMGA 3EK7A 1GJYA 4MVFA 3DF0A 1MF8B 3FWCA 1FPWA 1S36A 1KCYA 2JOJA 2M7NA 1YR5A 1UHIA 3EK4A 3NSLA 3PALA 1J7QA 1V1GA 3JVTB 3EK8A 3KHEA 3PLFB 3SG2A 1XFUO 3LL8B 1SBJA 3PN7B 4PHMA 4ZCUA 1BG1A 4Q04A 3K21A 4I5JA 2FCDA 4YRUA 4ORBB 1RECA 2CTNA 2PSRA 1GGWA 2Y5IA 1FBVA 1R2UA 2EHBA 1NPQA 1SPYA 1AJ4A 3QRXA 1TCOB 3AKAA 2KNEA 1B8CA 2Q4UA 3VRNA 1LA0A 3CR5X 2HF5A 2MBXA 1LVCD 3WHUB 1SL7A 4DIRA 2KGBC 4UPGA 5D69A 1NX2A 1G33A 2GGZA 1K8UA 1TNWA 3SG5A 1CFFA 3TZ1A 2KGRA 2ZN9A 2PALA 2WNDA 2KHNA 2LVIA 1QIVA 1UHHA 2BCBA 1VRKA 1YX7A 2CNPA 4GFTA 2BKHB 2RGIA 1DJWA 2AUCA 1ALVA 3BUWB 1K9PA 1MWNA 4PE7A 1IGVA 4AQIA 3CWGA 2Y4QA 3DVEA 1K96A 3BUXB 3H4SE 2LUXA 1F70A 2KAXA 1Y6WA 2DOQA 4USLA 2A4JA 1W7JB 2FOTA 3BOWA 3I5IC 1D1OA 3PATA 4DRWA 3KO0A 3A4UB 2HQ8A 4HSZA 2K7BA 3OX6A 4GGNA 4XJKB 1DT7B 4FTGA 1CLBA 2BE6A 3JTDC 3D0YB 1F71A 1E8AA 1A75A 4MSPA 1XFYO 1RK9A 1ZUZA 1JWDA 4CIDA 2PMYA 3AAJA 3SG3A 1F54A 4XJKA 3TUYC 3I5HC 1L2OB 4QJ4B 5CSIA 3OX5A 1K94A 1EXRA 3TDUA 2LANA 3ZNIA 1YVLA 3SG4A 1K93D 1HQVA 1WRLA 2KOTA 1SY9A 4CLNA 1GGZA 2FCEA 1YUTA 1LINA 2K61A 2KYFA 5IBWA 1QVIZ 4QJ3B 1OQPA 1YVHA 4F0ZB 1YUSA 4E68A 3VROA 1UURA 1ZOTB 2K7DA 3CR2A 1BLQA 4HRGA 4ORAB 3TS5B 2K7OA 2JT3A 3C1VA 2KQ6A 1M45A 1CDPA 4OR9B 2NXQA 1IG5A 1KFXL 1LKJA 4OKHA 1ALWA 1DGUA 1B4CA 3TDIA 2JU0A 3CTNA 2CT9A 4MZJA 4ZCVA 3CLNA 2K0JA 3A8RA 1S6JA 4M2PA 1DJYA 1S1EA 1XYDA 1CNPA 2LMUA 2MA2A 1SR6C 1FI5A 2KI4B 1IWQA 2L2EA 3E3RA 4JPZB 2JT0A 5CSNA 3I5GC 1C7WA 1ZFSA 1TRFA 2L98A 2JNFA 4GUKA 3TUYB 1QS7A 4N5XA 3LCPC 1PULA 1IRJA 3NXAA 3FWBA 3OP0A 2BECA 1J1EA 4ORCB 1R6PA 1YUUA 1UWOA 4YGEB 2MAZA 1J7RA 4ETOA 1B1GA 1A2XA 3CS1A 1CTRA 1JBAA 1WRKA 1IJ6A 5HKYA 2M3WA 5HYDA 1B7TZ 3O4YA 1J55A 3DF0B 2LC5A 3OHMB 4C0JA 2LVVA 3OB1B 1B8LA 1KK8B 1S26D 5KTYA 2LLSA 2MHHA 2JZIA 1MXLC 3WXAA 2SCPA 1KK7Z 3ICBA 2MRDA 3VRPA 2EC6C 4CFQA 1A4PA 1N2DA 1NCXA 4MBEA 2K2AA 3IQOA 3NSKA 4PDZA 1TN4A 3D10A 1TIZA 1W7IB 2GV5A 2I7AA 3NSOA 2BE4A 4MRXA 2M9GA 4MZKA 1KK7Y 1QX7A 1AP4A 3CZTX 2QACA 2F2OA 2P6BB 1IH0A 2L50A 1SR6B 2LVKA 2M29A 4YGDB 3FS7A 1S5GZ 2JT8A 1Y0VH 4PHJA 1CDLA 1KSMA 4YGAA 1WLMA 1BJFA 1RWYA 2LHIA 1NUBA 3I5GB 4MEWA 5AERA 2M8UA 1CM1A 1EG4A 1G4YR 1QATA 4CFRA 2OS8C 1FW4A 4D1EA 2ISDA 5I2OA 2I18A 1BODA 1TNPA 1BR1B 1WDCB 3GK1A 1QJTA 5AFPA 2LVJA 4WQ3A 2FJUB 2R2IA 2M97A 2NLNA 2KAVA 1Q80A 4NDBA 1K9UA 5GQQC 1U5IA 1RFJA 1CB1A 1SMGA 2KFFA 1KFUS 2OTGB 2BKIB 4A4BA 1CDNA 2H2KA 3BOWB 1TOPA 4DS7A 2HPSA 3ZWHA 1CDMA 1DJGA 2CBLA 5CPVA 1FI6A 2JPTA 2JWWA 1SL9A 2K2FA 2D8NA 2K7CA 5HKWA 1EH2A 1A75B 4PCWA 3MSEB 5KSZA 1WLZA 1YX8A 1BMOA 2KAYA 4M2QA 2KBMA 2WCEA 1XVJA 5B8IB 2LE9B 1GQMA 1SK6D 1X02A 1NX3A 1F55A 1NCZA 1K95A 4JWQA 2Y1NA 2KI6C 3BUOB 3SJSA 1IQ3A 2CCMA 1J1DA 2JQ6A 2CXJA 1PVAA 3EKJA 1JFJA 4M2OA 2NCOA 1S3PA 1FF1A 4JQ0D 3EVVA 1C07A 1LXFC 2LUCA 1F4OA 1PSRA 1NP8A 1QLKA 1J7OA 1V1FA 5G08A 1AJ5A 2LV7A 2Y1MA 5PALA 1UP5A 1OOJA 2JXLA 5I8NA 2BCXA 5TNCA 4PHKA 1MQ1A 1HT9A 1QVIY 1CMFA 1PRWA 2ZRTA 5F6TA 5HKZA 2COLB 5JOLA 1C7VA 2LMVA 1RJVA 1PK0D 1MUXA 2L51A 3PFVA 4YI9A 2O5GA 1XK4C 3BYAA 1OE9B 3I5IB 3LK1A 1BR4B 2ZFDA 4WQ2A 1AUIB 1JC2A 1Y1AA 3JTDB 4YBHB 3RLZA 1PVBA 1JF0A 1SYMA 2MLFC 4FQOA 2SASA 1H4BA 2WCBA 1M46A 2NCPA 3I5HB 3JVTC 4A4CA 1XFXO 5FYXA 2JRFA 2VRGA 2LAPA 4L9MA 4XYNA 1DVIA 3PN7C 1JUOA 2QPTA 3TDZA 3AKBA 1J7PA 1QV0A 1K2HA 4BY4A 2HETA 1XA5A 5D7FA 1OMRA 3LLEA 2KFHA 5BPJA 3SIAA 1OZOA 1YTZC 4TNCA 5DKQA 5HLVA 2NZ0A 1SRAA 3CR4X 2JNXA 1AHRA 3SG6A 1EG3A 2L4IA 4HREE 2Q91A 1B7TY 3LK0A 3PSRA 3IQQA 1JSAA 1IJ5A 2M1KB 2WCFA 3NSIA 4DUQA 1YRUB 2H61C 2PVBA 1QXPA 4GAOA 2HQWA 2L5XB 4GGFA 4ICBA 1NX0A 4R1EA 1DJHA 5CSJA 3OB2B 2V53A 1OMVA 2KQYA 3I5FC 1CLLA 4C0LA 3GK4X 1KWOC 1UHKA 2ZRSA 1BU3A 2KDHA 1N0YA 1CFDA 2BBMA 4AQJA 2LCPA 3CGAA 3BQ3A 2M7LA 2KBIA 3EKHA 2F33A 3EVUA 1B8RA 2PASA 4NDCA 3VRRA 1AK8A 1DMOA 1IKUA 1AVSA 1XK4A 1Y1UA 4MLWA 1SL8A 1WRZA 5KU1A 3WHTB 1DF0A 3HX4A 5AEQA 1U5IB 1S5GY 1MR8A 1XFZO 5I2LA 3BXKA 2KYCA 1A03A 5K89A 1BOCA 4PE1A 1YRTB 1L2OC 4AOMA 1ZACA 4I5KA 4YI8A 4DCKA 2GGMA 4OVNF 2BBNA 2WC8A 3DVMA 1CKKA 1EL4A 1SNLA 1KFUL 1SCMC 2JULA 2ZKMX 1PALA 1QV1A 2MLEC 1CFCA 1DJIA 1B9AA 1LA3A 5J3XA 3VGOA 1BF5A 3RM1A 2EC6B 4GBAA 1WY9A 4N1FA 1NCYA 1UHJA 1YURA 3BUNB 1K9KA 4YGCB 3EVRA 4PHNA 3AAKA 5AXIA 1F8HA 3I5FB 1DTLA 1L7ZA 1S6CA 1KWOB 1RTP1 1CLMA 1TTXA 2H61A 2KSPA 2M1UA 1UHNA 3TS5C 1SW8A 2LP2A 1NX1A 3WNXB 4IL1A 2L4HA 2G2BA 2L0PA 1QLSA 3KEVA 4MN0A 4WRIA 1IQ5A 3O78A 2LM5A 2JXCA 3DVKA 2OS8B 4PE0A 2KI4C 2AAOA 2JTZA 3GK2A 1KQMC 3KPXA 2WOSA 3GOFA 4GGFC 2JC2A 1SCVA 4N1GA 1QTXA 3DVJA 1BT6A 1UUSA 1TNXA 3DD4A 3KF9A 4NQGA 2LLUA 3D0YA 2K8MB 1NWDA 2OPOA 2F8PA 1ODBA 1DGVA 2AMIA 4OCIA 1SCMB 2B1UA 4C0KA 1MHOA 1N65A 2ZNDA 4P5OE 4P2YB 3VRQA 4HRHA 3IF7A 4I5NB 1TNQA 2BL0C 2LMTA 3FIAA 2MJWB 1KK8C 1MXEA 4GNKB 2E6WA 2KFGA 1KQVA 1KFXS 2M0RA 5ER4X 5DKRA 4QJ5B 1OZSA 2BCAA 3BUMB 1Y1XA 5DKNA 2ZNEA 1OSAA 5AANA 2I94A 1G8IA 4PALA 1XFWO 2F2PA 1K90D 1B47A 4OV2A 1TCFA 1M31A 4U8DA 1RROA 3HCMA 4MZLA 1KSOA 3SIBA 1JF2A 1NYAA 1JFKA 1ZMZA 1SKTA 2LP3A 2TN4A 4CPVA 1M39A 2ZN8A 1M63B 1CM4A 1QX2A 2E30A 1XO5A 2LNKA 3O2PA 1KQMB 1QX5B 3O6BA 5JJGA 4GPLB 5CSFA 4YGBB 2LHLA 1OMDA 2F3YA 2G9BA 2F3ZA 4BY5A 2LLTA 2WORA 2PRUA 1CFPA 2I2RE 2EGDA 1A29A 1S6IA 1NIWA
chains in the Genus database with same CATH superfamily
