3I5IB

The crystal structure of squid myosin s1 in the presence of so4 2-
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain isoform A
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5iB01
3HCMA 3WHUB 2LE9B 1DF0B 4DRWA 1DJZA 5AFPA 2JZIA 4PCWA 1CFPA 2BCXA 1N65A 5AEQA 1C7WA 3K21A 1Y0VH 5HLVA 2WC8A 1YR5A 2GGMA 3CR2A 4GGNA 2P6BB 4U8DA 1F55A 1W7JB 3DF0A 1QIVA 2JWWA 3ZNIA 3CZTX 3TDIA 2K7BA 3BXKA 1U5IB 2KI4B 5HKWA 3PM8A 1U5IA 1K93D 2PVBA 3CTNA 1TRFA 2JTTA 2MLEC 1NCYA 4MN0A 1N0YA 2Y4QA 1J7QA 1F4OA 4YI8A 1KFUS 4MRXA 2MHHA 3WXAA 1CM4A 2PASA 1QASA 2CTNA 4DUQA 2PRUA 1E8AA 1KK8B 1YX7A 5BPJA 2HF5A 1WDCC 1F8HA 5CSIA 1N2DA 2KNEA 1NPQA 1DGUA 4JPZB 2I2RE 5CSJA 1K9PA 3I5HB 2KAXA 2KFHA 2L2EA 4PDZA 1A03A 1KQMC 4ZCUA 3OP0A 1IRJA 1QIWA 3LL8B 3NSIA 1PRWA 3JVTB 2I7AA 2JT3A 3A4UB 4WQ2A 3KO0A 4N5XA 3EK4A 2JOJA 1RECA 1WRZA 2KYFA 2L51A 2AAOA 2Y1NA 3CLNA 2CXJA 3TDUA 1IKUA 1Y6WA 1RWYA 1K2HA 4GAOA 3BUWB 2QPTA 4N1GA 1OQPA 1YTZC 1YVLA 4OV2A 4GFTA 1G8IA 2GGZA 2NXQA 1CFDA 4C0KA 1NYAA 1HT9A 2K61A 2DOQA 1TNQA 1NX2A 2Q91A 4NDBA 1DJHA 1QLKA 1G4YR 4CFQA 2AUCA 5I2QA 2NCPA 2JQ6A 1V1FA 2FJUB 3LLEA 2KOTA 3SG2A 1H8BA 4FQOA 1B9AA 4NDCA 3O6BA 4MZJA 1CKKA 1W7IB 1DGVA 2KGBC 4P5OE 4PE7A 1CDLA 1IJ5A 5ER4X 2LV7A 1YURA 1BMOA 3CR4X 3JVTC 4C0LA 1QS7A 2LUCA 1MXEA 4HRHA 2K7OA 3BUOB 2LUXA 4HRGA 5D69A 1OZSA 4PE4A 2E30A 3TUYB 2L4HA 1KFXL 1CLMA 1NX1A 3AKBA 4PHNA 4YGDB 2WCFA 1JC2A 1QV1A 2HPSA 1SCVA 5DKRA 3GK2A 1LA3A 1HQVA 4CIDA 2I18A 1MXLC 1KQMB 1WRLA 2WOSA 2K8MB 3LCPC 4QJ4B 2KYCA 4BY4A 2LHIA 1PSBA 1JBAA 1NP8A 2F2OA 1FBVA 3BUNB 5CPVA 1DF0A 3CGAA 1NWDA 3FWBA 2G9BA 4MEWA 3BUXB 1CDNA 5AANA 4YGAA 2EGDA 3LK0A 3OB1B 3JTDB 1QVIZ 3C1VA 5FYXA 5HKZA 1SCMB 4DS7A 2L50A 4UPGA 3EKHA 1J7OA 1XYDA 4AQIA 1C7VA 1KWOB 4OCIA 2IS9A 2MLFC 1K9UA 1F54A 5KSZA 3SG5A 1TOPA 5ER5A 3EVUA 1K96A 4HSZA 3IQQA 1ZACA 1ALVA 1D1OA 2LCPA 4M2OA 3ZWHA 1PK0D 4L9MA 4M2PA 1JF2A 3DVEA 5HKYA 2E6WA 1QVIY 2F3YA 3I5FC 1TCFA 4ORAB 1IWQA 2GV5A 5B8IB 4YBHB 1SL8A 3GOFA 2KFFA 3PN7C 4ICBA 1PSRA 2LVVA 1KFUL 4GUKA 1SL9A 1WDCB 2L0PA 2HQ8A 3NSKA 4ORBB 2TN4A 3JTDC 3SG3A 3I5IC 2KGRA 5DKQA 4PE1A 2V53A 1DJXA 3TS5B 1TN4A 3CR5X 1BF5A 1IJ6A 1QTXA 3BOWB 3O4YA 3RLZA 1L2OB 3TDZA 1CNPA 2ZRTA 3BYAA 1AJ4A 1M31A 4MBEA 1ZUZA 1Y1AA 4JWQA 1JWDA 2EC6B 1TNPA 2CBLA 1BODA 1CM1A 2M8UA 2O60A 3HX4A 4CLNA 2K7DA 4Q04A 2KI4C 2FCEA 1RFJA 2H2KA 3SG4A 2M7NA 4E68A 2ZFDA 1SNLA 1XFZO 2WNDA 3SIBA 2HETA 2JTZA 1YRTB 1KCYA 3AKAA 2JT8A 3M0WA 2RGIA 2LVIA 5JOLA 1MWNA 1TCOB 1BOCA 4GBAA 1KWOC 1K9KA 2KSPA 1J7PA 4YI9A 5DKNA 1EG4A 2BCAA 1QX2A 4D1EA 4YGCB 1B4CA 1FF1A 2VRGA 2HQWA 1M45A 1CMGA 1DJGA 1MF8B 4PE0A 1QV0A 1A29A 2KAYA 1XK4A 2NLNA 3LK1A 3MSEB 1TIZA 2JPTA 3I5GB 5HLOA 2MBXA 2MJWB 3EVRA 1DVIA 2OS8B 2LANA 3NXAA 1BU3A 1FW4A 2WORA 1OMDA 1CLBA 1V1GA 2ZKMX 1WLMA 3VRQA 1IQ5A 2JNXA 1UUSA 2ZN9A 3EVVA 4MVFA 1A75B 1J1EA 1UHJA 5I2LA 1BLQA 1XA5A 2PMYA 4PHMA 1A2XA 1GGZA 1MR8A 1OMRA 3DVJA 1B8LA 3IF7A 3WNXB 2NZ0A 1TNXA 4HREE 1QATA 1CTRA 1OZOA 2D8NA 1KK7Z 2LMTA 1R6PA 1CB1A 1XFUO 1IQ3A 2KAVA 3KF9A 4YGBB 2M29A 3TUYC 1GJYA 3VRNA 1A4PA 4QJ3B 2JULA 1UURA 2LLTA 1YVHA 1SMGA 3FS7A 5I2OA 1S3PA 3SJSA 1PVAA 4YGEB 5HYDA 4PALA 1XFXO 1CFFA 1NSHA 1SK6D 1OSAA 2A4JA 2KFGA 2M0RA 4GPLB 1BR4B 3NSLA 1RK9A 1DJYA 5D7FA 2BL0B 1ZFSA 1L2OC 4XYNA 1MHOA 1SYMA 4CFRA 3EKJA 1IH0A 1KK7Y 2CCMA 2Q4UA 2LHLA 3D0YB 1AP4A 5PALA 1AJ5A 1IGVA 1MQ1A 1M46A 1SBJA 1TNWA 1UP5A 3RM1A 1EXRA 4QJ5B 3F45A 1NX3A 2G2BA 2QACA 1NCXA 3QRXA 1CDMA 1BR1B 1K95A 2BE4A 2K0JA 2KI6D 3E3RA 3FIAA 1JF0A 2M3WA 3VRRA 3PN7B 4C0JA 2ISDA 2SCPA 2BECA 2Y5IA 1RROA 1CDPA 1SR6C 2PALA 3O78A 1J1DA 2H61A 5AXIA 1PALA 2FOTA 2LLSA 3DD4A 5G08A 2JXLA 2LC5A 2JRFA 3AAKA 1ODBA 5IBWA 4AQJA 1NUBA 1DTLA 2BBNA 1LA0A 3FWCA 4P2YB 1YUSA 1KFXS 1XO5A 2NCOA 3VROA 3BUMB 3D0YA 2COLB 4OVNF 1ALWA 2BKIB 2OPOA 3TZ1A 4IL1A 1FI6A 1A75A 2KDHA 4AOMA 1J55A 1XVJA 1J7RA 1RJVA 2L98A 2KQYA 2OS8C 1ZMZA 3KPXA 1TTXA 1PVBA 2L5XB 2BCBA 1Q80A 1DJIA 2BL0C 3PSRA 5AERA 2JC2A 3EK7A 1S26D 4MZLA 2F8PA 2JXCA 1QX7A 2M9GA 1UHHA 3I5GC 3SG6A 4DIRA 1CMFA 1EG3A 1NIWA 3OX5A 2F3ZA 3CWGA 5JJGA 1JFJA 1G33A 4F0ZB 2FCDA 4ETOA 2M7LA 1QXPA 4M2QA 1H4BA 2F2PA 4CPVA 1QLSA 2JU0A 3SIAA 1AK8A 2OTGC 2Y1MA 1CLLA 2WCBA 1YUTA 1F4QA 1OE9B 4MRYA 5GQQC 1FPWA 2M49B 1B8CA 2R2IA 4GNKB 1S36A 1S1EA 3PFVA 1EH2A 1MUXA 5I8NA 3GK4X 1ZOTB 1SRAA 4I5JA 2LM5A 3VRPA 1SCMC 1OMVA 1SR6B 1JFKA 3D10A 5F6TA 5KTYA 2BKHB 1F71A 2BBMA 2PSRA 2LVJA 5CSNA 1XK4C 4PHKA 3VGOA 1Y1XA 3CS1A 2ZRSA 3I5IB 1B7TZ 4WQ3A 1DJWA 2MAZA 1UHKA 2K2AA 5J3XA 3IQOA 4YRUA 3DVKA 1XFYO 2CNPA 3PALA 1S6IA 1PULA 1KSMA 2ZNEA 4DCKA 4JQ0D 1K94A 1S6JA 1EL4A 2WCEA 2M97A 1WRKA 2LAPA 3AAJA 1NCZA 3SG7A 1F70A 3OHMB 1SKTA 3OX6A 4GGFC 2LLUA 4XJKB 3NSOA 1K90D 5KU1A 1B7TY 1DMOA 3BOWA 4NQGA 2AMIA 4FTGA 2OTGB 4MLWA 1RTP1 1M63B 1BJFA 1SPYA 1SY9A 2KI6C 4NDDA 4ORCB 1B1GA 1Y1UA 1AHRA 2BE6A 1BG1A 3KHEA 2M1UA 1KSOA 2K2FA 3PLFB 1M39A 2JNFA 3I5HC 5TNCA 1AVSA 2EC6C 3ICBA 1GGWA 2EHBA 1VRKA 4I5LB 2F33A 1GQMA 2MA2A 1YUUA 4MZKA 2KHNA 1R2UA 1X02A 1AUIB 3WHTB 2KBMA 2M1KB 3KEVA 2KBIA 2LMUA 4TNCA 1QX5B 4ZCVA 1SW8A 1LKJA 4A4CA 1IG5A 1JUOA 1NX0A 1KK8C 2O5GA 4MSPA 2K7CA 3BQ3A 3GK1A 2SASA 2I94A 1K8UA 4I5NB 1C07A 1WLZA 1DT7B 3H4SE 1LINA 1JSAA 2B1UA 4OKHA 4OR9B 1S5GY 4PHJA 1LXFC 1OOJA 2CT9A 1FI5A 5CSFA 1WY9A 2H61C 1QJTA 1L7ZA 1LVCD 2LP2A 1YRUB 4I5KA 1UHNA 3PATA 2JT0A 2LMVA 1SL7A 1S6CA 3DVMA 4R1EA 2ZNDA 1EJ3A 1B47A 4A4BA 1B8RA 3DF0B 5K89A 2LNKA 1XFVO 4USLA 1S5GZ 1YX8A 4GGFA 1UHIA 1CFCA 3A8RA 1BT6A 2ZN8A 2MRDA 1KQVA 3EK8A 2L4IA 3TS5C 3O2PA 2KQ6A 1XFWO 2LP3A 3OB2B 4N1FA 2LVKA 4WRIA 4BY5A 3I5FB 1UWOA 4XJKA
