3I5IB

The crystal structure of squid myosin s1 in the presence of so4 2-
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain isoform A
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB01
1SCMC 3PATA 1X02A 3TUYB 5ER5A 3CR2A 3GK2A 2KDHA 5KU1A 1BMOA 2Q4UA 1XFXO 4ORCB 2BE6A 3TS5B 2DOQA 2HQ8A 4I5NB 3DF0A 5F6TA 1KSOA 4MBEA 1XVJA 1U5IA 1ZOTB 2CBLA 2M7LA 5CPVA 1K9PA 3BUNB 3KHEA 2LUXA 2JC2A 2EC6B 1XK4A 2EHBA 3HX4A 2M9GA 3PFVA 4C0JA 1GGWA 1M63B 2OTGC 1S36A 1GGZA 1BODA 5DKQA 1BT6A 1QLKA 4IL1A 1DTLA 1QX5B 3OX6A 2M1KB 2FJUB 1B8RA 2JZIA 3ZWHA 1CFFA 2WOSA 4AOMA 2Y5IA 3TS5C 2KHNA 1IQ3A 4PDZA 1JUOA 1MUXA 4MN0A 4HRHA 1CKKA 4GGNA 3DF0B 4GBAA 1S26D 1BR1B 1CDLA 1J1EA 1TN4A 2MAZA 3FWBA 5I2LA 2OS8B 4DS7A 1DGUA 4OV2A 3A8RA 4JQ0D 1L2OB 1PALA 3JTDC 1OMRA 3NSOA 2V53A 2Q91A 3H4SE 1J7OA 1BU3A 4JPZB 4DCKA 2JTZA 3TUYC 1JFKA 1NCZA 2CXJA 2K0JA 3PN7B 3QRXA 1OMVA 1AJ4A 1SW8A 4FTGA 3BXKA 5CSJA 2JWWA 2JU0A 2L50A 3K21A 1YUSA 4GPLB 2M3WA 2MLFC 3GK1A 1DJGA 2ZRTA 2M97A 3EK7A 5I2QA 1FI5A 1RWYA 3VGOA 2O60A 2CT9A 4WQ3A 1NIWA 4R1EA 2ZNDA 2BL0B 4TNCA 4ZCVA 1F70A 5CSIA 1CLBA 4NDDA 5CSFA 2L98A 1B7TY 1S1EA 1TTXA 3O2PA 4QJ5B 3VRNA 1NPQA 1SK6D 2PALA 3CZTX 2BBNA 1XYDA 3NSIA 5HYDA 1OOJA 4YGBB 1SCVA 2FCDA 1S6IA 1W7IB 1J7PA 2KGBC 1CB1A 1KCYA 1G4YR 5FYXA 2AMIA 4UPGA 1MF8B 4GGFC 2H61C 2JNXA 2MHHA 3OX5A 2Y1MA 4NDCA 4A4BA 1RTP1 2LE9B 2KQYA 1CTRA 2LP3A 1F4QA 1A03A 1NX2A 2A4JA 2JPTA 2LLSA 2WCBA 1FPWA 2M0RA 3HCMA 4YGAA 1DF0A 3EK4A 3RLZA 4I5JA 4MVFA 5DKNA 3RM1A 1GJYA 4ZCUA 2KFHA 1K93D 3AKAA 2IS9A 1C7VA 1JF0A 3GOFA 1V1FA 2JULA 3VRPA 1G8IA 3D10A 1WRZA 2LAPA 3EVVA 1DJXA 1KFUS 3NSKA 2LLTA 4P5OE 1KQMC 1TIZA 1TRFA 2TN4A 2BECA 3SJSA 1NP8A 2KYFA 2NLNA 2L4IA 3TZ1A 3LK1A 2LMTA 1M45A 1PULA 1MXLC 2M49B 3F45A 2LVKA 2HPSA 2JT8A 1SR6B 4N1GA 1QLSA 1U5IB 1RK9A 2WNDA 1YUTA 1XK4C 4ORAB 3VRRA 1JWDA 1KWOC 5HLVA 1EH2A 4YBHB 5I2OA 3ZNIA 1UP5A 4HSZA 2LVVA 2ZN8A 1SBJA 1XFVO 3SG5A 3AAKA 1CDMA 1B4CA 3AAJA 2LHIA 1BJFA 2R2IA 1F4OA 1OSAA 2SCPA 1NSHA 4HRGA 1KQVA 1TNQA 1K2HA 1Y0VH 1XFUO 2VRGA 1LA3A 5PALA 1QS7A 1XFYO 3DVKA 1ZMZA 3FWCA 1YRUB 1S5GY 2CTNA 2MRDA 3I5HB 1K96A 3SIAA 1B1GA 1F54A 1Y1AA 1KK8B 3IQOA 1ALWA 1B7TZ 5HKZA 1BR4B 2LVIA 3OB2B 3I5IC 1KK7Z 1OQPA 4ORBB 3PM8A 3LK0A 1DF0B 2M29A 1YUUA 1CDPA 1CLLA 1B47A 5AANA 1GQMA 1YURA 2LMUA 1LINA 2JT3A 1L7ZA 3IQQA 1CMGA 3I5HC 3TDZA 1ODBA 1HT9A 1UURA 4MEWA 1A4PA 1H4BA 1R6PA 1PK0D 1FBVA 2L2EA 4MZKA 1RECA 3JVTB 4P2YB 1BLQA 4NQGA 2OPOA 3PN7C 2MBXA 3JTDB 1IRJA 4YI9A 5GQQC 3KEVA 2HF5A 1Y1UA 2GGMA 3LCPC 1N65A 1QASA 1S6JA 1C7WA 3WHTB 1MR8A 3EKJA 1QV0A 4PE7A 1IH0A 1B8CA 1KK8C 2GGZA 3CLNA 4USLA 1DMOA 4YGEB 1CM4A 2EGDA 4M2PA 1IQ5A 1MHOA 5KSZA 2COLB 2JRFA 5D7FA 2PMYA 1TNPA 1JF2A 4YGCB 1IWQA 2CCMA 1M39A 4C0LA 2F8PA 2BBMA 2ZFDA 1QVIZ 1J7RA 1TCOB 1W7JB 3BOWB 3I5GC 4OR9B 2LP2A 1LKJA 1JC2A 1QTXA 5DKRA 2JQ6A 3BOWA 2I7AA 1JBAA 5I8NA 1OZSA 4AQIA 1SR6C 1MXEA 3GK4X 1EL4A 2LNKA 1AVSA 4E68A 2BKHB 2BKIB 3KPXA 3CTNA 1NCYA 1A29A 2LV7A 2L0PA 3SG7A 3SG3A 1S6CA 1K9KA 1PVAA 5K89A 4F0ZB 1MWNA 1EXRA 2B1UA 2LANA 2I94A 3BYAA 3EK8A 1BG1A 1KFXL 3WNXB 4OKHA 2P6BB 2K2FA 1CFPA 1RFJA 2BE4A 4ETOA 1K9UA 1CDNA 1ZACA 1WY9A 1QATA 2E30A 3OHMB 3BUWB 1NCXA 1OMDA 2QPTA 1LA0A 4D1EA 3EVUA 4CPVA 1WDCB 1KK7Y 1NYAA 1UHNA 1WLZA 5JJGA 2NCPA 1UWOA 3EKHA 4CFQA 1NUBA 1WDCC 2LMVA 4PHJA 3LLEA 1DVIA 2ZN9A 5G08A 2HETA 4MZJA 2WCEA 1YR5A 1QXPA 3CWGA 4XJKA 2NZ0A 2L51A 1XFZO 3SG4A 1QIWA 2KFFA 3OB1B 1S3PA 4GFTA 2CNPA 1OE9B 2L5XB 3DVEA 2NXQA 1R2UA 3TDUA 4PHNA 3PLFB 1TCFA 2E6WA 2K8MB 1CFCA 1VRKA 1PRWA 1WRLA 1SCMB 1UUSA 2WCFA 2RGIA 3CS1A 4PCWA 1QIVA 1NX1A 4PE0A 2AUCA 3TDIA 1B9AA 1H8BA 5B8IB 4A4CA 1A2XA 1DJIA 1M46A 4WRIA 2LCPA 4OCIA 3KF9A 2PVBA 2LLUA 3C1VA 3DD4A 1S5GZ 1K95A 4WQ2A 4AQJA 1XFWO 2K61A 1UHKA 1XA5A 5IBWA 1ZFSA 1Y1XA 2LUCA 2OTGB 4JWQA 1F71A 4MSPA 2LHLA 2PSRA 2H2KA 3I5GB 3NSLA 4ICBA 4QJ4B 5ER4X 2KQ6A 1SMGA 3SG6A 1L2OC 4GNKB 1IGVA 1LVCD 2KAXA 2OS8C 4PHKA 4FQOA 1AUIB 2BCXA 5CSNA 5AFPA 2JXLA 1IG5A 1V1GA 4C0KA 1RJVA 4PE4A 1AP4A 2Y1NA 1XO5A 2FCEA 1AK8A 4YI8A 2L4HA 1JSAA 4GAOA 4DIRA 1F8HA 3KO0A 2D8NA 2F2OA 3A4UB 1DGVA 3D0YB 1SL8A 1K94A 1UHHA 2BL0C 5HKYA 3SG2A 5HLOA 3I5FB 2LM5A 1NWDA 4I5KA 2K7OA 1YX8A 1J7QA 2H61A 2KFGA 1IJ5A 2K7BA 2BCAA 2LVJA 2ZNEA 2M8UA 3O78A 1CNPA 5JOLA 2AAOA 3BQ3A 3CGAA 3O6BA 3SIBA 2JNFA 5AERA 1DJYA 3O4YA 1TNWA 1EG4A 4DUQA 1N2DA 1FF1A 2I18A 1UHJA 1JFJA 1QVIY 1KSMA 1J1DA 4MRYA 1QX7A 2JOJA 3FS7A 1KFXS 1M31A 2JTTA 1CM1A 1SL7A 2SASA 3I5FC 4MZLA 4DRWA 2LC5A 4YGDB 4HREE 1AJ5A 1EJ3A 1UHIA 4I5LB 2KI6C 4XYNA 4NDBA 2G2BA 4L9MA 1CMFA 4OVNF 5KTYA 1F55A 2PRUA 4MLWA 2I2RE 1IKUA 3CR5X 3PSRA 2KI4C 2KAYA 5AEQA 2O5GA 3I5IB 4XJKB 1A75A 1DJHA 1PSBA 2KYCA 3OP0A 1NX0A 1LXFC 1ZUZA 4PALA 1SPYA 2KNEA 3D0YA 3AKBA 1QV1A 1SNLA 3EVRA 2HQWA 1KFUL 1QX2A 1YRTB 1K90D 1HQVA 2KBIA 4N1FA 2BCBA 1YVLA 5D69A 1DT7B 4PHMA 2F3ZA 3FIAA 2QACA 1B8LA 3CR4X 3WXAA 1CFDA 3BUOB 1NX3A 1Y6WA 1RROA 2JXCA 1BF5A 1FW4A 2M1UA 1KQMB 1ALVA 2G9BA 1PVBA 4YRUA 2KBMA 1SYMA 3DVJA 2MJWB 2Y4QA 3PALA 1WLMA 2FOTA 1SRAA 1YX7A 3ICBA 3VRQA 1TOPA 2ZKMX 1EG3A 1N0YA 5HKWA 2KOTA 3IF7A 1BOCA 1WRKA 1OZOA 5J3XA 1CLMA 1Q80A 2KI4B 2PASA 1SY9A 2NCOA 2M7NA 4GUKA 3LL8B 4BY5A 2K7DA 2KSPA 2ZRSA 2ISDA 4PE1A 3VROA 4U8DA 1KWOB 4CFRA 1DJWA 3MSEB 1K8UA 3BUMB 1AHRA 3WHUB 3E3RA 1YTZC 2K7CA 2KAVA 1SKTA 2EC6C 2F2PA 4N5XA 4CIDA 2GV5A 3M0WA 5AXIA 2MA2A 5TNCA 4QJ3B 1FI6A 1PSRA 3DVMA 4GGFA 2F33A 3BUXB 3NXAA 4MRXA 2KGRA 3JVTC 1J55A 4CLNA 1MQ1A 1G33A 1E8AA 2KI6D 1IJ6A 2WORA 1C07A 1D1OA 1DJZA 1YVHA 4Q04A 2K2AA 4M2OA 2F3YA 5BPJA 2WC8A 4BY4A 1SL9A 4M2QA 1QJTA 1TNXA 2MLEC 2JT0A 1A75B