1WDCC 5ER5A 1DJXA 2PQLA 1QIWA 4MRYA 1EJ3A 2O60A 1QASA 4I5LB 4NDDA 2IS9A 1XFVO 2JTTA 3QMEA 1PSBA 1F4QA 4JKTA 3SG7A 5I2QA 3F45A 3RZSA 1DJZA 5I94A 3IVTA 1H8BA 2BL0B 2OTGC 3PM8A 2KI6D 2M49B 3M0WA 1NSHA 3B87A 4PE4A 1DF0B 5HLOA 1CMGA 3EK7A 1GJYA 5FI6A 4MVFA 3DF0A 1MF8B 3FWCA 1FPWA 1S36A 1Z2CB 3S0DA 1XFRA 3SS3A 1KCYA 2JOJA 2M7NA 1YR5A 1UHIA 3EK4A 3NSLA 3PALA 1J7QA 1V1GA 3JVTB 3EK8A 3KHEA 3PLFB 3FE9A 3SG2A 1XFUO 3LL8B 1SBJA 3PN7B 4PHMA 4ZCUA 1BG1A 4FQTA 3K21A 3L47A 4I5JA 2FCDA 4Q04A 4YRUA 4ORBB 1RECA 4JD9A 2CTNA 2PSRA 1GGWA 2Y5IA 1FBVA 1R2UA 2EHBA 1NPQA 1SPYA 1AJ4A 1C3ZA 3QRXA 1TCOB 3AKAA 2KNEA 1B8CA 2Q4UA 3VRNA 2BAPA 1LA0A 3CR5X 1IIOA 2HF5A 2MBXA 1LVCD 3WHUB 1SL7A 4DIRA 2KGBC 3NHIA 4UPGA 5D69A 1NX2A 1G33A 2GGZA 1K8UA 1TNWA 3SG5A 1CFFA 3TZ1A 2KGRA 2KLDA 2ZN9A 2PALA 2WNDA 2KHNA 2LVIA 1QIVA 1UHHA 2BCBA 1VRKA 1YX7A 2CNPA 4GFTA 2BKHB 2RGIA 1DJWA 2QDIA 2AUCA 1ALVA 3BUWB 1K9PA 1MWNA 4PE7A 1IGVA 4AQIA 3CWGA 2Y4QA 3DVEA 1K96A 3K1EA 3BUXB 3H4SE 2P71A 2LUXA 5FI7A 1F70A 2KAXA 1Y6WA 2DOQA 2KPHA 3DZTA 2A4JA 1W7JB 2FOTA 3BOWA 3I5IC 4USLA 1D1OA 3PATA 4DRWA 3KO0A 3A4UB 1T14A 2HQ8A 4HSZA 2K7BA 3OX6A 4GGNA 4XJKB 1DT7B 4FTGA 1CLBA 2BE6A 3PM2A 3JTDC 3D0YB 1F71A 1E8AA 1DELA 1A75A 3BJHA 1XFYO 4MSPA 1RK9A 1ZUZA 1JWDA 4CIDA 2PMYA 3AAJA 3SG3A 1F54A 4XJKA 3TUYC 3I5HC 1L2OB 4QJ4B 3CZ0A 5CSIA 3OX5A 1K94A 1EXRA 3TDUA 4IJ7A 2LANA 3ZNIA 2QEBA 1YVLA 3SG4A 1K93D 1HQVA 1WRLA 3VB1A 2KOTA 1SY9A 4CLNA 1GGZA 2FCEA 1YUTA 1LINA 2K61A 3R72A 2KYFA 5IBWA 1QVIZ 4QJ3B 1OQPA 1OW4A 1YVHA 4F0ZB 3L4AA 1YUSA 4E68A 3VROA 1UURA 1ZOTB 2K7DA 3CR2A 1BLQA 4HRGA 4ORAB 3B86A 3TS5B 2K7OA 2JT3A 3C1VA 2KQ6A 1M45A 1CDPA 4OR9B 2NXQA 1IG5A 1KFXL 1LKJA 4OKHA 1ALWA 1DGUA 3D78A 1B4CA 2WCLA 3TDIA 2JU0A 3CTNA 2CT9A 4MZJA 4ZCVA 3CLNA 2K0JA 3A8RA 1TUZA 1S6JA 4M2PA 3DYEA 3B7AA 1DJYA 3V2LA 1S1EA 1XYDA 1CNPA 2LMUA 1TWOA 2MA2A 1SR6C 2FJYA 1FI5A 2KI4B 1IWQA 2L2EA 3E3RA 4JPZB 2JT0A 5CSNA 3I5GC 1C7WA 1ZFSA 1TRFA 5D3OA 2L98A 2JNFA 4GUKA 3TUYB 1QS7A 4N5XA 3OBVA 3LCPC 1PULA 1IRJA 3NXAA 3FWBA 3OP0A 2BECA 1OOHA 1J1EA 4ORCB 1R6PA 2K60A 1YUUA 1UWOA 4YGEB 2MAZA 1J7RA 3D75A 2WC6A 4ETOA 1B1GA 1A2XA 3CS1A 1CTRA 1JBAA 1WRKA 1IJ6A 5HKYA 3D77A 2M3WA 5HYDA 1B7TZ 3O4YA 1J55A 3DF0B 2LC5A 3OHMB 4C0JA 2LVVA 3OB1B 3S0GA 1B8LA 1KK8B 2WCKA 1S26D 5KTYA 3DXLA 2LLSA 2MHHA 2JZIA 1LS8A 1MXLC 1Z4HA 2SCPA 3BFAA 3WXAA 1KK7Z 3ICBA 2MRDA 3VRPA 2EC6C 4CFQA 1A4PA 2QEVA 1N2DA 1NCXA 4MBEA 2K2AA 3IQOA 3NSKA 3Q8IA 3OGNA 4PDZA 1TN4A 3D10A 1C3YA 1TIZA 1W7IB 2GV5A 2I7AA 3NSOA 1W9ZA 2BE4A 2BNXA 2M9GA 2WCHA 1KK7Y 1QX7A 4MRXA 4MZKA 1AP4A 2WCMA 3CZTX 2QACA 2F2OA 2PYQA 2P6BB 1IH0A 2L50A 1SR6B 2QEHA 2LVKA 2M29A 4YGDB 3FS7A 1S5GZ 2JT8A 1Y0VH 4PHJA 1CDLA 1KSMA 4YGAA 1WLMA 1BJFA 1RWYA 2LHIA 1NUBA 3I5GB 4MEWA 5AERA 2M8UA 1CM1A 1EG4A 1G4YR 1QATA 4CFRA 2OS8C 1FW4A 4D1EA 2ISDA 5I2OA 2I18A 1BODA 1TNPA 1BR1B 1WDCB 3GK1A 1QJTA 5AFPA 2LVJA 4WQ3A 2FJUB 1SSEB 4KYNA 2R2IA 2M97A 2NLNA 3CABA 2KAVA 1Q80A 2H8VA 1K9UA 4NDBA 5GQQC 1U5IA 1RFJA 1CB1A 1SMGA 2KFFA 1KFUS 2OTGB 2BKIB 4A4BA 1CDNA 2H2KA 3BOWB 1TOPA 4DS7A 2HPSA 3ZWHA 1CDMA 1DJGA 2CBLA 5CPVA 1FI6A 2JPTA 2JWWA 3BFBA 1SL9A 5DICA 2K2FA 2D8NA 2K7CA 2L5YA 5HKWA 1EH2A 1A75B 4PCWA 3MSEB 5KSZA 1WLZA 1YX8A 1BMOA 2KAYA 4M2QA 2KBMA 2WCEA 1XVJA 5B8IB 2LE9B 1GQMA 1SK6D 1X02A 1NX3A 1F55A 1NCZA 1K95A 4JWQA 2Y1NA 2KI6C 3BUOB 3CDNA 3SJSA 1IQ3A 2CCMA 1J1DA 2JQ6A 2CXJA 1PVAA 3EKJA 1JFJA 4M2OA 2NCOA 1ORGA 1S3PA 1FF1A 2GTEA 3CZ1A 4JQ0D 3EVVA 1C07A 1LXFC 2LUCA 1F4OA 1PSRA 1NP8A 1QLKA 1J7OA 1V1FA 5G08A 1AJ5A 2LV7A 2Y1MA 5PALA 1UP5A 1OOJA 2JXLA 5I8NA 3NGVA 2BCXA 5TNCA 3O4XA 4PHKA 1MQ1A 1HT9A 1QVIY 1CMFA 3S0AA 2WC5A 1PRWA 2ZRTA 5F6TA 5HKZA 2COLB 5JOLA 1C7VA 2LMVA 1RJVA 1PK0D 3BFHA 1MUXA 2L51A 3PFVA 4YI9A 2O5GA 4INWA 1XK4C 3BYAA 1OE9B 2QEOA 3I5IB 3LK1A 1BR4B 2ZFDA 3R1PA 4WQ2A 3UNWA 3SS5A 1AUIB 1JC2A 1Y1AA 3JTDB 4YBHB 5EL2A 3RLZA 1PVBA 1JF0A 1SYMA 1DQEA 2MLFC 4FQOA 2SASA 1H4BA 2WCBA 1M46A 2NCPA 3UO9A 3I5HB 3JVTC 4A4CA 1XFXO 5FYXA 2JRFA 2VRGA 2LAPA 4L9MA 4XYNA 1DVIA 3PN7C 1JUOA 2QPTA 3TDZA 3AKBA 3N7HA 1J7PA 1QV0A 1K2HA 3PJIA 4BY4A 3FE6A 1OOIX 2HETA 1XA5A 5D7FA 1OMRA 3LLEA 2KFHA 5BPJA 3SIAA 1OZOA 1GM0A 1YTZC 4TNCA 5DKQA 5HLVA 1TUJA 2NZ0A 1SRAA 3CR4X 2JNXA 1AHRA 3SG6A 1EG3A 2L4IA 4HREE 2Q91A 1B7TY 3LK0A 3PSRA 3IQQA 1JSAA 1IJ5A 2M1KB 2WCFA 3NSIA 4DUQA 4F7FA 1YRUB 2H61C 2PVBA 1QXPA 4GAOA 2HQWA 2L5XB 4GGFA 4ICBA 1NX0A 4R1EA 1DJHA 5CSJA 3OB2B 2V53A 1OMVA 2KQYA 3I5FC 1CLLA 4C0LA 3GK4X 1KWOC 1UHKA 2ZRSA 1BU3A 2KDHA 1N0YA 3NHTA 1CFDA 3D73A 2BBMA 4AQJA 2L2CA 2LCPA 3CGAA 3BQ3A 2M7LA 2KBIA 3EKHA 2F33A 3EVUA 1B8RA 2PASA 4NDCA 3VRRA 1AK8A 1DMOA 1IKUA 1AVSA 1XK4A 1Y1UA 4MLWA 1SL8A 1WRZA 5KU1A 3WHTB 1DF0A 3HX4A 5AEQA 1U5IB 1S5GY 1MR8A 1XFZO 2JPOA 3BXKA 5I2LA 2KYCA 1A03A 5K89A 1BOCA 4PE1A 1YRTB 1L2OC 4INXA 4AOMA 1ZACA 4I5KA 4YI8A 4DCKA 2GGMA 4OVNF 2BBNA 1DEKA 2WC8A 3DVMA 1CKKA 1EL4A 1SNLA 1KFUL 1SCMC 3FE8A 2JULA 2ZKMX 5FI2A 1PALA 1QV1A 2MLEC 3B88A 1DJIA 1B9AA 1LA3A 5J3XA 1CFCA 3VGOA 1BF5A 3RM1A 2EC6B 4PT1A 4GBAA 1WY9A 3EG5B 1NCYA 1UHJA 4N1FA 1YURA 3BUNB 1K9KA 4YGCB 2ERBA 2WCJA 3EVRA 4PHNA 3AAKA 5AXIA 1F8HA 3I5FB 1DTLA 1L7ZA 1S6CA 1KWOB 1RTP1 1CLMA 1TTXA 2H61A 2KSPA 2M1UA 1UHNA 3TS5C 1SW8A 2LP2A 1NX1A 3WNXB 3DY9A 4IL1A 3R1OA 2L4HA 2G2BA 2KLEA 2L0PA 1QLSA 3CZ2A 3KEVA 3CYZA 4MN0A 4WRIA 1IQ5A 3O78A 2LM5A 2JXCA 3DVKA 2OS8B 4PE0A 2KI4C 2AAOA 2JTZA 3GK2A 1KQMC 3B6XA 2WOSA 3KPXA 