chains in the Genus database with same CATH superfamily
3HCMA 2ERBA 2QEBA 3OGNA 3WHUB 2LE9B 1DF0B 4DRWA 1DJZA 5AFPA 2WCJA 3DYEA 2JZIA 4PCWA 1CFPA 2BCXA 1N65A 3D78A 1C7WA 3K21A 5AEQA 3B87A 1Y0VH 3SS4A 5HLVA 2WC8A 3PM2A 1Z2CB 1YR5A 2GGMA 3CR2A 4GGNA 3R72A 2P6BB 4U8DA 1F55A 1W7JB 3DF0A 1QIVA 2JWWA 3ZNIA 3CZTX 3TDIA 2K7BA 3BXKA 1U5IB 2K60A 2KI4B 2WCLA 3R1OA 5HKWA 3PM8A 1U5IA 1K93D 2PVBA 3CTNA 1TRFA 2JTTA 2MLEC 1NCYA 4MN0A 1N0YA 2Y4QA 1J7QA 1F4OA 4YI8A 1KFUS 1T14A 3NGVA 4MRXA 2MHHA 3WXAA 1CM4A 2PASA 1QASA 2CTNA 4DUQA 4IJ7A 2PRUA 1E8AA 1KK8B 1YX7A 5BPJA 2HF5A 1WDCC 1F8HA 5CSIA 1N2DA 2KNEA 1NPQA 4FQTA 1DGUA 3L47A 4JPZB 2I2RE 5CSJA 1K9PA 3I5HB 2KAXA 2KFHA 2L2EA 4PDZA 1A03A 3CYZA 1KQMC 4ZCUA 1Z4HA 3OP0A 1IRJA 1QIWA 3LL8B 3DY9A 1OOFA 1PRWA 3NSIA 3JVTB 2I7AA 2JT3A 3NHTA 2BAPA 3A4UB 4WQ2A 3KO0A 2WC5A 4N5XA 3EK4A 2JOJA 3BFBA 1RECA 1WRZA 2KYFA 2L51A 2AAOA 2Y1NA 2FJYA 2CXJA 3CLNA 3CZ1A 3TDUA 1Y6WA 1RWYA 1IKUA 4GAOA 1K2HA 3BUWB 2QPTA 4N1GA 1OQPA 1TUJA 1YTZC 1YVLA 4OV2A 4GFTA 5FI2A 1G8IA 2GGZA 2NXQA 1CFDA 4C0KA 1NYAA 1HT9A 2K61A 2WCHA 2DOQA 3S0BA 1TNQA 1NX2A 1P28A 2Q91A 1DJHA 4NDBA 1QLKA 1G4YR 3S0DA 4CFQA 2AUCA 5I2QA 2NCPA 2JQ6A 1V1FA 2FJUB 3LLEA 2KOTA 3SG2A 1H8BA 4FQOA 1B9AA 4NDCA 3O6BA 4MZJA 4F7FA 1CKKA 1W7IB 1DGVA 2KGBC 3S0GA 4P5OE 4PE7A 1CDLA 3D73A 1IJ5A 5ER4X 2LV7A 1YURA 1BMOA 3CR4X 3JVTC 4C0LA 1QS7A 1SSEB 2LUCA 1MXEA 4HRHA 2K7OA 3BUOB 2LUXA 3Q8IA 4HRGA 5D69A 1OZSA 4PE4A 1OOHA 2E30A 3TUYB 2L4HA 1KFXL 1CLMA 1NX1A 3AKBA 4PHNA 4YGDB 1TUZA 2WCFA 1JC2A 5FI6A 1QV1A 2HPSA 1SCVA 5DKRA 3GK2A 1LA3A 1HQVA 4CIDA 2I18A 1MXLC 1KQMB 1WRLA 2WOSA 5HL1A 2K8MB 3LCPC 4QJ4B 1ORGA 2KYCA 2LHIA 4BY4A 1PSBA 1JBAA 1NP8A 2F2OA 1FBVA 3BUNB 5CPVA 1DF0A 3CGAA 1NWDA 3FWBA 2G9BA 4MEWA 3BUXB 1CDNA 5AANA 4YGAA 2EGDA 3LK0A 3OB1B 3JTDB 1GM0A 1QVIZ 3C1VA 5FYXA 5HKZA 1SCMB 4DS7A 3NHIA 2WCKA 3IVTA 2L50A 4UPGA 3EKHA 4INXA 1J7OA 1XYDA 4AQIA 1C7VA 1KWOB 4OCIA 2IS9A 2MLFC 1K9UA 1F54A 5KSZA 3SG5A 1TOPA 5ER5A 3EVUA 1K96A 3CDNA 3IQQA 1ZACA 1ALVA 4HSZA 4JKTA 1D1OA 2LCPA 4M2OA 3ZWHA 1PK0D 4INWA 4L9MA 4KYNA 4M2PA 1JF2A 3DVEA 5HKYA 2E6WA 1QVIY 2F3YA 3I5FC 1TCFA 4ORAB 1IWQA 2GV5A 5B8IB 4YBHB 1SL8A 3GOFA 2KFFA 3PN7C 4ICBA 2GTEA 1PSRA 2LVVA 1KFUL 4GUKA 1SL9A 1WDCB 2L0PA 2HQ8A 3NSKA 4ORBB 2TN4A 3JTDC 3SG3A 3I5IC 3CABA 2KGRA 5DKQA 4PE1A 2V53A 1DJXA 3TS5B 1TN4A 3CR5X 2WC6A 1BF5A 1IJ6A 1QTXA 3BOWB 3O4YA 3QMEA 3RLZA 1L2OB 3FE8A 3TDZA 1CNPA 3UO9A 3BFAA 2ZRTA 2QEVA 3BYAA 1AJ4A 1M31A 4MBEA 1ZUZA 1Y1AA 4JWQA 1JWDA 2EC6B 1TNPA 2CBLA 1BODA 1CM1A 2M8UA 2O60A 3HX4A 4CLNA 3R1VA 2K7DA 1DC1A 4Q04A 1DQEA 2FCEA 2KI4C 1RFJA 2H2KA 3SG4A 2M7NA 4E68A 2ZFDA 1SNLA 1XFZO 2WNDA 3SIBA 2HETA 2JTZA 1YRTB 1KCYA 2BNXA 3AKAA 2JT8A 3M0WA 2RGIA 2LVIA 5JOLA 1MWNA 1TCOB 1BOCA 4GBAA 1KWOC 1K9KA 2KSPA 1J7PA 4YI9A 5DKNA 1EG4A 2BCAA 1QX2A 4D1EA 4YGCB 1B4CA 1FF1A 2VRGA 2HQWA 1DELA 1M45A 1CMGA 1DJGA 1MF8B 4PE0A 1QV0A 1A29A 2KAYA 1XK4A 2NLNA 3D75A 3LK1A 3MSEB 1TIZA 2JPTA 3I5GB 5HLOA 2MBXA 4OZDA 2MJWB 3EVRA 1DVIA 2OS8B 2LANA 3NXAA 1BU3A 1FW4A 2WORA 1OMDA 1CLBA 1V1GA 2ZKMX 1WLMA 3VRQA 1IQ5A 2JNXA 1UUSA 2ZN9A 3EVVA 4MVFA 1A75B 1J1EA 1UHJA 5I2LA 1BLQA 1XA5A 2PMYA 4PHMA 1A2XA 1GGZA 1MR8A 1OMRA 3DVJA 3FE9A 1B8LA 3IF7A 3WNXB 2NZ0A 1QWVA 1TNXA 4HREE 1QATA 3EG5B 1CTRA 1OZOA 2D8NA 1KK7Z 2LMTA 2QEHA 1R6PA 1CB1A 1XFUO 1IQ3A 2KAVA 3KF9A 4YGBB 2M29A 3TUYC 1GJYA 3VRNA 1A4PA 4QJ3B 2JULA 1UURA 2LLTA 1YVHA 1SMGA 3FS7A 5I2OA 1S3PA 3SJSA 1PVAA 4YGEB 5HYDA 4PALA 1XFXO 1CFFA 1NSHA 1SK6D 1OSAA 2A4JA 2KFGA 2M0RA 4GPLB 1BR4B 2P70A 3NSLA 1RK9A 1DJYA 5D7FA 2BL0B 1ZFSA 1L2OC 4XYNA 1MHOA 1OOIX 1SYMA 4CFRA 3EKJA 1IH0A 1KK7Y 2CCMA 5I94A 2Q4UA 2LHLA 3D0YB 1AP4A 5PALA 1AJ5A 1DEKA 1IGVA 1MQ1A 1M46A 1SBJA 1TNWA 1UP5A 3BFHA 3RM1A 1EXRA 1TWOA 4QJ5B 3F45A 3L4LA 1NX3A 2G2BA 3K1EA 2QACA 1NCXA 3QRXA 1CDMA 1BR1B 1K95A 2BE4A 2K0JA 2KI6D 3E3RA 3FIAA 1JF0A 2M3WA 3VRRA 3PN7B 4C0JA 2ISDA 2SCPA 2WCMA 2BECA 2Y5IA 1RROA 1CDPA 1SR6C 2PALA 1W9ZA 3O78A 1J1DA 3VB1A 2H61A 5AXIA 1PALA 2FOTA 2KLEA 2LLSA 3DD4A 2JPOA 5G08A 2JXLA 2LC5A 2JRFA 3AAKA 1ODBA 5IBWA 4AQJA 1NUBA 1DTLA 2BBNA 1LA0A 3FWCA 4P2YB 3UNWA 3BJHA 3R1PA 1YUSA 3D77A 5EL2A 1KFXS 1XO5A 2NCOA 3DZTA 3VROA 3D76A 3BUMB 3D0YA 2COLB 4OVNF 1ALWA 2BKIB 2OPOA 2PQLA 3TZ1A 4IL1A 1FI6A 2L2CA 4JD9A 1A75A 2KDHA 4AOMA 1J55A 1XVJA 1J7RA 1RJVA 2L98A 2KQYA 2OS8C 1ZMZA 3KPXA 1TTXA 1PVBA 2L5XB 2BCBA 1Q80A 1DJIA 2BL0C 3PSRA 5AERA 2JC2A 3EK7A 1S26D 4MZLA 2F8PA 3B6XA 2JXCA 1QX7A 2M9GA 1UHHA 3I5GC 3SG6A 4DIRA 1CMFA 1EG3A 1NIWA 3OX5A 2F3ZA 3CWGA 5JJGA 1JFJA 1XFRA 1G33A 4F0ZB 2FCDA 4ETOA 2M7LA 1QXPA 4M2QA 1H4BA 3S0AA 3S0FA 1LS8A 2F2PA 4CPVA 1QLSA 2JU0A 3SIAA 2L5YA 3RZSA 1OW4A 2OTGC 2Y1MA 1CLLA 3OBVA 1AK8A 2WCBA 1YUTA 2YGUA 1F4QA 1OE9B 4MRYA 5GQQC 1FPWA 2M49B 3N7HA 1B8CA 2R2IA 4GNKB 1S36A 1S1EA 3PFVA 5DICA 1EH2A 2KPHA 1MUXA 5I8NA 3GK4X 1ZOTB 1SRAA 3B7AA 4I5JA 2LM5A 1IIOA 3VRPA 1SCMC 1OMVA 1SR6B 1JFKA 3D10A 5F6TA 5KTYA 2BKHB 1F71A 2BBMA 2PSRA 5FI7A 2LVJA 5CSNA 1XK4C 4PHKA 3VGOA 1Y1XA 3CS1A 2ZRSA 3I5IB 1B7TZ 3PJIA 4WQ3A 1DJWA 2MAZA 1UHKA 2K2AA 5J3XA 3IQOA 4YRUA 3DVKA 1XFYO 1C3ZA 2CNPA 3D74A 3PALA 1S6IA 1PULA 3CZ0A 1KSMA 3V2LA 2ZNEA 4DCKA 4JQ0D 1K94A 1S6JA 1EL4A 3SS5A 2WCEA 2M97A 1WRKA 2LAPA 3AAJA 1NCZA 3SG7A 1F70A 3OHMB 1SKTA 3OX6A 4GGFC 2LLUA 4XJKB 3NSOA 1K90D 5KU1A 1B7TY 1DMOA 3BOWA 4NQGA 2AMIA 3B88A 2OTGB 4FTGA 4MLWA 1RTP1 1M63B 1BJFA 1SPYA 1SY9A 2KI6C 4NDDA 4ORCB 1B1GA 1Y1UA 1AHRA 2BE6A 1BG1A 3KHEA 2M1UA 1KSOA 2K2FA 3PLFB 1M39A 1OOGA 2JNFA 3I5HC 5TNCA 3S0EA 1AVSA 2EC6C 3CZ2A 3ICBA 3L4AA 2EHBA 5D3OA 1VRKA 4I5LB 1GGWA 2F33A 1GQMA 2MA2A 1YUUA 4MZKA 2KHNA 1R2UA 1X02A 1AUIB 3WHTB 3B86A 2KBMA 2M1KB 3KEVA 2KBIA 2LMUA 4TNCA 1QX5B 4ZCVA 1SW8A 1LKJA 4A4CA 1IG5A 1JUOA 3FE6A 1NX0A 1KK8C 2O5GA 4MSPA 2K7CA 3BQ3A 3GK1A 2SASA 2I94A 1K8UA 4I5NB 1C07A 1WLZA 1DT7B 3H4SE 2H8VA 1LINA 1JSAA 2B1UA 4OKHA 4OR9B 1S5GY 4PHJA 1LXFC 1OOJA 2CT9A 1FI5A 5CSFA 1WY9A 2H61C 1QJTA 1L7ZA 1LVCD 2LP2A 1YRUB 4PT1A 4I5KA 1UHNA 3O4XA 2JT0A 2LMVA 3PATA 3SS3A 2KLDA 2P71A 1SL7A 1S6CA 3DVMA 4R1EA 2ZNDA 1EJ3A 1B47A 4A4BA 1B8RA 3DF0B 5K89A 3DXLA 2LNKA 1XFVO 4USLA 1S5GZ 1YX8A 4GGFA 1UHIA 1CFCA 3A8RA 1BT6A 2ZN8A 1C3YA 2MRDA 1KQVA 2PYQA 2QEOA 3EK8A 2L4IA 3TS5C 2QDIA 3O2PA 2KQ6A 1XFWO 2LP3A 3OB2B 4N1FA 2LVKA 4WRIA 4BY5A 3I5FB 1UWOA 4XJKA
chains in the Genus database with same CATH topology
3HCMA 3WHUB 2LE9B 1DF0B 4DRWA 1DJZA 5AFPA 2JZIA 4PCWA 1CFPA 2BCXA 1N65A 5AEQA 1C7WA 3K21A 1Y0VH 5HLVA 2WC8A 1YR5A 2GGMA 3CR2A 4GGNA 2P6BB 4U8DA 1F55A 1W7JB 3DF0A 1QIVA 2JWWA 3ZNIA 3CZTX 3TDIA 2K7BA 3BXKA 1U5IB 2KI4B 5HKWA 3PM8A 1U5IA 1K93D 2PVBA 3CTNA 1TRFA 2JTTA 2MLEC 1NCYA 4MN0A 1N0YA 2Y4QA 1J7QA 1F4OA 4YI8A 1KFUS 4MRXA 2MHHA 3WXAA 1CM4A 2PASA 1QASA 2CTNA 4DUQA 2PRUA 1E8AA 1KK8B 1YX7A 5BPJA 2HF5A 1WDCC 1F8HA 5CSIA 1N2DA 2KNEA 1NPQA 1DGUA 4JPZB 2I2RE 5CSJA 1K9PA 3I5HB 2KAXA 2KFHA 2L2EA 4PDZA 1A03A 1KQMC 4ZCUA 3OP0A 1IRJA 1QIWA 3LL8B 3NSIA 1PRWA 3JVTB 2I7AA 2JT3A 3A4UB 4WQ2A 3KO0A 4N5XA 3EK4A 2JOJA 1RECA 1WRZA 2KYFA 2L51A 2AAOA 2Y1NA 3CLNA 2CXJA 3TDUA 1IKUA 1Y6WA 1RWYA 1K2HA 4GAOA 3BUWB 2QPTA 4N1GA 1OQPA 1YTZC 1YVLA 4OV2A 4GFTA 1G8IA 2GGZA 2NXQA 1CFDA 4C0KA 1NYAA 1HT9A 2K61A 2DOQA 1TNQA 1NX2A 2Q91A 4NDBA 1DJHA 1QLKA 1G4YR 4CFQA 2AUCA 5I2QA 2NCPA 2JQ6A 1V1FA 2FJUB 3LLEA 2KOTA 3SG2A 1H8BA 4FQOA 1B9AA 4NDCA 3O6BA 4MZJA 1CKKA 1W7IB 1DGVA 2KGBC 4P5OE 4PE7A 1CDLA 1IJ5A 5ER4X 2LV7A 1YURA 1BMOA 3CR4X 3JVTC 4C0LA 1QS7A 2LUCA 1MXEA 4HRHA 2K7OA 3BUOB 2LUXA 4HRGA 5D69A 1OZSA 4PE4A 2E30A 3TUYB 2L4HA 1KFXL 1CLMA 1NX1A 3AKBA 4PHNA 4YGDB 2WCFA 1JC2A 1QV1A 2HPSA 1SCVA 5DKRA 3GK2A 1LA3A 1HQVA 4CIDA 2I18A 1MXLC 1KQMB 1WRLA 2WOSA 2K8MB 3LCPC 4QJ4B 2KYCA 4BY4A 2LHIA 1PSBA 1JBAA 1NP8A 2F2OA 1FBVA 3BUNB 5CPVA 1DF0A 3CGAA 1NWDA 3FWBA 2G9BA 4MEWA 3BUXB 1CDNA 5AANA 4YGAA 2EGDA 3LK0A 3OB1B 3JTDB 1QVIZ 3C1VA 5FYXA 5HKZA 1SCMB 4DS7A 2L50A 4UPGA 3EKHA 1J7OA 1XYDA 4AQIA 1C7VA 1KWOB 4OCIA 2IS9A 2MLFC 1K9UA 1F54A 5KSZA 3SG5A 1TOPA 5ER5A 3EVUA 1K96A 4HSZA 3IQQA 1ZACA 1ALVA 1D1OA 2LCPA 4M2OA 3ZWHA 1PK0D 4L9MA 4M2PA 1JF2A 3DVEA 5HKYA 2E6WA 1QVIY 2F3YA 3I5FC 1TCFA 4ORAB 1IWQA 2GV5A 5B8IB 4YBHB 1SL8A 3GOFA 2KFFA 3PN7C 4ICBA 1PSRA 2LVVA 1KFUL 4GUKA 1SL9A 1WDCB 2L0PA 2HQ8A 3NSKA 4ORBB 2TN4A 3JTDC 3SG3A 3I5IC 2KGRA 5DKQA 4PE1A 2V53A 1DJXA 3TS5B 1TN4A 3CR5X 1BF5A 1IJ6A 1QTXA 3BOWB 3O4YA 3RLZA 1L2OB 3TDZA 1CNPA 2ZRTA 3BYAA 1AJ4A 1M31A 4MBEA 1ZUZA 1Y1AA 4JWQA 1JWDA 2EC6B 1TNPA 2CBLA 1BODA 1CM1A 2M8UA 2O60A 3HX4A 4CLNA 2K7DA 4Q04A 2KI4C 2FCEA 1RFJA 2H2KA 3SG4A 2M7NA 4E68A 2ZFDA 1SNLA 1XFZO 2WNDA 3SIBA 2HETA 2JTZA 1YRTB 1KCYA 3AKAA 2JT8A 3M0WA 2RGIA 2LVIA 5JOLA 1MWNA 1TCOB 1BOCA 4GBAA 1KWOC 1K9KA 2KSPA 1J7PA 4YI9A 5DKNA 1EG4A 2BCAA 1QX2A 4D1EA 4YGCB 1B4CA 1FF1A 2VRGA 2HQWA 1M45A 1CMGA 1DJGA 1MF8B 4PE0A 1QV0A 1A29A 2KAYA 1XK4A 2NLNA 3LK1A 3MSEB 1TIZA 2JPTA 3I5GB 5HLOA 2MBXA 2MJWB 3EVRA 1DVIA 2OS8B 2LANA 3NXAA 1BU3A 1FW4A 2WORA 1OMDA 1CLBA 1V1GA 2ZKMX 1WLMA 3VRQA 1IQ5A 2JNXA 1UUSA 2ZN9A 3EVVA 4MVFA 1A75B 1J1EA 1UHJA 5I2LA 1BLQA 1XA5A 2PMYA 4PHMA 1A2XA 1GGZA 1MR8A 1OMRA 3DVJA 1B8LA 3IF7A 3WNXB 2NZ0A 1TNXA 4HREE 1QATA 1CTRA 1OZOA 2D8NA 1KK7Z 2LMTA 1R6PA 1CB1A 1XFUO 1IQ3A 2KAVA 3KF9A 4YGBB 2M29A 3TUYC 1GJYA 3VRNA 1A4PA 4QJ3B 2JULA 1UURA 2LLTA 1YVHA 1SMGA 3FS7A 5I2OA 1S3PA 3SJSA 1PVAA 4YGEB 5HYDA 4PALA 1XFXO 1CFFA 1NSHA 1SK6D 1OSAA 2A4JA 2KFGA 2M0RA 4GPLB 1BR4B 3NSLA 1RK9A 1DJYA 5D7FA 2BL0B 1ZFSA 1L2OC 4XYNA 1MHOA 1SYMA 4CFRA 3EKJA 1IH0A 1KK7Y 2CCMA 2Q4UA 2LHLA 3D0YB 1AP4A 5PALA 1AJ5A 1IGVA 1MQ1A 1M46A 1SBJA 1TNWA 1UP5A 3RM1A 1EXRA 4QJ5B 3F45A 1NX3A 2G2BA 2QACA 1NCXA 3QRXA 1CDMA 1BR1B 1K95A 2BE4A 2K0JA 2KI6D 3E3RA 3FIAA 1JF0A 2M3WA 3VRRA 3PN7B 4C0JA 2ISDA 2SCPA 2BECA 2Y5IA 1RROA 1CDPA 1SR6C 2PALA 3O78A 1J1DA 2H61A 5AXIA 1PALA 2FOTA 2LLSA 3DD4A 5G08A 2JXLA 2LC5A 2JRFA 3AAKA 1ODBA 5IBWA 4AQJA 1NUBA 1DTLA 2BBNA 1LA0A 3FWCA 4P2YB 1YUSA 1KFXS 1XO5A 2NCOA 3VROA 3BUMB 3D0YA 2COLB 4OVNF 1ALWA 2BKIB 2OPOA 3TZ1A 4IL1A 1FI6A 1A75A 2KDHA 4AOMA 1J55A 1XVJA 1J7RA 1RJVA 2L98A 2KQYA 2OS8C 1ZMZA 3KPXA 1TTXA 1PVBA 2L5XB 2BCBA 1Q80A 1DJIA 2BL0C 3PSRA 5AERA 2JC2A 3EK7A 1S26D 4MZLA 2F8PA 2JXCA 1QX7A 2M9GA 1UHHA 3I5GC 3SG6A 4DIRA 1CMFA 1EG3A 1NIWA 3OX5A 2F3ZA 3CWGA 5JJGA 1JFJA 1G33A 4F0ZB 2FCDA 4ETOA 2M7LA 1QXPA 4M2QA 1H4BA 2F2PA 4CPVA 1QLSA 2JU0A 3SIAA 1AK8A 2OTGC 2Y1MA 1CLLA 2WCBA 1YUTA 1F4QA 1OE9B 4MRYA 5GQQC 1FPWA 2M49B 1B8CA 2R2IA 4GNKB 1S36A 1S1EA 3PFVA 1EH2A 1MUXA 5I8NA 3GK4X 1ZOTB 1SRAA 4I5JA 2LM5A 3VRPA 1SCMC 1OMVA 1SR6B 1JFKA 3D10A 5F6TA 5KTYA 2BKHB 1F71A 2BBMA 