2FJYA

Crystal structure of b-form bombyx mori pheromone binding protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
136
structure length
136
Chain Sequence
b'NLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title Coil-to-helix transition and ligand release of Bombyx mori pheromone-binding protein.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 43
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2fjyA00
3DZTA 3DXLA 1OW4A 3D77A 2GTEA 2L2CA 3K1EA 2QDIA 4F7FA 3D74A 4INWA 3FE9A 5EL2A 1DQEA 3D73A 4FQTA 2ERBA 3CDNA 3V2LA 3FE8A 3NHIA 3S0AA 2QEHA 3S0BA 2JPOA 3BFBA 3L4LA 3N7HA 3OGNA 3NHTA 3RZSA 4JD9A 3CZ0A 3NGVA 2QEBA 2P71A 3CZ1A 1OOIX 1XFRA 1ORGA 4OZDA 1OOGA 3DYEA 2H8VA 1P28A 3CZ2A 1OOHA 3D78A 1GM0A 3S0FA 1T14A 3B7AA 3B86A 2QEOA 2WCJA 3S0GA 2P70A 3DY9A 3PJIA 3Q8IA 4INXA 1TWOA 1C3ZA 3CABA 2PQLA 2FJYA 1OOFA 3B87A 4PT1A 1QWVA 3R1PA 3R1OA 3BFHA 3L4AA 2WCLA 3BFAA 3R72A 2WC5A 3CYZA 2WC6A 2KPHA 2QEVA 3BJHA 3R1VA 5DICA 1C3YA 3B88A 3QMEA 3D75A 2WCMA 3VB1A 3B6XA 2WCHA 3D76A 3S0DA 2WCKA 3FE6A 1LS8A 3L47A 1TUJA 3S0EA
chains in the Genus database with same CATH superfamily
1YVLA 2WCFA 4XJKA 1GGZA 1MWNA 1NX0A 4WRIA 1Z4HA 1B1GA 4KYNA 2KYFA 2KLEA 1JWDA 1TUZA 2L2CA 2JT3A 2LHIA 2QDIA 2H61A 5KU1A 1KCYA 3WHUB 1QXPA 4INWA 2LUCA 3BUXB 1F71A 4N1GA 3OB1B 1DQEA 1E8AA 1K9KA 1PK0D 1U5IA 1YVHA 2L98A 5EL2A 1ZACA 1PSRA 3DD4A 2JWWA 4GUKA 4MBEA 1V1GA 3I5GC 1MHOA 3TDZA 1IQ3A 1K9PA 4N5XA 5I2QA 3S0BA 2LP2A 2WNDA 4ICBA 4I5JA 4OV2A 4CFQA 1B4CA 3BFBA 1SL9A 3CR5X 2AAOA 1DELA 2B1UA 1JSAA 3O4YA 3BXKA 2OS8C 1KSOA 2MRDA 2SCPA 4FQOA 2KLDA 4MRYA 4N1FA 1NCXA 5CPVA 1DEKA 2M0RA 3KF9A 1SK6D 1NPQA 1SL8A 4HREE 2FCEA 4PDZA 1XVJA 1K2HA 4PE1A 1FPWA 2JPTA 1A29A 1PVAA 2JOJA 2BECA 2K2AA 2MLEC 5HL1A 4CFRA 4MSPA 5K89A 1IKUA 4OZDA 3I5HC 1KFXL 4DUQA 1J55A 4CLNA 4YGAA 5TNCA 2YGUA 1G33A 2BKIB 1DJIA 4PHNA 2K2FA 3UO9A 1TNPA 1UP5A 3DVJA 2KYCA 2JZIA 5CSJA 3TUYC 1OE9B 1OOHA 3D78A 1RROA 5AXIA 4NDBA 1MQ1A 3B7AA 3NSOA 1RFJA 2QEOA 1DJGA 2GGMA 1ZUZA 3CZTX 1KFXS 3DY9A 2NCPA 1XFUO 1SKTA 3Q8IA 3DVMA 1C3ZA 1SRAA 4PALA 2DOQA 2JTZA 1CFPA 2I7AA 1CMGA 