3I5IB

The crystal structure of squid myosin s1 in the presence of so4 2-
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain isoform A
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB01
4CLNA 3LCPC 2LUXA 2B1UA 1S6IA 1WY9A 1AJ4A 1QTXA 4CFQA 1K9UA 3CR2A 4ORBB 5KU1A 2JXLA 2SCPA 1JUOA 2KAVA 3PFVA 5ER4X 4PE1A 1RWYA 3VRNA 1XYDA 2KSPA 1TNQA 2M3WA 2OTGC 2KFGA 3AAJA 4WRIA 4HRHA 1BU3A 2WCEA 3WXAA 4AQJA 2LLUA 1QATA 1CFFA 4JPZB 1MR8A 1AVSA 1CDPA 2OS8B 1ZOTB 1DMOA 2E6WA 3AKBA 1TNXA 1KFXL 4P2YB 1KK8B 4YGEB 2JT0A 2DOQA 4NDBA 2GGMA 1WRLA 2AMIA 1CDLA 3VROA 1SL9A 1XFWO 1UHIA 1GQMA 1DT7B 1CMGA 2L4HA 1Q80A 2LVIA 3DVKA 3OB2B 2JU0A 1MXEA 2JOJA 3I5GB 4A4CA 3TDZA 1BODA 1YR5A 1A2XA 1NX0A 3D0YA 3EK8A 2JT3A 3EVUA 5ER5A 3DF0B 3LL8B 2LLSA 1S6JA 1UURA 1B8CA 1WLZA 3SJSA 1BT6A 1SCVA 4XJKA 2Q4UA 1YUSA 4AOMA 2M1UA 2L0PA 4PALA 2LNKA 2JZIA 2Y5IA 3BUOB 5TNCA 2L4IA 2Y4QA 4I5JA 1AUIB 3O78A 1NCYA 1XFUO 2KFHA 2PRUA 3PN7B 1UP5A 4N1GA 1PALA 2FJUB 4PCWA 4NDCA 2G9BA 2KBIA 2F3YA 2LUCA 1PVBA 3D10A 3IF7A 1F8HA 2G2BA 3CGAA 3NXAA 4YGBB 3CS1A 1NCXA 3OX6A 3GK4X 4YI9A 1DF0B 5HKWA 1KK7Z 1SMGA 1TCOB 1DJZA 5D69A 1U5IB 3KO0A 2NZ0A 1KWOC 4C0LA 2F2OA 3I5FC 4YGAA 1CKKA 5CSNA 1MQ1A 2HQ8A 2H2KA 2BL0B 2KOTA 1J7RA 1CTRA 1R6PA 2SASA 2ZKMX 2K2FA 3CWGA 2QACA 4MZLA 1IGVA 1K8UA 5D7FA 1KFXS 4YGDB 2PVBA 3LK1A 2M49B 3SIBA 4F0ZB 3NSKA 4UPGA 2E30A 1XFVO 3BXKA 3EVVA 1BR4B 1C7VA 2R2IA 1S36A 4USLA 2LM5A 2ISDA 1AHRA 5DKQA 2PMYA 3BQ3A 4ZCVA 2KGBC 1FW4A 5HLOA 4C0KA 3MSEB 2QPTA 2KI4C 3EKHA 5PALA 2LMTA 2JQ6A 3FIAA 4HSZA 1NYAA 2M1KB 1A75B 3F45A 4MRYA 4MSPA 4QJ3B 2LHIA 3FWBA 2BCAA 1PSBA 2EC6C 4GGFA 4PE0A 1FI5A 1PVAA 1PK0D 1A29A 3TUYC 4M2OA 1N65A 3AAKA 4DUQA 2LVVA 2NXQA 1OMVA 1B9AA 1RROA 3KF9A 1LXFC 3ZNIA 1IQ5A 2KYCA 1SL8A 2K7DA 1WDCB 5AFPA 2TN4A 1AK8A 1SNLA 3OB1B 1TNPA 5HYDA 1LA0A 2L51A 2WC8A 3CZTX 3K21A 1F70A 1OOJA 2LVJA 1XFYO 4OR9B 1FBVA 2K61A 1DGVA 1EXRA 2OS8C 3EVRA 1K90D 2COLB 2M29A 4GPLB 1KK8C 5AERA 1LKJA 5KTYA 1BG1A 1M63B 2WORA 4DS7A 1QX7A 1VRKA 3BOWA 3OX5A 1CM1A 2I94A 2NCPA 1R2UA 2O60A 1EJ3A 4I5LB 4CFRA 1K9KA 3I5GC 3O4YA 1BJFA 1YX7A 3I5IB 1KFUS 5HKZA 1CDMA 4TNCA 1KSOA 1OE9B 1XFXO 4HREE 1IRJA 1RECA 2JC2A 1ZFSA 1D1OA 2CXJA 2FOTA 2MLEC 2OPOA 1SKTA 5HLVA 5AXIA 1WRKA 3KPXA 2MJWB 4PHKA 3I5HB 1E8AA 1ZACA 2CCMA 4GBAA 4XYNA 1CLLA 1UHJA 2A4JA 1ALVA 3PN7C 4CIDA 1UWOA 2WCBA 1EG3A 5DKRA 3FS7A 2D8NA 1YUTA 5G08A 1N0YA 1XA5A 1LVCD 1QVIY 1Y1UA 3GOFA 2V53A 2IS9A 3ICBA 1CDNA 3BUNB 4OCIA 2L2EA 1X02A 4I5NB 3DD4A 1DJGA 1J7OA 3EKJA 3C1VA 3ZWHA 3KHEA 3TS5B 1L7ZA 1DJHA 1NUBA 1SPYA 4AQIA 4XJKB 4C0JA 3O2PA 3TDUA 2M7LA 3VRQA 2ZRTA 4OKHA 5CPVA 4YBHB 1B1GA 1CLBA 5IBWA 1S26D 3JTDC 4GGFC 3SG4A 1BLQA 2LV7A 2OTGB 2HQWA 3DF0A 1AP4A 1W7IB 1TTXA 4I5KA 2M97A 2KNEA 1OQPA 2LP3A 5K89A 1F4OA 4CPVA 1NP8A 4WQ3A 2M9GA 1K95A 1SCMC 2LANA 4IL1A 1YX8A 4GFTA 1JFKA 1K94A 1EG4A 2BCXA 2EHBA 2KGRA 2M0RA 4DCKA 1BOCA 3JVTB 2CBLA 1J55A 4JQ0D 2KAXA 2NCOA 4QJ5B 4BY4A 1RJVA 5CSJA 1GJYA 4OV2A 3SG6A 1GGZA 1RTP1 1SYMA 1KFUL 1DF0A 1RK9A 1U5IA 1J1EA 1K93D 1QIWA 4YI8A 4P5OE 1WDCC 2LHLA 5B8IB 4YGCB 2GGZA 1KQMB 2M7NA 3PSRA 5HKYA 2BE6A 1M31A 1OSAA 1DJYA 1OMDA 1S5GY 1V1FA 1YVHA 3CLNA 3BUXB 4PHNA 1IG5A 1KSMA 4L9MA 1JSAA 3CTNA 1TNWA 4Q04A 1OZSA 3PM8A 1NPQA 1B4CA 1ODBA 2CNPA 4D1EA 2BKHB 1BR1B 1PULA 3NSOA 4A4BA 5I8NA 1JC2A 2CTNA 2KI6D 2JT8A 1KWOB 1QXPA 3I5FB 4PE7A 1NIWA 4MRXA 5J3XA 1A75A 5BPJA 3BUWB 1K96A 2BKIB 2F33A 5I2QA 1F54A 2LMVA 4U8DA 1ZMZA 1MWNA 4DRWA 2JWWA 3VRRA 4R1EA 2MBXA 1CFDA 3WHUB 3KEVA 4MVFA 1QIVA 3LK0A 2KI6C 1SK6D 3I5HC 2I7AA 4GNKB 1CFPA 1B8LA 2PASA 1MXLC 4ZCUA 1QJTA 1UHNA 4GUKA 4N5XA 2F8PA 1B8RA 2KYFA 1C07A 1JF0A 1EL4A 1N2DA 1RFJA 1JFJA 2EGDA 3GK2A 1QVIZ 3SG5A 3IQQA 2LVKA 2K7BA 2ZN8A 3H4SE 2KI4B 4YRUA 1XK4A 3IQOA 2LAPA 2KFFA 2PALA 4MN0A 2JTZA 4N1FA 1SR6B 2GV5A 1B7TY 3TUYB 4MZKA 4BY5A 2AUCA 5JOLA 1QLKA 1M46A 1SY9A 4HRGA 1UHHA 2JULA 5AANA 5CSIA 1A03A 1Y1XA 4MBEA 1DGUA 1G8IA 2MHHA 3WNXB 1F71A 4NDDA 4ORAB 1KCYA 2ZNEA 3TDIA 3CR4X 3OHMB 5I2OA 1LA3A 1XVJA 2JXCA 2BBMA 3PATA 1SW8A 1QX2A 1S6CA 3OP0A 2JNFA 2JRFA 3D0YB 1PRWA 1CMFA 1G4YR 1Y6WA 1NX1A 1NX3A 1QV1A 1IJ5A 1HQVA 3GK1A 1IJ6A 1M39A 3DVEA 1K9PA 2PSRA 1SBJA 3EK7A 1K2HA 1L2OB 2BL0C 2Y1MA 1KQVA 3JVTC 2KQ6A 4E68A 2NLNA 3BUMB 1QLSA 1J7QA 5DKNA 1IKUA 4OVNF 4GGNA 1S1EA 2H61A 1ALWA 1IH0A 1XO5A 1GGWA 4MLWA 1NWDA 1WRZA 1XFZO 1H8BA 2JTTA 1CB1A 2FCEA 4PDZA 1J1DA 4ICBA 2KHNA 2P6BB 1CM4A 3A4UB 2L98A 2ZN9A 4ETOA 1KQMC 2LCPA 2O5GA 1S5GZ 2K0JA 3SG7A 2K7OA 3O6BA 5KSZA 2Q91A 1Y0VH 2L50A 1IWQA 1F55A 1BMOA 2LE9B 4NQGA 1CNPA 2F3ZA 4MEWA 2BECA 4M2PA 3BYAA 2MRDA 3FWCA 2JPTA 2LP2A 1DJIA 1DTLA 1G33A 2FCDA 1H4BA 1MUXA 1LINA 4ORCB 4PHMA 1MF8B 2BE4A 2LMUA 2WOSA 2Y1NA 2I18A 4JWQA 2WCFA 4MZJA 2HPSA 1B47A 3RLZA 1JBAA 3A8RA 2HF5A 1TOPA 3NSIA 3SIAA 3SG3A 2BCBA 2ZNDA 3LLEA 2KQYA 1TRFA 4DIRA 3PLFB 1C7WA 5GQQC 3DVJA 1EH2A 1OZOA 2ZRSA 4GAOA 1XK4C 2I2RE 1WLMA 3VRPA 5I2LA 4PE4A 3PALA 1YRTB 3CR5X 3JTDB 3EK4A 1TN4A 2F2PA 1V1GA 2MA2A 1M45A 1BF5A 3RM1A 2LC5A 3TZ1A 3E3RA 1Y1AA 1SRAA 1J7PA 1KK7Y 1UUSA 2KBMA 2HETA 1TIZA 1YTZC 1SCMB 2VRGA 1NSHA 1TCFA 2AAOA 3I5IC 1DVIA 1QS7A 1QV0A 3SG2A 1ZUZA 4PHJA 1YRUB 1DJXA 4M2QA 1F4QA 2CT9A 1SR6C 1B7TZ 2M8UA 5JJGA 1W7JB 1QASA 1FI6A 1AJ5A 2K2AA 1HT9A 1IQ3A 2ZFDA 2K7CA 1NCZA 2L5XB 3QRXA 4FTGA 1UHKA 5CSFA 3HX4A 4QJ4B 1CFCA 5AEQA 2JNXA 3HCMA 1QX5B 1NX2A 1SL7A 3VGOA 3AKAA 2K8MB 1S3PA 1YUUA 1YVLA 1FF1A 1MHOA 2KDHA 2LLTA 3BOWB 4WQ2A 1OMRA 1YURA 1A4PA 2H61C 1JF2A 5F6TA 2MAZA 5FYXA 2KAYA 4FQOA 2MLFC 2BBNA 1DJWA 1JWDA 3M0WA 3TS5C 2EC6B 1FPWA 1CLMA 1PSRA 3NSLA 3DVMA 3WHTB 2WNDA 1L2OC 2RGIA