3L4LA 3S0EA 1DC1A 3S0FA 3GOFA 4GGFC 2JC2A 1SCVA 4N1GA 1QTXA 3DVJA 1BT6A 1UUSA 1TNXA 3DD4A 3KF9A 4NQGA 2LLUA 3D0YA 2K8MB 1NWDA 2OPOA 5HL1A 2F8PA 1ODBA 3D74A 1DGVA 2AMIA 4OCIA 1SCMB 2B1UA 4C0KA 1MHOA 1N65A 2ZNDA 4P5OE 4P2YB 3VRQA 4HRHA 3IF7A 4I5NB 1TNQA 2BL0C 2LMTA 3FIAA 2MJWB 1KK8C 1MXEA 4GNKB 2E6WA 2KFGA 1KQVA 3S0BA 1KFXS 2M0RA 5ER4X 5DKRA 4QJ5B 1OZSA 2BCAA 3BUMB 1Y1XA 5DKNA 3SS4A 2ZNEA 1OSAA 5AANA 1QWVA 2I94A 1G8IA 1P28A 4PALA 1XFWO 2F2PA 1K90D 1B47A 4OV2A 1TCFA 1M31A 4U8DA 1RROA 3HCMA 4MZLA 1OOFA 1KSOA 3SIBA 1JF2A 1NYAA 1JFKA 1OOGA 1ZMZA 1SKTA 2LP3A 2TN4A 4OZDA 3R1VA 4CPVA 1M39A 2ZN8A 2YGUA 1M63B 1CM4A 1QX2A 2E30A 1XO5A 2LNKA 3D76A 3O2PA 1KQMB 1QX5B 3O6BA 5JJGA 4GPLB 5CSFA 4YGBB 2LHLA 1OMDA 2F3YA 2G9BA 2F3ZA 4BY5A 2LLTA 2WORA 2PRUA 1CFPA 2P70A 2I2RE 2EGDA 1A29A 1S6IA 1NIWA
chains in the Genus database with same CATH topology
1WDCC 5ER5A 1DJXA 1QIWA 4MRYA 1EJ3A 2O60A 1QASA 4I5LB 4NDDA 2IS9A 1XFVO 2JTTA 1PSBA 1F4QA 3SG7A 5I2QA 3F45A 1DJZA 1H8BA 2BL0B 2OTGC 3PM8A 2KI6D 2M49B 3M0WA 1NSHA 4PE4A 1DF0B 5HLOA 1CMGA 3EK7A 1GJYA 4MVFA 3DF0A 1MF8B 3FWCA 1FPWA 1S36A 1KCYA 2JOJA 2M7NA 1YR5A 1UHIA 3EK4A 3NSLA 3PALA 1J7QA 1V1GA 3JVTB 3EK8A 3KHEA 3PLFB 3SG2A 1XFUO 3LL8B 1SBJA 3PN7B 4PHMA 4ZCUA 1BG1A 4Q04A 3K21A 4I5JA 2FCDA 4YRUA 4ORBB 1RECA 2CTNA 2PSRA 1GGWA 2Y5IA 1FBVA 1R2UA 2EHBA 1NPQA 1SPYA 1AJ4A 3QRXA 1TCOB 3AKAA 2KNEA 1B8CA 2Q4UA 3VRNA 1LA0A 3CR5X 2HF5A 2MBXA 1LVCD 3WHUB 1SL7A 4DIRA 2KGBC 4UPGA 5D69A 1NX2A 1G33A 2GGZA 1K8UA 1TNWA 3SG5A 1CFFA 3TZ1A 2KGRA 2ZN9A 2PALA 2WNDA 2KHNA 2LVIA 1QIVA 1UHHA 2BCBA 1VRKA 1YX7A 2CNPA 4GFTA 2BKHB 2RGIA 1DJWA 2AUCA 1ALVA 3BUWB 1K9PA 1MWNA 4PE7A 1IGVA 4AQIA 3CWGA 2Y4QA 3DVEA 1K96A 3BUXB 3H4SE 2LUXA 1F70A 2KAXA 1Y6WA 2DOQA 4USLA 2A4JA 1W7JB 2FOTA 3BOWA 3I5IC 1D1OA 3PATA 4DRWA 3KO0A 3A4UB 2HQ8A 4HSZA 2K7BA 3OX6A 4GGNA 4XJKB 1DT7B 4FTGA 1CLBA 2BE6A 3JTDC 3D0YB 1F71A 1E8AA 1A75A 4MSPA 1XFYO 1RK9A 1ZUZA 1JWDA 4CIDA 2PMYA 3AAJA 3SG3A 1F54A 4XJKA 3TUYC 3I5HC 1L2OB 4QJ4B 5CSIA 3OX5A 1K94A 1EXRA 3TDUA 2LANA 3ZNIA 1YVLA 3SG4A 1K93D 1HQVA 1WRLA 2KOTA 1SY9A 4CLNA 1GGZA 2FCEA 1YUTA 1LINA 2K61A 2KYFA 5IBWA 1QVIZ 4QJ3B 1OQPA 1YVHA 4F0ZB 1YUSA 4E68A 3VROA 1UURA 1ZOTB 2K7DA 3CR2A 1BLQA 4HRGA 4ORAB 3TS5B 2K7OA 2JT3A 3C1VA 2KQ6A 1M45A 1CDPA 4OR9B 2NXQA 1IG5A 1KFXL 1LKJA 4OKHA 1ALWA 1DGUA 1B4CA 3TDIA 2JU0A 3CTNA 2CT9A 4MZJA 4ZCVA 3CLNA 2K0JA 3A8RA 1S6JA 4M2PA 1DJYA 1S1EA 1XYDA 1CNPA 2LMUA 2MA2A 1SR6C 1FI5A 2KI4B 1IWQA 2L2EA 3E3RA 4JPZB 2JT0A 5CSNA 3I5GC 1C7WA 1ZFSA 1TRFA 2L98A 2JNFA 4GUKA 3TUYB 1QS7A 4N5XA 3LCPC 1PULA 1IRJA 3NXAA 3FWBA 3OP0A 2BECA 1J1EA 4ORCB 1R6PA 1YUUA 1UWOA 4YGEB 2MAZA 1J7RA 4ETOA 1B1GA 1A2XA 3CS1A 1CTRA 1JBAA 1WRKA 1IJ6A 5HKYA 2M3WA 5HYDA 1B7TZ 3O4YA 1J55A 3DF0B 2LC5A 3OHMB 4C0JA 2LVVA 3OB1B 1B8LA 1KK8B 1S26D 5KTYA 2LLSA 2MHHA 2JZIA 1MXLC 3WXAA 2SCPA 1KK7Z 3ICBA 2MRDA 3VRPA 2EC6C 4CFQA 1A4PA 1N2DA 1NCXA 4MBEA 2K2AA 3IQOA 3NSKA 4PDZA 1TN4A 3D10A 1TIZA 1W7IB 2GV5A 2I7AA 3NSOA 2BE4A 4MRXA 2M9GA 4MZKA 1KK7Y 1QX7A 1AP4A 3CZTX 2QACA 2F2OA 2P6BB 1IH0A 2L50A 1SR6B 2LVKA 2M29A 4YGDB 3FS7A 1S5GZ 2JT8A 1Y0VH 4PHJA 1CDLA 1KSMA 4YGAA 1WLMA 1BJFA 1RWYA 2LHIA 1NUBA 3I5GB 4MEWA 5AERA 2M8UA 1CM1A 1EG4A 1G4YR 1QATA 4CFRA 2OS8C 1FW4A 4D1EA 2ISDA 5I2OA 2I18A 1BODA 1TNPA 1BR1B 1WDCB 3GK1A 1QJTA 5AFPA 2LVJA 4WQ3A 2FJUB 2R2IA 2M97A 2NLNA 2KAVA 1Q80A 4NDBA 1K9UA 5GQQC 1U5IA 1RFJA 1CB1A 1SMGA 2KFFA 1KFUS 2OTGB 2BKIB 4A4BA 1CDNA 2H2KA 3BOWB 1TOPA 4DS7A 2HPSA 3ZWHA 1CDMA 1DJGA 2CBLA 5CPVA 1FI6A 2JPTA 2JWWA 1SL9A 2K2FA 2D8NA 2K7CA 5HKWA 1EH2A 1A75B 4PCWA 3MSEB 5KSZA 1WLZA 1YX8A 1BMOA 2KAYA 4M2QA 2KBMA 2WCEA 1XVJA 5B8IB 2LE9B 1GQMA 1SK6D 1X02A 1NX3A 1F55A 1NCZA 1K95A 4JWQA 2Y1NA 2KI6C 3BUOB 3SJSA 1IQ3A 2CCMA 1J1DA 2JQ6A 2CXJA 1PVAA 3EKJA 1JFJA 4M2OA 2NCOA 1S3PA 1FF1A 4JQ0D 3EVVA 1C07A 1LXFC 2LUCA 1F4OA 1PSRA 1NP8A 1QLKA 1J7OA 1V1FA 5G08A 1AJ5A 2LV7A 2Y1MA 5PALA 1UP5A 1OOJA 2JXLA 5I8NA 2BCXA 5TNCA 4PHKA 1MQ1A 1HT9A 1QVIY 1CMFA 1PRWA 2ZRTA 5F6TA 5HKZA 2COLB 5JOLA 1C7VA 2LMVA 1RJVA 1PK0D 1MUXA 2L51A 3PFVA 4YI9A 2O5GA 1XK4C 3BYAA 1OE9B 3I5IB 3LK1A 1BR4B 2ZFDA 4WQ2A 1AUIB 1JC2A 1Y1AA 3JTDB 4YBHB 3RLZA 1PVBA 1JF0A 1SYMA 2MLFC 4FQOA 2SASA 1H4BA 2WCBA 1M46A 2NCPA 3I5HB 3JVTC 4A4CA 1XFXO 5FYXA 2JRFA 2VRGA 2LAPA 4L9MA 4XYNA 1DVIA 3PN7C 1JUOA 2QPTA 3TDZA 3AKBA 1J7PA 1QV0A 1K2HA 4BY4A 2HETA 1XA5A 5D7FA 1OMRA 3LLEA 2KFHA 5BPJA 3SIAA 1OZOA 1YTZC 4TNCA 5DKQA 5HLVA 2NZ0A 1SRAA 3CR4X 2JNXA 1AHRA 3SG6A 1EG3A 2L4IA 4HREE 2Q91A 1B7TY 3LK0A 3PSRA 3IQQA 1JSAA 1IJ5A 2M1KB 2WCFA 3NSIA 4DUQA 1YRUB 2H61C 2PVBA 1QXPA 4GAOA 2HQWA 2L5XB 4GGFA 4ICBA 1NX0A 4R1EA 1DJHA 5CSJA 3OB2B 2V53A 1OMVA 2KQYA 3I5FC 1CLLA 4C0LA 3GK4X 1KWOC 1UHKA 2ZRSA 1BU3A 2KDHA 1N0YA 1CFDA 2BBMA 4AQJA 2LCPA 3CGAA 3BQ3A 2M7LA 2KBIA 3EKHA 2F33A 3EVUA 1B8RA 2PASA 4NDCA 3VRRA 1AK8A 1DMOA 1IKUA 1AVSA 1XK4A 1Y1UA 4MLWA 1SL8A 1WRZA 5KU1A 3WHTB 1DF0A 3HX4A 5AEQA 1U5IB 1S5GY 1MR8A 1XFZO 5I2LA 3BXKA 2KYCA 1A03A 5K89A 1BOCA 4PE1A 1YRTB 1L2OC 4AOMA 1ZACA 4I5KA 4YI8A 4DCKA 2GGMA 4OVNF 2BBNA 2WC8A 3DVMA 1CKKA 1EL4A 1SNLA 1KFUL 1SCMC 2JULA 2ZKMX 1PALA 1QV1A 2MLEC 1CFCA 1DJIA 1B9AA 1LA3A 5J3XA 3VGOA 1BF5A 3RM1A 2EC6B 4GBAA 1WY9A 4N1FA 1NCYA 1UHJA 1YURA 3BUNB 1K9KA 4YGCB 3EVRA 4PHNA 3AAKA 5AXIA 1F8HA 3I5FB 1DTLA 1L7ZA 1S6CA 1KWOB 1RTP1 