chains in the Genus database with same CATH superfamily
1SCMC 3PATA 1X02A 3TUYB 5ER5A 3CR2A 2QEBA 3GK2A 2KDHA 5KU1A 1BMOA 2Q4UA 1XFXO 3DXLA 4ORCB 2BE6A 3TS5B 3K1EA 2DOQA 2HQ8A 4I5NB 3DF0A 2WCLA 5F6TA 1KSOA 4MBEA 1XVJA 1U5IA 1ZOTB 2CBLA 2M7LA 3BFBA 1K9PA 3BUNB 3KHEA 5CPVA 2LUXA 1OW4A 2JC2A 2EC6B 1XK4A 2EHBA 3HX4A 2M9GA 3PFVA 4C0JA 1GGWA 1M63B 2OTGC 1S36A 1GGZA 1BODA 5DKQA 2L2CA 1BT6A 1QLKA 3O4XA 4IL1A 1DTLA 1QX5B 3OX6A 2M1KB 2FJUB 5EL2A 3BFAA 1B8RA 2JZIA 3ZWHA 1DC1A 1CFFA 2WOSA 4AOMA 2Y5IA 1T14A 3TS5C 2KHNA 1IQ3A 4PDZA 1JUOA 1MUXA 3R1VA 4MN0A 4HRHA 1CKKA 4GGNA 3DF0B 4GBAA 1S26D 1BR1B 1CDLA 1J1EA 1TN4A 2MAZA 3FWBA 4INXA 2OS8B 5I2LA 1DGUA 1W9ZA 4DS7A 3SS5A 1DEKA 4OV2A 3SS3A 3A8RA 4JQ0D 1L2OB 1PALA 3JTDC 1OMRA 3NSOA 2V53A 2Q91A 3H4SE 1J7OA 1BU3A 4JPZB 1OOIX 2JTZA 4DCKA 3TUYC 1JFKA 1NCZA 2CXJA 2K0JA 3PN7B 1QWVA 3QRXA 1OMVA 1AJ4A 1SW8A 4FTGA 3BXKA 5CSJA 2JWWA 2JU0A 2L50A 3K21A 1YUSA 1C3ZA 4GPLB 2M3WA 2MLFC 3GK1A 1DJGA 2ZRTA 5FI2A 2M97A 3EK7A 5I2QA 1FI5A 1RWYA 3VGOA 2O60A 2CT9A 3D76A 4WQ3A 1NIWA 4R1EA 2ZNDA 2BL0B 4TNCA 3B6XA 4ZCVA 1F70A 5CSIA 1CLBA 1IIOA 4NDDA 1P28A 2QEHA 5CSFA 2L98A 1B7TY 1S1EA 1TTXA 3O2PA 4QJ5B 3VRNA 1NPQA 1SK6D 2PALA 3CZTX 3L4LA 2BBNA 1XYDA 3CZ2A 3NSIA 5HYDA 1OOJA 4YGBB 1SCVA 2FCDA 1GM0A 1S6IA 1W7IB 1J7PA 2KGBC 1CB1A 1KCYA 1G4YR 2JPOA 3B88A 5FYXA 2AMIA 3R72A 4UPGA 1MF8B 4GGFC 2H61C 2JNXA 2MHHA 3OX5A 2Y1MA 4NDCA 4A4BA 1RTP1 4INWA 2LE9B 2KQYA 1CTRA 2LP3A 1F4QA 1A03A 1NX2A 2A4JA 2JPTA 2LLSA 2WCBA 1FPWA 2M0RA 3HCMA 4YGAA 1DF0A 3EK4A 3RLZA 4I5JA 4MVFA 5DKNA 3RM1A 1GJYA 4ZCUA 2KFHA 1K93D 3AKAA 2IS9A 1C7VA 1JF0A 3GOFA 1V1FA 2JULA 3VRPA 1G8IA 3D10A 1WRZA 2LAPA 3EVVA 1DJXA 1KFUS 3FE8A 3UO9A 3NSKA 3R1PA 2LLTA 4P5OE 3CZ1A 1KQMC 1TIZA 1TRFA 2TN4A 1C3YA 2BECA 3SJSA 1NP8A 2KYFA 2NLNA 2L4IA 3TZ1A 2WCMA 3LK1A 2LMTA 1M45A 1PULA 1MXLC 2M49B 3F45A 2LVKA 2HPSA 2JT8A 1SR6B 4N1GA 1QLSA 1U5IB 1RK9A 2WNDA 1YUTA 1XK4C 4ORAB 3VRRA 5I94A 1JWDA 1KWOC 1OOFA 5HLVA 3CABA 1EH2A 4YBHB 1XFRA 5I2OA 3ZNIA 1UP5A 4HSZA 2LVVA 2ZN8A 1SBJA 1XFVO 3SG5A 2WC6A 3AAKA 1CDMA 1B4CA 3AAJA 2LHIA 1BJFA 2R2IA 1F4OA 1OSAA 4OZDA 2SCPA 1NSHA 4HRGA 1KQVA 1TNQA 1K2HA 3D77A 1Y0VH 2WCJA 1XFUO 2VRGA 1LA3A 5PALA 1QS7A 1XFYO 3DVKA 1ZMZA 3FWCA 1YRUB 1S5GY 2CTNA 2MRDA 3I5HB 1K96A 3SIAA 1B1GA 1F54A 1Y1AA 1KK8B 3IQOA 1ALWA 1B7TZ 5HKZA 1BR4B 2LVIA 3OB2B 3I5IC 1KK7Z 3S0AA 2WCHA 1OQPA 4ORBB 2BNXA 3PM8A 3LK0A 1DF0B 2M29A 1YUUA 1CDPA 1CLLA 1B47A 3RZSA 5AANA 3S0FA 1GQMA 1YURA 2LMUA 1LINA 2JT3A 1L7ZA 3IQQA 1CMGA 3I5HC 3TDZA 1ODBA 3FE6A 1HT9A 1UURA 4MEWA 1A4PA 1Z4HA 1R6PA 1H4BA 1PK0D 1FBVA 2L2EA 4MZKA 1RECA 3JVTB 4P2YB 1BLQA 2KLDA 4NQGA 2OPOA 3PN7C 1Z2CB 2MBXA 3JTDB 1IRJA 4YI9A 5GQQC 3D73A 3KEVA 2HF5A 1Y1UA 2GGMA 3LCPC 1N65A 1QASA 1S6JA 1C7WA 3WHTB 1MR8A 3EKJA 1QV0A 4PE7A 1IH0A 1B8CA 1KK8C 2GGZA 3CLNA 4USLA 3SS4A 1DMOA 4YGEB 1CM4A 2EGDA 4M2PA 1ORGA 1IQ5A 1MHOA 5KSZA 2COLB 2JRFA 3PM2A 5D7FA 2PMYA 1TNPA 1JF2A 4YGCB 5D3OA 1IWQA 2CCMA 1M39A 4C0LA 2F8PA 2BBMA 2ZFDA 1QVIZ 1J7RA 1TCOB 1W7JB 3BOWB 3I5GC 4OR9B 2LP2A 1LKJA 1TUZA 1JC2A 1QTXA 5DKRA 2JQ6A 3BOWA 2I7AA 1JBAA 5I8NA 1OZSA 4AQIA 1SR6C 1MXEA 3GK4X 1EL4A 2LNKA 1AVSA 4E68A 2BKHB 2BKIB 3KPXA 3CTNA 1NCYA 1A29A 2LV7A 2L0PA 3SG7A 3SG3A 1S6CA 1K9KA 1PVAA 5K89A 4F0ZB 1MWNA 1EXRA 2B1UA 2LANA 2I94A 3BYAA 3EK8A 1BG1A 1DQEA 1KFXL 3WNXB 4OKHA 2P6BB 2K2FA 1CFPA 1RFJA 2BE4A 3OBVA 4ETOA 3S0EA 1K9UA 1CDNA 1ZACA 1WY9A 1QATA 2E30A 3OHMB 1OOHA 3BUWB 1NCXA 1OMDA 2QPTA 1LA0A 4D1EA 3EVUA 4CPVA 1WDCB 1KK7Y 1NYAA 1UHNA 1WLZA 5JJGA 2NCPA 1UWOA 3EKHA 4CFQA 1NUBA 1WDCC 2LMVA 4PHJA 3LLEA 1DVIA 3B86A 2ZN9A 5G08A 2HETA 4MZJA 2WCEA 3B87A 1YR5A 1QXPA 3CWGA 4XJKA 2NZ0A 3PJIA 2L51A 1XFZO 3D74A 4IJ7A 3SG4A 1QIWA 2KFFA 3OB1B 4KYNA 1S3PA 4GFTA 2CNPA 1OE9B 2L5XB 3DVEA 2P70A 2NXQA 2QDIA 1R2UA 3TDUA 4PHNA 3PLFB 1TCFA 2E6WA 2K8MB 1CFCA 1VRKA 1PRWA 1WRLA 1SCMB 1UUSA 2WCFA 2RGIA 3CS1A 4PCWA 1QIVA 1NX1A 4PE0A 1SSEB 2AUCA 3TDIA 1B9AA 1TWOA 3D75A 1H8BA 5B8IB 4A4CA 1A2XA 1DJIA 1M46A 2K60A 4WRIA 2LCPA 4OCIA 3KF9A 2PVBA 2LLUA 2FJYA 2WC5A 1S5GZ 1K95A 2PQLA 3C1VA 3DD4A 4WQ2A 4AQJA 1XFWO 2K61A 1UHKA 1XA5A 3CYZA 1ZFSA 1Y1XA 2LUCA 2OTGB 2QEVA 4JWQA 5IBWA 1F71A 4MSPA 2LHLA 2PSRA 2H2KA 3I5GB 3NSLA 4ICBA 3VB1A 4QJ4B 5ER4X 2KQ6A 1SMGA 3SG6A 1L2OC 4GNKB 1IGVA 1LVCD 2KAXA 3NHIA 2KPHA 2OS8C 4PHKA 3S0GA 4FQOA 1AUIB 2BCXA 5CSNA 5AFPA 2JXLA 1IG5A 1V1GA 4C0KA 3S0DA 1RJVA 4PE4A 2ERBA 1AP4A 2Y1NA 1XO5A 2P71A 2FCEA 1AK8A 4YI8A 2L4HA 4PT1A 4GAOA 4DIRA 1JSAA 1F8HA 3KO0A 2D8NA 2F2OA 3A4UB 1DGVA 3D0YB 3L47A 3NGVA 1SL8A 1K94A 1UHHA 2BL0C 5HKYA 3SG2A 1TUJA 3EG5B 5HLOA 3I5FB 2LM5A 1NWDA 4I5KA 4FQTA 2K7OA 1YX8A 1J7QA 3CZ0A 2H61A 2KFGA 1IJ5A 2K7BA 2BCAA 2L5YA 2LVJA 3NHTA 2ZNEA 2M8UA 3O78A 3FE9A 5JOLA 1CNPA 2AAOA 3BFHA 3BQ3A 3CGAA 3O6BA 3SIBA 2JNFA 5AERA 1DJYA 3O4YA 1TNWA 1EG4A 4DUQA 1N2DA 1FF1A 2I18A 1UHJA 1JFJA 1QVIY 1KSMA 1J1DA 4MRYA 1QX7A 2JOJA 3FS7A 3V2LA 2YGUA 1KFXS 1M31A 2JTTA 1CM1A 1SL7A 2SASA 3I5FC 4MZLA 4DRWA 2LC5A 4YGDB 4HREE 1AJ5A 1EJ3A 1UHIA 4I5LB 2KI6C 4XYNA 4NDBA 3R1OA 2G2BA 4L9MA 1CMFA 4OVNF 5KTYA 1F55A 2PRUA 2GTEA 2I2RE 4MLWA 1IKUA 3CR5X 3PSRA 2KI4C 2KAYA 5AEQA 2O5GA 3I5IB 4XJKB 1A75A 