2PSRA 2LVJA 5CSNA 1XK4C 4PHKA 3VGOA 1Y1XA 3CS1A 2ZRSA 3I5IB 1B7TZ 4WQ3A 1DJWA 2MAZA 1UHKA 2K2AA 5J3XA 3IQOA 4YRUA 3DVKA 1XFYO 2CNPA 3PALA 1S6IA 1PULA 1KSMA 2ZNEA 4DCKA 4JQ0D 1K94A 1S6JA 1EL4A 2WCEA 2M97A 1WRKA 2LAPA 3AAJA 1NCZA 3SG7A 1F70A 3OHMB 1SKTA 3OX6A 4GGFC 2LLUA 4XJKB 3NSOA 1K90D 5KU1A 1B7TY 1DMOA 3BOWA 4NQGA 2AMIA 4FTGA 2OTGB 4MLWA 1RTP1 1M63B 1BJFA 1SPYA 1SY9A 2KI6C 4NDDA 4ORCB 1B1GA 1Y1UA 1AHRA 2BE6A 1BG1A 3KHEA 2M1UA 1KSOA 2K2FA 3PLFB 1M39A 2JNFA 3I5HC 5TNCA 1AVSA 2EC6C 3ICBA 1GGWA 2EHBA 1VRKA 4I5LB 2F33A 1GQMA 2MA2A 1YUUA 4MZKA 2KHNA 1R2UA 1X02A 1AUIB 3WHTB 2KBMA 2M1KB 3KEVA 2KBIA 2LMUA 4TNCA 1QX5B 4ZCVA 1SW8A 1LKJA 4A4CA 1IG5A 1JUOA 1NX0A 1KK8C 2O5GA 4MSPA 2K7CA 3BQ3A 3GK1A 2SASA 2I94A 1K8UA 4I5NB 1C07A 1WLZA 1DT7B 3H4SE 1LINA 1JSAA 2B1UA 4OKHA 4OR9B 1S5GY 4PHJA 1LXFC 1OOJA 2CT9A 1FI5A 5CSFA 1WY9A 2H61C 1QJTA 1L7ZA 1LVCD 2LP2A 1YRUB 4I5KA 1UHNA 3PATA 2JT0A 2LMVA 1SL7A 1S6CA 3DVMA 4R1EA 2ZNDA 1EJ3A 1B47A 4A4BA 1B8RA 3DF0B 5K89A 2LNKA 1XFVO 4USLA 1S5GZ 1YX8A 4GGFA 1UHIA 1CFCA 3A8RA 1BT6A 2ZN8A 2MRDA 1KQVA 3EK8A 2L4IA 3TS5C 3O2PA 2KQ6A 1XFWO 2LP3A 3OB2B 4N1FA 2LVKA 4WRIA 4BY5A 3I5FB 1UWOA 4XJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCM A;  3WHU B;  2LE9 B;  1DF0 B;  4DRW A;  1DJZ A;  5AFP A;  2JZI A;  4PCW A;  1CFP A;  2BCX A;  1N65 A;  5AEQ A;  1C7W A;  3K21 A;  1Y0V H;  5HLV A;  2WC8 A;  1YR5 A;  2GGM A;  3CR2 A;  4GGN A;  2P6B B;  4U8D A;  1F55 A;  1W7J B;  3DF0 A;  1QIV A;  2JWW A;  3ZNI A;  3CZT X;  3TDI A;  2K7B A;  3BXK A;  1U5I B;  2KI4 B;  5HKW A;  3PM8 A;  1U5I A;  1K93 D;  2PVB A;  3CTN A;  1TRF A;  2JTT A;  2MLE C;  1NCY A;  4MN0 A;  1N0Y A;  2Y4Q A;  1J7Q A;  1F4O A;  4YI8 A;  1KFU S;  4MRX A;  2MHH A;  3WXA A;  1CM4 A;  2PAS A;  1QAS A;  2CTN A;  4DUQ A;  2PRU A;  1E8A A;  1KK8 B;  1YX7 A;  5BPJ A;  2HF5 A;  1WDC C;  1F8H A;  5CSI A;  1N2D A;  2KNE A;  1NPQ A;  1DGU A;  4JPZ B;  2I2R E;  5CSJ A;  1K9P A;  3I5H B;  2KAX A;  2KFH A;  2L2E A;  4PDZ A;  1A03 A;  1KQM C;  4ZCU A;  3OP0 A;  1IRJ A;  1QIW A;  3LL8 B;  3NSI A;  1PRW A;  3JVT B;  2I7A A;  2JT3 A;  3A4U B;  4WQ2 A;  3KO0 A;  4N5X A;  3EK4 A;  2JOJ A;  1REC A;  1WRZ A;  2KYF A;  2L51 A;  2AAO A;  2Y1N A;  3CLN A;  2CXJ A;  3TDU A;  1IKU A;  1Y6W A;  1RWY A;  1K2H A;  4GAO A;  3BUW B;  2QPT A;  4N1G A;  1OQP A;  1YTZ C;  1YVL A;  4OV2 A;  4GFT A;  1G8I A;  2GGZ A;  2NXQ A;  1CFD A;  4C0K A;  1NYA A;  1HT9 A;  2K61 A;  2DOQ A;  1TNQ A;  1NX2 A;  2Q91 A;  4NDB A;  1DJH A;  1QLK A;  1G4Y R;  4CFQ A;  2AUC A;  5I2Q A;  2NCP A;  2JQ6 A;  1V1F A;  2FJU B;  3LLE A;  2KOT A;  3SG2 A;  1H8B A;  4FQO A;  1B9A A;  4NDC A;  3O6B A;  4MZJ A;  1CKK A;  1W7I B;  1DGV A;  2KGB C;  4P5O E;  4PE7 A;  1CDL A;  1IJ5 A;  5ER4 X;  2LV7 A;  1YUR A;  1BMO A;  3CR4 X;  3JVT C;  4C0L A;  1QS7 A;  2LUC A;  1MXE A;  4HRH A;  2K7O A;  3BUO B;  2LUX A;  4HRG A;  5D69 A;  1OZS A;  4PE4 A;  2E30 A;  3TUY B;  2L4H A;  1KFX L;  1CLM A;  1NX1 A;  3AKB A;  4PHN A;  4YGD B;  2WCF A;  1JC2 A;  1QV1 A;  2HPS A;  1SCV A;  5DKR A;  3GK2 A;  1LA3 A;  1HQV A;  4CID A;  2I18 A;  1MXL C;  1KQM B;  1WRL A;  2WOS A;  2K8M B;  3LCP C;  4QJ4 B;  2KYC A;  4BY4 A;  2LHI A;  1PSB A;  1JBA A;  1NP8 A;  2F2O A;  1FBV A;  3BUN B;  5CPV A;  1DF0 A;  3CGA A;  1NWD A;  3FWB A;  2G9B A;  4MEW A;  3BUX B;  1CDN A;  5AAN A;  4YGA A;  2EGD A;  3LK0 A;  3OB1 B;  3JTD B;  1QVI Z;  3C1V A;  5FYX A;  5HKZ A;  1SCM B;  4DS7 A;  2L50 A;  4UPG A;  3EKH A;  1J7O A;  1XYD A;  4AQI A;  1C7V A;  1KWO B;  4OCI A;  2IS9 A;  2MLF C;  1K9U A;  1F54 A;  5KSZ A;  3SG5 A;  1TOP A;  5ER5 A;  3EVU A;  1K96 A;  4HSZ A;  3IQQ A;  1ZAC A;  1ALV A;  1D1O A;  2LCP A;  4M2O A;  3ZWH A;  1PK0 D;  4L9M A;  4M2P A;  1JF2 A;  3DVE A;  5HKY A;  2E6W A;  1QVI Y;  2F3Y A;  3I5F C;  1TCF A;  4ORA B;  1IWQ A;  2GV5 A;  5B8I B;  4YBH B;  1SL8 A;  3GOF A;  2KFF A;  3PN7 C;  4ICB A;  1PSR A;  2LVV A;  1KFU L;  4GUK A;  1SL9 A;  1WDC B;  2L0P A;  2HQ8 A;  3NSK A;  4ORB B;  2TN4 A;  3JTD C;  3SG3 A;  3I5I C;  2KGR A;  5DKQ A;  4PE1 A;  2V53 A;  1DJX A;  3TS5 B;  1TN4 A;  3CR5 X;  1BF5 A;  1IJ6 A;  1QTX A;  3BOW B;  3O4Y A;  3RLZ A;  1L2O B;  3TDZ A;  1CNP A;  2ZRT A;  3BYA A;  1AJ4 A;  1M31 A;  4MBE A;  1ZUZ A;  1Y1A A;  4JWQ A;  1JWD A;  2EC6 B;  1TNP A;  2CBL A;  1BOD A;  1CM1 A;  2M8U A;  2O60 A;  3HX4 A;  4CLN A;  2K7D A;  4Q04 A;  2KI4 C;  2FCE A;  1RFJ A;  2H2K A;  3SG4 A;  2M7N A;  4E68 A;  2ZFD A;  1SNL A;  1XFZ O;  2WND A;  3SIB A;  2HET A;  2JTZ A;  1YRT B;  1KCY A;  3AKA A;  2JT8 A;  3M0W A;  2RGI A;  2LVI A;  5JOL A;  1MWN A;  1TCO B;  1BOC A;  4GBA A;  1KWO C;  1K9K A;  2KSP A;  1J7P A;  4YI9 A;  5DKN A;  1EG4 A;  2BCA A;  1QX2 A;  4D1E A;  4YGC B;  1B4C A;  1FF1 A;  2VRG A;  2HQW A;  1M45 A;  1CMG A;  1DJG A;  1MF8 B;  4PE0 A;  1QV0 A;  1A29 A;  2KAY A;  1XK4 A;  2NLN A;  3LK1 A;  3MSE B;  1TIZ A;  2JPT A;  3I5G B;  5HLO A;  2MBX A;  2MJW B;  3EVR A;  1DVI A;  2OS8 B;  2LAN A;  3NXA A;  1BU3 A;  1FW4 A;  2WOR A;  1OMD A;  1CLB A;  1V1G A;  2ZKM X;  1WLM A;  3VRQ A;  1IQ5 A;  2JNX A;  1UUS A;  2ZN9 A;  3EVV A;  4MVF A;  1A75 B;  1J1E A;  1UHJ A;  5I2L A;  1BLQ A;  1XA5 A;  2PMY A;  4PHM A;  1A2X A;  1GGZ A;  1MR8 A;  1OMR A;  3DVJ A;  1B8L A;  3IF7 A;  3WNX B;  2NZ0 A;  1TNX A;  4HRE E;  1QAT A;  1CTR