2K7BA 2BAPA 3EG5B 5DKQA 1F4OA 3GK4X 3QRXA 4MZLA 1NWDA 5DKNA 2K60A 3BUNB 1QWVA 4BY4A 5IBWA 4ZCUA 2LC5A 3NSKA 1KK7Z 2F3ZA 4DCKA 1CFDA 5AANA 1BODA 4ORCB 3BFHA 3EKHA 2CCMA 3C1VA 5CSNA 2LLTA 5J3XA 4I5NB 3LK1A 1IG5A 3TUYB 4AOMA 1K8UA 5I94A 2LMTA 3IVTA 4MVFA 1GGWA 1KQVA 2LV7A 2WC6A 2LM5A 1UHJA 2KPHA 2LE9B 3BJHA 3R1VA 2KI6C 3OX6A 3B88A 1UWOA 5PALA 4NQGA 1LXFC 1Y0VH 5JOLA 5BPJA 1BMOA 2KAVA 1QX5B 1NIWA 1OSAA 2PRUA 2V53A 3D76A 3S0DA 1F55A 5GQQC 1B47A 3WNXB 1KSMA 3ZWHA 4OKHA 1LS8A 3TS5C 1EH2A 3CWGA 1OOJA 1W7JB 4C0KA 3DXLA 1IH0A 2BL0B 3LCPC 3OBVA 4C0JA 1GQMA 2WC8A 4I5KA 2FJUB 4HRGA 1B8CA 3BUWB 4YGBB 1D1OA 2VRGA 4GPLB 3D77A 3KEVA 1DJZA 1LA0A 2GTEA 2PVBA 4YGEB 2ISDA 1BG1A 1FW4A 4OVNF 3K1EA 4I5LB 5HKWA 1ZOTB 3HX4A 2L5XB 3PALA 3CS1A 3D74A 3DVEA 2COLB 4GGFC 2JRFA 4A4CA 3D73A 3CLNA 2Q91A 3I5FC 1PSBA 1NP8A 3BYAA 3FE8A 3S0AA 2QEHA 2AMIA 2GV5A 1TN4A 3JTDC 2JPOA 3GOFA 3VROA 1WDCB 1UHIA 1J7RA 3CR2A 1VRKA 2EC6C 2HF5A 3CR4X 3NHTA 4WQ2A 5I8NA 1YUUA 1PULA 1S3PA 1S6JA 3RZSA 1QLSA 1AUIB 2M1UA 2M3WA 4JD9A 3TS5B 3WXAA 2P71A 5D69A 1BU3A 2M8UA 2KOTA 2F8PA 2KI4C 1N0YA 1YUTA 2LMVA 2ZRTA 4HRHA 2F3YA 1SCMC 2KSPA 4MEWA 2F33A 2QPTA 1J7OA 1IQ5A 1KFUL 4U8DA 4P2YB 1R6PA 2K8MB 3DYEA 4BY5A 4YRUA 3EK8A 2PMYA 2EGDA 5KTYA 3SS4A 3CZ2A 4L9MA 3A8RA 1QVIZ 2BKHB 1TRFA 1QVIY 3FIAA 4F0ZB 1C7WA 4CIDA 2NXQA 2PALA 1XK4C 5KSZA 3DF0B 5AEQA 1KFUS 1KQMC 4YI9A 2WCJA 4OR9B 1UHKA 2A4JA 5DKRA 1DGUA 2F2OA 1RWYA 3PJIA 2RGIA 5G08A 1G4YR 1DGVA 1RK9A 1N65A 1TWOA 4TNCA 1AJ4A 4GGNA 3FWBA 2KAYA 2O60A 1YRTB 5AERA 1UHNA 3DF0A 2KNEA 1HT9A 2LVVA 5D3OA 2KI4B 2PQLA 2M29A 1MXLC 1WLMA 3SIBA 1JC2A 4JWQA 5HYDA 1SCMB 2Y4QA 3UNWA 1OOFA 1QS7A 2KBIA 2ZNEA 3B87A 5HLVA 2WOSA 1C7VA 1MR8A 1B9AA 1YUSA 1LVCD 1AVSA 3GK2A 1QX7A 3SS5A 5B8IB 2K0JA 1WY9A 3M0WA 1BLQA 1CFCA 3R1OA 2HETA 2JTTA 3AKBA 3I5GB 4R1EA 2KFFA 1BF5A 1UHHA 1SMGA 2LP3A 3L4AA 4MZKA 3PSRA 3SG6A 1KK8C 1MUXA 4ETOA 1TCOB 1IJ5A 3AAJA 1RJVA 2JULA 2K7DA 2LVJA 3BFAA 3EVVA 3O4XA 4JQ0D 1WRZA 3RLZA 1K90D 3EK7A 1IGVA 3AKAA 2OS8B 4JPZB 2JNXA 5HKYA 1CKKA 1K94A 1MF8B 2BCXA 3TZ1A 4DIRA 1Y1XA 3KPXA 3D75A 1KWOC 1DJYA 3NXAA 2CNPA 