1DJHA 3BJHA 1PSBA 2KYCA 3OP0A 1NX0A 1LXFC 1ZUZA 4PALA 4F7FA 1SPYA 2KNEA 3D0YA 3AKBA 1QV1A 1SNLA 3EVRA 2HQWA 1KFUL 1QX2A 3IVTA 1YRTB 1K90D 1HQVA 2KBIA 4N1FA 2BCBA 1YVLA 5D69A 1DT7B 4PHMA 2F3ZA 3FIAA 2QACA 1B8LA 3CR4X 3WXAA 1CFDA 3BUOB 5HL1A 1NX3A 1Y6WA 1RROA 2JXCA 3CDNA 3DY9A 1BF5A 1FW4A 2M1UA 2QEOA 1DELA 1ALVA 1KQMB 2G9BA 1PVBA 2WCKA 4YRUA 2KBMA 1SYMA 3DVJA 2MJWB 2Y4QA 3PALA 1WLMA 2FOTA 4JD9A 1SRAA 1YX7A 3ICBA 3VRQA 1TOPA 2ZKMX 1EG3A 1N0YA 5HKWA 2KOTA 3IF7A 1BOCA 5DICA 1WRKA 1OZOA 5J3XA 1CLMA 1Q80A 2KI4B 2PASA 1SY9A 2NCOA 2M7NA 4GUKA 4JKTA 3LL8B 4BY5A 2K7DA 2KSPA 2ZRSA 2ISDA 4PE1A 3VROA 3D78A 4U8DA 3Q8IA 1OOGA 3DYEA 1KWOB 3DZTA 4CFRA 1DJWA 3UNWA 3QMEA 3MSEB 1K8UA 3BUMB 3OGNA 1AHRA 3B7AA 3WHUB 3E3RA 1YTZC 2K7CA 2KAVA 5FI7A 1SKTA 2EC6C 2F2PA 2BAPA 4N5XA 4CIDA 2GV5A 3M0WA 5AXIA 2MA2A 5TNCA 4QJ3B 1FI6A 1PSRA 3DVMA 4GGFA 2F33A 3BUXB 5FI6A 3NXAA 4MRXA 2KGRA 2KLEA 3JVTC 1J55A 3N7HA 3S0BA 4CLNA 1MQ1A 1G33A 1E8AA 2KI6D 1IJ6A 3L4AA 2WORA 1C07A 1D1OA 2H8VA 1DJZA 2PYQA 1YVHA 4Q04A 1LS8A 2K2AA 4M2OA 2F3YA 5BPJA 2WC8A 4BY4A 1SL9A 4M2QA 1QJTA 1TNXA 2MLEC 2JT0A 1A75B
chains in the Genus database with same CATH topology
1SCMC 3PATA 1X02A 3TUYB 5ER5A 3CR2A 3GK2A 2KDHA 5KU1A 1BMOA 2Q4UA 1XFXO 4ORCB 2BE6A 3TS5B 2DOQA 2HQ8A 4I5NB 3DF0A 5F6TA 1KSOA 4MBEA 1XVJA 1U5IA 1ZOTB 2CBLA 2M7LA 5CPVA 1K9PA 3BUNB 3KHEA 2LUXA 2JC2A 2EC6B 1XK4A 2EHBA 3HX4A 2M9GA 3PFVA 4C0JA 1GGWA 1M63B 2OTGC 1S36A 1GGZA 1BODA 5DKQA 1BT6A 1QLKA 4IL1A 1DTLA 1QX5B 3OX6A 2M1KB 2FJUB 1B8RA 2JZIA 3ZWHA 1CFFA 2WOSA 4AOMA 2Y5IA 3TS5C 2KHNA 1IQ3A 4PDZA 1JUOA 1MUXA 4MN0A 4HRHA 1CKKA 4GGNA 3DF0B 4GBAA 1S26D 1BR1B 1CDLA 1J1EA 1TN4A 2MAZA 3FWBA 5I2LA 2OS8B 4DS7A 1DGUA 4OV2A 3A8RA 4JQ0D 1L2OB 1PALA 3JTDC 1OMRA 3NSOA 2V53A 2Q91A 3H4SE 1J7OA 1BU3A 4JPZB 4DCKA 2JTZA 3TUYC 1JFKA 1NCZA 2CXJA 2K0JA 3PN7B 3QRXA 1OMVA 1AJ4A 1SW8A 4FTGA 3BXKA 5CSJA 2JWWA 2JU0A 2L50A 3K21A 1YUSA 4GPLB 2M3WA 2MLFC 3GK1A 1DJGA 2ZRTA 2M97A 3EK7A 5I2QA 1FI5A 1RWYA 3VGOA 2O60A 2CT9A 4WQ3A 1NIWA 4R1EA 2ZNDA 2BL0B 4TNCA 4ZCVA 1F70A 5CSIA 1CLBA 4NDDA 5CSFA 2L98A 1B7TY 1S1EA 1TTXA 3O2PA 4QJ5B 3VRNA 1NPQA 1SK6D 2PALA 3CZTX 2BBNA 1XYDA 3NSIA 5HYDA 1OOJA 4YGBB 1SCVA 2FCDA 1S6IA 1W7IB 1J7PA 2KGBC 1CB1A 1KCYA 1G4YR 5FYXA 2AMIA 4UPGA 1MF8B 4GGFC 2H61C 2JNXA 2MHHA 3OX5A 2Y1MA 4NDCA 4A4BA 1RTP1 2LE9B 2KQYA 1CTRA 2LP3A 1F4QA 1A03A 1NX2A 2A4JA 2JPTA 2LLSA 2WCBA 1FPWA 2M0RA 3HCMA 4YGAA 1DF0A 3EK4A 3RLZA 4I5JA 4MVFA 5DKNA 3RM1A 1GJYA 4ZCUA 2KFHA 1K93D 3AKAA 2IS9A 1C7VA 1JF0A 3GOFA 1V1FA 2JULA 3VRPA 1G8IA 3D10A 1WRZA 2LAPA 3EVVA 1DJXA 1KFUS 3NSKA 2LLTA 4P5OE 1KQMC 1TIZA 1TRFA 2TN4A 2BECA 3SJSA 1NP8A 2KYFA 2NLNA 2L4IA 3TZ1A 3LK1A 2LMTA 1M45A 1PULA 1MXLC 2M49B 3F45A 2LVKA 2HPSA 2JT8A 1SR6B 4N1GA 1QLSA 1U5IB 1RK9A 2WNDA 1YUTA 1XK4C 4ORAB 3VRRA 1JWDA 1KWOC 5HLVA 1EH2A 4YBHB 5I2OA 3ZNIA 1UP5A 4HSZA 2LVVA 2ZN8A 1SBJA 1XFVO 3SG5A 3AAKA 1CDMA 1B4CA 3AAJA 2LHIA 1BJFA 2R2IA 1F4OA 1OSAA 2SCPA 1NSHA 4HRGA 1KQVA 1TNQA 1K2HA 1Y0VH 1XFUO 2VRGA 1LA3A 5PALA 1QS7A 1XFYO 3DVKA 1ZMZA 3FWCA 1YRUB 1S5GY 2CTNA 2MRDA 3I5HB 1K96A 3SIAA 1B1GA 1F54A 1Y1AA 1KK8B 3IQOA 1ALWA 1B7TZ 5HKZA 1BR4B 2LVIA 3OB2B 3I5IC 1KK7Z 1OQPA 4ORBB 3PM8A 3LK0A 1DF0B 2M29A 1YUUA 1CDPA 1CLLA 1B47A 5AANA 1GQMA 1YURA 2LMUA 1LINA 2JT3A 1L7ZA 3IQQA 1CMGA 3I5HC 3TDZA 1ODBA 1HT9A 1UURA 4MEWA 1A4PA 1H4BA 1R6PA 1PK0D 1FBVA 2L2EA 4MZKA 1RECA 3JVTB 4P2YB 1BLQA 4NQGA 2OPOA 3PN7C 2MBXA 3JTDB 1IRJA 4YI9A 5GQQC 3KEVA 2HF5A 1Y1UA 2GGMA 3LCPC 1N65A 1QASA 1S6JA 1C7WA 3WHTB 1MR8A 3EKJA 1QV0A 4PE7A 1IH0A 1B8CA 1KK8C 2GGZA 3CLNA 4USLA 1DMOA 4YGEB 1CM4A 2EGDA 4M2PA 1IQ5A 1MHOA 5KSZA 2COLB 2JRFA 5D7FA 2PMYA 1TNPA 1JF2A 4YGCB 1IWQA 2CCMA 1M39A 4C0LA 2F8PA 2BBMA 2ZFDA 1QVIZ 1J7RA 1TCOB 1W7JB 3BOWB 3I5GC 4OR9B 2LP2A 1LKJA 1JC2A 1QTXA 5DKRA 2JQ6A 3BOWA 2I7AA 1JBAA 5I8NA 1OZSA 4AQIA 1SR6C 1MXEA 3GK4X 1EL4A 2LNKA 1AVSA 4E68A 2BKHB 2BKIB 3KPXA 3CTNA 1NCYA 1A29A 2LV7A 2L0PA 3SG7A 3SG3A 1S6CA 1K9KA 1PVAA 5K89A 4F0ZB 1MWNA 1EXRA 2B1UA 2LANA 2I94A 3BYAA 3EK8A 1BG1A 1KFXL 3WNXB 4OKHA 2P6BB 2K2FA 1CFPA 1RFJA 2BE4A 4ETOA 1K9UA 1CDNA 1ZACA 1WY9A 1QATA 2E30A 3OHMB 3BUWB 1NCXA 1OMDA 2QPTA 1LA0A 4D1EA 3EVUA 4CPVA 1WDCB 1KK7Y 1NYAA 1UHNA 1WLZA 5JJGA 2NCPA 1UWOA 3EKHA 4CFQA 1NUBA 1WDCC 2LMVA 4PHJA 3LLEA 1DVIA 2ZN9A 5G08A 2HETA 4MZJA 2WCEA 1YR5A 1QXPA 3CWGA 4XJKA 2NZ0A 2L51A 1XFZO 3SG4A 1QIWA 2KFFA 3OB1B 1S3PA 4GFTA 2CNPA 1OE9B 2L5XB 3DVEA 2NXQA 1R2UA 3TDUA 4PHNA 3PLFB 1TCFA 2E6WA 2K8MB 1CFCA 1VRKA 1PRWA 1WRLA 1SCMB 1UUSA 2WCFA 2RGIA 3CS1A 4PCWA 1QIVA 1NX1A 4PE0A 2AUCA 3TDIA 1B9AA 1H8BA 5B8IB 4A4CA 1A2XA 1DJIA 1M46A 4WRIA 2LCPA 4OCIA 3KF9A 2PVBA 2LLUA 3C1VA 3DD4A 1S5GZ 1K95A 4WQ2A 4AQJA 1XFWO 2K61A 1UHKA 1XA5A 5IBWA 1ZFSA 1Y1XA 2LUCA 2OTGB 4JWQA 1F71A 4MSPA 2LHLA 2PSRA 2H2KA 3I5GB 3NSLA 4ICBA 4QJ4B 5ER4X 2KQ6A 1SMGA 3SG6A 1L2OC 4GNKB 1IGVA 1LVCD 2KAXA 2OS8C 4PHKA 4FQOA 1AUIB 2BCXA 5CSNA 5AFPA 2JXLA 1IG5A 1V1GA 4C0KA 1RJVA 4PE4A 1AP4A 2Y1NA 1XO5A 2FCEA 1AK8A 4YI8A 2L4HA 1JSAA 4GAOA 4DIRA 1F8HA 3KO0A 2D8NA 2F2OA 3A4UB 1DGVA 3D0YB 1SL8A 1K94A 1UHHA 2BL0C 5HKYA 3SG2A 5HLOA 3I5FB 2LM5A 1NWDA 4I5KA 2K7OA 1YX8A 1J7QA 2H61A 2KFGA 1IJ5A 2K7BA 2BCAA 2LVJA 2ZNEA 2M8UA 3O78A 1CNPA 5JOLA 2AAOA 3BQ3A 3CGAA 3O6BA 3SIBA 2JNFA 5AERA 1DJYA 3O4YA 1TNWA 1EG4A 4DUQA 1N2DA 1FF1A 2I18A 1UHJA 1JFJA 1QVIY 1KSMA 1J1DA 4MRYA 1QX7A 