A;  1OZO A;  2D8N A;  1KK7 Z;  2LMT A;  1R6P A;  1CB1 A;  1XFU O;  1IQ3 A;  2KAV A;  3KF9 A;  4YGB B;  2M29 A;  3TUY C;  1GJY A;  3VRN A;  1A4P A;  4QJ3 B;  2JUL A;  1UUR A;  2LLT A;  1YVH A;  1SMG A;  3FS7 A;  5I2O A;  1S3P A;  3SJS A;  1PVA A;  4YGE B;  5HYD A;  4PAL A;  1XFX O;  1CFF A;  1NSH A;  1SK6 D;  1OSA A;  2A4J A;  2KFG A;  2M0R A;  4GPL B;  1BR4 B;  3NSL A;  1RK9 A;  1DJY A;  5D7F A;  2BL0 B;  1ZFS A;  1L2O C;  4XYN A;  1MHO A;  1SYM A;  4CFR A;  3EKJ A;  1IH0 A;  1KK7 Y;  2CCM A;  2Q4U A;  2LHL A;  3D0Y B;  1AP4 A;  5PAL A;  1AJ5 A;  1IGV A;  1MQ1 A;  1M46 A;  1SBJ A;  1TNW A;  1UP5 A;  3RM1 A;  1EXR A;  4QJ5 B;  3F45 A;  1NX3 A;  2G2B A;  2QAC A;  1NCX A;  3QRX A;  1CDM A;  1BR1 B;  1K95 A;  2BE4 A;  2K0J A;  2KI6 D;  3E3R A;  3FIA A;  1JF0 A;  2M3W A;  3VRR A;  3PN7 B;  4C0J A;  2ISD A;  2SCP A;  2BEC A;  2Y5I A;  1RRO A;  1CDP A;  1SR6 C;  2PAL A;  3O78 A;  1J1D A;  2H61 A;  5AXI A;  1PAL A;  2FOT A;  2LLS A;  3DD4 A;  5G08 A;  2JXL A;  2LC5 A;  2JRF A;  3AAK A;  1ODB A;  5IBW A;  4AQJ A;  1NUB A;  1DTL A;  2BBN A;  1LA0 A;  3FWC A;  4P2Y B;  1YUS A;  1KFX S;  1XO5 A;  2NCO A;  3VRO A;  3BUM B;  3D0Y A;  2COL B;  4OVN F;  1ALW A;  2BKI B;  2OPO A;  3TZ1 A;  4IL1 A;  1FI6 A;  1A75 A;  2KDH A;  4AOM A;  1J55 A;  1XVJ A;  1J7R A;  1RJV A;  2L98 A;  2KQY A;  2OS8 C;  1ZMZ A;  3KPX A;  1TTX A;  1PVB A;  2L5X B;  2BCB A;  1Q80 A;  1DJI A;  2BL0 C;  3PSR A;  5AER A;  2JC2 A;  3EK7 A;  1S26 D;  4MZL A;  2F8P A;  2JXC A;  1QX7 A;  2M9G A;  1UHH A;  3I5G C;  3SG6 A;  4DIR A;  1CMF A;  1EG3 A;  1NIW A;  3OX5 A;  2F3Z A;  3CWG A;  5JJG A;  1JFJ A;  1G33 A;  4F0Z B;  2FCD A;  4ETO A;  2M7L A;  1QXP A;  4M2Q A;  1H4B A;  2F2P A;  4CPV A;  1QLS A;  2JU0 A;  3SIA A;  1AK8 A;  2OTG C;  2Y1M A;  1CLL A;  2WCB A;  1YUT A;  1F4Q A;  1OE9 B;  4MRY A;  5GQQ C;  1FPW A;  2M49 B;  1B8C A;  2R2I A;  4GNK B;  1S36 A;  1S1E A;  3PFV A;  1EH2 A;  1MUX A;  5I8N A;  3GK4 X;  1ZOT B;  1SRA A;  4I5J A;  2LM5 A;  3VRP A;  1SCM C;  1OMV A;  1SR6 B;  1JFK A;  3D10 A;  5F6T A;  5KTY A;  2BKH B;  1F71 A;  2BBM A;  2PSR A;  2LVJ A;  5CSN A;  1XK4 C;  4PHK A;  3VGO A;  1Y1X A;  3CS1 A;  2ZRS A;  3I5I B;  1B7T Z;  4WQ3 A;  1DJW A;  2MAZ A;  1UHK A;  2K2A A;  5J3X A;  3IQO A;  4YRU A;  3DVK A;  1XFY O;  2CNP A;  3PAL A;  1S6I A;  1PUL A;  1KSM A;  2ZNE A;  4DCK A;  4JQ0 D;  1K94 A;  1S6J A;  1EL4 A;  2WCE A;  2M97 A;  1WRK A;  2LAP A;  3AAJ A;  1NCZ A;  3SG7 A;  1F70 A;  3OHM B;  1SKT A;  3OX6 A;  4GGF C;  2LLU A;  4XJK B;  3NSO A;  1K90 D;  5KU1 A;  1B7T Y;  1DMO A;  3BOW A;  4NQG A;  2AMI A;  4FTG A;  2OTG B;  4MLW A;  1RTP 1;  1M63 B;  1BJF A;  1SPY A;  1SY9 A;  2KI6 C;  4NDD A;  4ORC B;  1B1G A;  1Y1U A;  1AHR A;  2BE6 A;  1BG1 A;  3KHE A;  2M1U A;  1KSO A;  2K2F A;  3PLF B;  1M39 A;  2JNF A;  3I5H C;  5TNC A;  1AVS A;  2EC6 C;  3ICB A;  1GGW A;  2EHB A;  1VRK A;  4I5L B;  2F33 A;  1GQM A;  2MA2 A;  1YUU A;  4MZK A;  2KHN A;  1R2U A;  1X02 A;  1AUI B;  3WHT B;  2KBM A;  2M1K B;  3KEV A;  2KBI A;  2LMU A;  4TNC A;  1QX5 B;  4ZCV A;  1SW8 A;  1LKJ A;  4A4C A;  1IG5 A;  1JUO A;  1NX0 A;  1KK8 C;  2O5G A;  4MSP A;  2K7C A;  3BQ3 A;  3GK1 A;  2SAS A;  2I94 A;  1K8U A;  4I5N B;  1C07 A;  1WLZ A;  1DT7 B;  3H4S E;  1LIN A;  1JSA A;  2B1U A;  4OKH A;  4OR9 B;  1S5G Y;  4PHJ A;  1LXF C;  1OOJ A;  2CT9 A;  1FI5 A;  5CSF A;  1WY9 A;  2H61 C;  1QJT A;  1L7Z A;  1LVC D;  2LP2 A;  1YRU B;  4I5K A;  1UHN A;  3PAT A;  2JT0 A;  2LMV A;  1SL7 A;  1S6C A;  3DVM A;  4R1E A;  2ZND A;  1EJ3 A;  1B47 A;  4A4B A;  1B8R A;  3DF0 B;  5K89 A;  2LNK A;  1XFV O;  4USL A;  1S5G Z;  1YX8 A;  4GGF A;  1UHI A;  1CFC A;  3A8R A;  1BT6 A;  2ZN8 A;  2MRD A;  1KQV A;  3EK8 A;  2L4I A;  3TS5 C;  3O2P A;  2KQ6 A;  1XFW O;  2LP3 A;  3OB2 B;  4N1F A;  2LVK A;  4WRI A;  4BY5 A;  3I5F B;  1UWO A;  4XJK A; 
#chains in the Genus database with same CATH topology
 3HCM A;  2ERB A;  2QEB A;  3OGN A;  3WHU B;  2LE9 B;  1DF0 B;  4DRW A;  1DJZ A;  5AFP A;  2WCJ A;  3DYE A;  2JZI A;  4PCW A;  1CFP A;  2BCX A;  1N65 A;  3D78 A;  1C7W A;  3K21 A;  5AEQ A;  3B87 A;  1Y0V H;  3SS4 A;  5HLV A;  2WC8 A;  3PM2 A;  1Z2C B;  1YR5 A;  2GGM A;  3CR2 A;  4GGN A;  3R72 A;  2P6B B;  4U8D A;  1F55 A;  1W7J B;  3DF0 A;  1QIV A;  2JWW A;  3ZNI A;  3CZT X;  3TDI A;  2K7B A;  3BXK A;  1U5I B;  2K60 A;  2KI4 B;  2WCL A;  3R1O A;  5HKW A;  3PM8 A;  1U5I A;  1K93 D;  2PVB A;  3CTN A;  1TRF A;  2JTT A;  2MLE C;  1NCY A;  4MN0 A;  1N0Y A;  2Y4Q A;  1J7Q A;  1F4O A;  4YI8 A;  1KFU S;  1T14 A;  3NGV A;  4MRX A;  2MHH A;  3WXA A;  1CM4 A;  2PAS A;  1QAS A;  2CTN A;  4DUQ A;  4IJ7 A;  2PRU A;  1E8A A;  1KK8 B;  1YX7 A;  5BPJ A;  2HF5 A;  1WDC C;  1F8H A;  5CSI A;  1N2D A;  2KNE A;  1NPQ A;  4FQT A;  1DGU A;  3L47 A;  4JPZ B;  2I2R E;  5CSJ A;  1K9P A;  3I5H B;  2KAX A;  2KFH A;  2L2E A;  4PDZ A;  1A03 A;  3CYZ A;  1KQM C;  4ZCU A;  1Z4H A;  3OP0 A;  1IRJ A;  1QIW A;  3LL8 B;  3DY9 A;  1OOF A;  1PRW A;  3NSI A;  3JVT B;  2I7A A;  2JT3 A;  3NHT A;  2BAP A;  3A4U B;  4WQ2 A;  3KO0 A;  2WC5 A;  4N5X A;  3EK4 A;  2JOJ A;  3BFB A;  1REC A;  1WRZ A;  2KYF A;  2L51 A;  2AAO A;  2Y1N A;  2FJY A;  2CXJ A;  3CLN A;  3CZ1 A;  3TDU A;  1Y6W A;  1RWY A;  1IKU A;  4GAO A;  1K2H A;  3BUW B;  2QPT A;  4N1G A;  1OQP