2WCMA 1L2OC 3BQ3A 3VB1A 2L0PA 3BUOB 1YR5A 2WCHA 1QASA 1K95A 1JF2A 1QIWA 3EKJA 3FE6A 2JT0A 4M2PA 3PATA 2WORA 5FI2A 3S0EA 1H8BA 3DZTA 1OMRA 3I5HB 2NLNA 4NDCA 1UURA 2K61A 2M7NA 1OW4A 1ZMZA 1PVBA 1B7TZ 1K93D 1NYAA 1NCZA 2NZ0A 1B7TY 2M1KB 2QACA 3IQOA 5JJGA 2Y1NA 4F7FA 1WRKA 1YRUB 2ZRSA 3NSIA 4ORBB 3FE9A 4QJ3B 1KK8B 1EG4A 3BOWB 2KQYA 1M39A 3VRPA 4ZCVA 1CDMA 2ZNDA 1XFVO 2D8NA 3OP0A 2IS9A 4FQTA 1QLKA 2ERBA 3OB2B 2BCAA 3CDNA 1B8RA 1Y1UA 2KDHA 1K9UA 3NHIA 2M7LA 3V2LA 3VRNA 2CBLA 2ZKMX 1DF0B 3SG5A 2M9GA 1J7PA 1CMFA 1NSHA 1V1FA 3I5IC 4WQ3A 1XYDA 4YBHB 1L2OB 3TDIA 1OMDA 3NGVA 1BR4B 1SY9A 1SR6C 3LL8B 1NX2A 1MXEA 1DF0A 1JFJA 1OOIX 1ORGA 2KHNA 1QJTA 3SG4A 2KGRA 1RTP1 4IJ7A 2WCEA 1M63B 1YX7A 3PM2A 1Q80A 2H61C 3H4SE 2K7CA 1OOGA 2SASA 1JF0A 2TN4A 3ZNIA 4QJ5B 2I94A 2P6BB 3ICBA 1SYMA 3DVKA 3PM8A 1BR1B 5HLOA 5I2OA 4GAOA 1JFKA 1IRJA 1W7IB 3S0FA 1DMOA 1TCFA 4MRXA 2KFHA 1BT6A 3S0GA 1CTRA 1DJHA 2P70A 1CDNA 1BOCA 1K96A 3I5IB 4PHJA 1C3YA 4USLA 3GK1A 4FTGA 4GNKB 4YI8A 4AQIA 4PCWA 3O6BA 3JVTC 4NDDA 3OHMB 2BNXA 3CABA 4JKTA 2NCOA 1SR6B 1F54A 3AAKA 1IJ6A 3NSLA 4GBAA 2PASA 2LVIA 3RM1A 3CTNA 2BE4A 3FWCA 4PT1A 1W9ZA 1YURA 2KAXA 2L4HA 2OPOA 3SG7A 1NX3A 2G9BA 2Y5IA 2KFGA 1QATA 1QTXA 1LINA 3I5FB 4PE7A 2ZN9A 2KGBC 2CT9A 1U5IB 3PN7C 2EHBA 1A03A 2KBMA 1AHRA 5CSFA 2WCLA 3O2PA 2LNKA 1WLZA 3HCMA 3JTDB 1S26D 2R2IA 2MAZA 4GGFA 2EC6B 4QJ4B 5D7FA 2WC5A 3TDUA 2LMUA 1XO5A 1S6CA 1Y6WA 2KQ6A 4M2OA 1AP4A 2JNFA 4MN0A 1F8HA 1OZSA 1M31A 3O78A 2OTGC 1C07A 1OMVA 5ER4X 2BE6A 2KI6D 3JVTB 3KO0A 1SPYA 1ALWA 2BBNA 2WCKA 1JUOA 3L47A 2PSRA 1TUJA 1PALA 3MSEB 1IIOA 2AUCA 4ORAB 1FI6A 1SSEB 1AJ5A 1X02A 1YTZC 2Q4UA 2LCPA 1GJYA 3K21A 1RECA 3EVRA 1M45A 2L5YA 1XFWO 2FCDA 1EG3A 3PN7B 5HKZA 2M97A 1IWQA 1A4PA 1KQMB 2E30A 4HSZA 3SJSA 3IQQA 2PYQA 1S5GZ 1B8LA 4PHMA 1JBAA 2LLUA 1S5GY 2LLSA 1G8IA 2WCBA 5F6TA 1SCVA 2CXJA 1AK8A 2HPSA 1SBJA 5AFPA 3SIAA 4PE0A 2L4IA 2OTGB 1XK4A 1QV0A 3L4LA 4OCIA 3N7HA 3VRRA 1OZOA 3OGNA 1XFXO 1CFFA 4PE4A 2L50A 2MLFC 1OQPA 1R2UA 2JU0A 3CZ0A 2CTNA 4Q04A 1NCYA 1NX1A 2QEBA 3IF7A 4DRWA 2LHLA 2HQ8A 2L2EA 1NUBA 3CZ1A 4MZJA 1XFRA 1EXRA 4IL1A 