2JOJA 3FS7A 1KFXS 1M31A 2JTTA 1CM1A 1SL7A 2SASA 3I5FC 4MZLA 4DRWA 2LC5A 4YGDB 4HREE 1AJ5A 1EJ3A 1UHIA 4I5LB 2KI6C 4XYNA 4NDBA 2G2BA 4L9MA 1CMFA 4OVNF 5KTYA 1F55A 2PRUA 4MLWA 2I2RE 1IKUA 3CR5X 3PSRA 2KI4C 2KAYA 5AEQA 2O5GA 3I5IB 4XJKB 1A75A 1DJHA 1PSBA 2KYCA 3OP0A 1NX0A 1LXFC 1ZUZA 4PALA 1SPYA 2KNEA 3D0YA 3AKBA 1QV1A 1SNLA 3EVRA 2HQWA 1KFUL 1QX2A 1YRTB 1K90D 1HQVA 2KBIA 4N1FA 2BCBA 1YVLA 5D69A 1DT7B 4PHMA 2F3ZA 3FIAA 2QACA 1B8LA 3CR4X 3WXAA 1CFDA 3BUOB 1NX3A 1Y6WA 1RROA 2JXCA 1BF5A 1FW4A 2M1UA 1KQMB 1ALVA 2G9BA 1PVBA 4YRUA 2KBMA 1SYMA 3DVJA 2MJWB 2Y4QA 3PALA 1WLMA 2FOTA 1SRAA 1YX7A 3ICBA 3VRQA 1TOPA 2ZKMX 1EG3A 1N0YA 5HKWA 2KOTA 3IF7A 1BOCA 1WRKA 1OZOA 5J3XA 1CLMA 1Q80A 2KI4B 2PASA 1SY9A 2NCOA 2M7NA 4GUKA 3LL8B 4BY5A 2K7DA 2KSPA 2ZRSA 2ISDA 4PE1A 3VROA 4U8DA 1KWOB 4CFRA 1DJWA 3MSEB 1K8UA 3BUMB 1AHRA 3WHUB 3E3RA 1YTZC 2K7CA 2KAVA 1SKTA 2EC6C 2F2PA 4N5XA 4CIDA 2GV5A 3M0WA 5AXIA 2MA2A 5TNCA 4QJ3B 1FI6A 1PSRA 3DVMA 4GGFA 2F33A 3BUXB 3NXAA 4MRXA 2KGRA 3JVTC 1J55A 4CLNA 1MQ1A 1G33A 1E8AA 2KI6D 1IJ6A 2WORA 1C07A 1D1OA 1DJZA 1YVHA 4Q04A 2K2AA 4M2OA 2F3YA 5BPJA 2WC8A 4BY4A 1SL9A 4M2QA 1QJTA 1TNXA 2MLEC 2JT0A 1A75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCM C;  3PAT A;  1X02 A;  3TUY B;  5ER5 A;  3CR2 A;  3GK2 A;  2KDH A;  5KU1 A;  1BMO A;  2Q4U A;  1XFX O;  4ORC B;  2BE6 A;  3TS5 B;  2DOQ A;  2HQ8 A;  4I5N B;  3DF0 A;  5F6T A;  1KSO A;  4MBE A;  1XVJ A;  1U5I A;  1ZOT B;  2CBL A;  2M7L A;  5CPV A;  1K9P A;  3BUN B;  3KHE A;  2LUX A;  2JC2 A;  2EC6 B;  1XK4 A;  2EHB A;  3HX4 A;  2M9G A;  3PFV A;  4C0J A;  1GGW A;  1M63 B;  2OTG C;  1S36 A;  1GGZ A;  1BOD A;  5DKQ A;  1BT6 A;  1QLK A;  4IL1 A;  1DTL A;  1QX5 B;  3OX6 A;  2M1K B;  2FJU B;  1B8R A;  2JZI A;  3ZWH A;  1CFF A;  2WOS A;  4AOM A;  2Y5I A;  3TS5 C;  2KHN A;  1IQ3 A;  4PDZ A;  1JUO A;  1MUX A;  4MN0 A;  4HRH A;  1CKK A;  4GGN A;  3DF0 B;  4GBA A;  1S26 D;  1BR1 B;  1CDL A;  1J1E A;  1TN4 A;  2MAZ A;  3FWB A;  5I2L A;  2OS8 B;  4DS7 A;  1DGU A;  4OV2 A;  3A8R A;  4JQ0 D;  1L2O B;  1PAL A;  3JTD C;  1OMR A;  3NSO A;  2V53 A;  2Q91 A;  3H4S E;  1J7O A;  1BU3 A;  4JPZ B;  4DCK A;  2JTZ A;  3TUY C;  1JFK A;  1NCZ A;  2CXJ A;  2K0J A;  3PN7 B;  3QRX A;  1OMV A;  1AJ4 A;  1SW8 A;  4FTG A;  3BXK A;  5CSJ A;  2JWW A;  2JU0 A;  2L50 A;  3K21 A;  1YUS A;  4GPL B;  2M3W A;  2MLF C;  3GK1 A;  1DJG A;  2ZRT A;  2M97 A;  3EK7 A;  5I2Q A;  1FI5 A;  1RWY A;  3VGO A;  2O60 A;  2CT9 A;  4WQ3 A;  1NIW A;  4R1E A;  2ZND A;  2BL0 B;  4TNC A;  4ZCV A;  1F70 A;  5CSI A;  1CLB A;  4NDD A;  5CSF A;  2L98 A;  1B7T Y;  1S1E A;  1TTX A;  3O2P A;  4QJ5 B;  3VRN A;  1NPQ A;  1SK6 D;  2PAL A;  3CZT X;  2BBN A;  1XYD A;  3NSI A;  5HYD A;  1OOJ A;  4YGB B;  1SCV A;  2FCD A;  1S6I A;  1W7I B;  1J7P A;  2KGB C;  1CB1 A;  1KCY A;  1G4Y R;  5FYX A;  2AMI A;  4UPG A;  1MF8 B;  4GGF C;  2H61 C;  2JNX A;  2MHH A;  3OX5 A;  2Y1M A;  4NDC A;  4A4B A;  1RTP 1;  2LE9 B;  2KQY A;  1CTR A;  2LP3 A;  1F4Q A;  1A03 A;  1NX2 A;  2A4J A;  2JPT A;  2LLS A;  2WCB A;  1FPW A;  2M0R A;  3HCM A;  4YGA A;  1DF0 A;  3EK4 A;  3RLZ A;  4I5J A;  4MVF A;  5DKN A;  3RM1 A;  1GJY A;  4ZCU A;  2KFH A;  1K93 D;  3AKA A;  2IS9 A;  1C7V A;  1JF0 A;  3GOF A;  1V1F A;  2JUL A;  3VRP A;  1G8I A;  3D10 A;  1WRZ A;  2LAP A;  3EVV A;  1DJX A;  1KFU S;  3NSK A;  2LLT A;  4P5O E;  1KQM C;  1TIZ A;  1TRF A;  2TN4 A;  2BEC A;  3SJS A;  1NP8 A;  2KYF A;  2NLN A;  2L4I A;  3TZ1 A;  3LK1 A;  2LMT A;  1M45 A;  1PUL A;  1MXL C;  2M49 B;  3F45 A;  2LVK A;  2HPS A;  2JT8 A;  1SR6 B;  4N1G A;  1QLS A;  1U5I B;  1RK9 A;  2WND A;  1YUT A;  1XK4 C;  4ORA B;  3VRR A;  1JWD A;  1KWO C;  5HLV A;  1EH2 A;  4YBH B;  5I2O A;  3ZNI A;  1UP5 A;  4HSZ A;  2LVV A;  2ZN8 A;  1SBJ A;  1XFV O;  3SG5 A;  3AAK A;  1CDM A;  1B4C A;  3AAJ A;  2LHI A;  1BJF A;  2R2I A;  1F4O A;  1OSA A;  2SCP A;  1NSH A;  4HRG A;  1KQV A;  1TNQ A;  1K2H A;  1Y0V H;  1XFU O;  2VRG A;  1LA3 A;  5PAL A;  1QS7 A;  1XFY O;  3DVK A;  1ZMZ A;  3FWC A;  1YRU B;  1S5G Y;  2CTN A;  2MRD A;  3I5H B;  1K96 A;  3SIA A;  1B1G A;  1F54 A;  1Y1A A;  1KK8 B;  3IQO A;  1ALW A;  1B7T Z;  5HKZ A;  1BR4 B;  2LVI A;  3OB2 B;  3I5I C;  1KK7 Z;  1OQP A;  4ORB B;  3PM8 A;  3LK0 A;  1DF0 B;  2M29 A;  1YUU A;  1CDP A;  1CLL A;  1B47 A;  5AAN A;  1GQM A;  1YUR A;  2LMU A;  1LIN A;  2JT3 A;  1L7Z A;  3IQQ A;  1CMG A;  3I5H C;  3TDZ A;  1ODB A;  1HT9 A;  1UUR A;  4MEW A;  1A4P A;  1H4B A;  1R6P A;  1PK0 D;  1FBV A;  2L2E A;  4MZK A;  1REC A;  3JVT B;  4P2Y B;  1BLQ A;  4NQG A;  2OPO A;  3PN7 C;  2MBX A;  3JTD B;  1IRJ A;  4YI9 A;  5GQQ C;  3KEV A;  2HF5 A;  1Y1U A;  2GGM A;  3LCP C;  1N65 A;  1QAS A;  1S6J A;  1C7W A;  3WHT B;  1MR8 A;  3EKJ A;  1QV0 A;  4PE7 A;  1IH0 A;  1B8C A;  1KK8 C;  2GGZ A;  3CLN A;  4USL A;  1DMO A;  4YGE B;  1CM4 A;  2EGD A;  4M2P A;  1IQ5 A;  1MHO A;  5KSZ A;  2COL B;  2JRF A;  5D7F A;  2PMY A;  1TNP A;  1JF2 A;  4YGC B;  1IWQ A;  2CCM A;  1M39 A;  4C0L A;  2F8P A;  2BBM A;  2ZFD A;  1QVI Z;  1J7R A;  1TCO B;  1W7J B;  3BOW B;  3I5G C;  4OR9 B;  2LP2 A;  1LKJ A;  1JC2 A;  1QTX A;  5DKR A;  2JQ6 A;  3BOW A;  2I7A A;  1JBA A;  5I8N A;  1OZS A;  4AQI A;  1SR6 C;  1MXE A;  3GK4 X;  1EL4 A;  2LNK A;  1AVS A;  4E68 A;  2BKH B;  2BKI B;  3KPX A;  3CTN A;  1NCY A;  1A29 A;  2LV7 A;  2L0P A;  3SG7 A;  3SG3 A;  1S6C A;  1K9K A;  1PVA A;  5K89 A;  4F0Z B;  1MWN A;  1EXR A;  2B1U A;  2LAN A;  2I94 A;  3BYA A;  3EK8 A;  1BG1 A;  1KFX L;  3WNX B;  4OKH A;  2P6B B;  2K2F A;  1CFP A;  1RFJ A;  2BE4 A;  4ETO A;  1K9U A;  1CDN A;  1ZAC A;  1WY9 A;  1QAT A;  2E30 A;  3OHM B;  3BUW B;  1NCX A;  1OMD A;  2QPT A;  1LA0 A;  4D1E A;  3EVU A;  4CPV A;  1WDC B;  1KK7 Y;  1NYA A;  1UHN A;  1WLZ A;  5JJG A;  2NCP A;  1UWO A;  3EKH A;  4CFQ A;  1NUB A;  1WDC C;  2LMV A;  4PHJ A;  3LLE A;  1DVI A;  2ZN9 A;  5G08 A;  2HET A;  4MZJ A;  2WCE A;  1YR5 A;  1QXP A;  3CWG A;  4XJK A;  2NZ0 A;  2L51 A;  1XFZ O;  3SG4 A;  1QIW A;  2KFF A;  3OB1 B;  1S3P A;  4GFT A;  2CNP A;  1OE9 B;  2L5X B;  3DVE A;  2NXQ A;  1R2U A;  3TDU A;  4PHN A;  3PLF B;  1TCF A;  2E6W A;  2K8M B;  1CFC A;  1VRK A;  1PRW A;  1WRL A;  1SCM B;  1UUS A;  2WCF A;  2RGI A;  3CS1 A;  4PCW A;  1QIV A;  1NX1 A;  4PE0 A;  2AUC A;  3TDI A;  1B9A A;  1H8B A;  5B8I B;  4A4C A;  1A2X A;  1DJI A;  1M46 A;  4WRI A;  2LCP A;  4OCI A;  3KF9 A;  2PVB A;  2LLU A;  3C1V A;  3DD4 A;  1S5G Z;  1K95 A;  4WQ2 A;  4AQJ A;  1XFW O;  2K61 A;  1UHK A;  1XA5 A;  5IBW A;  1ZFS A;  1Y1X A;  2LUC A;  2OTG B;  4JWQ A;  1F71 A;  4MSP A;  2LHL A;  2PSR A;  2H2K A;  3I5G B;  3NSL A;  4ICB A;  4QJ4 B;  5ER4 X;  2KQ6 A;  1SMG A;  3SG6 A;  1L2O C;  4GNK B;  1IGV A;  1LVC D;  2KAX A;  2OS8 C;  4PHK A;  4FQO A;  1AUI B;  2BCX A;  5CSN A;  5AFP A;  2JXL A;  1IG5 A;  1V1G A;  4C0K A;  1RJV A;  4PE4 A;  1AP4 A;  2Y1N A;  1XO5 A;  2FCE A;  1AK8 A;  4YI8 A;  2L4H A;  1JSA A;  4GAO A;  4DIR A;  1F8H A;  3KO0 A;  2D8N A;  2F2O A;  3A4U B;  1DGV A;  3D0Y B;  1SL8 A;  1K94 A;  1UHH A;  2BL0 C;  5HKY A;  3SG2 A;  5HLO A;  3I5F B;  2LM5 A;  1NWD A;  4I5K A;  2K7O A;  1YX8 A;  1J7Q A;  2H61 A;  2KFG A;  1IJ5 A;  2K7B A;  2BCA A;  2LVJ A;  2ZNE A;  2M8U A;  3O78 A;  1CNP A;  5JOL A;  2AAO A;  3BQ3 A;  3CGA A;  3O6B A;  3SIB A;  2JNF A;  5AER A;  1DJY A;  3O4Y A;  1TNW A;  1EG4 A;  4DUQ A;  1N2D A;  1FF1 A;  2I18 A;  1UHJ A;  1JFJ A;  1QVI Y;  1KSM A;  1J1D A;  4MRY A;  1QX7 A;  2JOJ A;  3FS7 A;  1KFX S;  1M31 A;  2JTT A;  1CM1 A;  1SL7 A;  2SAS A;  3I5F C;  4MZL A;  4DRW A;  2LC5 A;  4YGD B;  4HRE E;  1AJ5 A;  1EJ3 A;  1UHI A;  4I5L B;  2KI6 C;  4XYN A;  4NDB A;  2G2B A;  4L9M A;  1CMF A;  4OVN F;  5KTY A;  1F55 A;  2PRU A;  4MLW A;  2I2R E;  1IKU A;  3CR5 X;  3PSR A;  2KI4 C;  2KAY A;  5AEQ A;  2O5G A;  3I5I B;  4XJK B;  1A75 A;  1DJH A;  1PSB A;  2KYC A;  3OP0 A;  1NX0 A;  1LXF C;  1ZUZ A;  4PAL A;  1SPY A;  2KNE A;  3D0Y A;  3AKB A;  1QV1 A;  1SNL A;  3EVR A;  2HQW A;  1KFU L;  1QX2 A;  1YRT B;  1K90 D;  1HQV A;  2KBI A;  4N1F A;  2BCB A;  1YVL A;  5D69 A;  1DT7 B;  4PHM A;  2F3Z A;  3FIA A;  2QAC A;  1B8L A;  3CR4 X;  3WXA A;  1CFD A;  3BUO B;  1NX3 A;  1Y6W A;  1RRO A;  2JXC A;  1BF5 A;  1FW4 A;  2M1U A;  1KQM B;  1ALV A;  2G9B A;  1PVB A;  4YRU A;  2KBM A;  1SYM A;  3DVJ A;  2MJW B;  2Y4Q A;  3PAL A;  1WLM A;  2FOT A;  1SRA A;  1YX7 A;  3ICB A;  3VRQ A;  1TOP A;  2ZKM X;  1EG3 A;  1N0Y A;  5HKW A;  2KOT A;  3IF7 A;  1BOC A;  1WRK A;  1OZO A;  5J3X A;  1CLM A;  1Q80 A;  2KI4 B;  2PAS A;  1SY9 A;  2NCO A;  2M7N A;  4GUK A;  3LL8 B;  4BY5 A;  2K7D A;  2KSP A;  2ZRS A;  2ISD A;  4PE1 A;  3VRO A;  4U8D A;  1KWO B;  4CFR A;  1DJW A;  3MSE B;  1K8U A;  3BUM B;  1AHR A;  3WHU B;  3E3R A;  1YTZ C;  2K7C A;  2KAV A;  1SKT A;  2EC6 C;  2F2P A;  4N5X A;  4CID A;  2GV5 A;  3M0W A;  5AXI A;  2MA2 A;  5TNC A;  4QJ3 B;  1FI6 A;  1PSR A;  3DVM A;  4GGF A;  2F33 A;  3BUX B;  3NXA A;  4MRX A;  2KGR A;  3JVT C;  1J55 A;  4CLN A;  1MQ1 A;  1G33 A;  1E8A A;  2KI6 D;  1IJ6 A;  2WOR A;  1C07 A;  1D1O A;  1DJZ A;  1YVH A;  4Q04 A;  2K2A A;  4M2O A;  2F3Y A;  5BPJ A;  2WC8 A;  4BY4 A;  1SL9 A;  4M2Q A;  1QJT A;  1TNX A;  2MLE C;  2JT0 A;  1A75 B; 
#chains in the Genus database with same CATH topology
 1SCM C;  3PAT A;  1X02 A;  3TUY B;  5ER5 A;  3CR2 A;  2QEB A;  3GK2 A;  2KDH A;  5KU1 A;  1BMO A;  2Q4U A;  1XFX O;  3DXL A;  4ORC B;  2BE6 A;  3TS5 B;  3K1E A;  2DOQ A;  2HQ8 A;  4I5N B;  3DF0 A;  2WCL A;  5F6T A;  1KSO A;  4MBE A;  1XVJ A;  1U5I A;  1ZOT B;  2CBL A;  2M7L A;  3BFB A;  1K9P A;  3BUN B;  3KHE A;  5CPV A;  2LUX A;  1OW4 A;  2JC2 A;  2EC6 B;  1XK4 A;  2EHB A;  3HX4 A;  2M9G A;  3PFV A;  4C0J A;  1GGW A;  1M63 B;  2OTG C;  1S36 A;  1GGZ A;  1BOD A;  5DKQ A;  2L2C A;  1BT6 A;  1QLK A;  3O4X A;  4IL1 A;  1DTL A;  1QX5 B;  3OX6 A;  2M1K B;  2FJU B;  5EL2 A;  3BFA A;  1B8R A;  2JZI A;  3ZWH A;  1DC1 A;  1CFF A;  2WOS A;  4AOM A;  2Y5I A;  1T14 A;  3TS5 C;  2KHN A;  1IQ3 A;  4PDZ A;  1JUO A;  1MUX A;  3R1V A;  4MN0 A;  4HRH A;  1CKK A;  4GGN A;  3DF0 B;  4GBA A;  1S26 D;  1BR1 B;  1CDL A;  1J1E A;  1TN4 A;  2MAZ A;  3FWB A;  4INX A;  2OS8 B;  5I2L A;  1DGU A;  1W9Z A;  4DS7 A;  3SS5 A;  1DEK A;  4OV2 A;  3SS3 A;  3A8R A;  4JQ0 D;  1L2O B;  1PAL A;  3JTD C;  1OMR A;  3NSO A;  2V53 A;  2Q91 A;  3H4S E;  1J7O A;  1BU3 A;  4JPZ B;  1OOI X;  2JTZ A;  4DCK A;  3TUY C;  1JFK A;  1NCZ A;  2CXJ A;  2K0J A;  3PN7 B;  1QWV A;  3QRX A;  1OMV A;  1AJ4 A;  1SW8 A;  4FTG A;  3BXK A;  5CSJ A;  2JWW A;  2JU0 A;  2L50 A;  3K21 A;  1YUS A;  1C3Z A;  4GPL B;  2M3W A;  2MLF C;  3GK1 A;  1DJG A;  2ZRT A;  5FI2 A;  2M97 