chains in the Genus database with same CATH superfamily
4CLNA 3LCPC 2LUXA 2B1UA 1S6IA 1WY9A 1AJ4A 1QTXA 4CFQA 1K9UA 3CR2A 4ORBB 5KU1A 2JXLA 2SCPA 1JUOA 2KAVA 3PFVA 5ER4X 4PE1A 2YGUA 3R1VA 1RWYA 3VRNA 1XYDA 2KSPA 1TNQA 2M3WA 2OTGC 2KFGA 3AAJA 4WRIA 4HRHA 1T14A 1BU3A 2WCEA 3WXAA 1QWVA 4AQJA 2LLUA 2WCHA 1QATA 1CFFA 4JPZB 1MR8A 1AVSA 1CDPA 2OS8B 2FJYA 1ZOTB 3D76A 2E6WA 2QEOA 3AKBA 3N7HA 1DMOA 1TNXA 1KFXL 4P2YB 1KK8B 4YGEB 2JT0A 2DOQA 4NDBA 3S0AA 2GGMA 1WRLA 2AMIA 1CDLA 2PYQA 3VROA 1SL9A 1XFWO 1UHIA 1GQMA 1DT7B 2K60A 1CMGA 2L4HA 1Q80A 2LVIA 3DVKA 3OB2B 2JU0A 1MXEA 2JOJA 3I5GB 4A4CA 3TDZA 1BODA 1YR5A 1A2XA 1NX0A 3D0YA 3B7AA 1GM0A 3EK8A 1Z4HA 2JT3A 3EVUA 5ER5A 3DF0B 3LL8B 2LLSA 1S6JA 1UURA 1Z2CB 1B8CA 1OOFA 1WLZA 3SJSA 1BT6A 1SCVA 4XJKA 2Q4UA 1YUSA 4AOMA 2M1UA 2L0PA 4INXA 4PALA 2LNKA 2JZIA 2Y5IA 3BUOB 4JD9A 5TNCA 2L4IA 2Y4QA 4I5JA 1AUIB 3O78A 1NCYA 1XFUO 2KFHA 2PRUA 3PN7B 1UP5A 4N1GA 1PALA 2FJUB 4PCWA 4NDCA 2G9BA 2KBIA 2F3YA 2LUCA 1PVBA 3D10A 3IF7A 3DY9A 2G2BA 3PJIA 1F8HA 3CGAA 3NXAA 3Q8IA 3CS1A 4OZDA 4YGBB 1NCXA 3OX6A 3GK4X 4YI9A 1DF0B 5HKWA 1KK7Z 1SMGA 1TCOB 1DJZA 5D69A 1U5IB 2BAPA 2NZ0A 3KO0A 1KWOC 4C0LA 2F2OA 3I5FC 4YGAA 1CKKA 5CSNA 1MQ1A 2HQ8A 2H2KA 3B88A 2BL0B 2KOTA 1J7RA 1CTRA 1R6PA 2SASA 2ZKMX 2K2FA 3B86A 3CWGA 2QACA 4MZLA 1IGVA 1K8UA 5D7FA 1KFXS 4YGDB 2PVBA 2KLEA 3LK1A 2M49B 3SIBA 4F0ZB 3NSKA 4UPGA 2E30A 1OW4A 1XFVO 3BXKA 3EVVA 1BR4B 1C7VA 2R2IA 1S36A 4USLA 2LM5A 2ISDA 1AHRA 5DKQA 2PMYA 3BQ3A 4ZCVA 2KGBC 1FW4A 2WC5A 4KYNA 2QDIA 5HLOA 3MSEB 4C0KA 2QPTA 2KI4C 2QEHA 3EKHA 5PALA 2LMTA 2JQ6A 3FIAA 4HSZA 1NYAA 2M1KB 1A75B 3D73A 1ORGA 3F45A 4MRYA 4MSPA 2LHIA 3FWBA 2BCAA 1PSBA 2EC6C 4GGFA 4PE0A 1FI5A 1PVAA 1PK0D 1A29A 3TUYC 4M2OA 1N65A 3AAKA 4DUQA 2LVVA 2NXQA 1OMVA 3CABA 1B9AA 1RROA 1SSEB 3KF9A 1LXFC 3ZNIA 5DICA 1IQ5A 2KYCA 1SL8A 2K7DA 1WDCB 5AFPA 2TN4A 1AK8A 1IIOA 1SNLA 3OB1B 1TNPA 5HYDA 1LA0A 2L51A 2WC8A 3CZTX 3K21A 1F70A 1OOJA 2LVJA 1XFYO 3L4AA 3BFHA 1C3YA 4OR9B 5D3OA 1FBVA 2K61A 1DGVA 3OBVA 1EXRA 2OS8C 3EVRA 5FI2A 1K90D 2WCJA 2COLB 2M29A 4GPLB 1TUZA 1KK8C 1OOGA 3B87A 5AERA 1LKJA 2KPHA 5KTYA 1BG1A 1M63B 2WORA 4DS7A 2QEBA 1QX7A 1VRKA 3BOWA 3OX5A 1CM1A 2I94A 2NCPA 1R2UA 2O60A 1EJ3A 4I5LB 4CFRA 1K9KA 3I5GC 4F7FA 3O4YA 1BJFA 1YX7A 3I5IB 1KFUS 5HKZA 1CDMA 4FQTA 4TNCA 3RZSA 1KSOA 1OE9B 1OOIX 1XFXO 4HREE 3V2LA 1IRJA 1RECA 2JC2A 2KLDA 1ZFSA 1D1OA 2CXJA 3FE8A 2FOTA 2MLEC 2OPOA 1SKTA 5HLVA 5AXIA 1WRKA 2QEVA 3O4XA 3KPXA 2MJWB 4PHKA 3I5HB 1DELA 1E8AA 1ZACA 2CCMA 3S0FA 4GBAA 4XYNA 1CLLA 1UHJA 2A4JA 1ALVA 3PN7C 4CIDA 1UWOA 2WCBA 1EG3A 5DKRA 3FS7A 2D8NA 3R1PA 3UNWA 1YUTA 5G08A 1N0YA 1XA5A 1LVCD 1QVIY 1Y1UA 3GOFA 2V53A 2IS9A 3DZTA 3ICBA 1CDNA 3BUNB 4OCIA 2L2EA 1X02A 4I5NB 3DD4A 1DJGA 1J7OA 3R1OA 3EKJA 3C1VA 3ZWHA 3CZ2A 3KHEA 1L7ZA 4QJ3B 3TS5B 1DJHA 1NUBA 1SPYA 3L47A 4AQIA 4XJKB 3R72A 4C0JA 3O2PA 3TDUA 2M7LA 3VRQA 2ZRTA 4OKHA 5CPVA 4YBHB 2P71A 1B1GA 1CLBA 5IBWA 1S26D 3JTDC 4GGFC 3SG4A 1BLQA 2LV7A 2OTGB 2HQWA 3DF0A 1AP4A 1W7IB 3K1EA 1TTXA 1DEKA 4I5KA 2M97A 2KNEA 1OQPA 2LP3A 5K89A 3D77A 1F4OA 3IVTA 4CPVA 1NP8A 4WQ3A 2M9GA 1K95A 1SCMC 2LANA 4IL1A 1YX8A 4GFTA 1JFKA 1K94A 1EG4A 2BCXA 2EHBA 2KGRA 2M0RA 4PT1A 4DCKA 1BOCA 3DYEA 3JVTB 2CBLA 3SS3A 2GTEA 1J55A 4JQ0D 2KAXA 2NCOA 4QJ5B 2P70A 4BY4A 1RJVA 3BFBA 5CSJA 1GJYA 4OV2A 3CYZA 3SG6A 1GGZA 1RTP1 1SYMA 1KFUL 1DF0A 2ERBA 1LS8A 1RK9A 1U5IA 1J1EA 1K93D 1QIWA 4YI8A 4P5OE 1WDCC 1XFRA 4IJ7A 2LHLA 1C3ZA 5B8IB 4YGCB 2GGZA 1KQMB 2M7NA 3S0EA 3PSRA 5HKYA 2BE6A 1M31A 1OSAA 1DJYA 1OMDA 1S5GY 1V1FA 1YVHA 3CLNA 3D74A 3BUXB 3VB1A 4PHNA 1IG5A 1KSMA 4L9MA 1JSAA 2L5YA 3CTNA 1TNWA 4Q04A 3CZ0A 1OZSA 3PM8A 1NPQA 1B4CA 1ODBA 2CNPA 1P28A 4D1EA 2BKHB 1BR1B 1PULA 3NSOA 4A4BA 5I8NA 1JC2A 2CTNA 2KI6D 2JT8A 1KWOB 1QXPA 3I5FB 4PE7A 1NIWA 4MRXA 5J3XA 1A75A 5EL2A 5BPJA 3BUWB 1K96A 2BKIB 2F33A 5I2QA 1F54A 2LMVA 4U8DA 1ZMZA 1MWNA 4DRWA 2JWWA 3VRRA 4R1EA 1TWOA 2MBXA 1CFDA 3WHUB 3KEVA 4MVFA 1QIVA 3LK0A 2KI6C 1SK6D 4INWA 3I5HC 2I7AA 4GNKB 5FI6A 1CFPA 1B8LA 2PASA 1MXLC 4ZCUA 1QJTA 1UHNA 4GUKA 4N5XA 2F8PA 1B8RA 2KYFA 1C07A 1JF0A 1EL4A 1N2DA 1RFJA 2JPOA 1JFJA 2EGDA 3GK2A 1QVIZ 3FE6A 3SG5A 3IQQA 2LVKA 2K7BA 2ZN8A 3H4SE 2KI4B 4YRUA 1XK4A 2BNXA 3IQOA 2LAPA 2KFFA 2PALA 4MN0A 2JTZA 3SS5A 4N1FA 1SR6B 2GV5A 1B7TY 3TUYB 4MZKA 4BY5A 3UO9A 2AUCA 1DQEA 5JOLA 1QLKA 1M46A 1SY9A 3S0DA 4HRGA 1UHHA 2JULA 5AANA 3D75A 5CSIA 1A03A 1Y1XA 4MBEA 1DGUA 1G8IA 2MHHA 3WNXB 1F71A 4NDDA 4ORAB 1KCYA 2ZNEA 3TDIA 3CR4X 3OHMB 5I2OA 1LA3A 1XVJA 2JXCA 2BBMA 3PATA 1DC1A 1SW8A 1QX2A 1S6CA 3OP0A 2JNFA 2JRFA 3D0YB 1PRWA 3D78A 1G4YR 1Y6WA 3NHTA 1CMFA 1NX1A 1NX3A 1QV1A 1IJ5A 1HQVA 1OOHA 3GK1A 1IJ6A 1M39A 3BFAA 4JKTA 3DVEA 1K9PA 2PSRA 1SBJA 3EK7A 1K2HA 1L2OB 2BL0C 2Y1MA 1KQVA 3JVTC 2KQ6A 4E68A 2NLNA 3BUMB 1QLSA 1J7QA 5DKNA 1IKUA 3CDNA 3DXLA 4OVNF 4GGNA 1S1EA 2H61A 1ALWA 1IH0A 1XO5A 2WC6A 1GGWA 3CZ1A 4MLWA 1NWDA 5FI7A 1WRZA 1XFZO 1H8BA 2JTTA 1CB1A 2FCEA 4PDZA 1J1DA 4ICBA 2KHNA 2P6BB 1CM4A 1W9ZA 3A4UB 2L98A 2ZN9A 4ETOA 1KQMC 2LCPA 2O5GA 1S5GZ 2K0JA 3PM2A 2K7OA 3SG7A 3O6BA 5KSZA 2Q91A 3FE9A 1Y0VH 2L50A 1IWQA 1F55A 1BMOA 2LE9B 3BJHA 4NQGA 2F3ZA 4MEWA 2BECA 1CNPA 4M2PA 3B6XA 