4YGCB 1EL4A 1F70A 2Y1MA 1QX2A 1H4BA 1LKJA 2M49B 1CM1A 4A4BA 2F2PA 2BL0C 1SL7A 2MBXA 1BJFA 1CLLA 1TNXA 1M46A 2LANA 5ER5A 2HQWA 2H8VA 1P28A 3VRQA 1DVIA 1S36A 5FI6A 1TNQA 1ZFSA 1KWOB 1KK7Y 3D0YB 1N2DA 1GM0A 1T14A 3BOWA 3B86A 1SW8A 3LLEA 2ZN8A 5FI7A 2JXCA 2K7OA 1UUSA 4GFTA 2JXLA 4PHKA 4M2QA 2ZFDA 1J1EA 2I2RE 1DC1A 1Y1AA 5CSIA 4AQJA 1J1DA 4D1EA 1CDPA 2LAPA 1CLMA 3SS3A 1WRLA 4INXA 3A4UB 5I2LA 3D0YA 1HQVA 3SG3A 1A75B 1ALVA 1XFZO 4YGDB 3SG2A 1WDCC 4UPGA 2GGZA 1DJWA 1S1EA 1TNWA 3PLFB 1FF1A 2FJYA 3LK0A 1A2XA 2H2KA 3WHTB 2L51A 1DT7B 1PRWA 1XA5A 1LA3A 2BCBA 1FBVA 2MA2A 4XYNA 1A75A 1L7ZA 2LVKA 1ODBA 1QIVA 3EK4A 3R1PA 1Z2CB 4C0LA 1CDLA 2E6WA 3E3RA 4MLWA 1TTXA 1XFYO 1J7QA 4CPVA 1CB1A 2LUXA 3VGOA 1DJXA 3EVUA 3FS7A 3CGAA 3BUMB 3R72A 4E68A 2G2BA 3CYZA 1CM4A 3OX5A 1DTLA 1QV1A 2JQ6A 2JT8A 2MJWB 2QEVA 1S6IA 3D10A 3PFVA 5DICA 3QMEA 2FOTA 2O5GA 4XJKB 1SNLA 3KHEA 1TOPA 2BBMA 2JC2A 5FYXA 1CNPA 2I18A 1YX8A 4P5OE 3B6XA 1FI5A 1F4QA 4DS7A 3F45A 1CLBA 1TIZA 2MHHA 1EJ3A
chains in the Genus database with same CATH topology
3DZTA 3DXLA 1OW4A 3D77A 2GTEA 2L2CA 3K1EA 2QDIA 4F7FA 3D74A 4INWA 3FE9A 5EL2A 1DQEA 3D73A 4FQTA 2ERBA 3CDNA 3V2LA 3FE8A 3NHIA 3S0AA 2QEHA 3S0BA 2JPOA 3BFBA 3L4LA 3N7HA 3OGNA 3NHTA 3RZSA 4JD9A 3CZ0A 3NGVA 2QEBA 2P71A 3CZ1A 1OOIX 1XFRA 1ORGA 4OZDA 1OOGA 3DYEA 2H8VA 1P28A 3CZ2A 1OOHA 3D78A 1GM0A 3S0FA 1T14A 3B7AA 3B86A 2QEOA 2WCJA 3S0GA 2P70A 3DY9A 3PJIA 3Q8IA 4INXA 1TWOA 1C3ZA 3CABA 2PQLA 2FJYA 1OOFA 3B87A 4PT1A 1QWVA 3R1PA 3R1OA 3BFHA 3L4AA 2WCLA 3BFAA 3R72A 2WC5A 3CYZA 2WC6A 2KPHA 2QEVA 3BJHA 3R1VA 5DICA 1C3YA 3B88A 3QMEA 3D75A 2WCMA 3VB1A 3B6XA 2WCHA 3D76A 3S0DA 2WCKA 3FE6A 1LS8A 3L47A 1TUJA 3S0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZT A;  3DXL A;  1OW4 A;  3D77 A;  2GTE A;  2L2C A;  3K1E A;  2QDI A;  4F7F A;  3D74 A;  4INW A;  3FE9 A;  5EL2 A;  1DQE A;  3D73 A;  4FQT A;  2ERB A;  3CDN A;  3V2L A;  3FE8 A;  3NHI A;  3S0A A;  2QEH A;  3S0B A;  2JPO A;  3BFB A;  3L4L A;  3N7H A;  3OGN A;  3NHT A;  3RZS A;  4JD9 A;  3CZ0 A;  3NGV A;  2QEB A;  2P71 A;  3CZ1 A;  1OOI X;  1XFR A;  1ORG A;  