A;  3EK7 A;  5I2Q A;  1FI5 A;  1RWY A;  3VGO A;  2O60 A;  2CT9 A;  3D76 A;  4WQ3 A;  1NIW A;  4R1E A;  2ZND A;  2BL0 B;  4TNC A;  3B6X A;  4ZCV A;  1F70 A;  5CSI A;  1CLB A;  1IIO A;  4NDD A;  1P28 A;  2QEH A;  5CSF A;  2L98 A;  1B7T Y;  1S1E A;  1TTX A;  3O2P A;  4QJ5 B;  3VRN A;  1NPQ A;  1SK6 D;  2PAL A;  3CZT X;  3L4L A;  2BBN A;  1XYD A;  3CZ2 A;  3NSI A;  5HYD A;  1OOJ A;  4YGB B;  1SCV A;  2FCD A;  1GM0 A;  1S6I A;  1W7I B;  1J7P A;  2KGB C;  1CB1 A;  1KCY A;  1G4Y R;  2JPO A;  3B88 A;  5FYX A;  2AMI A;  3R72 A;  4UPG A;  1MF8 B;  4GGF C;  2H61 C;  2JNX A;  2MHH A;  3OX5 A;  2Y1M A;  4NDC A;  4A4B A;  1RTP 1;  4INW A;  2LE9 B;  2KQY A;  1CTR A;  2LP3 A;  1F4Q A;  1A03 A;  1NX2 A;  2A4J A;  2JPT A;  2LLS A;  2WCB A;  1FPW A;  2M0R A;  3HCM A;  4YGA A;  1DF0 A;  3EK4 A;  3RLZ A;  4I5J A;  4MVF A;  5DKN A;  3RM1 A;  1GJY A;  4ZCU A;  2KFH A;  1K93 D;  3AKA A;  2IS9 A;  1C7V A;  1JF0 A;  3GOF A;  1V1F A;  2JUL A;  3VRP A;  1G8I A;  3D10 A;  1WRZ A;  2LAP A;  3EVV A;  1DJX A;  1KFU S;  3FE8 A;  3UO9 A;  3NSK A;  3R1P A;  2LLT A;  4P5O E;  3CZ1 A;  1KQM C;  1TIZ A;  1TRF A;  2TN4 A;  1C3Y A;  2BEC A;  3SJS A;  1NP8 A;  2KYF A;  2NLN A;  2L4I A;  3TZ1 A;  2WCM A;  3LK1 A;  2LMT A;  1M45 A;  1PUL A;  1MXL C;  2M49 B;  3F45 A;  2LVK A;  2HPS A;  2JT8 A;  1SR6 B;  4N1G A;  1QLS A;  1U5I B;  1RK9 A;  2WND A;  1YUT A;  1XK4 C;  4ORA B;  3VRR A;  5I94 A;  1JWD A;  1KWO C;  1OOF A;  5HLV A;  3CAB A;  1EH2 A;  4YBH B;  1XFR A;  5I2O A;  3ZNI A;  1UP5 A;  4HSZ A;  2LVV A;  2ZN8 A;  1SBJ A;  1XFV O;  3SG5 A;  2WC6 A;  3AAK A;  1CDM A;  1B4C A;  3AAJ A;  2LHI A;  1BJF A;  2R2I A;  1F4O A;  1OSA A;  4OZD A;  2SCP A;  1NSH A;  4HRG A;  1KQV A;  1TNQ A;  1K2H A;  3D77 A;  1Y0V H;  2WCJ A;  1XFU O;  2VRG A;  1LA3 A;  5PAL A;  1QS7 A;  1XFY O;  3DVK A;  1ZMZ A;  3FWC A;  1YRU B;  1S5G Y;  2CTN A;  2MRD A;  3I5H B;  1K96 A;  3SIA A;  1B1G A;  1F54 A;  1Y1A A;  1KK8 B;  3IQO A;  1ALW A;  1B7T Z;  5HKZ A;  1BR4 B;  2LVI A;  3OB2 B;  3I5I C;  1KK7 Z;  3S0A A;  2WCH A;  1OQP A;  4ORB B;  2BNX A;  3PM8 A;  3LK0 A;  1DF0 B;  2M29 A;  1YUU A;  1CDP A;  1CLL A;  1B47 A;  3RZS A;  5AAN A;  3S0F A;  1GQM A;  1YUR A;  2LMU A;  1LIN A;  2JT3 A;  1L7Z A;  3IQQ A;  1CMG A;  3I5H C;  3TDZ A;  1ODB A;  3FE6 A;  1HT9 A;  1UUR A;  4MEW A;  1A4P A;  1Z4H A;  1R6P A;  1H4B A;  1PK0 D;  1FBV A;  2L2E A;  4MZK A;  1REC A;  3JVT B;  4P2Y B;  1BLQ A;  2KLD A;  4NQG A;  2OPO A;  3PN7 C;  1Z2C B;  2MBX A;  3JTD B;  1IRJ A;  4YI9 A;  5GQQ C;  3D73 A;  3KEV A;  2HF5 A;  1Y1U A;  2GGM A;  3LCP C;  1N65 A;  1QAS A;  1S6J A;  1C7W A;  3WHT B;  1MR8 A;  3EKJ A;  1QV0 A;  4PE7 A;  1IH0 A;  1B8C A;  1KK8 C;  2GGZ A;  3CLN A;  4USL A;  3SS4 A;  1DMO A;  4YGE B;  1CM4 A;  2EGD A;  4M2P A;  1ORG A;  1IQ5 A;  1MHO A;  5KSZ A;  2COL B;  2JRF A;  3PM2 A;  5D7F A;  2PMY A;  1TNP A;  1JF2 A;  4YGC B;  5D3O A;  1IWQ A;  2CCM A;  1M39 A;  4C0L A;  2F8P A;  2BBM A;  2ZFD A;  1QVI Z;  1J7R A;  1TCO B;  1W7J B;  3BOW B;  3I5G C;  4OR9 B;  2LP2 A;  1LKJ A;  1TUZ A;  1JC2 A;  1QTX A;  5DKR A;  2JQ6 A;  3BOW A;  2I7A A;  1JBA A;  5I8N A;  1OZS A;  4AQI A;  1SR6 C;  1MXE A;  3GK4 X;  1EL4 A;  2LNK A;  1AVS A;  4E68 A;  2BKH B;  2BKI B;  3KPX A;  3CTN A;  1NCY A;  1A29 A;  2LV7 A;  2L0P A;  3SG7 A;  3SG3 A;  1S6C A;  1K9K A;  1PVA A;  5K89 A;  4F0Z B;  1MWN A;  1EXR A;  2B1U A;  2LAN A;  2I94 A;  3BYA A;  3EK8 A;  1BG1 A;  1DQE A;  1KFX L;  3WNX B;  4OKH A;  2P6B B;  2K2F A;  1CFP A;  1RFJ A;  2BE4 A;  3OBV A;  4ETO A;  3S0E A;  1K9U A;  1CDN A;  1ZAC A;  1WY9 A;  1QAT A;  2E30 A;  3OHM B;  1OOH A;  3BUW B;  1NCX A;  1OMD A;  2QPT A;  1LA0 A;  4D1E A;  3EVU A;  4CPV A;  1WDC B;  1KK7 Y;  1NYA A;  1UHN A;  1WLZ A;  5JJG A;  2NCP A;  1UWO A;  3EKH A;  4CFQ A;  1NUB A;  1WDC C;  2LMV A;  4PHJ A;  3LLE A;  1DVI A;  3B86 A;  2ZN9 A;  5G08 A;  2HET A;  4MZJ A;  2WCE A;  3B87 A;  1YR5 A;  1QXP A;  3CWG A;  4XJK A;  2NZ0 A;  3PJI A;  2L51 A;  1XFZ O;  3D74 A;  4IJ7 A;  3SG4 A;  1QIW A;  2KFF A;  3OB1 B;  4KYN A;  1S3P A;  4GFT A;  2CNP A;  1OE9 B;  2L5X B;  3DVE A;  2P70 A;  2NXQ A;  2QDI A;  1R2U A;  3TDU A;  4PHN A;  3PLF B;  1TCF A;  2E6W A;  2K8M B;  1CFC A;  1VRK A;  1PRW A;  1WRL A;  1SCM B;  1UUS A;  2WCF A;  2RGI A;  3CS1 A;  4PCW A;  1QIV A;  1NX1 A;  4PE0 A;  1SSE B;  2AUC A;  3TDI A;  1B9A A;  1TWO A;  3D75 A;  1H8B A;  5B8I B;  4A4C A;  1A2X A;  1DJI A;  1M46 A;  2K60 A;  4WRI A;  2LCP A;  4OCI A;  3KF9 A;  2PVB A;  2LLU A;  2FJY A;  2WC5 A;  1S5G Z;  1K95 A;  2PQL A;  3C1V A;  3DD4 A;  4WQ2 A;  4AQJ A;  1XFW O;  2K61 A;  1UHK A;  1XA5 A;  3CYZ A;  1ZFS A;  1Y1X A;  2LUC A;  2OTG B;  2QEV A;  4JWQ A;  5IBW A;  1F71 A;  4MSP A;  2LHL A;  2PSR A;  2H2K A;  3I5G B;  3NSL A;  4ICB A;  3VB1 A;  4QJ4 B;  5ER4 X;  2KQ6 A;  1SMG A;  3SG6 A;  1L2O C;  4GNK B;  1IGV A;  1LVC D;  2KAX A;  3NHI A;  2KPH A;  2OS8 C;  4PHK A;  3S0G A;  4FQO A;  1AUI B;  2BCX A;  5CSN A;  5AFP A;  2JXL A;  1IG5 A;  1V1G A;  4C0K A;  3S0D A;  1RJV A;  4PE4 A;  2ERB A;  1AP4 A;  2Y1N A;  1XO5 A;  2P71 A;  2FCE A;  1AK8 A;  4YI8 A;  2L4H A;  4PT1 A;  4GAO A;  4DIR A;  1JSA A;  1F8H A;  3KO0 A;  2D8N A;  2F2O A;  3A4U B;  1DGV A;  3D0Y B;  3L47 A;  3NGV A;  1SL8 A;  1K94 A;  1UHH A;  2BL0 C;  5HKY A;  