1CLMA 1TTXA 2H61A 2KSPA 2M1UA 1UHNA 3TS5C 1SW8A 2LP2A 1NX1A 3WNXB 4IL1A 2L4HA 2G2BA 2L0PA 1QLSA 3KEVA 4MN0A 4WRIA 1IQ5A 3O78A 2LM5A 2JXCA 3DVKA 2OS8B 4PE0A 2KI4C 2AAOA 2JTZA 3GK2A 1KQMC 3KPXA 2WOSA 3GOFA 4GGFC 2JC2A 1SCVA 4N1GA 1QTXA 3DVJA 1BT6A 1UUSA 1TNXA 3DD4A 3KF9A 4NQGA 2LLUA 3D0YA 2K8MB 1NWDA 2OPOA 2F8PA 1ODBA 1DGVA 2AMIA 4OCIA 1SCMB 2B1UA 4C0KA 1MHOA 1N65A 2ZNDA 4P5OE 4P2YB 3VRQA 4HRHA 3IF7A 4I5NB 1TNQA 2BL0C 2LMTA 3FIAA 2MJWB 1KK8C 1MXEA 4GNKB 2E6WA 2KFGA 1KQVA 1KFXS 2M0RA 5ER4X 5DKRA 4QJ5B 1OZSA 2BCAA 3BUMB 1Y1XA 5DKNA 2ZNEA 1OSAA 5AANA 2I94A 1G8IA 4PALA 1XFWO 2F2PA 1K90D 1B47A 4OV2A 1TCFA 1M31A 4U8DA 1RROA 3HCMA 4MZLA 1KSOA 3SIBA 1JF2A 1NYAA 1JFKA 1ZMZA 1SKTA 2LP3A 2TN4A 4CPVA 1M39A 2ZN8A 1M63B 1CM4A 1QX2A 2E30A 1XO5A 2LNKA 3O2PA 1KQMB 1QX5B 3O6BA 5JJGA 4GPLB 5CSFA 4YGBB 2LHLA 1OMDA 2F3YA 2G9BA 2F3ZA 4BY5A 2LLTA 2WORA 2PRUA 1CFPA 2I2RE 2EGDA 1A29A 1S6IA 1NIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDC C;  5ER5 A;  1DJX A;  1QIW A;  4MRY A;  1EJ3 A;  2O60 A;  1QAS A;  4I5L B;  4NDD A;  2IS9 A;  1XFV O;  2JTT A;  1PSB A;  1F4Q A;  3SG7 A;  5I2Q A;  3F45 A;  1DJZ A;  1H8B A;  2BL0 B;  2OTG C;  3PM8 A;  2KI6 D;  2M49 B;  3M0W A;  1NSH A;  4PE4 A;  1DF0 B;  5HLO A;  1CMG A;  3EK7 A;  1GJY A;  4MVF A;  3DF0 A;  1MF8 B;  3FWC A;  1FPW A;  1S36 A;  1KCY A;  2JOJ A;  2M7N A;  1YR5 A;  1UHI A;  3EK4 A;  3NSL A;  3PAL A;  1J7Q A;  1V1G A;  3JVT B;  3EK8 A;  3KHE A;  3PLF B;  3SG2 A;  1XFU O;  3LL8 B;  1SBJ A;  3PN7 B;  4PHM A;  4ZCU A;  1BG1 A;  4Q04 A;  3K21 A;  4I5J A;  2FCD A;  4YRU A;  4ORB B;  1REC A;  2CTN A;  2PSR A;  1GGW A;  2Y5I A;  1FBV A;  1R2U A;  2EHB A;  1NPQ A;  1SPY A;  1AJ4 A;  3QRX A;  1TCO B;  3AKA A;  2KNE A;  1B8C A;  2Q4U A;  3VRN A;  1LA0 A;  3CR5 X;  2HF5 A;  2MBX A;  1LVC D;  3WHU B;  1SL7 A;  4DIR A;  2KGB C;  4UPG A;  5D69 A;  1NX2 A;  1G33 A;  2GGZ A;  1K8U A;  1TNW A;  3SG5 A;  1CFF A;  3TZ1 A;  2KGR A;  2ZN9 A;  2PAL A;  2WND A;  2KHN A;  2LVI A;  1QIV A;  1UHH A;  2BCB A;  1VRK A;  1YX7 A;  2CNP A;  4GFT A;  2BKH B;  2RGI A;  1DJW A;  2AUC A;  1ALV A;  3BUW B;  1K9P A;  1MWN A;  4PE7 A;  1IGV A;  4AQI A;  3CWG A;  2Y4Q A;  3DVE A;  1K96 A;  3BUX B;  3H4S E;  2LUX A;  1F70 A;  2KAX A;  1Y6W A;  2DOQ A;  4USL A;  2A4J A;  1W7J B;  2FOT A;  3BOW A;  3I5I C;  1D1O A;  3PAT A;  4DRW A;  3KO0 A;  3A4U B;  2HQ8 A;  4HSZ A;  2K7B A;  3OX6 A;  4GGN A;  4XJK B;  1DT7 B;  4FTG A;  1CLB A;  2BE6 A;  3JTD C;  3D0Y B;  1F71 A;  1E8A A;  1A75 A;  4MSP A;  1XFY O;  1RK9 A;  1ZUZ A;  1JWD A;  4CID A;  2PMY A;  3AAJ A;  3SG3 A;  1F54 A;  4XJK A;  3TUY C;  3I5H C;  1L2O B;  4QJ4 B;  5CSI A;  3OX5 A;  1K94 A;  1EXR A;  3TDU A;  2LAN A;  3ZNI A;  1YVL A;  3SG4 A;  1K93 D;  1HQV A;  1WRL A;  2KOT A;  1SY9 A;  4CLN A;  1GGZ A;  2FCE A;  1YUT A;  1LIN A;  2K61 A;  2KYF A;  5IBW A;  1QVI Z;  4QJ3 B;  1OQP A;  1YVH A;  4F0Z B;  1YUS A;  4E68 A;  3VRO A;  1UUR A;  1ZOT B;  2K7D A;  3CR2 A;  1BLQ A;  4HRG A;  4ORA B;  3TS5 B;  2K7O A;  2JT3 A;  3C1V A;  2KQ6 A;  1M45 A;  1CDP A;  4OR9 B;  2NXQ A;  1IG5 A;  1KFX L;  1LKJ A;  4OKH A;  1ALW A;  1DGU A;  1B4C A;  3TDI A;  2JU0 A;  3CTN A;  2CT9 A;  4MZJ A;  4ZCV A;  3CLN A;  2K0J A;  3A8R A;  1S6J A;  4M2P A;  1DJY A;  1S1E A;  1XYD A;  1CNP A;  2LMU A;  2MA2 A;  1SR6 C;  1FI5 A;  2KI4 B;  1IWQ A;  2L2E A;  3E3R A;  4JPZ B;  2JT0 A;  5CSN A;  3I5G C;  1C7W A;  1ZFS A;  1TRF A;  2L98 A;  2JNF A;  4GUK A;  3TUY B;  1QS7 A;  4N5X A;  3LCP C;  1PUL A;  1IRJ A;  3NXA A;  3FWB A;  3OP0 A;  2BEC A;  1J1E A;  4ORC B;  1R6P A;  1YUU A;  1UWO A;  4YGE B;  2MAZ A;  1J7R A;  4ETO A;  1B1G A;  1A2X A;  3CS1 A;  1CTR A;  1JBA A;  1WRK A;  1IJ6 A;  5HKY A;  2M3W A;  5HYD A;  1B7T Z;  3O4Y A;  1J55 A;  3DF0 B;  2LC5 A;  3OHM B;  4C0J A;  2LVV A;  3OB1 B;  1B8L A;  1KK8 B;  1S26 D;  5KTY A;  2LLS A;  2MHH A;  2JZI A;  1MXL C;  3WXA A;  2SCP A;  1KK7 Z;  3ICB A;  2MRD A;  3VRP A;  2EC6 C;  4CFQ A;  1A4P A;  1N2D A;  1NCX A;  4MBE A;  2K2A A;  3IQO A;  3NSK A;  4PDZ A;  1TN4 A;  3D10 A;  1TIZ A;  1W7I B;  2GV5 A;  2I7A A;  3NSO A;  2BE4 A;  4MRX A;  2M9G A;  4MZK A;  1KK7 Y;  1QX7 A;  1AP4 A;  3CZT X;  2QAC A;  2F2O A;  2P6B B;  1IH0 A;  2L50 A;  1SR6 B;  2LVK A;  2M29 A;  4YGD B;  3FS7 A;  1S5G Z;  2JT8 A;  1Y0V H;  4PHJ A;  1CDL A;  1KSM A;  4YGA A;  1WLM A;  1BJF A;  1RWY A;  2LHI A;  1NUB A;  3I5G B;  4MEW A;  5AER A;  2M8U A;  1CM1 A;  1EG4 A;  1G4Y R;  1QAT A;  4CFR A;  2OS8 C;  1FW4 A;  4D1E A;  2ISD A;  5I2O A;  2I18 A;  1BOD A;  1TNP A;  1BR1 B;  1WDC B;  3GK1 A;  1QJT A;  5AFP A;  2LVJ A;  4WQ3 A;  2FJU B;  2R2I A;  2M97 A;  2NLN A;  2KAV A;  1Q80 A;  4NDB A;  1K9U A;  5GQQ C;  1U5I A;  1RFJ A;  1CB1 A;  1SMG A;  2KFF A;  1KFU S;  2OTG B;  2BKI B;  4A4B A;  1CDN A;  2H2K A;  3BOW B;  1TOP A;  4DS7 A;  2HPS A;  3ZWH A;  1CDM A;  1DJG A;  2CBL A;  5CPV A;  1FI6 A;  2JPT A;  2JWW A;  1SL9 A;  2K2F A;  2D8N A;  2K7C A;  5HKW A;  1EH2 A;  1A75 B;  4PCW A;  3MSE B;  5KSZ A;  1WLZ A;  1YX8 A;  1BMO A;  2KAY A;  4M2Q A;  2KBM A;  2WCE A;  1XVJ A;  5B8I B;  2LE9 B;  1GQM A;  1SK6 D;  1X02 A;  1NX3 A;  1F55 A;  1NCZ A;  1K95 A;  4JWQ A;  2Y1N A;  2KI6 C;  3BUO B;  3SJS A;  1IQ3 A;  2CCM A;  1J1D A;  2JQ6 A;  2CXJ A;  1PVA A;  3EKJ A;  1JFJ A;  4M2O A;  2NCO A;  1S3P A;  1FF1 A;  4JQ0 D;  3EVV A;  1C07 A;  1LXF C;  2LUC A;  1F4O A;  1PSR A;  1NP8 A;  1QLK A;  1J7O A;  1V1F A;  5G08 A;  1AJ5 A;  2LV7 A;  2Y1M A;  5PAL A;  1UP5 A;  1OOJ A;  2JXL A;  5I8N A;  2BCX A;  5TNC A;  4PHK A;  1MQ1 A;  1HT9 A;  1QVI Y;  1CMF A;  1PRW A;  2ZRT A;  5F6T A;  5HKZ A;  2COL B;  5JOL A;  1C7V A;  2LMV A;  1RJV A;  1PK0 D;  1MUX A;  2L51 A;  3PFV A;  4YI9 A;  2O5G A;  1XK4 C;  3BYA A;  1OE9 B;  3I5I B;  3LK1 A;  1BR4 B;  2ZFD A;  4WQ2 A;  1AUI B;  1JC2 A;  1Y1A A;  3JTD B;  4YBH B;  3RLZ A;  1PVB A;  1JF0 A;  1SYM A;  2MLF C;  4FQO A;  2SAS A;  1H4B A;  2WCB A;  1M46 A;  2NCP A;  3I5H B;  3JVT C;  4A4C A;  1XFX O;  5FYX A;  2JRF A;  2VRG A;  2LAP A;  4L9M A;  4XYN A;  1DVI A;  3PN7 C;  1JUO A;  2QPT A;  3TDZ A;  3AKB A;  1J7P A;  1QV0 A;  1K2H A;  4BY4 A;  2HET A;  1XA5 A;  5D7F A;  1OMR A;  3LLE A;  2KFH A;  5BPJ A;  3SIA A;  1OZO A;  1YTZ C;  4TNC A;  5DKQ A;  5HLV A;  2NZ0 A;  1SRA A;  3CR4 X;  2JNX A;  1AHR A;  3SG6 A;  1EG3 A;  2L4I A;  4HRE E;  2Q91 A;  1B7T Y;  3LK0 A;  3PSR A;  3IQQ A;  1JSA A;  1IJ5 A;  2M1K B;  2WCF A;  3NSI A;  4DUQ A;  1YRU B;  2H61 C;  2PVB A;  1QXP A;  4GAO A;  2HQW A;  2L5X B;  4GGF A;  4ICB A;  1NX0 A;  4R1E A;  1DJH A;  5CSJ A;  3OB2 B;  2V53 A;  1OMV A;  2KQY A;  3I5F C;  1CLL A;  4C0L A;  3GK4 X;  1KWO C;  1UHK A;  2ZRS A;  1BU3 A;  2KDH A;  1N0Y A;  1CFD A;  2BBM A;  4AQJ A;  2LCP A;  3CGA A;  3BQ3 A;  2M7L A;  2KBI A;  3EKH A;  2F33 A;  3EVU A;  1B8R A;  2PAS A;  4NDC A;  3VRR A;  1AK8 A;  1DMO A;  1IKU A;  1AVS A;  1XK4 A;  1Y1U A;  4MLW A;  1SL8 A;  1WRZ A;  5KU1 A;  3WHT B;  1DF0 A;  3HX4 A;  5AEQ A;  1U5I B;  1S5G Y;  1MR8 A;  1XFZ O;  5I2L A;  3BXK A;  2KYC A;  1A03 A;  5K89 A;  1BOC A;  4PE1 A;  1YRT B;  1L2O C;  4AOM A;  1ZAC A;  4I5K A;  4YI8 A;  4DCK A;  2GGM A;  4OVN F;  2BBN A;  2WC8 A;  3DVM A;  1CKK A;  1EL4 A;  1SNL A;  1KFU L;  1SCM C;  2JUL A;  2ZKM X;  1PAL A;  1QV1 A;  2MLE C;  1CFC A;  1DJI A;  1B9A A;  1LA3 A;  5J3X A;  3VGO A;  1BF5 A;  3RM1 A;  2EC6 B;  4GBA A;  1WY9 A;  4N1F A;  1NCY A;  1UHJ A;  1YUR A;  3BUN B;  1K9K A;  4YGC B;  3EVR A;  4PHN A;  3AAK A;  5AXI A;  1F8H A;  3I5F B;  1DTL A;  1L7Z A;  1S6C A;  1KWO B;  1RTP 1;  1CLM A;  1TTX A;  2H61 A;  2KSP A;  2M1U A;  1UHN A;  3TS5 C;  1SW8 A;  2LP2 A;  1NX1 A;  3WNX B;  4IL1 A;  2L4H A;  2G2B A;  2L0P A;  1QLS A;  3KEV A;  4MN0 A;  4WRI A;  1IQ5 A;  3O78 A;  2LM5 A;  2JXC A;  3DVK A;  2OS8 B;  4PE0 A;  2KI4 C;  2AAO A;  2JTZ A;  3GK2 A;  1KQM C;  3KPX A;  2WOS A;  3GOF A;  4GGF C;  2JC2 A;  1SCV A;  4N1G A;  1QTX A;  3DVJ A;  1BT6 A;  1UUS A;  1TNX A;  3DD4 A;  3KF9 A;  4NQG A;  2LLU A;  3D0Y A;  2K8M B;  1NWD A;  2OPO A;  2F8P A;  1ODB A;  1DGV A;  2AMI A;  4OCI A;  1SCM B;  2B1U A;  4C0K A;  1MHO A;  1N65 A;  2ZND A;  4P5O E;  4P2Y B;  3VRQ A;  4HRH A;  3IF7 A;  4I5N B;  1TNQ A;  2BL0 C;  2LMT A;  3FIA A;  2MJW B;  1KK8 C;  1MXE A;  4GNK B;  2E6W A;  2KFG A;  1KQV A;  1KFX S;  2M0R A;  5ER4 X;  5DKR A;  4QJ5 B;  1OZS A;  2BCA A;  3BUM B;  1Y1X A;  5DKN A;  2ZNE A;  1OSA A;  5AAN A;  2I94 A;  1G8I A;  4PAL A;  1XFW O;  2F2P A;  1K90 D;  1B47 A;  4OV2 A;  1TCF A;  1M31 A;  4U8D A;  1RRO A;  3HCM A;  4MZL A;  1KSO A;  3SIB A;  1JF2 A;  1NYA A;  1JFK A;  1ZMZ A;  1SKT A;  2LP3 A;  2TN4 A;  4CPV A;  1M39 A;  2ZN8 A;  1M63 B;  1CM4 A;  1QX2 A;  2E30 A;  1XO5 A;  2LNK A;  3O2P A;  1KQM B;  1QX5 B;  3O6B A;  5JJG A;  4GPL B;  5CSF A;  4YGB B;  2LHL A;  1OMD A;  2F3Y A;  2G9B A;  2F3Z A;  4BY5 A;  2LLT A;  2WOR A;  2PRU A;  1CFP A;  2I2R E;  2EGD A;  1A29 A;  1S6I A;  1NIW A; 
#chains in the Genus database with same CATH topology
 1WDC C;  5ER5 A;  1DJX A;  2PQL A;  1QIW A;  4MRY A;  1EJ3 A;  2O60 A;  1QAS A;  4I5L B;  4NDD A;  2IS9 A;  1XFV O;  2JTT A;  3QME A;  1PSB A;  1F4Q A;  4JKT A;  3SG7 A;  5I2Q A;  3F45 A;  3RZS A;  1DJZ A;  5I94 A;  3IVT A;  1H8B A;  2BL0 B;  2OTG C;  3PM8 A;  2KI6 D;  2M49 B;  3M0W A;  1NSH A;  3B87 A;  4PE4 A;  1DF0 B;  5HLO A;  1CMG A;  3EK7 A;  1GJY A;  5FI6 A;  4MVF A;  3DF0 A;  1MF8 B;  3FWC A;  1FPW A;  1S36 A;  1Z2C B;  3S0D A;  1XFR A;  3SS3 A;  1KCY A;  2JOJ A;  2M7N A;  1YR5 A;  1UHI A;  3EK4 A;  3NSL A;  3PAL A;  1J7Q A;  1V1G A;  3JVT B;  3EK8 A;  3KHE A;  3PLF B;  3FE9 A;  3SG2 A;  1XFU O;  3LL8 B;  1SBJ A;  3PN7 B;  4PHM A;  4ZCU A;  1BG1 A;  4FQT A;  3K21 A;  3L47 A;  4I5J A;  2FCD A;  4Q04 A;  4YRU A;  4ORB B;  1REC A;  4JD9 A;  2CTN A;  2PSR A;  1GGW A;  2Y5I A;  1FBV A;  1R2U A;  2EHB A;  1NPQ A;  1SPY A;  1AJ4 A;  1C3Z A;  3QRX A;  1TCO B;  3AKA A;  2KNE A;  1B8C A;  2Q4U A;  3VRN A;  2BAP A;  1LA0 A;  3CR5 X;  1IIO A;  2HF5 A;  2MBX A;  1LVC D;  3WHU B;  1SL7 A;  4DIR A;  2KGB C;  3NHI A;  4UPG A;  5D69 A;  1NX2 A;  1G33 A;  2GGZ A;  1K8U A;  1TNW A;  3SG5 A;  1CFF A;  3TZ1 A;  2KGR A;  2KLD A;  2ZN9 A;  2PAL A;  2WND A;  2KHN A;  2LVI A;  1QIV A;  1UHH A;  2BCB A;  1VRK A;  1YX7 A;  2CNP A;  4GFT A;  2BKH B;  2RGI A;  1DJW A;  2QDI A;  2AUC A;  1ALV A;  3BUW B;  1K9P A;  1MWN A;  4PE7 A;  1IGV A;  4AQI A;  3CWG A;  2Y4Q A;  3DVE A;  1K96 A;  3K1E A;  3BUX B;  3H4S E;  2P71 A;  2LUX A;  5FI7 A;  1F70 A;  2KAX A;  1Y6W A;  2DOQ A;  2KPH A;  3DZT A;  2A4J A;  1W7J B;  2FOT A;  3BOW A;  3I5I C;  4USL A;  1D1O A;  3PAT A;  4DRW A;  3KO0 A;  3A4U B;  1T14 A;  2HQ8 A;  4HSZ A;  2K7B A;  3OX6 A;  4GGN A;  4XJK B;  1DT7 B;  4FTG A;  1CLB A;  2BE6 A;  3PM2 A;  3JTD C;  3D0Y B;  1F71 A;  1E8A A;  1DEL A;  1A75 A;  3BJH A;  1XFY O;  4MSP A;  1RK9 A;  1ZUZ A;  1JWD A;  4CID A;  2PMY A;  3AAJ A;  3SG3 A;  1F54 A;  4XJK A;  3TUY C;  3I5H C;  1L2O B;  4QJ4 B;  3CZ0 A;  5CSI A;  3OX5 A;  1K94 A;  1EXR A;  3TDU A;  4IJ7 A;  2LAN A;  3ZNI A;  2QEB A;  1YVL A;  3SG4 A;  1K93 D;  1HQV A;  1WRL A;  3VB1 A;  2KOT A;  1SY9 A;  4CLN A;  1GGZ A;  2FCE A;  1YUT A;  1LIN A;  2K61 A;  3R72 A;  2KYF A;  5IBW A;  1QVI Z;  4QJ3 B;  1OQP A;  1OW4 A;  1YVH A;  4F0Z B;  3L4A A;  1YUS A;  4E68 A;  3VRO A;  1UUR A;  1ZOT B;  2K7D A;  3CR2 A;  1BLQ A;  4HRG A;  4ORA B;  3B86 A;  3TS5 B;  2K7O A;  2JT3 A;  3C1V A;  2KQ6 A;  1M45 A;  1CDP A;  4OR9 B;  2NXQ A;  1IG5 A;  1KFX L;  1LKJ A;  4OKH A;  1ALW A;  1DGU A;  3D78 A;  1B4C A;  2WCL A;  3TDI A;  2JU0 A;  3CTN A;  2CT9 A;  4MZJ A;  4ZCV A;  3CLN A;  2K0J A;  3A8R A;  1TUZ A;  1S6J A;  4M2P A;  3DYE A;  3B7A A;  1DJY A;  3V2L A;  1S1E A;  1XYD A;  1CNP A;  2LMU A;  1TWO A;  2MA2 A;  1SR6 C;  2FJY A;  1FI5 A;  2KI4 B;  1IWQ A;  2L2E A;  3E3R A;  4JPZ B;  2JT0 A;  5CSN A;  3I5G C;  1C7W A;  1ZFS A;  1TRF A;  5D3O A;  2L98 A;  2JNF A;  4GUK A;  3TUY B;  1QS7 A;  4N5X A;  3OBV A;  3LCP C;  1PUL A;  1IRJ A;  3NXA A;  3FWB A;  3OP0 A;  2BEC A;  1OOH A;  1J1E A;  4ORC B;  1R6P A;  2K60 A;  1YUU A;  1UWO A;  4YGE B;  2MAZ A;  1J7R A;  3D75 A;  2WC6 A;  4ETO A;  1B1G A;  1A2X A;  3CS1 A;  1CTR A;  1JBA A;  1WRK A;  1IJ6 A;  5HKY A;  3D77 A;  2M3W A;  5HYD A;  1B7T Z;  3O4Y A;  1J55 A;  3DF0 B;  2LC5 A;  3OHM B;  4C0J A;  2LVV A;  3OB1 B;  3S0G A;  1B8L A;  1KK8 B;  2WCK A;  1S26 D;  5KTY A;  3DXL A;  2LLS A;  2MHH A;  2JZI A;  1LS8 A;  1MXL C;  1Z4H A;  2SCP A;  3BFA A;  3WXA A;  1KK7 Z;  3ICB A;  2MRD A;  3VRP A;  2EC6 C;  4CFQ A;  1A4P A;  2QEV A;  1N2D A;  1NCX A;  4MBE A;  2K2A A;  3IQO A;  3NSK A;  3Q8I A;  3OGN A;  4PDZ A;  1TN4 A;  3D10 A;  1C3Y A;  1TIZ A;  1W7I B;  2GV5 A;  2I7A A;  3NSO A;  1W9Z A;  2BE4 A;  2BNX A;  2M9G A;  2WCH A;  1KK7 Y;  1QX7 A;  4MRX A;  4MZK A;  1AP4 A;  2WCM A;  3CZT X;  2QAC A;  2F2O A;  2PYQ A;  2P6B B;  1IH0 A;  2L50 A;  1SR6 B;  2QEH A;  2LVK A;  2M29 A;  4YGD B;  3FS7 A;  1S5G Z;  2JT8 A;  1Y0V H;  4PHJ A;  1CDL A;  1KSM A;  4YGA A;  1WLM A;  1BJF A;  1RWY A;  2LHI A;  1NUB A;  3I5G B;  4MEW A;  5AER A;  2M8U A;  1CM1 A;  1EG4 A;  1G4Y R;  1QAT A;  4CFR A;  2OS8 C;  1FW4 A;  4D1E A;  2ISD A;  5I2O A;  2I18 A;  1BOD A;  1TNP A;  1BR1 B;  1WDC B;  3GK1 A;  1QJT A;  5AFP A;  2LVJ A;  4WQ3 A;  2FJU B;  1SSE B;  4KYN A;  2R2I A;  2M97 A;  2NLN A;  3CAB A;  2KAV A;  1Q80 A;  2H8V A;  1K9U A;  4NDB A;  5GQQ C;  1U5I A;  1RFJ A;  1CB1 A;  1SMG A;  2KFF A;  1KFU S;  2OTG B;  2BKI B;  4A4B A;  1CDN A;  2H2K A;  3BOW B;  1TOP A;  4DS7 A;  2HPS A;  3ZWH A;  1CDM A;  1DJG A;  2CBL A;  5CPV A;  1FI6 A;  2JPT A;  2JWW A;  3BFB A;  1SL9 A;  5DIC A;  2K2F A;  2D8N A;  2K7C A;  2L5Y A;  5HKW A;  1EH2 A;  1A75 B;  4PCW A;  3MSE B;  5KSZ A;  1WLZ A;  1YX8 A;  1BMO A;  2KAY A;  4M2Q A;  2KBM A;  2WCE A;  1XVJ A;  5B8I B;  2LE9 B;  1GQM A;  1SK6 D;  1X02 A;  1NX3 A;  1F55 A;  1NCZ A;  1K95 A;  4JWQ A;  2Y1N A;  2KI6 C;  3BUO B;  3CDN A;  3SJS A;  1IQ3 A;  2CCM A;  1J1D A;  2JQ6 A;  2CXJ A;  1PVA A;  3EKJ A;  1JFJ A;  4M2O A;  2NCO A;  1ORG A;  1S3P A;  1FF1 A;  2GTE A;  3CZ1 A;  4JQ0 D;  3EVV A;  1C07 A;  1LXF C;  2LUC A;  1F4O A;  1PSR A;  1NP8 A;  1QLK A;  1J7O A;  1V1F A;  5G08 A;  1AJ5 A;  2LV7 A;  2Y1M A;  5PAL A;  1UP5 A;  1OOJ A;  2JXL A;  5I8N A;  3NGV A;  2BCX A;  5TNC A;  3O4X A;  4PHK A;  1MQ1 A;  1HT9 A;  1QVI Y;  1CMF A;  3S0A A;  2WC5 A;  1PRW A;  2ZRT A;  5F6T A;  5HKZ A;  2COL B;  5JOL A;  1C7V A;  2LMV A;  1RJV A;  1PK0 D;  3BFH A;  1MUX A;  2L51 A;  3PFV A;  4YI9 A;  2O5G A;  4INW A;  1XK4 C;  3BYA A;  1OE9 B;  2QEO A;  3I5I B;  3LK1 A;  1BR4 B;  2ZFD A;  3R1P A;  4WQ2 A;  3UNW A;  3SS5 A;  1AUI B;  1JC2 A;  1Y1A A;  3JTD B;  4YBH B;  5EL2 A;  3RLZ A;  1PVB A;  1JF0 A;  1SYM A;  1DQE A;  2MLF C;  4FQO A;  2SAS A;  1H4B A;  2WCB A;  1M46 A;  2NCP A;  3UO9 A;  3I5H B;  3JVT C;  4A4C A;  1XFX O;  5FYX A;  2JRF A;  2VRG A;  2LAP A;  4L9M A;  4XYN A;  1DVI A;  3PN7 C;  1JUO A;  2QPT A;  3TDZ A;  3AKB A;  3N7H A;  1J7P A;  1QV0 A;  1K2H A;  3PJI A;  4BY4 A;  3FE6 A;  1OOI X;  2HET A;  1XA5 A;  5D7F A;  1OMR A;  3LLE A;  2KFH A;  5BPJ A;  3SIA A;  1OZO A;  1GM0 A;  1YTZ C;  4TNC A;  5DKQ A;  5HLV A;  1TUJ A;  2NZ0 A;  1SRA A;  3CR4 X;  2JNX A;  1AHR A;  3SG6 A;  1EG3 A;  2L4I A;  4HRE E;  2Q91 A;  1B7T Y;  3LK0 A;  3PSR A;  3IQQ A;  1JSA A;  1IJ5 A;  2M1K B;  2WCF A;  3NSI A;  4DUQ A;  4F7F A;  1YRU B;  2H61 C;  2PVB A;  1QXP A;  4GAO A;  2HQW A;  2L5X B;  4GGF A;  4ICB A;  1NX0 A;  4R1E A;  1DJH A;  5CSJ A;  3OB2 B;  2V53 A;  1OMV A;  2KQY A;  3I5F C;  1CLL A;  4C0L A;  3GK4 X;  1KWO C;  1UHK A;  2ZRS A;  1BU3 A;  2KDH A;  1N0Y A;  3NHT A;  1CFD A;  3D73 A;  2BBM A;  4AQJ A;  2L2C A;  2LCP A;  3CGA A;  3BQ3 A;  2M7L A;  2KBI A;  3EKH A;  2F33 