4OZD A;  1OOG A;  3DYE A;  2H8V A;  1P28 A;  3CZ2 A;  1OOH A;  3D78 A;  1GM0 A;  3S0F A;  1T14 A;  3B7A A;  3B86 A;  2QEO A;  2WCJ A;  3S0G A;  2P70 A;  3DY9 A;  3PJI A;  3Q8I A;  4INX A;  1TWO A;  1C3Z A;  3CAB A;  2PQL A;  2FJY A;  1OOF A;  3B87 A;  4PT1 A;  1QWV A;  3R1P A;  3R1O A;  3BFH A;  3L4A A;  2WCL A;  3BFA A;  3R72 A;  2WC5 A;  3CYZ A;  2WC6 A;  2KPH A;  2QEV A;  3BJH A;  3R1V A;  5DIC A;  1C3Y A;  3B88 A;  3QME A;  3D75 A;  2WCM A;  3VB1 A;  3B6X A;  2WCH A;  3D76 A;  3S0D A;  2WCK A;  3FE6 A;  1LS8 A;  3L47 A;  1TUJ A;  3S0E A; 
#chains in the Genus database with same CATH topology
 1YVL A;  2WCF A;  4XJK A;  1GGZ A;  1MWN A;  1NX0 A;  4WRI A;  1Z4H A;  1B1G A;  4KYN A;  2KYF A;  2KLE A;  1JWD A;  1TUZ A;  2L2C A;  2JT3 A;  2LHI A;  2QDI A;  2H61 A;  5KU1 A;  1KCY A;  3WHU B;  1QXP A;  4INW A;  2LUC A;  3BUX B;  1F71 A;  4N1G A;  3OB1 B;  1DQE A;  1E8A A;  1K9K A;  1PK0 D;  1U5I A;  1YVH A;  2L98 A;  5EL2 A;  1ZAC A;  1PSR A;  3DD4 A;  2JWW A;  4GUK A;  4MBE A;  1V1G A;  3I5G C;  1MHO A;  3TDZ A;  1IQ3 A;  1K9P A;  4N5X A;  5I2Q A;  3S0B A;  2LP2 A;  2WND A;  4ICB A;  4I5J A;  4OV2 A;  4CFQ A;  1B4C A;  3BFB A;  1SL9 A;  3CR5 X;  2AAO A;  1DEL A;  2B1U A;  1JSA A;  3O4Y A;  3BXK A;  2OS8 C;  1KSO A;  2MRD A;  2SCP A;  4FQO A;  2KLD A;  4MRY A;  4N1F A;  1NCX A;  5CPV A;  1DEK A;  2M0R A;  3KF9 A;  1SK6 D;  1NPQ A;  1SL8 A;  4HRE E;  2FCE A;  4PDZ A;  1XVJ A;  1K2H A;  4PE1 A;  1FPW A;  2JPT A;  1A29 A;  1PVA A;  2JOJ A;  2BEC A;  2K2A A;  2MLE C;  5HL1 A;  4CFR A;  4MSP A;  5K89 A;  1IKU A;  4OZD A;  3I5H C;  1KFX L;  4DUQ A;  1J55 A;  4CLN A;  4YGA A;  5TNC A;  2YGU A;  1G33 A;  2BKI B;  1DJI A;  4PHN A;  2K2F A;  3UO9 A;  1TNP A;  1UP5 A;  3DVJ A;  2KYC A;  2JZI A;  5CSJ A;  3TUY C;  1OE9 B;  1OOH A;  3D78 A;  1RRO A;  5AXI A;  4NDB A;  1MQ1 A;  3B7A A;  3NSO A;  1RFJ A;  2QEO A;  1DJG A;  2GGM A;  1ZUZ A;  3CZT X;  1KFX S;  3DY9 A;  2NCP A;  1XFU O;  1SKT A;  3Q8I A;  3DVM A;  1C3Z A;  1SRA A;  4PAL A;  2DOQ A;  2JTZ A;  1CFP A;  2I7A A;  1CMG A;  2K7B A;  2BAP A;  