3SG2 A;  1TUJ A;  3EG5 B;  5HLO A;  3I5F B;  2LM5 A;  1NWD A;  4I5K A;  4FQT A;  2K7O A;  1YX8 A;  1J7Q A;  3CZ0 A;  2H61 A;  2KFG A;  1IJ5 A;  2K7B A;  2BCA A;  2L5Y A;  2LVJ A;  3NHT A;  2ZNE A;  2M8U A;  3O78 A;  3FE9 A;  5JOL A;  1CNP A;  2AAO A;  3BFH A;  3BQ3 A;  3CGA A;  3O6B A;  3SIB A;  2JNF A;  5AER A;  1DJY A;  3O4Y A;  1TNW A;  1EG4 A;  4DUQ A;  1N2D A;  1FF1 A;  2I18 A;  1UHJ A;  1JFJ A;  1QVI Y;  1KSM A;  1J1D A;  4MRY A;  1QX7 A;  2JOJ A;  3FS7 A;  3V2L A;  2YGU A;  1KFX S;  1M31 A;  2JTT A;  1CM1 A;  1SL7 A;  2SAS A;  3I5F C;  4MZL A;  4DRW A;  2LC5 A;  4YGD B;  4HRE E;  1AJ5 A;  1EJ3 A;  1UHI A;  4I5L B;  2KI6 C;  4XYN A;  4NDB A;  3R1O A;  2G2B A;  4L9M A;  1CMF A;  4OVN F;  5KTY A;  1F55 A;  2PRU A;  2GTE A;  2I2R E;  4MLW A;  1IKU A;  3CR5 X;  3PSR A;  2KI4 C;  2KAY A;  5AEQ A;  2O5G A;  3I5I B;  4XJK B;  1A75 A;  1DJH A;  3BJH A;  1PSB A;  2KYC A;  3OP0 A;  1NX0 A;  1LXF C;  1ZUZ A;  4PAL A;  4F7F A;  1SPY A;  2KNE A;  3D0Y A;  3AKB A;  1QV1 A;  1SNL A;  3EVR A;  2HQW A;  1KFU L;  1QX2 A;  3IVT A;  1YRT B;  1K90 D;  1HQV A;  2KBI A;  4N1F A;  2BCB A;  1YVL A;  5D69 A;  1DT7 B;  4PHM A;  2F3Z A;  3FIA A;  2QAC A;  1B8L A;  3CR4 X;  3WXA A;  1CFD A;  3BUO B;  5HL1 A;  1NX3 A;  1Y6W A;  1RRO A;  2JXC A;  3CDN A;  3DY9 A;  1BF5 A;  1FW4 A;  2M1U A;  2QEO A;  1DEL A;  1ALV A;  1KQM B;  2G9B A;  1PVB A;  2WCK A;  4YRU A;  2KBM A;  1SYM A;  3DVJ A;  2MJW B;  2Y4Q A;  3PAL A;  1WLM A;  2FOT A;  4JD9 A;  1SRA A;  1YX7 A;  3ICB A;  3VRQ A;  1TOP A;  2ZKM X;  1EG3 A;  1N0Y A;  5HKW A;  2KOT A;  3IF7 A;  1BOC A;  5DIC A;  1WRK A;  1OZO A;  5J3X A;  1CLM A;  1Q80 A;  2KI4 B;  2PAS A;  1SY9 A;  2NCO A;  2M7N A;  4GUK A;  4JKT A;  3LL8 B;  4BY5 A;  2K7D A;  2KSP A;  2ZRS A;  2ISD A;  4PE1 A;  3VRO A;  3D78 A;  4U8D A;  3Q8I A;  1OOG A;  3DYE A;  1KWO B;  3DZT A;  4CFR A;  1DJW A;  3UNW A;  3QME A;  3MSE B;  1K8U A;  3BUM B;  3OGN A;  1AHR A;  3B7A A;  3WHU B;  3E3R A;  1YTZ C;  2K7C A;  2KAV A;  5FI7 A;  1SKT A;  2EC6 C;  2F2P A;  2BAP A;  4N5X A;  4CID A;  2GV5 A;  3M0W A;  5AXI A;  2MA2 A;  5TNC A;  4QJ3 B;  1FI6 A;  1PSR A;  3DVM A;  4GGF A;  2F33 A;  3BUX B;  5FI6 A;  3NXA A;  4MRX A;  2KGR A;  2KLE A;  3JVT C;  1J55 A;  3N7H A;  3S0B A;  4CLN A;  1MQ1 A;  1G33 A;  1E8A A;  2KI6 D;  1IJ6 A;  3L4A A;  2WOR A;  1C07 A;  1D1O A;  2H8V A;  1DJZ A;  2PYQ A;  1YVH A;  4Q04 A;  1LS8 A;  2K2A A;  4M2O A;  2F3Y A;  5BPJ A;  2WC8 A;  4BY4 A;  1SL9 A;  4M2Q A;  1QJT A;  1TNX A;  2MLE C;  2JT0 A;  1A75 B; 
#chains in the Genus database with same CATH homology
 1SCM C;  3PAT A;  1X02 A;  3TUY B;  5ER5 A;  3CR2 A;  3GK2 A;  2KDH A;  5KU1 A;  1BMO A;  2Q4U A;  1XFX O;  4ORC B;  2BE6 A;  3TS5 B;  2DOQ A;  2HQ8 A;  4I5N B;  3DF0 A;  5F6T A;  1KSO A;  4MBE A;  1XVJ A;  1U5I A;  1ZOT B;  2CBL A;  2M7L A;  5CPV A;  1K9P A;  3BUN B;  3KHE A;  2LUX A;  2JC2 A;  2EC6 B;  1XK4 A;  2EHB A;  3HX4 A;  2M9G A;  3PFV A;  4C0J A;  1GGW A;  1M63 B;  2OTG C;  1S36 A;  1GGZ A;  1BOD A;  5DKQ A;  1BT6 A;  1QLK A;  4IL1 A;  1DTL A;  1QX5 B;  3OX6 A;  2M1K B;  2FJU B;  1B8R A;  2JZI A;  3ZWH A;  1CFF A;  2WOS A;  4AOM A;  2Y5I A;  3TS5 C;  2KHN A;  1IQ3 A;  4PDZ A;  1JUO A;  1MUX A;  4MN0 A;  4HRH A;  1CKK A;  4GGN A;  3DF0 B;  4GBA A;  1S26 D;  1BR1 B;  1CDL A;  1J1E A;  1TN4 A;  2MAZ A;  3FWB A;  5I2L A;  2OS8 B;  4DS7 A;  1DGU A;  4OV2 A;  3A8R A;  4JQ0 D;  1L2O B;  1PAL A;  3JTD C;  1OMR A;  3NSO A;  2V53 A;  2Q91 A;  3H4S E;  1J7O A;  1BU3 A;  4JPZ B;  4DCK A;  2JTZ A;  3TUY C;  1JFK A;  1NCZ A;  2CXJ A;  2K0J A;  3PN7 B;  3QRX A;  1OMV A;  1AJ4 A;  1SW8 A;  4FTG A;  3BXK A;  5CSJ A;  2JWW A;  2JU0 A;  2L50 A;  3K21 A;  1YUS A;  4GPL B;  2M3W A;  2MLF C;  3GK1 A;  1DJG A;  2ZRT A;  2M97 A;  3EK7 A;  5I2Q A;  1FI5 A;  1RWY A;  3VGO A;  2O60 A;  2CT9 A;  4WQ3 A;  1NIW A;  4R1E A;  2ZND A;  2BL0 B;  4TNC A;  4ZCV A;  1F70 A;  5CSI A;  1CLB A;  4NDD A;  5CSF A;  2L98 A;  1B7T Y;  1S1E A;  1TTX A;  3O2P A;  4QJ5 B;  3VRN A;  1NPQ A;  1SK6 D;  2PAL A;  3CZT X;  2BBN A;  1XYD A;  3NSI A;  5HYD A;  1OOJ A;  4YGB B;  1SCV A;  2FCD A;  1S6I A;  1W7I B;  1J7P A;  2KGB C;  1CB1 A;  1KCY A;  1G4Y R;  5FYX A;  2AMI A;  4UPG A;  1MF8 B;  4GGF C;  2H61 C;  2JNX A;  2MHH A;  3OX5 A;  2Y1M A;  4NDC A;  4A4B A;  1RTP 1;  2LE9 B;  2KQY A;  1CTR A;  2LP3 A;  1F4Q A;  1A03 A;  1NX2 A;  2A4J A;  2JPT A;  2LLS A;  2WCB A;  1FPW A;  2M0R A;  3HCM A;  4YGA A;  1DF0 A;  3EK4 A;  3RLZ A;  4I5J A;  4MVF A;  5DKN A;  3RM1 A;  1GJY A;  4ZCU A;  2KFH A;  1K93 D;  3AKA A;  2IS9 A;  1C7V A;  1JF0 A;  3GOF A;  1V1F A;  2JUL A;  3VRP A;  1G8I A;  3D10 A;  1WRZ A;  2LAP A;  3EVV A;  1DJX A;  1KFU S;  3NSK A;  2LLT A;  4P5O E;  1KQM C;  1TIZ A;  1TRF A;  2TN4 A;  2BEC A;  3SJS A;  1NP8 A;  2KYF A;  2NLN A;  2L4I A;  3TZ1 A;  3LK1 A;  2LMT A;  1M45 A;  1PUL A;  1MXL C;  2M49 B;  3F45 A;  2LVK A;  2HPS A;  2JT8 A;  1SR6 B;  4N1G A;  1QLS A;  1U5I B;  1RK9 A;  2WND A;  1YUT A;  1XK4 C;  4ORA B;  3VRR A;  1JWD A;  1KWO C;  5HLV A;  1EH2 A;  4YBH B;  5I2O A;  3ZNI A;  1UP5 A;  4HSZ A;  2LVV A;  2ZN8 A;  1SBJ A;  1XFV O;  3SG5 A;  3AAK A;  1CDM A;  1B4C A;  3AAJ A;  2LHI A;  1BJF A;  2R2I A;  1F4O A;  1OSA A;  2SCP A;  1NSH A;  4HRG A;  1KQV A;  1TNQ A;  1K2H A;  1Y0V