3BYAA 2MRDA 3FWCA 2JPTA 2LP2A 1DJIA 1DTLA 1G33A 2FCDA 1H4BA 1MUXA 1LINA 4ORCB 4PHMA 1MF8B 2BE4A 2LMUA 2WOSA 2Y1NA 2I18A 4JWQA 2WCFA 4MZJA 1TUJA 2HPSA 1B47A 3RLZA 1JBAA 3A8RA 3S0GA 2HF5A 1TOPA 3NSIA 3SIAA 3SG3A 5I94A 2BCBA 2ZNDA 3LLEA 2KQYA 1TRFA 4DIRA 3PLFB 1C7WA 5GQQC 5HL1A 3DVJA 1EH2A 1OZOA 2ZRSA 4GAOA 1XK4C 2I2RE 1WLMA 3VRPA 5I2LA 2L2CA 4PE4A 3PALA 1YRTB 3CR5X 3JTDB 3EK4A 1TN4A 2F2PA 1V1GA 2H8VA 3EG5B 2MA2A 1M45A 3NHIA 1BF5A 3RM1A 2LC5A 2PQLA 3E3RA 3TZ1A 1Y1AA 3S0BA 1SRAA 3OGNA 1J7PA 1KK7Y 1UUSA 2KBMA 2HETA 1TIZA 1YTZC 1SCMB 2VRGA 1NSHA 1TCFA 2AAOA 3I5IC 1DVIA 1QS7A 1QV0A 3SG2A 1ZUZA 4PHJA 1YRUB 1DJXA 4M2QA 1F4QA 2CT9A 1SR6C 1B7TZ 2M8UA 3SS4A 5JJGA 1W7JB 1QASA 1FI6A 1AJ5A 2K2AA 1HT9A 1IQ3A 2ZFDA 2K7CA 2WCMA 1NCZA 2L5XB 3QRXA 4FTGA 1UHKA 5CSFA 3HX4A 4QJ4B 1CFCA 5AEQA 2JNXA 3HCMA 3QMEA 1QX5B 1NX2A 1SL7A 3VGOA 3AKAA 2K8MB 1S3PA 3L4LA 1YUUA 1YVLA 1FF1A 1MHOA 2KDHA 2LLTA 3BOWB 4WQ2A 1OMRA 1YURA 1A4PA 2H61C 1JF2A 5F6TA 2MAZA 5FYXA 2KAYA 4FQOA 2MLFC 2BBNA 1DJWA 2WCKA 1JWDA 3M0WA 3TS5C 2EC6B 1FPWA 1CLMA 1PSRA 3NGVA 3NSLA 3DVMA 2WCLA 3WHTB 2WNDA 1L2OC 2RGIA
chains in the Genus database with same CATH topology
4CLNA 3LCPC 2LUXA 2B1UA 1S6IA 1WY9A 1AJ4A 1QTXA 4CFQA 1K9UA 3CR2A 4ORBB 5KU1A 2JXLA 2SCPA 1JUOA 2KAVA 3PFVA 5ER4X 4PE1A 1RWYA 3VRNA 1XYDA 2KSPA 1TNQA 2M3WA 2OTGC 2KFGA 3AAJA 4WRIA 4HRHA 1BU3A 2WCEA 3WXAA 4AQJA 2LLUA 1QATA 1CFFA 4JPZB 1MR8A 1AVSA 1CDPA 2OS8B 1ZOTB 1DMOA 2E6WA 3AKBA 1TNXA 1KFXL 4P2YB 1KK8B 4YGEB 2JT0A 2DOQA 4NDBA 2GGMA 1WRLA 2AMIA 1CDLA 3VROA 1SL9A 1XFWO 1UHIA 1GQMA 1DT7B 1CMGA 2L4HA 1Q80A 2LVIA 3DVKA 3OB2B 2JU0A 1MXEA 2JOJA 3I5GB 4A4CA 3TDZA 1BODA 1YR5A 1A2XA 1NX0A 3D0YA 3EK8A 2JT3A 3EVUA 5ER5A 3DF0B 3LL8B 2LLSA 1S6JA 1UURA 1B8CA 1WLZA 3SJSA 1BT6A 1SCVA 4XJKA 2Q4UA 1YUSA 4AOMA 2M1UA 2L0PA 4PALA 2LNKA 2JZIA 2Y5IA 3BUOB 5TNCA 2L4IA 2Y4QA 4I5JA 1AUIB 3O78A 1NCYA 1XFUO 2KFHA 2PRUA 3PN7B 1UP5A 4N1GA 1PALA 2FJUB 4PCWA 4NDCA 2G9BA 2KBIA 2F3YA 2LUCA 1PVBA 3D10A 3IF7A 1F8HA 2G2BA 3CGAA 3NXAA 4YGBB 3CS1A 1NCXA 3OX6A 3GK4X 4YI9A 1DF0B 5HKWA 1KK7Z 1SMGA 1TCOB 1DJZA 5D69A 1U5IB 3KO0A 2NZ0A 1KWOC 4C0LA 2F2OA 3I5FC 4YGAA 1CKKA 5CSNA 1MQ1A 2HQ8A 2H2KA 2BL0B 2KOTA 1J7RA 1CTRA 1R6PA 2SASA 2ZKMX 2K2FA 3CWGA 2QACA 4MZLA 1IGVA 1K8UA 5D7FA 1KFXS 4YGDB 2PVBA 3LK1A 2M49B 3SIBA 4F0ZB 3NSKA 4UPGA 2E30A 1XFVO 3BXKA 3EVVA 1BR4B 1C7VA 2R2IA 1S36A 4USLA 2LM5A 2ISDA 1AHRA 5DKQA 2PMYA 3BQ3A 4ZCVA 2KGBC 1FW4A 5HLOA 4C0KA 3MSEB 2QPTA 2KI4C 3EKHA 5PALA 2LMTA 2JQ6A 3FIAA 4HSZA 1NYAA 2M1KB 1A75B 3F45A 4MRYA 4MSPA 4QJ3B 2LHIA 3FWBA 2BCAA 1PSBA 2EC6C 4GGFA 4PE0A 1FI5A 1PVAA 1PK0D 1A29A 3TUYC 4M2OA 1N65A 3AAKA 4DUQA 2LVVA 2NXQA 1OMVA 1B9AA 1RROA 3KF9A 1LXFC 3ZNIA 1IQ5A 2KYCA 1SL8A 2K7DA 1WDCB 5AFPA 2TN4A 1AK8A 1SNLA 3OB1B 1TNPA 5HYDA 1LA0A 2L51A 2WC8A 3CZTX 3K21A 1F70A 1OOJA 2LVJA 1XFYO 4OR9B 1FBVA 2K61A 1DGVA 1EXRA 2OS8C 3EVRA 1K90D 2COLB 2M29A 4GPLB 1KK8C 5AERA 1LKJA 5KTYA 1BG1A 1M63B 2WORA 4DS7A 1QX7A 1VRKA 3BOWA 3OX5A 1CM1A 2I94A 2NCPA 1R2UA 2O60A 1EJ3A 4I5LB 4CFRA 1K9KA 3I5GC 3O4YA 1BJFA 1YX7A 3I5IB 1KFUS 5HKZA 1CDMA 4TNCA 1KSOA 1OE9B 1XFXO 4HREE 1IRJA 1RECA 2JC2A 1ZFSA 1D1OA 2CXJA 2FOTA 2MLEC 2OPOA 1SKTA 5HLVA 5AXIA 1WRKA 3KPXA 2MJWB 4PHKA 3I5HB 1E8AA 1ZACA 2CCMA 4GBAA 4XYNA 1CLLA 1UHJA 2A4JA 1ALVA 3PN7C 4CIDA 1UWOA 2WCBA 1EG3A 5DKRA 3FS7A 2D8NA 1YUTA 5G08A 1N0YA 1XA5A 1LVCD 1QVIY 1Y1UA 3GOFA 2V53A 2IS9A 3ICBA 1CDNA 3BUNB 4OCIA 2L2EA 1X02A 4I5NB 3DD4A 1DJGA 1J7OA 3EKJA 3C1VA 3ZWHA 3KHEA 3TS5B 1L7ZA 1DJHA 1NUBA 1SPYA 4AQIA 4XJKB 4C0JA 3O2PA 3TDUA 2M7LA 3VRQA 2ZRTA 4OKHA 5CPVA 4YBHB 1B1GA 1CLBA 5IBWA 1S26D 3JTDC 4GGFC 3SG4A 1BLQA 2LV7A 2OTGB 2HQWA 3DF0A 1AP4A 1W7IB 1TTXA 4I5KA 2M97A 2KNEA 1OQPA 2LP3A 5K89A 1F4OA 4CPVA 1NP8A 4WQ3A 2M9GA 1K95A 1SCMC 2LANA 4IL1A 1YX8A 4GFTA 1JFKA 1K94A 1EG4A 2BCXA 2EHBA 2KGRA 2M0RA 4DCKA 1BOCA 3JVTB 2CBLA 1J55A 4JQ0D 2KAXA 2NCOA 4QJ5B 4BY4A 1RJVA 5CSJA 1GJYA 4OV2A 3SG6A 1GGZA 1RTP1 1SYMA 1KFUL 1DF0A 1RK9A 1U5IA 1J1EA 1K93D 1QIWA 4YI8A 4P5OE 1WDCC 2LHLA 5B8IB 4YGCB 2GGZA 1KQMB 2M7NA 3PSRA 5HKYA 2BE6A 1M31A 1OSAA 1DJYA 1OMDA 1S5GY 1V1FA 1YVHA 3CLNA 3BUXB 4PHNA 1IG5A 1KSMA 4L9MA 1JSAA 3CTNA 1TNWA 4Q04A 1OZSA 3PM8A 1NPQA 1B4CA 1ODBA 2CNPA 4D1EA 2BKHB 1BR1B 1PULA 3NSOA 4A4BA 5I8NA 1JC2A 2CTNA 2KI6D 2JT8A 1KWOB 1QXPA 3I5FB 4PE7A 1NIWA 4MRXA 5J3XA 1A75A 5BPJA 3BUWB 1K96A 2BKIB 2F33A 5I2QA 1F54A 2LMVA 4U8DA 1ZMZA 1MWNA 4DRWA 2JWWA 3VRRA 4R1EA 2MBXA 1CFDA 3WHUB 3KEVA 4MVFA 1QIVA 3LK0A 2KI6C 1SK6D 3I5HC 2I7AA 4GNKB 1CFPA 1B8LA 2PASA 1MXLC 4ZCUA 1QJTA 1UHNA 4GUKA 4N5XA 2F8PA 1B8RA 2KYFA 1C07A 1JF0A 1EL4A 1N2DA 1RFJA 1JFJA 2EGDA 3GK2A 1QVIZ 3SG5A 3IQQA 2LVKA 2K7BA 2ZN8A 3H4SE 2KI4B 4YRUA 1XK4A 3IQOA 2LAPA 2KFFA 2PALA 4MN0A 2JTZA 4N1FA 1SR6B 2GV5A 1B7TY 3TUYB 4MZKA 4BY5A 2AUCA 5JOLA 1QLKA 1M46A 1SY9A 4HRGA 1UHHA 2JULA 5AANA 5CSIA 1A03A 1Y1XA 4MBEA 1DGUA 1G8IA 2MHHA 3WNXB 1F71A 4NDDA 4ORAB 1KCYA 2ZNEA 3TDIA 3CR4X 3OHMB 5I2OA 1LA3A 1XVJA 2JXCA 2BBMA 3PATA 1SW8A 1QX2A 1S6CA 3OP0A 2JNFA 2JRFA 3D0YB 1PRWA 1CMFA 1G4YR 1Y6WA 1NX1A 1NX3A 1QV1A 1IJ5A 1HQVA 3GK1A 1IJ6A 1M39A 3DVEA 1K9PA 2PSRA 1SBJA 3EK7A 1K2HA 1L2OB 2BL0C 2Y1MA 1KQVA 3JVTC 2KQ6A 4E68A 2NLNA 3BUMB 1QLSA 1J7QA 5DKNA 1IKUA 4OVNF 4GGNA 1S1EA 2H61A 1ALWA 1IH0A 1XO5A 1GGWA 4MLWA 1NWDA 1WRZA 1XFZO 1H8BA 2JTTA 1CB1A 2FCEA 4PDZA 1J1DA 4ICBA 2KHNA 2P6BB 