A;  3EVU A;  1B8R A;  2PAS A;  4NDC A;  3VRR A;  1AK8 A;  1DMO A;  1IKU A;  1AVS A;  1XK4 A;  1Y1U A;  4MLW A;  1SL8 A;  1WRZ A;  5KU1 A;  3WHT B;  1DF0 A;  3HX4 A;  5AEQ A;  1U5I B;  1S5G Y;  1MR8 A;  1XFZ O;  2JPO A;  3BXK A;  5I2L A;  2KYC A;  1A03 A;  5K89 A;  1BOC A;  4PE1 A;  1YRT B;  1L2O C;  4INX A;  4AOM A;  1ZAC A;  4I5K A;  4YI8 A;  4DCK A;  2GGM A;  4OVN F;  2BBN A;  1DEK A;  2WC8 A;  3DVM A;  1CKK A;  1EL4 A;  1SNL A;  1KFU L;  1SCM C;  3FE8 A;  2JUL A;  2ZKM X;  5FI2 A;  1PAL A;  1QV1 A;  2MLE C;  3B88 A;  1DJI A;  1B9A A;  1LA3 A;  5J3X A;  1CFC A;  3VGO A;  1BF5 A;  3RM1 A;  2EC6 B;  4PT1 A;  4GBA A;  1WY9 A;  3EG5 B;  1NCY A;  1UHJ A;  4N1F A;  1YUR A;  3BUN B;  1K9K A;  4YGC B;  2ERB A;  2WCJ A;  3EVR A;  4PHN A;  3AAK A;  5AXI A;  1F8H A;  3I5F B;  1DTL A;  1L7Z A;  1S6C A;  1KWO B;  1RTP 1;  1CLM A;  1TTX A;  2H61 A;  2KSP A;  2M1U A;  1UHN A;  3TS5 C;  1SW8 A;  2LP2 A;  1NX1 A;  3WNX B;  3DY9 A;  4IL1 A;  3R1O A;  2L4H A;  2G2B A;  2KLE A;  2L0P A;  1QLS A;  3CZ2 A;  3KEV A;  3CYZ A;  4MN0 A;  4WRI A;  1IQ5 A;  3O78 A;  2LM5 A;  2JXC A;  3DVK A;  2OS8 B;  4PE0 A;  2KI4 C;  2AAO A;  2JTZ A;  3GK2 A;  1KQM C;  3B6X A;  2WOS A;  3KPX A;  3L4L A;  3S0E A;  1DC1 A;  3S0F A;  3GOF A;  4GGF C;  2JC2 A;  1SCV A;  4N1G A;  1QTX A;  3DVJ A;  1BT6 A;  1UUS A;  1TNX A;  3DD4 A;  3KF9 A;  4NQG A;  2LLU A;  3D0Y A;  2K8M B;  1NWD A;  2OPO A;  5HL1 A;  2F8P A;  1ODB A;  3D74 A;  1DGV A;  2AMI A;  4OCI A;  1SCM B;  2B1U A;  4C0K A;  1MHO A;  1N65 A;  2ZND A;  4P5O E;  4P2Y B;  3VRQ A;  4HRH A;  3IF7 A;  4I5N B;  1TNQ A;  2BL0 C;  2LMT A;  3FIA A;  2MJW B;  1KK8 C;  1MXE A;  4GNK B;  2E6W A;  2KFG A;  1KQV A;  3S0B A;  1KFX S;  2M0R A;  5ER4 X;  5DKR A;  4QJ5 B;  1OZS A;  2BCA A;  3BUM B;  1Y1X A;  5DKN A;  3SS4 A;  2ZNE A;  1OSA A;  5AAN A;  1QWV A;  2I94 A;  1G8I A;  1P28 A;  4PAL A;  1XFW O;  2F2P A;  1K90 D;  1B47 A;  4OV2 A;  1TCF A;  1M31 A;  4U8D A;  1RRO A;  3HCM A;  4MZL A;  1OOF A;  1KSO A;  3SIB A;  1JF2 A;  1NYA A;  1JFK A;  1OOG A;  1ZMZ A;  1SKT A;  2LP3 A;  2TN4 A;  4OZD A;  3R1V A;  4CPV A;  1M39 A;  2ZN8 A;  2YGU A;  1M63 B;  1CM4 A;  1QX2 A;  2E30 A;  1XO5 A;  2LNK A;  3D76 A;  3O2P A;  1KQM B;  1QX5 B;  3O6B A;  5JJG A;  4GPL B;  5CSF A;  4YGB B;  2LHL A;  1OMD A;  2F3Y A;  2G9B A;  2F3Z A;  4BY5 A;  2LLT A;  2WOR A;  2PRU A;  1CFP A;  2P70 A;  2I2R E;  2EGD A;  1A29 A;  1S6I A;  1NIW A; 
#chains in the Genus database with same CATH homology
 1WDC C;  5ER5 A;  1DJX A;  1QIW A;  4MRY A;  1EJ3 A;  2O60 A;  1QAS A;  4I5L B;  4NDD A;  2IS9 A;  1XFV O;  2JTT A;  1PSB A;  1F4Q A;  3SG7 A;  5I2Q A;  3F45 A;  1DJZ A;  1H8B A;  2BL0 B;  2OTG C;  3PM8 A;  2KI6 D;  2M49 B;  3M0W A;  1NSH A;  4PE4 A;  1DF0 B;  5HLO A;  1CMG A;  3EK7 A;  1GJY A;  4MVF A;  3DF0 A;  1MF8 B;  3FWC A;  1FPW A;  1S36 A;  1KCY A;  2JOJ A;  2M7N A;  1YR5 A;  1UHI A;  3EK4 A;  3NSL A;  3PAL A;  1J7Q A;  1V1G A;  3JVT B;  3EK8 A;  3KHE A;  3PLF B;  3SG2 A;  1XFU O;  3LL8 B;  1SBJ A;  3PN7 B;  4PHM A;  4ZCU A;  1BG1 A;  4Q04 A;  3K21 A;  4I5J A;  2FCD A;  4YRU A;  4ORB B;  1REC A;  2CTN A;  2PSR A;  1GGW A;  2Y5I A;  1FBV A;  1R2U A;  2EHB A;  1NPQ A;  1SPY A;  1AJ4 A;  3QRX A;  1TCO B;  3AKA A;  2KNE A;  1B8C A;  2Q4U A;  3VRN A;  1LA0 A;  3CR5 X;  2HF5 A;  2MBX A;  1LVC D;  3WHU B;  1SL7 A;  4DIR A;  2KGB C;  4UPG A;  5D69 A;  1NX2 A;  1G33 A;  2GGZ A;  1K8U A;  1TNW A;  3SG5 A;  1CFF A;  3TZ1 A;  2KGR A;  2ZN9 A;  2PAL A;  2WND A;  2KHN A;  2LVI A;  1QIV A;  1UHH A;  2BCB A;  1VRK A;  1YX7 A;  2CNP A;  4GFT A;  2BKH B;  2RGI A;  1DJW A;  2AUC A;  1ALV A;  3BUW B;  1K9P A;  1MWN A;  4PE7 A;  1IGV A;  4AQI A;  3CWG A;  2Y4Q A;  3DVE A;  1K96 A;  3BUX B;  3H4S E;  2LUX A;  1F70 A;  2KAX A;  1Y6W A;  2DOQ A;  4USL A;  2A4J A;  1W7J B;  2FOT A;  3BOW A;  3I5I C;  1D1O A;  3PAT A;  4DRW A;  3KO0 A;  3A4U B;  2HQ8 A;  4HSZ A;  2K7B A;  3OX6 A;  4GGN A;  4XJK B;  1DT7 B;  4FTG A;  1CLB A;  2BE6 A;  3JTD C;  3D0Y B;  1F71 A;  1E8A A;  1A75 A;  4MSP A;  1XFY O;  1RK9 A;  1ZUZ A;  1JWD A;  4CID A;  2PMY A;  3AAJ A;  3SG3 A;  1F54 A;  4XJK A;  3TUY C;  3I5H C;  1L2O B;  4QJ4 B;  5CSI A;  3OX5 A;  1K94 A;  1EXR A;  3TDU A;  2LAN A;  3ZNI A;  1YVL A;  3SG4 A;  1K93 D;  1HQV A;  1WRL A;  2KOT A;  1SY9 A;  4CLN A;  1GGZ A;  2FCE A;  1YUT A;  1LIN A;  2K61 A;  2KYF A;  5IBW A;  1QVI Z;  4QJ3 B;  1OQP A;  1YVH A;  4F0Z B;  1YUS A;  4E68 A;  3VRO A;  1UUR A;  1ZOT B;  2K7D A;  3CR2 A;  1BLQ A;  4HRG A;  4ORA B;  3TS5 B;  2K7O A;  2JT3 A;  3C1V A;  2KQ6 A;  1M45 A;  1CDP A;  4OR9 B;  2NXQ A;  1IG5 A;  1KFX L;  1LKJ A;  4OKH A;  1ALW A;  1DGU A;  1B4C A;  3TDI A;  2JU0 A;  3CTN A;  2CT9 A;  4MZJ A;  4ZCV A;  3CLN A;  2K0J A;  3A8R A;  1S6J A;  4M2P A;  1DJY A;  1S1E A;  1XYD A;  1CNP A;  2LMU A;  2MA2 A;  1SR6 C;  1FI5 A;  2KI4 B;  1IWQ A;  2L2E A;  3E3R A;  4JPZ B;  2JT0 A;  5CSN A;  3I5G C;  1C7W A;  1ZFS A;  1TRF A;  2L98 A;  2JNF A;  4GUK A;  3TUY B;  1QS7 A;  4N5X A;  3LCP C;  1PUL A;  1IRJ A;  3NXA A;  3FWB A;  3OP0 A;  2BEC A;  1J1E A;  4ORC B;  1R6P A;  1YUU A;  1UWO A;  4YGE B;  2MAZ A;  1J7R A;  4ETO A;  1B1G A;  1A2X A;  3CS1 A;  1CTR A;  1JBA A;  1WRK A;  1IJ6 A;  5HKY A;  2M3W