H;  1XFU O;  2VRG A;  1LA3 A;  5PAL A;  1QS7 A;  1XFY O;  3DVK A;  1ZMZ A;  3FWC A;  1YRU B;  1S5G Y;  2CTN A;  2MRD A;  3I5H B;  1K96 A;  3SIA A;  1B1G A;  1F54 A;  1Y1A A;  1KK8 B;  3IQO A;  1ALW A;  1B7T Z;  5HKZ A;  1BR4 B;  2LVI A;  3OB2 B;  3I5I C;  1KK7 Z;  1OQP A;  4ORB B;  3PM8 A;  3LK0 A;  1DF0 B;  2M29 A;  1YUU A;  1CDP A;  1CLL A;  1B47 A;  5AAN A;  1GQM A;  1YUR A;  2LMU A;  1LIN A;  2JT3 A;  1L7Z A;  3IQQ A;  1CMG A;  3I5H C;  3TDZ A;  1ODB A;  1HT9 A;  1UUR A;  4MEW A;  1A4P A;  1H4B A;  1R6P A;  1PK0 D;  1FBV A;  2L2E A;  4MZK A;  1REC A;  3JVT B;  4P2Y B;  1BLQ A;  4NQG A;  2OPO A;  3PN7 C;  2MBX A;  3JTD B;  1IRJ A;  4YI9 A;  5GQQ C;  3KEV A;  2HF5 A;  1Y1U A;  2GGM A;  3LCP C;  1N65 A;  1QAS A;  1S6J A;  1C7W A;  3WHT B;  1MR8 A;  3EKJ A;  1QV0 A;  4PE7 A;  1IH0 A;  1B8C A;  1KK8 C;  2GGZ A;  3CLN A;  4USL A;  1DMO A;  4YGE B;  1CM4 A;  2EGD A;  4M2P A;  1IQ5 A;  1MHO A;  5KSZ A;  2COL B;  2JRF A;  5D7F A;  2PMY A;  1TNP A;  1JF2 A;  4YGC B;  1IWQ A;  2CCM A;  1M39 A;  4C0L A;  2F8P A;  2BBM A;  2ZFD A;  1QVI Z;  1J7R A;  1TCO B;  1W7J B;  3BOW B;  3I5G C;  4OR9 B;  2LP2 A;  1LKJ A;  1JC2 A;  1QTX A;  5DKR A;  2JQ6 A;  3BOW A;  2I7A A;  1JBA A;  5I8N A;  1OZS A;  4AQI A;  1SR6 C;  1MXE A;  3GK4 X;  1EL4 A;  2LNK A;  1AVS A;  4E68 A;  2BKH B;  2BKI B;  3KPX A;  3CTN A;  1NCY A;  1A29 A;  2LV7 A;  2L0P A;  3SG7 A;  3SG3 A;  1S6C A;  1K9K A;  1PVA A;  5K89 A;  4F0Z B;  1MWN A;  1EXR A;  2B1U A;  2LAN A;  2I94 A;  3BYA A;  3EK8 A;  1BG1 A;  1KFX L;  3WNX B;  4OKH A;  2P6B B;  2K2F A;  1CFP A;  1RFJ A;  2BE4 A;  4ETO A;  1K9U A;  1CDN A;  1ZAC A;  1WY9 A;  1QAT A;  2E30 A;  3OHM B;  3BUW B;  1NCX A;  1OMD A;  2QPT A;  1LA0 A;  4D1E A;  3EVU A;  4CPV A;  1WDC B;  1KK7 Y;  1NYA A;  1UHN A;  1WLZ A;  5JJG A;  2NCP A;  1UWO A;  3EKH A;  4CFQ A;  1NUB A;  1WDC C;  2LMV A;  4PHJ A;  3LLE A;  1DVI A;  2ZN9 A;  5G08 A;  2HET A;  4MZJ A;  2WCE A;  1YR5 A;  1QXP A;  3CWG A;  4XJK A;  2NZ0 A;  2L51 A;  1XFZ O;  3SG4 A;  1QIW A;  2KFF A;  3OB1 B;  1S3P A;  4GFT A;  2CNP A;  1OE9 B;  2L5X B;  3DVE A;  2NXQ A;  1R2U A;  3TDU A;  4PHN A;  3PLF B;  1TCF A;  2E6W A;  2K8M B;  1CFC A;  1VRK A;  1PRW A;  1WRL A;  1SCM B;  1UUS A;  2WCF A;  2RGI A;  3CS1 A;  4PCW A;  1QIV A;  1NX1 A;  4PE0 A;  2AUC A;  3TDI A;  1B9A A;  1H8B A;  5B8I B;  4A4C A;  1A2X A;  1DJI A;  1M46 A;  4WRI A;  2LCP A;  4OCI A;  3KF9 A;  2PVB A;  2LLU A;  3C1V A;  3DD4 A;  1S5G Z;  1K95 A;  4WQ2 A;  4AQJ A;  1XFW O;  2K61 A;  1UHK A;  1XA5 A;  5IBW A;  1ZFS A;  1Y1X A;  2LUC A;  2OTG B;  4JWQ A;  1F71 A;  4MSP A;  2LHL A;  2PSR A;  2H2K A;  3I5G B;  3NSL A;  4ICB A;  4QJ4 B;  5ER4 X;  2KQ6 A;  1SMG A;  3SG6 A;  1L2O C;  4GNK B;  1IGV A;  1LVC D;  2KAX A;  2OS8 C;  4PHK A;  4FQO A;  1AUI B;  2BCX A;  5CSN A;  5AFP A;  2JXL A;  1IG5 A;  1V1G A;  4C0K A;  1RJV A;  4PE4 A;  1AP4 A;  2Y1N A;  1XO5 A;  2FCE A;  1AK8 A;  4YI8 A;  2L4H A;  1JSA A;  4GAO A;  4DIR A;  1F8H A;  3KO0 A;  2D8N A;  2F2O A;  3A4U B;  1DGV A;  3D0Y B;  1SL8 A;  1K94 A;  1UHH A;  2BL0 C;  5HKY A;  3SG2 A;  5HLO A;  3I5F B;  2LM5 A;  1NWD A;  4I5K A;  2K7O A;  1YX8 A;  1J7Q A;  2H61 A;  2KFG A;  1IJ5 A;  2K7B A;  2BCA A;  2LVJ A;  2ZNE A;  2M8U A;  3O78 A;  1CNP A;  5JOL A;  2AAO A;  3BQ3 A;  3CGA A;  3O6B A;  3SIB A;  2JNF A;  5AER A;  1DJY A;  3O4Y A;  1TNW A;  1EG4 A;  4DUQ A;  1N2D A;  1FF1 A;  2I18 A;  1UHJ A;  1JFJ A;  1QVI Y;  1KSM A;  1J1D A;  4MRY A;  1QX7 A;  2JOJ A;  3FS7 A;  1KFX S;  1M31 A;  2JTT A;  1CM1 A;  1SL7 A;  2SAS A;  3I5F C;  4MZL A;  4DRW A;  2LC5 A;  4YGD B;  4HRE E;  1AJ5 A;  1EJ3 A;  1UHI A;  4I5L B;  2KI6 C;  4XYN A;  4NDB A;  2G2B A;  4L9M A;  1CMF A;  4OVN F;  5KTY A;  1F55 A;  2PRU A;  4MLW A;  2I2R E;  1IKU A;  3CR5 X;  3PSR A;  2KI4 C;  2KAY A;  5AEQ A;  2O5G A;  3I5I B;  4XJK B;  1A75 A;  1DJH A;  1PSB A;  2KYC A;  3OP0 A;  1NX0 A;  1LXF C;  1ZUZ A;  4PAL A;  1SPY A;  2KNE A;  3D0Y A;  3AKB A;  1QV1 A;  1SNL A;  3EVR A;  2HQW A;  1KFU L;  1QX2 A;  1YRT B;  1K90 D;  1HQV A;  2KBI A;  4N1F A;  2BCB A;  1YVL A;  5D69 A;  1DT7 B;  4PHM A;  2F3Z A;  3FIA A;  2QAC A;  1B8L A;  3CR4 X;  3WXA A;  1CFD A;  3BUO B;  1NX3 A;  1Y6W A;  1RRO A;  2JXC A;  1BF5 A;  1FW4 A;  2M1U A;  1KQM B;  1ALV A;  2G9B A;  1PVB A;  4YRU A;  2KBM A;  1SYM A;  3DVJ A;  2MJW B;  2Y4Q A;  3PAL A;  1WLM A;  2FOT A;  1SRA A;  1YX7 A;  3ICB A;  3VRQ A;  1TOP A;  2ZKM X;  1EG3 A;  1N0Y A;  5HKW A;  2KOT A;  3IF7 A;  1BOC A;  1WRK A;  1OZO A;  5J3X A;  1CLM A;  1Q80 A;  2KI4 B;  2PAS A;  1SY9 A;  2NCO A;  2M7N A;  4GUK A;  3LL8 B;  4BY5 A;  2K7D A;  2KSP A;  2ZRS A;  2ISD A;  4PE1 A;  3VRO A;  4U8D A;  1KWO B;  4CFR A;  1DJW A;  3MSE B;  1K8U A;  3BUM B;  1AHR A;  3WHU B;  3E3R A;  1YTZ C;  2K7C A;  2KAV A;  1SKT A;  2EC6 C;  2F2P A;  4N5X A;  4CID A;  2GV5 A;  3M0W A;  5AXI A;  2MA2 A;  5TNC A;  4QJ3 B;  1FI6 A;  1PSR A;  3DVM A;  4GGF A;  2F33 A;  3BUX B;  3NXA A;  4MRX A;  2KGR A;  3JVT C;  1J55 A;  4CLN A;  1MQ1 A;  1G33 A;  1E8A A;  2KI6 D;  1IJ6 A;  2WOR A;  1C07 A;  1D1O A;  1DJZ A;  1YVH A;  4Q04 A;  2K2A A;  4M2O A;  2F3Y A;  5BPJ A;  2WC8 A;  4BY4 A;  1SL9 A;  4M2Q A;  1QJT A;  1TNX A;  2MLE C;  2JT0 A;  1A75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...