A;  1TUJ A;  1YTZ C;  1YVL A;  4OV2 A;  4GFT A;  5FI2 A;  1G8I A;  2GGZ A;  2NXQ A;  1CFD A;  4C0K A;  1NYA A;  1HT9 A;  2K61 A;  2WCH A;  2DOQ A;  3S0B A;  1TNQ A;  1NX2 A;  1P28 A;  2Q91 A;  1DJH A;  4NDB A;  1QLK A;  1G4Y R;  3S0D A;  4CFQ A;  2AUC A;  5I2Q A;  2NCP A;  2JQ6 A;  1V1F A;  2FJU B;  3LLE A;  2KOT A;  3SG2 A;  1H8B A;  4FQO A;  1B9A A;  4NDC A;  3O6B A;  4MZJ A;  4F7F A;  1CKK A;  1W7I B;  1DGV A;  2KGB C;  3S0G A;  4P5O E;  4PE7 A;  1CDL A;  3D73 A;  1IJ5 A;  5ER4 X;  2LV7 A;  1YUR A;  1BMO A;  3CR4 X;  3JVT C;  4C0L A;  1QS7 A;  1SSE B;  2LUC A;  1MXE A;  4HRH A;  2K7O A;  3BUO B;  2LUX A;  3Q8I A;  4HRG A;  5D69 A;  1OZS A;  4PE4 A;  1OOH A;  2E30 A;  3TUY B;  2L4H A;  1KFX L;  1CLM A;  1NX1 A;  3AKB A;  4PHN A;  4YGD B;  1TUZ A;  2WCF A;  1JC2 A;  5FI6 A;  1QV1 A;  2HPS A;  1SCV A;  5DKR A;  3GK2 A;  1LA3 A;  1HQV A;  4CID A;  2I18 A;  1MXL C;  1KQM B;  1WRL A;  2WOS A;  5HL1 A;  2K8M B;  3LCP C;  4QJ4 B;  1ORG A;  2KYC A;  2LHI A;  4BY4 A;  1PSB A;  1JBA A;  1NP8 A;  2F2O A;  1FBV A;  3BUN B;  5CPV A;  1DF0 A;  3CGA A;  1NWD A;  3FWB A;  2G9B A;  4MEW A;  3BUX B;  1CDN A;  5AAN A;  4YGA A;  2EGD A;  3LK0 A;  3OB1 B;  3JTD B;  1GM0 A;  1QVI Z;  3C1V A;  5FYX A;  5HKZ A;  1SCM B;  4DS7 A;  3NHI A;  2WCK A;  3IVT A;  2L50 A;  4UPG A;  3EKH A;  4INX A;  1J7O A;  1XYD A;  4AQI A;  1C7V A;  1KWO B;  4OCI A;  2IS9 A;  2MLF C;  1K9U A;  1F54 A;  5KSZ A;  3SG5 A;  1TOP A;  5ER5 A;  3EVU A;  1K96 A;  3CDN A;  3IQQ A;  1ZAC A;  1ALV A;  4HSZ A;  4JKT A;  1D1O A;  2LCP A;  4M2O A;  3ZWH A;  1PK0 D;  4INW A;  4L9M A;  4KYN A;  4M2P A;  1JF2 A;  3DVE A;  5HKY A;  2E6W A;  1QVI Y;  2F3Y A;  3I5F C;  1TCF A;  4ORA B;  1IWQ A;  2GV5 A;  5B8I B;  4YBH B;  1SL8 A;  3GOF A;  2KFF A;  3PN7 C;  4ICB A;  2GTE A;  1PSR A;  2LVV A;  1KFU L;  4GUK A;  1SL9 A;  1WDC B;  2L0P A;  2HQ8 A;  3NSK A;  4ORB B;  2TN4 A;  3JTD C;  3SG3 A;  3I5I C;  3CAB A;  2KGR A;  5DKQ A;  4PE1 A;  2V53 A;  1DJX A;  3TS5 B;  1TN4 A;  3CR5 X;  2WC6 A;  1BF5 A;  1IJ6 A;  1QTX A;  3BOW B;  3O4Y A;  3QME A;  3RLZ A;  1L2O B;  3FE8 A;  3TDZ A;  1CNP A;  3UO9 A;  3BFA A;  2ZRT A;  2QEV A;  3BYA A;  1AJ4 A;  1M31 A;  4MBE A;  1ZUZ A;  1Y1A A;  4JWQ A;  1JWD A;  2EC6 B;  1TNP A;  2CBL A;  1BOD A;  1CM1 A;  2M8U A;  2O60 A;  3HX4 A;  4CLN A;  3R1V A;  2K7D A;  1DC1 A;  4Q04 A;  1DQE A;  2FCE A;  2KI4 C;  1RFJ A;  2H2K A;  3SG4 A;  2M7N A;  4E68 A;  2ZFD A;  1SNL A;  1XFZ O;  2WND A;  3SIB A;  2HET A;  2JTZ A;  1YRT B;  1KCY A;  2BNX A;  3AKA A;  2JT8 A;  3M0W A;  2RGI A;  2LVI A;  5JOL A;  1MWN A;  1TCO B;  1BOC A;  4GBA A;  1KWO C;  1K9K A;  2KSP A;  1J7P A;  4YI9 A;  5DKN A;  1EG4 A;  2BCA A;  1QX2 A;  4D1E A;  4YGC B;  1B4C A;  1FF1 A;  2VRG A;  2HQW A;  1DEL A;  1M45 A;  1CMG A;  1DJG A;  1MF8 B;  4PE0 A;  1QV0 A;  1A29 A;  2KAY A;  1XK4 A;  2NLN A;  3D75 A;  3LK1 A;  3MSE B;  1TIZ A;  2JPT A;  3I5G B;  5HLO A;  2MBX A;  4OZD A;  2MJW B;  3EVR A;  1DVI A;  2OS8 B;  2LAN A;  3NXA A;  1BU3 A;  1FW4 A;  2WOR A;  1OMD A;  1CLB A;  1V1G A;  2ZKM X;  1WLM A;  3VRQ A;  1IQ5 A;  2JNX A;  1UUS A;  2ZN9 A;  3EVV A;  4MVF A;  1A75 B;  1J1E A;  1UHJ A;  5I2L A;  1BLQ A;  1XA5 A;  2PMY A;  4PHM A;  1A2X A;  1GGZ A;  1MR8 A;  1OMR A;  3DVJ A;  3FE9 A;  1B8L A;  3IF7 A;  3WNX B;  2NZ0 A;  1QWV A;  1TNX A;  4HRE E;  1QAT A;  3EG5 B;  1CTR A;  1OZO A;  2D8N A;  1KK7 Z;  2LMT A;  2QEH A;  1R6P A;  1CB1 A;  1XFU O;  1IQ3 A;  2KAV A;  3KF9 A;  4YGB B;  2M29 A;  3TUY C;  1GJY A;  3VRN A;  1A4P A;  4QJ3 B;  2JUL A;  1UUR A;  2LLT A;  1YVH A;  1SMG A;  3FS7 A;  5I2O A;  1S3P A;  3SJS A;  1PVA A;  4YGE B;  5HYD A;  4PAL A;  1XFX O;  1CFF A;  1NSH A;  1SK6 D;  1OSA A;  2A4J A;  2KFG A;  2M0R A;  4GPL B;  1BR4 B;  2P70 A;  3NSL A;  1RK9 A;  1DJY A;  5D7F A;  2BL0 B;  1ZFS A;  1L2O C;  4XYN A;  1MHO A;  1OOI X;  1SYM A;  4CFR A;  3EKJ A;  1IH0 A;  1KK7 Y;  2CCM A;  5I94 A;  2Q4U A;  2LHL A;  3D0Y B;  1AP4 A;  5PAL A;  1AJ5 A;  1DEK A;  1IGV A;  1MQ1 A;  1M46 A;  1SBJ A;  1TNW A;  1UP5 A;  3BFH A;  3RM1 A;  1EXR A;  1TWO A;  4QJ5 B;  3F45 A;  3L4L A;  1NX3 A;  2G2B A;  3K1E A;  2QAC A;  1NCX A;  3QRX A;  1CDM A;  1BR1 B;  1K95 A;  2BE4 A;  2K0J A;  2KI6 D;  3E3R A;  3FIA A;  1JF0 A;  2M3W A;  3VRR A;  3PN7 B;  4C0J A;  2ISD A;  2SCP A;  2WCM A;  2BEC A;  2Y5I A;  1RRO A;  1CDP A;  1SR6 C;  2PAL A;  1W9Z A;  3O78 A;  1J1D A;  3VB1 A;  2H61 A;  5AXI A;  1PAL A;  2FOT A;  2KLE A;  2LLS A;  3DD4 A;  2JPO A;  5G08 A;  2JXL A;  2LC5 A;  2JRF A;  3AAK A;  1ODB A;  5IBW A;  4AQJ A;  1NUB A;  1DTL A;  2BBN A;  1LA0 A;  3FWC A;  4P2Y B;  3UNW A;  3BJH A;  3R1P A;  1YUS A;  3D77 A;  5EL2 A;  1KFX S;  1XO5 A;  2NCO A;  3DZT A;  3VRO A;  3D76 A;  3BUM B;  3D0Y A;  2COL B;  4OVN F;  1ALW A;  2BKI B;  2OPO A;  2PQL A;  3TZ1 A;  4IL1 A;  1FI6 A;  2L2C A;  4JD9 A;  1A75 A;  2KDH A;  4AOM A;  1J55 A;  1XVJ A;  1J7R A;  1RJV A;  2L98 A;  2KQY A;  2OS8 C;  1ZMZ A;  3KPX A;  1TTX A;  1PVB A;  2L5X B;  2BCB A;  1Q80 A;  1DJI A;  2BL0 C;  3PSR A;  5AER A;  2JC2 A;  3EK7 A;  1S26 D;  4MZL A;  2F8P A;  3B6X A;  2JXC A;  1QX7 A;  2M9G A;  1UHH A;  3I5G C;  3SG6 A;  4DIR A;  1CMF A;  1EG3 A;  1NIW A;  3OX5 A;  2F3Z A;  3CWG A;  5JJG A;  1JFJ A;  1XFR A;  1G33 A;  4F0Z B;  2FCD A;  4ETO A;  