3EG5 B;  5DKQ A;  1F4O A;  3GK4 X;  3QRX A;  4MZL A;  1NWD A;  5DKN A;  2K60 A;  3BUN B;  1QWV A;  4BY4 A;  5IBW A;  4ZCU A;  2LC5 A;  3NSK A;  1KK7 Z;  2F3Z A;  4DCK A;  1CFD A;  5AAN A;  1BOD A;  4ORC B;  3BFH A;  3EKH A;  2CCM A;  3C1V A;  5CSN A;  2LLT A;  5J3X A;  4I5N B;  3LK1 A;  1IG5 A;  3TUY B;  4AOM A;  1K8U A;  5I94 A;  2LMT A;  3IVT A;  4MVF A;  1GGW A;  1KQV A;  2LV7 A;  2WC6 A;  2LM5 A;  1UHJ A;  2KPH A;  2LE9 B;  3BJH A;  3R1V A;  2KI6 C;  3OX6 A;  3B88 A;  1UWO A;  5PAL A;  4NQG A;  1LXF C;  1Y0V H;  5JOL A;  5BPJ A;  1BMO A;  2KAV A;  1QX5 B;  1NIW A;  1OSA A;  2PRU A;  2V53 A;  3D76 A;  3S0D A;  1F55 A;  5GQQ C;  1B47 A;  3WNX B;  1KSM A;  3ZWH A;  4OKH A;  1LS8 A;  3TS5 C;  1EH2 A;  3CWG A;  1OOJ A;  1W7J B;  4C0K A;  3DXL A;  1IH0 A;  2BL0 B;  3LCP C;  3OBV A;  4C0J A;  1GQM A;  2WC8 A;  4I5K A;  2FJU B;  4HRG A;  1B8C A;  3BUW B;  4YGB B;  1D1O A;  2VRG A;  4GPL B;  3D77 A;  3KEV A;  1DJZ A;  1LA0 A;  2GTE A;  2PVB A;  4YGE B;  2ISD A;  1BG1 A;  1FW4 A;  4OVN F;  3K1E A;  4I5L B;  5HKW A;  1ZOT B;  3HX4 A;  2L5X B;  3PAL A;  3CS1 A;  3D74 A;  3DVE A;  2COL B;  4GGF C;  2JRF A;  4A4C A;  3D73 A;  3CLN A;  2Q91 A;  3I5F C;  1PSB A;  1NP8 A;  3BYA A;  3FE8 A;  3S0A A;  2QEH A;  2AMI A;  2GV5 A;  1TN4 A;  3JTD C;  2JPO A;  3GOF A;  3VRO A;  1WDC B;  1UHI A;  1J7R A;  3CR2 A;  1VRK A;  2EC6 C;  2HF5 A;  3CR4 X;  3NHT A;  4WQ2 A;  5I8N A;  1YUU A;  1PUL A;  1S3P A;  1S6J A;  3RZS A;  1QLS A;  1AUI B;  2M1U A;  2M3W A;  4JD9 A;  3TS5 B;  3WXA A;  2P71 A;  5D69 A;  1BU3 A;  2M8U A;  2KOT A;  2F8P A;  2KI4 C;  1N0Y A;  1YUT A;  2LMV A;  2ZRT A;  4HRH A;  2F3Y A;  1SCM C;  2KSP A;  4MEW A;  2F33 A;  2QPT A;  1J7O A;  1IQ5 A;  1KFU L;  4U8D A;  4P2Y B;  1R6P A;  2K8M B;  3DYE A;  4BY5 A;  4YRU A;  3EK8 A;  2PMY A;  2EGD A;  5KTY A;  3SS4 A;  3CZ2 A;  4L9M A;  3A8R A;  1QVI Z;  2BKH B;  1TRF A;  1QVI Y;  3FIA A;  4F0Z B;  1C7W A;  4CID A;  2NXQ A;  2PAL A;  1XK4 C;  5KSZ A;  3DF0 B;  5AEQ A;  1KFU S;  1KQM C;  4YI9 A;  2WCJ A;  4OR9 B;  1UHK A;  2A4J A;  5DKR A;  1DGU A;  