1CM4A 3A4UB 2L98A 2ZN9A 4ETOA 1KQMC 2LCPA 2O5GA 1S5GZ 2K0JA 3SG7A 2K7OA 3O6BA 5KSZA 2Q91A 1Y0VH 2L50A 1IWQA 1F55A 1BMOA 2LE9B 4NQGA 1CNPA 2F3ZA 4MEWA 2BECA 4M2PA 3BYAA 2MRDA 3FWCA 2JPTA 2LP2A 1DJIA 1DTLA 1G33A 2FCDA 1H4BA 1MUXA 1LINA 4ORCB 4PHMA 1MF8B 2BE4A 2LMUA 2WOSA 2Y1NA 2I18A 4JWQA 2WCFA 4MZJA 2HPSA 1B47A 3RLZA 1JBAA 3A8RA 2HF5A 1TOPA 3NSIA 3SIAA 3SG3A 2BCBA 2ZNDA 3LLEA 2KQYA 1TRFA 4DIRA 3PLFB 1C7WA 5GQQC 3DVJA 1EH2A 1OZOA 2ZRSA 4GAOA 1XK4C 2I2RE 1WLMA 3VRPA 5I2LA 4PE4A 3PALA 1YRTB 3CR5X 3JTDB 3EK4A 1TN4A 2F2PA 1V1GA 2MA2A 1M45A 1BF5A 3RM1A 2LC5A 3TZ1A 3E3RA 1Y1AA 1SRAA 1J7PA 1KK7Y 1UUSA 2KBMA 2HETA 1TIZA 1YTZC 1SCMB 2VRGA 1NSHA 1TCFA 2AAOA 3I5IC 1DVIA 1QS7A 1QV0A 3SG2A 1ZUZA 4PHJA 1YRUB 1DJXA 4M2QA 1F4QA 2CT9A 1SR6C 1B7TZ 2M8UA 5JJGA 1W7JB 1QASA 1FI6A 1AJ5A 2K2AA 1HT9A 1IQ3A 2ZFDA 2K7CA 1NCZA 2L5XB 3QRXA 4FTGA 1UHKA 5CSFA 3HX4A 4QJ4B 1CFCA 5AEQA 2JNXA 3HCMA 1QX5B 1NX2A 1SL7A 3VGOA 3AKAA 2K8MB 1S3PA 1YUUA 1YVLA 1FF1A 1MHOA 2KDHA 2LLTA 3BOWB 4WQ2A 1OMRA 1YURA 1A4PA 2H61C 1JF2A 5F6TA 2MAZA 5FYXA 2KAYA 4FQOA 2MLFC 2BBNA 1DJWA 1JWDA 3M0WA 3TS5C 2EC6B 1FPWA 1CLMA 1PSRA 3NSLA 3DVMA 3WHTB 2WNDA 1L2OC 2RGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLN A;  3LCP C;  2LUX A;  2B1U A;  1S6I A;  1WY9 A;  1AJ4 A;  1QTX A;  4CFQ A;  1K9U A;  3CR2 A;  4ORB B;  5KU1 A;  2JXL A;  2SCP A;  1JUO A;  2KAV A;  3PFV A;  5ER4 X;  4PE1 A;  1RWY A;  3VRN A;  1XYD A;  2KSP A;  1TNQ A;  2M3W A;  2OTG C;  2KFG A;  3AAJ A;  4WRI A;  4HRH A;  1BU3 A;  2WCE A;  3WXA A;  4AQJ A;  2LLU A;  1QAT A;  1CFF A;  4JPZ B;  1MR8 A;  1AVS A;  1CDP A;  2OS8 B;  1ZOT B;  1DMO A;  2E6W A;  3AKB A;  1TNX A;  1KFX L;  4P2Y B;  1KK8 B;  4YGE B;  2JT0 A;  2DOQ A;  4NDB A;  2GGM A;  1WRL A;  2AMI A;  1CDL A;  3VRO A;  1SL9 A;  1XFW O;  1UHI A;  1GQM A;  1DT7 B;  1CMG A;  2L4H A;  1Q80 A;  2LVI A;  3DVK A;  3OB2 B;  2JU0 A;  1MXE A;  2JOJ A;  3I5G B;  4A4C A;  3TDZ A;  1BOD A;  1YR5 A;  1A2X A;  1NX0 A;  3D0Y A;  3EK8 A;  2JT3 A;  3EVU A;  5ER5 A;  3DF0 B;  3LL8 B;  2LLS A;  1S6J A;  1UUR A;  1B8C A;  1WLZ A;  3SJS A;  1BT6 A;  1SCV A;  4XJK A;  2Q4U A;  1YUS A;  4AOM A;  2M1U A;  2L0P A;  4PAL A;  2LNK A;  2JZI A;  2Y5I A;  3BUO B;  5TNC A;  2L4I A;  2Y4Q A;  4I5J A;  1AUI B;  3O78 A;  1NCY A;  1XFU O;  2KFH A;  2PRU A;  3PN7 B;  1UP5 A;  4N1G A;  1PAL A;  2FJU B;  4PCW A;  4NDC A;  2G9B A;  2KBI A;  2F3Y A;  2LUC A;  1PVB A;  3D10 A;  3IF7 A;  1F8H A;  2G2B A;  3CGA A;  3NXA A;  4YGB B;  3CS1 A;  1NCX A;  3OX6 A;  3GK4 X;  4YI9 A;  1DF0 B;  5HKW A;  1KK7 Z;  1SMG A;  1TCO B;  1DJZ A;  5D69 A;  1U5I B;  3KO0 A;  2NZ0 A;  1KWO C;  4C0L A;  2F2O A;  3I5F C;  4YGA A;  1CKK A;  5CSN A;  1MQ1 A;  2HQ8 A;  2H2K A;  2BL0 B;  2KOT A;  1J7R A;  1CTR A;  1R6P A;  2SAS A;  2ZKM X;  2K2F A;  3CWG A;  2QAC A;  4MZL A;  1IGV A;  1K8U A;  5D7F A;  1KFX S;  4YGD B;  2PVB A;  3LK1 A;  2M49 B;  3SIB A;  4F0Z B;  3NSK A;  4UPG A;  2E30 A;  1XFV O;  3BXK A;  3EVV A;  1BR4 B;  1C7V A;  2R2I A;  1S36 A;  4USL A;  2LM5 A;  2ISD A;  1AHR A;  5DKQ A;  2PMY A;  3BQ3 A;  4ZCV A;  2KGB C;  1FW4 A;  5HLO A;  4C0K A;  3MSE B;  2QPT A;  2KI4 C;  3EKH A;  5PAL A;  2LMT A;  2JQ6 A;  3FIA A;  4HSZ A;  1NYA A;  2M1K B;  1A75 B;  3F45 A;  4MRY A;  4MSP A;  4QJ3 B;  2LHI A;  3FWB A;  2BCA A;  1PSB A;  2EC6 C;  4GGF A;  4PE0 A;  1FI5 A;  1PVA A;  1PK0 D;  1A29 A;  3TUY C;  4M2O A;  1N65 A;  3AAK A;  4DUQ A;  2LVV A;  2NXQ A;  1OMV A;  1B9A A;  1RRO A;  3KF9 A;  1LXF C;  3ZNI A;  1IQ5 A;  2KYC A;  1SL8 A;  2K7D A;  1WDC B;  5AFP A;  2TN4 A;  1AK8 A;  1SNL A;  3OB1 B;  1TNP A;  5HYD A;  1LA0 A;  2L51 A;  2WC8 A;  3CZT X;  3K21 A;  1F70 A;  1OOJ A;  2LVJ A;  1XFY O;  4OR9 B;  1FBV A;  2K61 A;  1DGV A;  1EXR A;  2OS8 C;  3EVR A;  1K90 D;  2COL B;  2M29 A;  4GPL B;  1KK8 C;  5AER A;  1LKJ A;  5KTY A;  1BG1 A;  1M63 B;  2WOR A;  4DS7 A;  1QX7 A;  1VRK A;  3BOW A;  3OX5 A;  1CM1 A;  2I94 A;  2NCP A;  1R2U A;  2O60 A;  1EJ3 A;  4I5L B;  4CFR A;  1K9K A;  3I5G C;  3O4Y A;  1BJF A;  1YX7 A;  3I5I B;  1KFU S;  5HKZ A;  1CDM A;  4TNC A;  1KSO A;  1OE9 B;  1XFX O;  4HRE E;  1IRJ A;  1REC A;  2JC2 A;  1ZFS A;  1D1O A;  2CXJ A;  2FOT A;  2MLE C;  2OPO A;  1SKT A;  5HLV A;  5AXI A;  1WRK A;  3KPX A;  2MJW B;  4PHK A;  3I5H B;  1E8A A;  1ZAC A;  2CCM A;  4GBA A;  4XYN A;  1CLL A;  1UHJ A;  2A4J A;  1ALV A;  3PN7 C;  4CID A;  1UWO A;  2WCB A;  1EG3 A;  5DKR A;  3FS7 A;  2D8N A;  1YUT A;  5G08 A;  1N0Y A;  1XA5 A;  1LVC D;  1QVI Y;  1Y1U A;  3GOF A;  2V53 A;  2IS9 A;  3ICB A;  1CDN A;  3BUN B;  4OCI A;  2L2E A;  1X02 A;  4I5N B;  3DD4 A;  1DJG A;  1J7O A;  3EKJ A;  3C1V A;  3ZWH A;  3KHE A;  3TS5 B;  1L7Z A;  1DJH A;  1NUB A;  1SPY A;  4AQI A;  4XJK B;  4C0J A;  3O2P A;  3TDU A;  2M7L A;  3VRQ A;  2ZRT A;  4OKH A;  5CPV A;  4YBH B;  1B1G A;  1CLB A;  5IBW A;  1S26 D;  3JTD C;  4GGF C;  3SG4 A;  1BLQ A;  2LV7 A;  2OTG B;  2HQW A;  3DF0 A;  1AP4 A;  1W7I B;  1TTX A;  4I5K A;  2M97 A;  2KNE A;  1OQP A;  2LP3 A;  5K89 A;  1F4O A;  4CPV A;  1NP8 A;  4WQ3 A;  2M9G A;  1K95 A;  1SCM C;  2LAN A;  4IL1 A;  1YX8 A;  4GFT A;  1JFK A;  1K94 A;  1EG4 A;  2BCX A;  2EHB A;  2KGR A;  2M0R A;  4DCK A;  1BOC A;  3JVT B;  2CBL A;  1J55 A;  4JQ0 D;  2KAX A;  2NCO A;  4QJ5 B;  4BY4 A;  1RJV A;  5CSJ A;  1GJY A;  4OV2 