2M7L A;  1QXP A;  4M2Q A;  1H4B A;  3S0A A;  3S0F A;  1LS8 A;  2F2P A;  4CPV A;  1QLS A;  2JU0 A;  3SIA A;  2L5Y A;  3RZS A;  1OW4 A;  2OTG C;  2Y1M A;  1CLL A;  3OBV A;  1AK8 A;  2WCB A;  1YUT A;  2YGU A;  1F4Q A;  1OE9 B;  4MRY A;  5GQQ C;  1FPW A;  2M49 B;  3N7H A;  1B8C A;  2R2I A;  4GNK B;  1S36 A;  1S1E A;  3PFV A;  5DIC A;  1EH2 A;  2KPH A;  1MUX A;  5I8N A;  3GK4 X;  1ZOT B;  1SRA A;  3B7A A;  4I5J A;  2LM5 A;  1IIO A;  3VRP A;  1SCM C;  1OMV A;  1SR6 B;  1JFK A;  3D10 A;  5F6T A;  5KTY A;  2BKH B;  1F71 A;  2BBM A;  2PSR A;  5FI7 A;  2LVJ A;  5CSN A;  1XK4 C;  4PHK A;  3VGO A;  1Y1X A;  3CS1 A;  2ZRS A;  3I5I B;  1B7T Z;  3PJI A;  4WQ3 A;  1DJW A;  2MAZ A;  1UHK A;  2K2A A;  5J3X A;  3IQO A;  4YRU A;  3DVK A;  1XFY O;  1C3Z A;  2CNP A;  3D74 A;  3PAL A;  1S6I A;  1PUL A;  3CZ0 A;  1KSM A;  3V2L A;  2ZNE A;  4DCK A;  4JQ0 D;  1K94 A;  1S6J A;  1EL4 A;  3SS5 A;  2WCE A;  2M97 A;  1WRK A;  2LAP A;  3AAJ A;  1NCZ A;  3SG7 A;  1F70 A;  3OHM B;  1SKT A;  3OX6 A;  4GGF C;  2LLU A;  4XJK B;  3NSO A;  1K90 D;  5KU1 A;  1B7T Y;  1DMO A;  3BOW A;  4NQG A;  2AMI A;  3B88 A;  2OTG B;  4FTG A;  4MLW A;  1RTP 1;  1M63 B;  1BJF A;  1SPY A;  1SY9 A;  2KI6 C;  4NDD A;  4ORC B;  1B1G A;  1Y1U A;  1AHR A;  2BE6 A;  1BG1 A;  3KHE A;  2M1U A;  1KSO A;  2K2F A;  3PLF B;  1M39 A;  1OOG A;  2JNF A;  3I5H C;  5TNC A;  3S0E A;  1AVS A;  2EC6 C;  3CZ2 A;  3ICB A;  3L4A A;  2EHB A;  5D3O A;  1VRK A;  4I5L B;  1GGW A;  2F33 A;  1GQM A;  2MA2 A;  1YUU A;  4MZK A;  2KHN A;  1R2U A;  1X02 A;  1AUI B;  3WHT B;  3B86 A;  2KBM A;  2M1K B;  3KEV A;  2KBI A;  2LMU A;  4TNC A;  1QX5 B;  4ZCV A;  1SW8 A;  1LKJ A;  4A4C A;  1IG5 A;  1JUO A;  3FE6 A;  1NX0 A;  1KK8 C;  2O5G A;  4MSP A;  2K7C A;  3BQ3 A;  3GK1 A;  2SAS A;  2I94 A;  1K8U A;  4I5N B;  1C07 A;  1WLZ A;  1DT7 B;  3H4S E;  2H8V A;  1LIN A;  1JSA A;  2B1U A;  4OKH A;  4OR9 B;  1S5G Y;  4PHJ A;  1LXF C;  1OOJ A;  2CT9 A;  1FI5 A;  5CSF A;  1WY9 A;  2H61 C;  1QJT A;  1L7Z A;  1LVC D;  2LP2 A;  1YRU B;  4PT1 A;  4I5K A;  1UHN A;  3O4X A;  2JT0 A;  2LMV A;  3PAT A;  3SS3 A;  2KLD A;  2P71 A;  1SL7 A;  1S6C A;  3DVM A;  4R1E A;  2ZND A;  1EJ3 A;  1B47 A;  4A4B A;  1B8R A;  3DF0 B;  5K89 A;  3DXL A;  2LNK A;  1XFV O;  4USL A;  1S5G Z;  1YX8 A;  4GGF A;  1UHI A;  1CFC A;  3A8R A;  1BT6 A;  2ZN8 A;  1C3Y A;  2MRD A;  1KQV A;  2PYQ A;  2QEO A;  3EK8 A;  2L4I A;  3TS5 C;  2QDI A;  3O2P A;  2KQ6 A;  1XFW O;  2LP3 A;  3OB2 B;  4N1F A;  2LVK A;  4WRI A;  4BY5 A;  3I5F B;  1UWO A;  4XJK A; 
#chains in the Genus database with same CATH homology
 3HCM A;  3WHU B;  2LE9 B;  1DF0 B;  4DRW A;  1DJZ A;  5AFP A;  2JZI A;  4PCW A;  1CFP A;  2BCX A;  1N65 A;  5AEQ A;  1C7W A;  3K21 A;  1Y0V H;  5HLV A;  2WC8 A;  1YR5 A;  2GGM A;  3CR2 A;  4GGN A;  2P6B B;  4U8D A;  1F55 A;  1W7J B;  3DF0 A;  1QIV A;  2JWW A;  3ZNI A;  3CZT X;  3TDI A;  2K7B A;  3BXK A;  1U5I B;  2KI4 B;  5HKW A;  3PM8 A;  1U5I A;  1K93 D;  2PVB A;  3CTN A;  1TRF A;  2JTT A;  2MLE C;  1NCY A;  4MN0 A;  1N0Y A;  2Y4Q A;  1J7Q A;  1F4O A;  4YI8 A;  1KFU S;  4MRX A;  2MHH A;  3WXA A;  1CM4 A;  2PAS A;  1QAS A;  2CTN A;  4DUQ A;  2PRU A;  1E8A A;  1KK8 B;  1YX7 A;  5BPJ A;  2HF5 A;  1WDC C;  1F8H A;  5CSI A;  1N2D A;  2KNE A;  1NPQ A;  1DGU A;  4JPZ B;  2I2R E;  5CSJ A;  1K9P A;  3I5H B;  2KAX A;  2KFH A;  2L2E A;  4PDZ A;  1A03 A;  1KQM C;  4ZCU A;  3OP0 A;  1IRJ A;  1QIW A;  3LL8 B;  3NSI A;  1PRW A;  3JVT B;  2I7A A;  2JT3 A;  3A4U B;  4WQ2 A;  3KO0 A;  4N5X A;  3EK4 A;  2JOJ A;  1REC A;  1WRZ A;  2KYF A;  2L51 A;  2AAO A;  2Y1N A;  3CLN A;  2CXJ A;  3TDU A;  1IKU A;  1Y6W A;  1RWY A;  1K2H A;  4GAO A;  3BUW B;  2QPT A;  4N1G A;  1OQP A;  1YTZ C;  1YVL A;  4OV2 A;  4GFT A;  1G8I A;  2GGZ A;  2NXQ A;  1CFD A;  4C0K A;  1NYA A;  1HT9 A;  2K61 A;  2DOQ A;  1TNQ A;  1NX2 A;  2Q91 A;  4NDB A;  1DJH A;  1QLK A;  1G4Y R;  4CFQ A;  2AUC A;  5I2Q A;  2NCP A;  2JQ6 A;  1V1F A;  2FJU B;  3LLE A;  2KOT A;  3SG2 A;  1H8B A;  4FQO A;  1B9A A;  4NDC A;  3O6B A;  4MZJ A;  1CKK A;  1W7I B;  1DGV A;  2KGB C;  4P5O E;  4PE7 A;  1CDL A;  1IJ5 A;  5ER4 X;  2LV7 A;  1YUR A;  1BMO A;  3CR4 X;  3JVT C;  4C0L A;  1QS7 A;  2LUC A;  1MXE A;  4HRH A;  2K7O A;  3BUO B;  2LUX A;  4HRG A;  5D69 A;  1OZS A;  4PE4 A;  2E30 A;  3TUY B;  2L4H A;  1KFX L;  1CLM A;  1NX1 A;  3AKB A;  4PHN A;  4YGD B;  2WCF A;  1JC2 A;  1QV1 A;  2HPS A;  1SCV A;  5DKR A;  3GK2 A;  1LA3 A;  1HQV A;  4CID A;  2I18 A;  1MXL C;  1KQM B;  1WRL A;  2WOS A;  2K8M B;  3LCP C;  4QJ4 B;  2KYC A;  4BY4 A;  2LHI A;  1PSB A;  1JBA A;  1NP8 A;  2F2O A;  1FBV A;  3BUN B;  5CPV A;  1DF0 A;  3CGA A;  1NWD A;  3FWB A;  2G9B A;  4MEW A;  3BUX B;  1CDN A;  5AAN A;  4YGA A;  2EGD A;  3LK0 A;  3OB1 B;  3JTD B;  1QVI Z;  3C1V A;  5FYX A;  5HKZ A;  1SCM B;  4DS7 A;  2L50 A;  4UPG A;  3EKH A;  1J7O A;  1XYD A;  4AQI A;  1C7V A;  1KWO B;  4OCI A;  2IS9 A;  2MLF C;  1K9U A;  1F54 A;  5KSZ A;  3SG5 A;  1TOP A;  5ER5 A;  3EVU A;  1K96 A;  4HSZ A;  3IQQ A;  1ZAC A;  1ALV A;  1D1O A;  2LCP A;  4M2O A;  3ZWH A;  1PK0 D;  4L9M A;  4M2P A;  1JF2 A;  3DVE A;  5HKY A;  2E6W A;  1QVI Y;  2F3Y A;  3I5F C;  1TCF A;  4ORA B;  1IWQ A;  2GV5 A;  5B8I B;  4YBH B;  1SL8 A;  3GOF A;  2KFF A;  3PN7 C;  4ICB A;  1PSR A;  2LVV A;  