2F2O A;  1RWY A;  3PJI A;  2RGI A;  5G08 A;  1G4Y R;  1DGV A;  1RK9 A;  1N65 A;  1TWO A;  4TNC A;  1AJ4 A;  4GGN A;  3FWB A;  2KAY A;  2O60 A;  1YRT B;  5AER A;  1UHN A;  3DF0 A;  2KNE A;  1HT9 A;  2LVV A;  5D3O A;  2KI4 B;  2PQL A;  2M29 A;  1MXL C;  1WLM A;  3SIB A;  1JC2 A;  4JWQ A;  5HYD A;  1SCM B;  2Y4Q A;  3UNW A;  1OOF A;  1QS7 A;  2KBI A;  2ZNE A;  3B87 A;  5HLV A;  2WOS A;  1C7V A;  1MR8 A;  1B9A A;  1YUS A;  1LVC D;  1AVS A;  3GK2 A;  1QX7 A;  3SS5 A;  5B8I B;  2K0J A;  1WY9 A;  3M0W A;  1BLQ A;  1CFC A;  3R1O A;  2HET A;  2JTT A;  3AKB A;  3I5G B;  4R1E A;  2KFF A;  1BF5 A;  1UHH A;  1SMG A;  2LP3 A;  3L4A A;  4MZK A;  3PSR A;  3SG6 A;  1KK8 C;  1MUX A;  4ETO A;  1TCO B;  1IJ5 A;  3AAJ A;  1RJV A;  2JUL A;  2K7D A;  2LVJ A;  3BFA A;  3EVV A;  3O4X A;  4JQ0 D;  1WRZ A;  3RLZ A;  1K90 D;  3EK7 A;  1IGV A;  3AKA A;  2OS8 B;  4JPZ B;  2JNX A;  5HKY A;  1CKK A;  1K94 A;  1MF8 B;  2BCX A;  3TZ1 A;  4DIR A;  1Y1X A;  3KPX A;  3D75 A;  1KWO C;  1DJY A;  3NXA A;  2CNP A;  2WCM A;  1L2O C;  3BQ3 A;  3VB1 A;  2L0P A;  3BUO B;  1YR5 A;  2WCH A;  1QAS A;  1K95 A;  1JF2 A;  1QIW A;  3EKJ A;  3FE6 A;  2JT0 A;  4M2P A;  3PAT A;  2WOR A;  5FI2 A;  3S0E A;  1H8B A;  3DZT A;  1OMR A;  3I5H B;  2NLN A;  4NDC A;  1UUR A;  2K61 A;  2M7N A;  1OW4 A;  1ZMZ A;  1PVB A;  1B7T Z;  1K93 D;  1NYA A;  1NCZ A;  2NZ0 A;  1B7T Y;  2M1K B;  2QAC A;  3IQO A;  5JJG A;  2Y1N A;  4F7F A;  1WRK A;  1YRU B;  2ZRS A;  3NSI A;  4ORB B;  3FE9 A;  4QJ3 B;  1KK8 B;  1EG4 A;  3BOW B;  2KQY A;  1M39 A;  3VRP A;  4ZCV A;  1CDM A;  2ZND A;  1XFV O;  2D8N A;  3OP0 A;  2IS9 A;  4FQT A;  1QLK A;  2ERB A;  3OB2 B;  2BCA A;  3CDN A;  1B8R A;  1Y1U A;  2KDH A;  1K9U A;  3NHI A;  2M7L A;  3V2L A;  3VRN A;  2CBL A;  2ZKM X;  1DF0 B;  3SG5 A;  2M9G A;  1J7P A;  1CMF A;  1NSH A;  1V1F A;  3I5I C;  4WQ3 A;  1XYD A;  4YBH B;  1L2O B;  3TDI A;  1OMD A;  3NGV A;  1BR4 B;  1SY9 A;  1SR6 C;  3LL8 B;  1NX2 A;  1MXE A;  1DF0 A;  1JFJ A;  1OOI X;  1ORG A;  2KHN A;  1QJT A;  3SG4 A;  2KGR A;  1RTP 1;  4IJ7 A;  2WCE A;  1M63 B;  1YX7 A;  3PM2 