A;  3SG6 A;  1GGZ A;  1RTP 1;  1SYM A;  1KFU L;  1DF0 A;  1RK9 A;  1U5I A;  1J1E A;  1K93 D;  1QIW A;  4YI8 A;  4P5O E;  1WDC C;  2LHL A;  5B8I B;  4YGC B;  2GGZ A;  1KQM B;  2M7N A;  3PSR A;  5HKY A;  2BE6 A;  1M31 A;  1OSA A;  1DJY A;  1OMD A;  1S5G Y;  1V1F A;  1YVH A;  3CLN A;  3BUX B;  4PHN A;  1IG5 A;  1KSM A;  4L9M A;  1JSA A;  3CTN A;  1TNW A;  4Q04 A;  1OZS A;  3PM8 A;  1NPQ A;  1B4C A;  1ODB A;  2CNP A;  4D1E A;  2BKH B;  1BR1 B;  1PUL A;  3NSO A;  4A4B A;  5I8N A;  1JC2 A;  2CTN A;  2KI6 D;  2JT8 A;  1KWO B;  1QXP A;  3I5F B;  4PE7 A;  1NIW A;  4MRX A;  5J3X A;  1A75 A;  5BPJ A;  3BUW B;  1K96 A;  2BKI B;  2F33 A;  5I2Q A;  1F54 A;  2LMV A;  4U8D A;  1ZMZ A;  1MWN A;  4DRW A;  2JWW A;  3VRR A;  4R1E A;  2MBX A;  1CFD A;  3WHU B;  3KEV A;  4MVF A;  1QIV A;  3LK0 A;  2KI6 C;  1SK6 D;  3I5H C;  2I7A A;  4GNK B;  1CFP A;  1B8L A;  2PAS A;  1MXL C;  4ZCU A;  1QJT A;  1UHN A;  4GUK A;  4N5X A;  2F8P A;  1B8R A;  2KYF A;  1C07 A;  1JF0 A;  1EL4 A;  1N2D A;  1RFJ A;  1JFJ A;  2EGD A;  3GK2 A;  1QVI Z;  3SG5 A;  3IQQ A;  2LVK A;  2K7B A;  2ZN8 A;  3H4S E;  2KI4 B;  4YRU A;  1XK4 A;  3IQO A;  2LAP A;  2KFF A;  2PAL A;  4MN0 A;  2JTZ A;  4N1F A;  1SR6 B;  2GV5 A;  1B7T Y;  3TUY B;  4MZK A;  4BY5 A;  2AUC A;  5JOL A;  1QLK A;  1M46 A;  1SY9 A;  4HRG A;  1UHH A;  2JUL A;  5AAN A;  5CSI A;  1A03 A;  1Y1X A;  4MBE A;  1DGU A;  1G8I A;  2MHH A;  3WNX B;  1F71 A;  4NDD A;  4ORA B;  1KCY A;  2ZNE A;  3TDI A;  3CR4 X;  3OHM B;  5I2O A;  1LA3 A;  1XVJ A;  2JXC A;  2BBM A;  3PAT A;  1SW8 A;  1QX2 A;  1S6C A;  3OP0 A;  2JNF A;  2JRF A;  3D0Y B;  1PRW A;  1CMF A;  1G4Y R;  1Y6W A;  1NX1 A;  1NX3 A;  1QV1 A;  1IJ5 A;  1HQV A;  3GK1 A;  1IJ6 A;  1M39 A;  3DVE A;  1K9P A;  2PSR A;  1SBJ A;  3EK7 A;  1K2H A;  1L2O B;  2BL0 C;  2Y1M A;  1KQV A;  3JVT C;  2KQ6 A;  4E68 A;  2NLN A;  3BUM B;  1QLS A;  1J7Q A;  5DKN A;  1IKU A;  4OVN F;  4GGN A;  1S1E A;  2H61 A;  1ALW A;  1IH0 A;  1XO5 A;  1GGW A;  4MLW A;  1NWD A;  1WRZ A;  1XFZ O;  1H8B A;  2JTT A;  1CB1 A;  2FCE A;  4PDZ A;  1J1D A;  4ICB A;  2KHN A;  2P6B B;  1CM4 A;  3A4U B;  2L98 A;  2ZN9 A;  4ETO A;  1KQM C;  2LCP A;  2O5G A;  1S5G Z;  2K0J A;  3SG7 A;  2K7O A;  3O6B A;  5KSZ A;  2Q91 A;  1Y0V H;  2L50 A;  1IWQ A;  1F55 A;  1BMO A;  2LE9 B;  4NQG A;  1CNP A;  2F3Z A;  4MEW A;  2BEC A;  4M2P A;  3BYA A;  2MRD A;  3FWC A;  2JPT A;  2LP2 A;  1DJI A;  1DTL A;  1G33 A;  2FCD A;  1H4B A;  1MUX A;  1LIN A;  4ORC B;  4PHM A;  1MF8 B;  2BE4 A;  2LMU A;  2WOS A;  2Y1N A;  2I18 A;  4JWQ A;  2WCF A;  4MZJ A;  2HPS A;  1B47 A;  3RLZ A;  1JBA A;  3A8R A;  2HF5 A;  1TOP A;  3NSI A;  3SIA A;  3SG3 A;  2BCB A;  2ZND A;  3LLE A;  2KQY A;  1TRF A;  4DIR A;  3PLF B;  1C7W A;  5GQQ C;  3DVJ A;  1EH2 A;  1OZO A;  2ZRS A;  4GAO A;  1XK4 C;  2I2R E;  1WLM A;  3VRP A;  5I2L A;  4PE4 A;  3PAL A;  1YRT B;  3CR5 X;  3JTD B;  3EK4 A;  1TN4 A;  2F2P A;  1V1G A;  2MA2 A;  1M45 A;  1BF5 A;  3RM1 A;  2LC5 A;  3TZ1 A;  3E3R A;  1Y1A A;  1SRA A;  1J7P A;  1KK7 Y;  1UUS A;  2KBM A;  2HET A;  1TIZ A;  1YTZ C;  1SCM B;  2VRG A;  1NSH A;  1TCF A;  2AAO A;  3I5I C;  1DVI A;  1QS7 A;  1QV0 A;  3SG2 A;  1ZUZ A;  4PHJ A;  1YRU B;  1DJX A;  4M2Q A;  1F4Q A;  2CT9 A;  1SR6 C;  1B7T Z;  2M8U A;  5JJG A;  1W7J B;  1QAS A;  1FI6 A;  1AJ5 A;  2K2A A;  1HT9 A;  1IQ3 A;  2ZFD A;  2K7C A;  1NCZ A;  2L5X B;  3QRX A;  4FTG A;  1UHK A;  5CSF A;  3HX4 A;  4QJ4 B;  1CFC A;  5AEQ A;  2JNX A;  3HCM A;  1QX5 B;  1NX2 A;  1SL7 A;  3VGO A;  3AKA A;  2K8M B;  1S3P A;  1YUU A;  1YVL A;  1FF1 A;  1MHO A;  2KDH A;  2LLT A;  3BOW B;  4WQ2 A;  1OMR A;  1YUR A;  1A4P A;  2H61 C;  1JF2 A;  5F6T A;  2MAZ A;  5FYX A;  2KAY A;  4FQO A;  2MLF C;  2BBN A;  1DJW A;  1JWD A;  3M0W A;  3TS5 C;  2EC6 B;  1FPW A;  1CLM A;  1PSR A;  3NSL A;  3DVM A;  3WHT B;  2WND A;  1L2O C;  2RGI A; 
#chains in the Genus database with same CATH topology
 4CLN A;  3LCP C;  2LUX A;  2B1U A;  1S6I A;  1WY9 A;  1AJ4 A;  1QTX A;  4CFQ A;  1K9U A;  3CR2 A;  4ORB B;  5KU1 A;  2JXL A;  2SCP A;  1JUO A;  2KAV A;  3PFV A;  5ER4 X;  4PE1 A;  2YGU A;  3R1V A;  1RWY A;  3VRN A;  1XYD A;  2KSP A;  1TNQ A;  2M3W A;  2OTG C;  2KFG A;  3AAJ A;  4WRI A;  4HRH A;  1T14 A;  1BU3 A;  2WCE A;  3WXA A;  1QWV A;  4AQJ A;  2LLU A;  2WCH A;  1QAT A;  1CFF A;  4JPZ B;  1MR8 A;  1AVS A;  1CDP A;  2OS8 B;  2FJY A;  1ZOT B;  3D76 A;  2E6W A;  2QEO A;  3AKB A;  3N7H A;  1DMO A;  1TNX A;  1KFX L;  4P2Y B;  1KK8 B;  4YGE B;  2JT0 A;  2DOQ A;  4NDB A;  3S0A A;  2GGM A;  1WRL A;  2AMI A;  1CDL A;  2PYQ A;  3VRO A;  1SL9 A;  1XFW O;  1UHI A;  1GQM A;  1DT7 B;  2K60 A;  1CMG A;  2L4H A;  1Q80 A;  2LVI A;  3DVK A;  3OB2 B;  2JU0 A;  1MXE A;  2JOJ A;  3I5G B;  4A4C A;  3TDZ A;  1BOD A;  1YR5 A;  1A2X A;  1NX0 A;  3D0Y A;  3B7A A;  1GM0 A;  3EK8 A;  1Z4H A;  2JT3 A;  3EVU A;  5ER5 A;  3DF0 B;  3LL8 B;  2LLS A;  1S6J A;  1UUR A;  1Z2C B;  1B8C A;  1OOF A;  1WLZ A;  3SJS A;  1BT6 A;  1SCV A;  4XJK A;  2Q4U A;  1YUS A;  4AOM A;  2M1U A;  2L0P A;  4INX A;  4PAL A;  2LNK A;  2JZI A;  2Y5I A;  3BUO B;  4JD9 A;  5TNC A;  2L4I A;  2Y4Q A;  4I5J A;  1AUI B;  3O78 A;  1NCY A;  1XFU O;  2KFH A;  2PRU A;  3PN7 B;  1UP5 A;  4N1G A;  1PAL A;  2FJU B;  4PCW A;  4NDC A;  2G9B A;  2KBI A;  2F3Y A;  2LUC A;  1PVB