1KFU L;  4GUK A;  1SL9 A;  1WDC B;  2L0P A;  2HQ8 A;  3NSK A;  4ORB B;  2TN4 A;  3JTD C;  3SG3 A;  3I5I C;  2KGR A;  5DKQ A;  4PE1 A;  2V53 A;  1DJX A;  3TS5 B;  1TN4 A;  3CR5 X;  1BF5 A;  1IJ6 A;  1QTX A;  3BOW B;  3O4Y A;  3RLZ A;  1L2O B;  3TDZ A;  1CNP A;  2ZRT A;  3BYA A;  1AJ4 A;  1M31 A;  4MBE A;  1ZUZ A;  1Y1A A;  4JWQ A;  1JWD A;  2EC6 B;  1TNP A;  2CBL A;  1BOD A;  1CM1 A;  2M8U A;  2O60 A;  3HX4 A;  4CLN A;  2K7D A;  4Q04 A;  2KI4 C;  2FCE A;  1RFJ A;  2H2K A;  3SG4 A;  2M7N A;  4E68 A;  2ZFD A;  1SNL A;  1XFZ O;  2WND A;  3SIB A;  2HET A;  2JTZ A;  1YRT B;  1KCY A;  3AKA A;  2JT8 A;  3M0W A;  2RGI A;  2LVI A;  5JOL A;  1MWN A;  1TCO B;  1BOC A;  4GBA A;  1KWO C;  1K9K A;  2KSP A;  1J7P A;  4YI9 A;  5DKN A;  1EG4 A;  2BCA A;  1QX2 A;  4D1E A;  4YGC B;  1B4C A;  1FF1 A;  2VRG A;  2HQW A;  1M45 A;  1CMG A;  1DJG A;  1MF8 B;  4PE0 A;  1QV0 A;  1A29 A;  2KAY A;  1XK4 A;  2NLN A;  3LK1 A;  3MSE B;  1TIZ A;  2JPT A;  3I5G B;  5HLO A;  2MBX A;  2MJW B;  3EVR A;  1DVI A;  2OS8 B;  2LAN A;  3NXA A;  1BU3 A;  1FW4 A;  2WOR A;  1OMD A;  1CLB A;  1V1G A;  2ZKM X;  1WLM A;  3VRQ A;  1IQ5 A;  2JNX A;  1UUS A;  2ZN9 A;  3EVV A;  4MVF A;  1A75 B;  1J1E A;  1UHJ A;  5I2L A;  1BLQ A;  1XA5 A;  2PMY A;  4PHM A;  1A2X A;  1GGZ A;  1MR8 A;  1OMR A;  3DVJ A;  1B8L A;  3IF7 A;  3WNX B;  2NZ0 A;  1TNX A;  4HRE E;  1QAT A;  1CTR A;  1OZO A;  2D8N A;  1KK7 Z;  2LMT A;  1R6P A;  1CB1 A;  1XFU O;  1IQ3 A;  2KAV A;  3KF9 A;  4YGB B;  2M29 A;  3TUY C;  1GJY A;  3VRN A;  1A4P A;  4QJ3 B;  2JUL A;  1UUR A;  2LLT A;  1YVH A;  1SMG A;  3FS7 A;  5I2O A;  1S3P A;  3SJS A;  1PVA A;  4YGE B;  5HYD A;  4PAL A;  1XFX O;  1CFF A;  1NSH A;  1SK6 D;  1OSA A;  2A4J A;  2KFG A;  2M0R A;  4GPL B;  1BR4 B;  3NSL A;  1RK9 A;  1DJY A;  5D7F A;  2BL0 B;  1ZFS A;  1L2O C;  4XYN A;  1MHO A;  1SYM A;  4CFR A;  3EKJ A;  1IH0 A;  1KK7 Y;  2CCM A;  2Q4U A;  2LHL A;  3D0Y B;  1AP4 A;  5PAL A;  1AJ5 A;  1IGV A;  1MQ1 A;  1M46 A;  1SBJ A;  1TNW A;  1UP5 A;  3RM1 A;  1EXR A;  4QJ5 B;  3F45 A;  1NX3 A;  2G2B A;  2QAC A;  1NCX A;  3QRX A;  1CDM A;  1BR1 B;  1K95 A;  2BE4 A;  2K0J A;  2KI6 D;  3E3R A;  3FIA A;  1JF0 A;  2M3W A;  3VRR A;  3PN7 B;  4C0J A;  2ISD A;  2SCP A;  2BEC A;  2Y5I A;  1RRO A;  1CDP A;  1SR6 C;  2PAL A;  3O78 A;  1J1D A;  2H61 A;  5AXI A;  1PAL A;  2FOT A;  2LLS A;  3DD4 A;  5G08 A;  2JXL A;  2LC5 A;  2JRF A;  3AAK A;  1ODB A;  5IBW A;  4AQJ A;  1NUB A;  1DTL A;  2BBN A;  1LA0 A;  3FWC A;  4P2Y B;  1YUS A;  1KFX S;  1XO5 A;  2NCO A;  3VRO A;  3BUM B;  3D0Y A;  2COL B;  4OVN F;  1ALW A;  2BKI B;  2OPO A;  3TZ1 A;  4IL1 A;  1FI6 A;  1A75 A;  2KDH A;  4AOM A;  1J55 A;  1XVJ A;  1J7R A;  1RJV A;  2L98 A;  2KQY A;  2OS8 C;  1ZMZ A;  3KPX A;  1TTX A;  1PVB A;  2L5X B;  2BCB A;  1Q80 A;  1DJI A;  2BL0 C;  3PSR A;  5AER A;  2JC2 A;  3EK7 A;  1S26 D;  4MZL A;  2F8P A;  2JXC A;  1QX7 A;  2M9G A;  1UHH A;  3I5G C;  3SG6 A;  4DIR A;  1CMF A;  1EG3 A;  1NIW A;  3OX5 A;  2F3Z A;  3CWG A;  5JJG A;  1JFJ A;  1G33 A;  4F0Z B;  2FCD A;  4ETO A;  2M7L A;  1QXP A;  4M2Q A;  1H4B A;  2F2P A;  4CPV A;  1QLS A;  2JU0 A;  3SIA A;  1AK8 A;  2OTG C;  2Y1M A;  1CLL A;  2WCB A;  1YUT A;  1F4Q A;  1OE9 B;  4MRY A;  5GQQ C;  1FPW A;  2M49 B;  1B8C A;  2R2I A;  4GNK B;  1S36 A;  1S1E A;  3PFV A;  1EH2 A;  1MUX A;  5I8N A;  3GK4 X;  1ZOT B;  1SRA A;  4I5J A;  2LM5 A;  3VRP A;  1SCM C;  1OMV A;  1SR6 B;  1JFK A;  3D10 A;  5F6T A;  5KTY A;  2BKH B;  1F71 A;  2BBM A;  2PSR A;  2LVJ A;  5CSN A;  1XK4 C;  4PHK A;  3VGO A;  1Y1X A;  3CS1 A;  2ZRS A;  3I5I B;  1B7T Z;  4WQ3 A;  1DJW A;  2MAZ A;  1UHK A;  2K2A A;  5J3X A;  3IQO A;  4YRU A;  3DVK A;  1XFY O;  2CNP A;  3PAL A;  1S6I A;  1PUL A;  1KSM A;  2ZNE A;  4DCK A;  4JQ0 D;  1K94 A;  1S6J A;  1EL4 A;  2WCE A;  2M97 A;  1WRK A;  2LAP A;  3AAJ A;  1NCZ A;  3SG7 A;  1F70 A;  3OHM B;  1SKT A;  3OX6 A;  4GGF C;  2LLU A;  4XJK B;  3NSO A;  1K90 D;  5KU1 A;  1B7T Y;  1DMO A;  3BOW A;  4NQG A;  2AMI A;  4FTG A;  2OTG B;  4MLW A;  1RTP 1;  1M63 B;  1BJF A;  1SPY A;  1SY9 A;  2KI6 C;  4NDD A;  4ORC B;  1B1G A;  1Y1U A;  1AHR A;  2BE6 A;  1BG1 A;  3KHE A;  2M1U A;  1KSO A;  2K2F A;  3PLF B;  1M39 A;  2JNF A;  3I5H C;  5TNC A;  1AVS A;  2EC6 C;  3ICB A;  1GGW A;  2EHB A;  1VRK A;  4I5L B;  2F33 A;  1GQM A;  2MA2 A;  1YUU A;  4MZK A;  2KHN A;  1R2U A;  1X02 A;  1AUI B;  3WHT B;  2KBM A;  2M1K B;  3KEV A;  2KBI A;  2LMU A;  4TNC A;  1QX5 B;  4ZCV A;  1SW8 A;  1LKJ A;  4A4C A;  1IG5 A;  1JUO A;  1NX0 A;  1KK8 C;  2O5G A;  4MSP A;  2K7C A;  3BQ3 A;  3GK1 A;  2SAS A;  2I94 A;  1K8U A;  4I5N B;  1C07 A;  1WLZ A;  1DT7 B;  3H4S E;  1LIN A;  1JSA A;  2B1U A;  4OKH A;  4OR9 B;  1S5G Y;  4PHJ A;  1LXF C;  1OOJ A;  2CT9 A;  1FI5 A;  5CSF A;  1WY9 A;  2H61 C;  1QJT A;  1L7Z A;  1LVC D;  2LP2 A;  1YRU B;  4I5K A;  1UHN A;  3PAT A;  2JT0 A;  2LMV A;  1SL7 A;  1S6C A;  3DVM A;  4R1E A;  2ZND A;  1EJ3 A;  1B47 A;  4A4B A;  1B8R A;  3DF0 B;  5K89 A;  2LNK A;  1XFV O;  4USL A;  1S5G Z;  1YX8 A;  4GGF A;  1UHI A;  1CFC A;  3A8R A;  1BT6 A;  2ZN8 A;  2MRD A;  1KQV A;  3EK8 A;  2L4I A;  3TS5 C;  3O2P A;  2KQ6 A;  1XFW O;  2LP3 A;  3OB2 B;  4N1F A;  2LVK A;  4WRI A;  4BY5 A;  3I5F B;  1UWO A;  4XJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...