A;  5HYD A;  1B7T Z;  3O4Y A;  1J55 A;  3DF0 B;  2LC5 A;  3OHM B;  4C0J A;  2LVV A;  3OB1 B;  1B8L A;  1KK8 B;  1S26 D;  5KTY A;  2LLS A;  2MHH A;  2JZI A;  1MXL C;  3WXA A;  2SCP A;  1KK7 Z;  3ICB A;  2MRD A;  3VRP A;  2EC6 C;  4CFQ A;  1A4P A;  1N2D A;  1NCX A;  4MBE A;  2K2A A;  3IQO A;  3NSK A;  4PDZ A;  1TN4 A;  3D10 A;  1TIZ A;  1W7I B;  2GV5 A;  2I7A A;  3NSO A;  2BE4 A;  4MRX A;  2M9G A;  4MZK A;  1KK7 Y;  1QX7 A;  1AP4 A;  3CZT X;  2QAC A;  2F2O A;  2P6B B;  1IH0 A;  2L50 A;  1SR6 B;  2LVK A;  2M29 A;  4YGD B;  3FS7 A;  1S5G Z;  2JT8 A;  1Y0V H;  4PHJ A;  1CDL A;  1KSM A;  4YGA A;  1WLM A;  1BJF A;  1RWY A;  2LHI A;  1NUB A;  3I5G B;  4MEW A;  5AER A;  2M8U A;  1CM1 A;  1EG4 A;  1G4Y R;  1QAT A;  4CFR A;  2OS8 C;  1FW4 A;  4D1E A;  2ISD A;  5I2O A;  2I18 A;  1BOD A;  1TNP A;  1BR1 B;  1WDC B;  3GK1 A;  1QJT A;  5AFP A;  2LVJ A;  4WQ3 A;  2FJU B;  2R2I A;  2M97 A;  2NLN A;  2KAV A;  1Q80 A;  4NDB A;  1K9U A;  5GQQ C;  1U5I A;  1RFJ A;  1CB1 A;  1SMG A;  2KFF A;  1KFU S;  2OTG B;  2BKI B;  4A4B A;  1CDN A;  2H2K A;  3BOW B;  1TOP A;  4DS7 A;  2HPS A;  3ZWH A;  1CDM A;  1DJG A;  2CBL A;  5CPV A;  1FI6 A;  2JPT A;  2JWW A;  1SL9 A;  2K2F A;  2D8N A;  2K7C A;  5HKW A;  1EH2 A;  1A75 B;  4PCW A;  3MSE B;  5KSZ A;  1WLZ A;  1YX8 A;  1BMO A;  2KAY A;  4M2Q A;  2KBM A;  2WCE A;  1XVJ A;  5B8I B;  2LE9 B;  1GQM A;  1SK6 D;  1X02 A;  1NX3 A;  1F55 A;  1NCZ A;  1K95 A;  4JWQ A;  2Y1N A;  2KI6 C;  3BUO B;  3SJS A;  1IQ3 A;  2CCM A;  1J1D A;  2JQ6 A;  2CXJ A;  1PVA A;  3EKJ A;  1JFJ A;  4M2O A;  2NCO A;  1S3P A;  1FF1 A;  4JQ0 D;  3EVV A;  1C07 A;  1LXF C;  2LUC A;  1F4O A;  1PSR A;  1NP8 A;  1QLK A;  1J7O A;  1V1F A;  5G08 A;  1AJ5 A;  2LV7 A;  2Y1M A;  5PAL A;  1UP5 A;  1OOJ A;  2JXL A;  5I8N A;  2BCX A;  5TNC A;  4PHK A;  1MQ1 A;  1HT9 A;  1QVI Y;  1CMF A;  1PRW A;  2ZRT A;  5F6T A;  5HKZ A;  2COL B;  5JOL A;  1C7V A;  2LMV A;  1RJV A;  1PK0 D;  1MUX A;  2L51 A;  3PFV A;  4YI9 A;  2O5G A;  1XK4 C;  3BYA A;  1OE9 B;  3I5I B;  3LK1 A;  1BR4 B;  2ZFD A;  4WQ2 A;  1AUI B;  1JC2 A;  1Y1A A;  3JTD B;  4YBH B;  3RLZ A;  1PVB A;  1JF0 A;  1SYM A;  2MLF C;  4FQO A;  2SAS A;  1H4B A;  2WCB A;  1M46 A;  2NCP A;  3I5H B;  3JVT C;  4A4C A;  1XFX O;  5FYX A;  2JRF A;  2VRG A;  2LAP A;  4L9M A;  4XYN A;  1DVI A;  3PN7 C;  1JUO A;  2QPT A;  3TDZ A;  3AKB A;  1J7P A;  1QV0 A;  1K2H A;  4BY4 A;  2HET A;  1XA5 A;  5D7F A;  1OMR A;  3LLE A;  2KFH A;  5BPJ A;  3SIA A;  1OZO A;  1YTZ C;  4TNC A;  5DKQ A;  5HLV A;  2NZ0 A;  1SRA A;  3CR4 X;  2JNX A;  1AHR A;  3SG6 A;  1EG3 A;  2L4I A;  4HRE E;  2Q91 A;  1B7T Y;  3LK0 A;  3PSR A;  3IQQ A;  1JSA A;  1IJ5 A;  2M1K B;  2WCF A;  3NSI A;  4DUQ A;  1YRU B;  2H61 C;  2PVB A;  1QXP A;  4GAO A;  2HQW A;  2L5X B;  4GGF A;  4ICB A;  1NX0 A;  4R1E A;  1DJH A;  5CSJ A;  3OB2 B;  2V53 A;  1OMV A;  2KQY A;  3I5F C;  1CLL A;  4C0L A;  3GK4 X;  1KWO C;  1UHK A;  2ZRS A;  1BU3 A;  2KDH A;  1N0Y A;  1CFD A;  2BBM A;  4AQJ A;  2LCP A;  3CGA A;  3BQ3 A;  2M7L A;  2KBI A;  3EKH A;  2F33 A;  3EVU A;  1B8R A;  2PAS A;  4NDC A;  3VRR A;  1AK8 A;  1DMO A;  1IKU A;  1AVS A;  1XK4 A;  1Y1U A;  4MLW A;  1SL8 A;  1WRZ A;  5KU1 A;  3WHT B;  1DF0 A;  3HX4 A;  5AEQ A;  1U5I B;  1S5G Y;  1MR8 A;  1XFZ O;  5I2L A;  3BXK A;  2KYC A;  1A03 A;  5K89 A;  1BOC A;  4PE1 A;  1YRT B;  1L2O C;  4AOM A;  1ZAC A;  4I5K A;  4YI8 A;  4DCK A;  2GGM A;  4OVN F;  2BBN A;  2WC8 A;  3DVM A;  1CKK A;  1EL4 A;  1SNL A;  1KFU L;  1SCM C;  2JUL A;  2ZKM X;  1PAL A;  1QV1 A;  2MLE C;  1CFC A;  1DJI A;  1B9A A;  1LA3 A;  5J3X A;  3VGO A;  1BF5 A;  3RM1 A;  2EC6 B;  4GBA A;  1WY9 A;  4N1F A;  1NCY A;  1UHJ A;  1YUR A;  3BUN B;  1K9K A;  4YGC B;  3EVR A;  4PHN A;  3AAK A;  5AXI A;  1F8H A;  3I5F B;  1DTL A;  1L7Z A;  1S6C A;  1KWO B;  1RTP 1;  1CLM A;  1TTX A;  2H61 A;  2KSP A;  2M1U A;  1UHN A;  3TS5 C;  1SW8 A;  2LP2 A;  1NX1 A;  3WNX B;  4IL1 A;  2L4H A;  2G2B A;  2L0P A;  1QLS A;  3KEV A;  4MN0 A;  4WRI A;  1IQ5 A;  3O78 A;  2LM5 A;  2JXC A;  3DVK A;  2OS8 B;  4PE0 A;  2KI4 C;  2AAO A;  2JTZ A;  3GK2 A;  1KQM C;  3KPX A;  2WOS A;  3GOF A;  4GGF C;  2JC2 A;  1SCV A;  4N1G A;  1QTX A;  3DVJ A;  1BT6 A;  1UUS A;  1TNX A;  3DD4 A;  3KF9 A;  4NQG A;  2LLU A;  3D0Y A;  2K8M B;  1NWD A;  2OPO A;  2F8P A;  1ODB A;  1DGV A;  2AMI A;  4OCI A;  1SCM B;  2B1U A;  4C0K A;  1MHO A;  1N65 A;  2ZND A;  4P5O E;  4P2Y B;  3VRQ A;  4HRH A;  3IF7 A;  4I5N B;  1TNQ A;  2BL0 C;  2LMT A;  3FIA A;  2MJW B;  1KK8 C;  1MXE A;  4GNK B;  2E6W A;  2KFG A;  1KQV A;  1KFX S;  2M0R A;  5ER4 X;  5DKR A;  4QJ5 B;  1OZS A;  2BCA A;  3BUM B;  1Y1X A;  5DKN A;  2ZNE A;  1OSA A;  5AAN A;  2I94 A;  1G8I A;  4PAL A;  1XFW O;  2F2P A;  1K90 D;  1B47 A;  4OV2 A;  1TCF A;  1M31 A;  4U8D A;  1RRO A;  3HCM A;  4MZL A;  1KSO A;  3SIB A;  1JF2 A;  1NYA A;  1JFK A;  1ZMZ A;  1SKT A;  2LP3 A;  2TN4 A;  4CPV A;  1M39 A;  2ZN8 A;  1M63 B;  1CM4 A;  1QX2 A;  2E30 A;  1XO5 A;  2LNK A;  3O2P A;  1KQM B;  1QX5 B;  3O6B A;  5JJG A;  4GPL B;  5CSF A;  4YGB B;  2LHL A;  1OMD A;  2F3Y A;  2G9B A;  2F3Z A;  4BY5 A;  2LLT A;  2WOR A;  2PRU A;  1CFP A;  2I2R E;  2EGD A;  1A29 A;  1S6I A;  1NIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...