A;  3D10 A;  3IF7 A;  3DY9 A;  2G2B A;  3PJI A;  1F8H A;  3CGA A;  3NXA A;  3Q8I A;  3CS1 A;  4OZD A;  4YGB B;  1NCX A;  3OX6 A;  3GK4 X;  4YI9 A;  1DF0 B;  5HKW A;  1KK7 Z;  1SMG A;  1TCO B;  1DJZ A;  5D69 A;  1U5I B;  2BAP A;  2NZ0 A;  3KO0 A;  1KWO C;  4C0L A;  2F2O A;  3I5F C;  4YGA A;  1CKK A;  5CSN A;  1MQ1 A;  2HQ8 A;  2H2K A;  3B88 A;  2BL0 B;  2KOT A;  1J7R A;  1CTR A;  1R6P A;  2SAS A;  2ZKM X;  2K2F A;  3B86 A;  3CWG A;  2QAC A;  4MZL A;  1IGV A;  1K8U A;  5D7F A;  1KFX S;  4YGD B;  2PVB A;  2KLE A;  3LK1 A;  2M49 B;  3SIB A;  4F0Z B;  3NSK A;  4UPG A;  2E30 A;  1OW4 A;  1XFV O;  3BXK A;  3EVV A;  1BR4 B;  1C7V A;  2R2I A;  1S36 A;  4USL A;  2LM5 A;  2ISD A;  1AHR A;  5DKQ A;  2PMY A;  3BQ3 A;  4ZCV A;  2KGB C;  1FW4 A;  2WC5 A;  4KYN A;  2QDI A;  5HLO A;  3MSE B;  4C0K A;  2QPT A;  2KI4 C;  2QEH A;  3EKH A;  5PAL A;  2LMT A;  2JQ6 A;  3FIA A;  4HSZ A;  1NYA A;  2M1K B;  1A75 B;  3D73 A;  1ORG A;  3F45 A;  4MRY A;  4MSP A;  2LHI A;  3FWB A;  2BCA A;  1PSB A;  2EC6 C;  4GGF A;  4PE0 A;  1FI5 A;  1PVA A;  1PK0 D;  1A29 A;  3TUY C;  4M2O A;  1N65 A;  3AAK A;  4DUQ A;  2LVV A;  2NXQ A;  1OMV A;  3CAB A;  1B9A A;  1RRO A;  1SSE B;  3KF9 A;  1LXF C;  3ZNI A;  5DIC A;  1IQ5 A;  2KYC A;  1SL8 A;  2K7D A;  1WDC B;  5AFP A;  2TN4 A;  1AK8 A;  1IIO A;  1SNL A;  3OB1 B;  1TNP A;  5HYD A;  1LA0 A;  2L51 A;  2WC8 A;  3CZT X;  3K21 A;  1F70 A;  1OOJ A;  2LVJ A;  1XFY O;  3L4A A;  3BFH A;  1C3Y A;  4OR9 B;  5D3O A;  1FBV A;  2K61 A;  1DGV A;  3OBV A;  1EXR A;  2OS8 C;  3EVR A;  5FI2 A;  1K90 D;  2WCJ A;  2COL B;  2M29 A;  4GPL B;  1TUZ A;  1KK8 C;  1OOG A;  3B87 A;  5AER A;  1LKJ A;  2KPH A;  5KTY A;  1BG1 A;  1M63 B;  2WOR A;  4DS7 A;  2QEB A;  1QX7 A;  1VRK A;  3BOW A;  3OX5 A;  1CM1 A;  2I94 A;  2NCP A;  1R2U A;  2O60 A;  1EJ3 A;  4I5L B;  4CFR A;  1K9K A;  3I5G C;  4F7F A;  3O4Y A;  1BJF A;  1YX7 A;  3I5I B;  1KFU S;  5HKZ A;  1CDM A;  4FQT A;  4TNC A;  3RZS A;  1KSO A;  1OE9 B;  1OOI X;  1XFX O;  4HRE E;  3V2L A;  1IRJ A;  1REC A;  2JC2 A;  2KLD A;  1ZFS A;  1D1O A;  2CXJ A;  3FE8 A;  2FOT A;  2MLE C;  2OPO A;  1SKT A;  5HLV A;  5AXI A;  1WRK A;  2QEV A;  3O4X A;  3KPX A;  2MJW B;  4PHK A;  3I5H B;  1DEL A;  1E8A A;  1ZAC A;  2CCM A;  3S0F A;  4GBA A;  4XYN A;  1CLL A;  1UHJ A;  2A4J A;  1ALV A;  3PN7 C;  4CID A;  1UWO A;  2WCB A;  1EG3 A;  5DKR A;  3FS7 A;  2D8N A;  3R1P A;  3UNW A;  1YUT A;  5G08 A;  1N0Y A;  1XA5 A;  1LVC D;  1QVI Y;  1Y1U A;  3GOF A;  2V53 A;  2IS9 A;  3DZT A;  3ICB A;  1CDN A;  3BUN B;  4OCI A;  2L2E A;  1X02 A;  4I5N B;  3DD4 A;  1DJG A;  1J7O A;  3R1O A;  3EKJ A;  3C1V A;  3ZWH A;  3CZ2 A;  3KHE A;  1L7Z A;  4QJ3 B;  3TS5 B;  1DJH A;  1NUB A;  1SPY A;  3L47 A;  4AQI A;  4XJK B;  3R72 A;  4C0J A;  3O2P A;  3TDU A;  2M7L A;  3VRQ A;  2ZRT A;  4OKH A;  5CPV A;  4YBH B;  2P71 A;  1B1G A;  1CLB A;  5IBW A;  1S26 D;  3JTD C;  4GGF C;  3SG4 A;  1BLQ A;  2LV7 A;  2OTG B;  2HQW A;  3DF0 A;  1AP4 A;  1W7I B;  3K1E A;  1TTX A;  1DEK A;  4I5K A;  2M97 A;  2KNE A;  1OQP A;  2LP3 A;  5K89 A;  3D77 A;  1F4O A;  3IVT A;  4CPV A;  1NP8 A;  4WQ3 A;  2M9G A;  1K95 A;  1SCM C;  2LAN A;  4IL1 A;  1YX8 A;  4GFT A;  1JFK A;  1K94 A;  1EG4 A;  2BCX A;  2EHB A;  2KGR A;  2M0R A;  4PT1 A;  4DCK A;  1BOC A;  3DYE A;  3JVT B;  2CBL A;  3SS3 A;  2GTE A;  1J55 A;  4JQ0 D;  2KAX A;  2NCO A;  4QJ5 B;  2P70 A;  4BY4 A;  1RJV A;  3BFB A;  5CSJ A;  1GJY A;  4OV2 A;  3CYZ A;  3SG6 A;  1GGZ A;  1RTP 1;  1SYM A;  1KFU L;  1DF0 A;  2ERB A;  1LS8 A;  1RK9 A;  1U5I A;  1J1E A;  1K93 D;  1QIW A;  4YI8 A;  4P5O E;  1WDC C;  1XFR A;  4IJ7 A;  2LHL A;  1C3Z A;  5B8I B;  4YGC B;  2GGZ A;  1KQM B;  2M7N A;  3S0E A;  3PSR A;  5HKY A;  2BE6 A;  1M31 A;  1OSA A;  1DJY A;  1OMD A;  1S5G Y;  1V1F A;  1YVH A;  3CLN A;  3D74 A;  3BUX B;  3VB1 A;  4PHN A;  1IG5 A;  1KSM A;  4L9M A;  1JSA A;  2L5Y A;  3CTN A;  1TNW A;  4Q04 A;  3CZ0 A;  1OZS A;  3PM8 A;  1NPQ A;  1B4C A;  1ODB A;  2CNP A;  1P28 A;  4D1E A;  2BKH B;  1BR1 B;  1PUL A;  3NSO A;  4A4B A;  5I8N A;  1JC2 A;  2CTN A;  2KI6 D;  2JT8 A;  1KWO B;  1QXP A;  3I5F B;  4PE7 A;  1NIW A;  4MRX A;  5J3X A;  1A75 A;  5EL2 A;  5BPJ A;  3BUW B;  1K96 A;  2BKI B;  2F33 A;  5I2Q A;  1F54 A;  2LMV A;  4U8D A;  1ZMZ A;  1MWN A;  4DRW A;  2JWW A;  3VRR A;  4R1E A;  1TWO A;  2MBX A;  1CFD A;  3WHU B;  3KEV A;  4MVF A;  1QIV A;  3LK0 A;  2KI6 C;  1SK6 D;  4INW A;  3I5H C;  2I7A A;  4GNK B;  5FI6 A;  1CFP A;  1B8L A;  2PAS A;  1MXL C;  4ZCU A;  1QJT A;  1UHN A;  4GUK A;  4N5X A;  2F8P A;  1B8R A;  2KYF A;  1C07 A;  1JF0 A;  1EL4 A;  1N2D A;  1RFJ A;  2JPO A;  1JFJ A;  2EGD A;  3GK2 A;  1QVI Z;  3FE6 A;  3SG5 A;  3IQQ A;  2LVK A;  2K7B A;  2ZN8 A;  3H4S E;  2KI4 B;  4YRU A;  1XK4 A;  2BNX A;  3IQO A;  2LAP A;  2KFF A;  2PAL A;  4MN0 A;  2JTZ A;  3SS5 A;  4N1F A;  1SR6 B;  2GV5 A;  1B7T Y;  3TUY B;  4MZK A;  4BY5 A;  3UO9 A;  2AUC A;  1DQE A;  5JOL A;  1QLK A;  1M46 A;  1SY9 A;  3S0D A;  4HRG A;  1UHH A;  2JUL A;  5AAN A;  3D75 A;  5CSI A;  1A03 A;  1Y1X A;  4MBE A;  1DGU A;  1G8I A;  2MHH A;  3WNX B;  1F71 A;  4NDD A;  4ORA B;  1KCY A;  2ZNE A;  3TDI A;  3CR4 X;  3OHM B;  5I2O A;  1LA3 A;  1XVJ A;  2JXC A;  2BBM A;  3PAT A;  1DC1 A;  1SW8 A;  1QX2 A;  1S6C A;  3OP0 A;  2JNF A;  2JRF A;  3D0Y B;  1PRW A;  3D78 A;  1G4Y R;  1Y6W A;  3NHT A;  1CMF A;  1NX1 A;  1NX3 A;  1QV1 A;  1IJ5 A;  1HQV A;  1OOH A;  3GK1 A;  1IJ6 A;  1M39 A;  3BFA A;  4JKT A;  3DVE A;  1K9P A;  2PSR A;  1SBJ A;  3EK7 A;  1K2H A;  1L2O B;  2BL0 C;  2Y1M A;  1KQV A;  3JVT C;  2KQ6 A;  4E68 A;  2NLN A;  3BUM B;  1QLS A;  1J7Q A;  5DKN A;  1IKU A;  3CDN A;  3DXL A;  4OVN F;  4GGN A;  1S1E A;  2H61 A;  1ALW A;  1IH0 A;  1XO5 A;  2WC6 A;  1GGW A;  3CZ1 A;  4MLW A;  1NWD A;  5FI7 A;  1WRZ A;  1XFZ O;  1H8B A;  2JTT A;  1CB1 A;  2FCE A;  4PDZ A;  1J1D A;  4ICB A;  2KHN A;  2P6B B;  1CM4 A;  1W9Z A;  3A4U B;  2L98 A;  2ZN9 A;  4ETO A;  1KQM C;  2LCP A;  2O5G A;  1S5G Z;  2K0J A;  3PM2 A;  2K7O A;  3SG7 A;  3O6B A;  5KSZ A;  2Q91 A;  3FE9 A;  1Y0V H;  2L50 A;  1IWQ A;  1F55 A;  1BMO A;  2LE9 B;  3BJH A;  4NQG A;  2F3Z A;  4MEW A;  2BEC A;  1CNP A;  4M2P A;  3B6X A;  3BYA A;  2MRD A;  3FWC A;  2JPT A;  2LP2 A;  1DJI A;  1DTL A;  1G33 A;  2FCD A;  1H4B A;  1MUX A;  1LIN A;  4ORC B;  4PHM A;  1MF8 B;  2BE4 A;  2LMU A;  2WOS A;  2Y1N A;  2I18 A;  4JWQ A;  2WCF A;  4MZJ A;  1TUJ A;  2HPS A;  1B47 A;  3RLZ A;  1JBA A;  3A8R A;  3S0G A;  2HF5 A;  1TOP A;  3NSI A;  3SIA A;  3SG3 A;  5I94 A;  2BCB A;  2ZND A;  3LLE A;  2KQY A;  1TRF A;  4DIR A;  3PLF B;  1C7W A;  5GQQ C;  5HL1 A;  3DVJ A;  1EH2 A;  1OZO A;  2ZRS A;  4GAO A;  1XK4 C;  2I2R E;  1WLM A;  3VRP A;  5I2L A;  2L2C A;  4PE4 A;  3PAL A;  1YRT B;  3CR5 X;  3JTD B;  3EK4 A;  1TN4 A;  2F2P A;  1V1G A;  2H8V A;  3EG5 B;  2MA2 A;  1M45 A;  3NHI A;  1BF5 A;  3RM1 A;  2LC5 A;  2PQL A;  3E3R A;  3TZ1 A;  1Y1A A;  3S0B A;  1SRA A;  3OGN A;  1J7P A;  1KK7 Y;  1UUS A;  2KBM A;  2HET A;  1TIZ A;  1YTZ C;  1SCM B;  2VRG A;  1NSH A;  1TCF A;  2AAO A;  3I5I C;  1DVI A;  1QS7 A;  1QV0 A;  3SG2 A;  1ZUZ A;  4PHJ A;  1YRU B;  1DJX A;  4M2Q A;  1F4Q A;  2CT9 A;  1SR6 C;  1B7T Z;  2M8U A;  3SS4 A;  5JJG A;  1W7J B;  1QAS A;  1FI6 A;  1AJ5 A;  2K2A A;  1HT9 A;  1IQ3 A;  2ZFD A;  2K7C A;  2WCM A;  1NCZ A;  2L5X B;  3QRX A;  4FTG A;  1UHK A;  5CSF A;  3HX4 A;  4QJ4 B;  1CFC A;  5AEQ A;  2JNX A;  3HCM A;  3QME A;  1QX5 B;  1NX2 A;  1SL7 A;  3VGO A;  3AKA A;  2K8M B;  1S3P A;  3L4L A;  1YUU A;  1YVL A;  1FF1 A;  1MHO A;  2KDH A;  2LLT A;  3BOW B;  4WQ2 A;  1OMR A;  1YUR A;  1A4P A;  2H61 C;  1JF2 A;  5F6T A;  2MAZ A;  5FYX A;  2KAY A;  4FQO A;  2MLF C;  2BBN A;  1DJW A;  2WCK A;  1JWD A;  3M0W A;  3TS5 C;  2EC6 B;  1FPW A;  1CLM A;  1PSR A;  3NGV A;  3NSL A;  3DVM A;  2WCL A;  3WHT B;  2WND A;  1L2O C;  2RGI A; 
#chains in the Genus database with same CATH homology
 4CLN A;  3LCP C;  2LUX A;  2B1U A;  1S6I A;  1WY9 A;  1AJ4 A;  1QTX A;  4CFQ A;  1K9U A;  3CR2 A;  4ORB B;  5KU1 A;  2JXL A;  2SCP A;  1JUO A;  2KAV A;  3PFV A;  5ER4 X;  4PE1 A;  1RWY A;  3VRN A;  1XYD A;  2KSP A;  1TNQ A;  2M3W A;  2OTG C;  2KFG A;  3AAJ A;  4WRI A;  4HRH A;  1BU3 A;  2WCE A;  3WXA A;  4AQJ A;  2LLU A;  1QAT A;  1CFF A;  4JPZ B;  1MR8 A;  1AVS A;  1CDP A;  2OS8 B;  1ZOT B;  1DMO A;  2E6W A;  3AKB A;  1TNX A;  1KFX L;  4P2Y B;  1KK8 B;  4YGE B;  2JT0 A;  2DOQ A;  4NDB A;  2GGM A;  1WRL A;  2AMI A;  1CDL A;  3VRO A;  1SL9 A;  1XFW O;  1UHI A;  1GQM A;  1DT7 B;  1CMG A;  2L4H A;  1Q80 A;  2LVI A;  3DVK A;  3OB2 B;  2JU0 A;  1MXE A;  2JOJ A;  3I5G B;  4A4C A;  3TDZ A;  1BOD A;  1YR5 A;  1A2X A;  1NX0 A;  3D0Y A;  3EK8 A;  2JT3 A;  3EVU A;  5ER5 A;  3DF0 B;  3LL8 B;  2LLS A;  1S6J A;  1UUR A;  1B8C A;  1WLZ A;  3SJS A;  1BT6 A;  1SCV A;  4XJK A;  2Q4U A;  1YUS A;  4AOM A;  2M1U A;  2L0P A;  4PAL A;  2LNK A;  2JZI A;  2Y5I A;  3BUO B;  5TNC A;  2L4I A;  2Y4Q A;  4I5J A;  1AUI B;  3O78 A;  1NCY A;  1XFU O;  2KFH A;  2PRU A;  3PN7 B;  1UP5 A;  4N1G A;  1PAL A;  2FJU B;  4PCW A;  4NDC A;  2G9B A;  2KBI A;  2F3Y A;  2LUC A;  1PVB A;  3D10 A;  3IF7 A;  1F8H A;  2G2B A;  3CGA A;  3NXA A;  4YGB B;  3CS1 A;  1NCX A;  3OX6 A;  3GK4 X;  4YI9 A;  1DF0 B;  5HKW A;  1KK7 Z;  1SMG A;  1TCO B;  1DJZ A;  5D69 A;  1U5I B;  3KO0 A;  2NZ0 A;  1KWO C;  4C0L A;  2F2O A;  3I5F C;  4YGA A;  1CKK A;  5CSN A;  1MQ1 A;  2HQ8 A;  2H2K A;  2BL0 B;  2KOT A;  1J7R A;  1CTR A;  1R6P A;  2SAS A;  2ZKM X;  2K2F A;  3CWG A;  2QAC A;  4MZL A;  1IGV A;  1K8U A;  5D7F A;  1KFX S;  4YGD B;  2PVB A;  3LK1 A;  2M49 B;  3SIB A;  4F0Z B;  3NSK A;  4UPG A;  2E30 A;  1XFV O;  3BXK A;  3EVV A;  1BR4 B;  1C7V A;  2R2I A;  1S36 A;  4USL A;  2LM5 A;  2ISD A;  1AHR A;  5DKQ A;  2PMY A;  3BQ3 A;  4ZCV A;  2KGB C;  1FW4 A;  5HLO A;  4C0K A;  3MSE B;  2QPT A;  2KI4 C;  3EKH A;  5PAL A;  2LMT A;  2JQ6 A;  3FIA A;  4HSZ A;  1NYA A;  2M1K B;  1A75 B;  3F45 A;  4MRY A;  4MSP A;  4QJ3 B;  2LHI A;  3FWB A;  2BCA A;  1PSB A;  2EC6 C;  4GGF A;  4PE0 A;  1FI5 A;  1PVA A;  1PK0 D;  1A29 A;  3TUY C;  4M2O A;  1N65 A;  3AAK A;  4DUQ A;  2LVV A;  2NXQ A;  1OMV A;  1B9A A;  1RRO A;  3KF9 A;  1LXF C;  3ZNI A;  1IQ5 A;  2KYC A;  1SL8 A;  2K7D A;  1WDC B;  5AFP A;  2TN4 A;  1AK8 A;  1SNL A;  3OB1 B;  1TNP A;  5HYD A;  1LA0 A;  2L51 A;  2WC8 A;  3CZT X;  3K21 A;  1F70 A;  1OOJ A;  2LVJ A;  1XFY O;  4OR9 B;  1FBV A;  2K61 A;  1DGV A;  1EXR A;  2OS8 C;  3EVR A;  1K90 D;  2COL B;  2M29 A;  4GPL B;  1KK8 C;  5AER A;  1LKJ A;  5KTY A;  1BG1 A;  1M63 B;  2WOR A;  4DS7 A;  1QX7 A;  1VRK A;  3BOW A;  3OX5 A;  1CM1 A;  2I94 A;  2NCP A;  1R2U A;  2O60 A;  1EJ3 A;  4I5L B;  4CFR A;  1K9K A;  3I5G C;  3O4Y A;  1BJF A;  1YX7 A;  3I5I B;  1KFU S;  5HKZ A;  1CDM A;  4TNC A;  1KSO A;  1OE9 B;  1XFX O;  4HRE E;  1IRJ A;  1REC A;  2JC2 A;  1ZFS A;  1D1O A;  2CXJ A;  2FOT A;  2MLE C;  2OPO A;  1SKT A;  5HLV A;  5AXI A;  1WRK A;  3KPX A;  2MJW B;  4PHK A;  3I5H B;  1E8A A;  1ZAC A;  2CCM A;  4GBA A;  4XYN A;  1CLL A;  1UHJ A;  2A4J A;  1ALV A;  3PN7 C;  4CID A;  1UWO A;  2WCB A;  1EG3 A;  5DKR A;  3FS7 A;  2D8N A;  1YUT A;  5G08 A;  1N0Y A;  1XA5 A;  1LVC D;  1QVI Y;  1Y1U A;  3GOF A;  2V53 A;  2IS9 A;  3ICB A;  1CDN A;  3BUN B;  4OCI A;  2L2E A;  1X02 A;  4I5N B;  3DD4 A;  1DJG A;  1J7O A;  3EKJ A;  3C1V A;  3ZWH A;  3KHE A;  3TS5 B;  1L7Z A;  1DJH A;  1NUB A;  1SPY A;  4AQI A;  4XJK B;  4C0J A;  3O2P A;  3TDU A;  2M7L A;  3VRQ A;  2ZRT A;  4OKH A;  5CPV A;  4YBH B;  1B1G A;  1CLB A;  5IBW A;  1S26 D;  3JTD C;  4GGF C;  3SG4 A;  1BLQ A;  2LV7 A;  2OTG B;  2HQW A;  3DF0 A;  1AP4 A;  1W7I B;  1TTX A;  4I5K A;  2M97 A;  2KNE A;  1OQP A;  2LP3 A;  5K89 A;  1F4O A;  4CPV A;  1NP8 A;  4WQ3 A;  2M9G A;  1K95 A;  1SCM C;  2LAN A;  4IL1 A;  1YX8 A;  4GFT A;  1JFK A;  1K94 A;  1EG4 A;  2BCX A;  2EHB A;  2KGR A;  2M0R A;  4DCK A;  1BOC A;  3JVT B;  2CBL A;  1J55 A;  4JQ0 D;  2KAX A;  2NCO A;  4QJ5 B;  4BY4 A;  1RJV A;  5CSJ A;  1GJY A;  4OV2 A;  3SG6 A;  1GGZ A;  1RTP 1;  1SYM A;  1KFU L;  1DF0 A;  1RK9 A;  1U5I A;  1J1E A;  1K93 D;  1QIW A;  4YI8 A;  4P5O E;  1WDC C;  2LHL A;  5B8I B;  4YGC B;  2GGZ A;  1KQM B;  2M7N A;  3PSR A;  5HKY A;  2BE6 A;  1M31 A;  1OSA A;  1DJY A;  1OMD A;  1S5G Y;  1V1F A;  1YVH A;  3CLN A;  3BUX B;  4PHN A;  1IG5 A;  1KSM A;  4L9M A;  1JSA A;  3CTN A;  1TNW A;  4Q04 A;  1OZS A;  3PM8 A;  1NPQ A;  1B4C A;  1ODB A;  2CNP A;  4D1E A;  2BKH B;  1BR1 B;  1PUL A;  3NSO A;  4A4B A;  5I8N A;  1JC2 A;  2CTN A;  2KI6 D;  2JT8 A;  1KWO B;  1QXP A;  3I5F B;  4PE7 A;  1NIW A;  4MRX A;  5J3X A;  1A75 A;  5BPJ A;  3BUW B;  1K96 A;  2BKI B;  2F33 A;  5I2Q A;  1F54 A;  2LMV A;  4U8D A;  1ZMZ A;  1MWN A;  4DRW A;  2JWW A;  3VRR A;  4R1E A;  2MBX A;  1CFD A;  3WHU B;  3KEV A;  4MVF A;  1QIV A;  3LK0 A;  2KI6 C;  1SK6 D;  3I5H C;  2I7A A;  4GNK B;  1CFP A;  1B8L A;  2PAS A;  1MXL C;  4ZCU A;  1QJT A;  1UHN A;  4GUK A;  4N5X A;  2F8P A;  1B8R A;  2KYF A;  1C07 A;  1JF0 A;  1EL4 A;  1N2D A;  1RFJ A;  1JFJ A;  2EGD A;  3GK2 A;  1QVI Z;  3SG5 A;  3IQQ A;  2LVK A;  2K7B A;  2ZN8 A;  3H4S E;  2KI4 B;  4YRU A;  1XK4 A;  3IQO A;  2LAP A;  2KFF A;  2PAL A;  4MN0 A;  2JTZ A;  4N1F A;  1SR6 B;  2GV5 A;  1B7T Y;  3TUY B;  4MZK A;  4BY5 A;  2AUC A;  5JOL A;  1QLK A;  1M46 A;  1SY9 A;  4HRG A;  1UHH A;  2JUL A;  5AAN A;  5CSI A;  1A03 A;  1Y1X A;  4MBE A;  1DGU A;  1G8I A;  2MHH A;  3WNX B;  1F71 A;  4NDD A;  4ORA B;  1KCY A;  2ZNE A;  3TDI A;  3CR4 X;  3OHM B;  5I2O A;  1LA3 A;  1XVJ A;  2JXC A;  2BBM A;  3PAT A;  1SW8 A;  1QX2 A;  1S6C A;  3OP0 A;  2JNF A;  2JRF A;  3D0Y B;  1PRW A;  1CMF A;  1G4Y R;  1Y6W A;  1NX1 A;  1NX3 A;  1QV1 A;  1IJ5 A;  1HQV A;  3GK1 A;  1IJ6 A;  1M39 A;  3DVE A;  1K9P A;  2PSR A;  1SBJ A;  3EK7 A;  1K2H A;  1L2O B;  2BL0 C;  2Y1M A;  1KQV A;  3JVT C;  2KQ6 A;  4E68 A;  2NLN A;  3BUM B;  1QLS A;  1J7Q A;  5DKN A;  1IKU A;  4OVN F;  4GGN A;  1S1E A;  2H61 A;  1ALW A;  1IH0 A;  1XO5 A;  1GGW A;  4MLW A;  1NWD A;  1WRZ A;  1XFZ O;  1H8B A;  2JTT A;  1CB1 A;  2FCE A;  4PDZ A;  1J1D A;  4ICB A;  2KHN A;  2P6B B;  1CM4 A;  3A4U B;  2L98 A;  2ZN9 A;  4ETO A;  1KQM C;  2LCP A;  2O5G A;  1S5G Z;  2K0J A;  3SG7 A;  2K7O A;  3O6B A;  5KSZ A;  2Q91 A;  1Y0V H;  2L50 A;  1IWQ A;  1F55 A;  1BMO A;  2LE9 B;  4NQG A;  1CNP A;  2F3Z A;  4MEW A;  2BEC A;  4M2P A;  3BYA A;  2MRD A;  3FWC A;  2JPT A;  2LP2 A;  1DJI A;  1DTL A;  1G33 A;  2FCD A;  1H4B A;  1MUX A;  1LIN A;  4ORC B;  4PHM A;  1MF8 B;  2BE4 A;  2LMU A;  2WOS A;  2Y1N A;  2I18 A;  4JWQ A;  2WCF A;  4MZJ A;  2HPS A;  1B47 A;  3RLZ A;  1JBA A;  3A8R A;  2HF5 A;  1TOP A;  3NSI A;  3SIA A;  3SG3 A;  2BCB A;  2ZND A;  3LLE A;  2KQY A;  1TRF A;  4DIR A;  3PLF B;  1C7W A;  5GQQ C;  3DVJ A;  1EH2 A;  1OZO A;  2ZRS A;  4GAO A;  1XK4 C;  2I2R E;  1WLM A;  3VRP A;  5I2L A;  4PE4 A;  3PAL A;  1YRT B;  3CR5 X;  3JTD B;  3EK4 A;  1TN4 A;  2F2P A;  1V1G A;  2MA2 A;  1M45 A;  1BF5 A;  3RM1 A;  2LC5 A;  3TZ1 A;  3E3R A;  1Y1A A;  1SRA A;  1J7P A;  1KK7 Y;  1UUS A;  2KBM A;  2HET A;  1TIZ A;  1YTZ C;  1SCM B;  2VRG A;  1NSH A;  1TCF A;  2AAO A;  3I5I C;  1DVI A;  1QS7 A;  1QV0 A;  3SG2 A;  1ZUZ A;  4PHJ A;  1YRU B;  1DJX A;  4M2Q A;  1F4Q A;  2CT9 A;  1SR6 C;  1B7T Z;  2M8U A;  5JJG A;  1W7J B;  1QAS A;  1FI6 A;  1AJ5 A;  2K2A A;  1HT9 A;  1IQ3 A;  2ZFD A;  2K7C A;  1NCZ A;  2L5X B;  3QRX A;  4FTG A;  1UHK A;  5CSF A;  3HX4 A;  4QJ4 B;  1CFC A;  5AEQ A;  2JNX A;  3HCM A;  1QX5 B;  1NX2 A;  1SL7 A;  3VGO A;  3AKA A;  2K8M B;  1S3P A;  1YUU A;  1YVL A;  1FF1 A;  1MHO A;  2KDH A;  2LLT A;  3BOW B;  4WQ2 A;  1OMR A;  1YUR A;  1A4P A;  2H61 C;  1JF2 A;  5F6T A;  2MAZ A;  5FYX A;  2KAY A;  4FQO A;  2MLF C;  2BBN A;  1DJW A;  1JWD A;  3M0W A;  3TS5 C;  2EC6 B;  1FPW A;  1CLM A;  1PSR A;  3NSL A;  3DVM A;  3WHT B;  2WND A;  1L2O C;  2RGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...