A;  1Q80 A;  2H61 C;  3H4S E;  2K7C A;  1OOG A;  2SAS A;  1JF0 A;  2TN4 A;  3ZNI A;  4QJ5 B;  2I94 A;  2P6B B;  3ICB A;  1SYM A;  3DVK A;  3PM8 A;  1BR1 B;  5HLO A;  5I2O A;  4GAO A;  1JFK A;  1IRJ A;  1W7I B;  3S0F A;  1DMO A;  1TCF A;  4MRX A;  2KFH A;  1BT6 A;  3S0G A;  1CTR A;  1DJH A;  2P70 A;  1CDN A;  1BOC A;  1K96 A;  3I5I B;  4PHJ A;  1C3Y A;  4USL A;  3GK1 A;  4FTG A;  4GNK B;  4YI8 A;  4AQI A;  4PCW A;  3O6B A;  3JVT C;  4NDD A;  3OHM B;  2BNX A;  3CAB A;  4JKT A;  2NCO A;  1SR6 B;  1F54 A;  3AAK A;  1IJ6 A;  3NSL A;  4GBA A;  2PAS A;  2LVI A;  3RM1 A;  3CTN A;  2BE4 A;  3FWC A;  4PT1 A;  1W9Z A;  1YUR A;  2KAX A;  2L4H A;  2OPO A;  3SG7 A;  1NX3 A;  2G9B A;  2Y5I A;  2KFG A;  1QAT A;  1QTX A;  1LIN A;  3I5F B;  4PE7 A;  2ZN9 A;  2KGB C;  2CT9 A;  1U5I B;  3PN7 C;  2EHB A;  1A03 A;  2KBM A;  1AHR A;  5CSF A;  2WCL A;  3O2P A;  2LNK A;  1WLZ A;  3HCM A;  3JTD B;  1S26 D;  2R2I A;  2MAZ A;  4GGF A;  2EC6 B;  4QJ4 B;  5D7F A;  2WC5 A;  3TDU A;  2LMU A;  1XO5 A;  1S6C A;  1Y6W A;  2KQ6 A;  4M2O A;  1AP4 A;  2JNF A;  4MN0 A;  1F8H A;  1OZS A;  1M31 A;  3O78 A;  2OTG C;  1C07 A;  1OMV A;  5ER4 X;  2BE6 A;  2KI6 D;  3JVT B;  3KO0 A;  1SPY A;  1ALW A;  2BBN A;  2WCK A;  1JUO A;  3L47 A;  2PSR A;  1TUJ A;  1PAL A;  3MSE B;  1IIO A;  2AUC A;  4ORA B;  1FI6 A;  1SSE B;  1AJ5 A;  1X02 A;  1YTZ C;  2Q4U A;  2LCP A;  1GJY A;  3K21 A;  1REC A;  3EVR A;  1M45 A;  2L5Y A;  1XFW O;  2FCD A;  1EG3 A;  3PN7 B;  5HKZ A;  2M97 A;  1IWQ A;  1A4P A;  1KQM B;  2E30 A;  4HSZ A;  3SJS A;  3IQQ A;  2PYQ A;  1S5G Z;  1B8L A;  4PHM A;  1JBA A;  2LLU A;  1S5G Y;  2LLS A;  1G8I A;  2WCB A;  5F6T A;  1SCV A;  2CXJ A;  1AK8 A;  2HPS A;  1SBJ A;  5AFP A;  3SIA A;  4PE0 A;  2L4I A;  2OTG B;  1XK4 A;  1QV0 A;  3L4L A;  4OCI A;  3N7H A;  3VRR A;  1OZO A;  3OGN A;  1XFX O;  1CFF A;  4PE4 A;  2L50 A;  2MLF C;  1OQP A;  1R2U A;  2JU0 A;  3CZ0 A;  2CTN A;  4Q04 A;  1NCY A;  1NX1 A;  2QEB A;  3IF7 A;  4DRW A;  2LHL A;  2HQ8 A;  2L2E A;  1NUB A;  3CZ1 A;  4MZJ A;  1XFR A;  1EXR A;  4IL1 A;  4YGC B;  1EL4 A;  1F70 A;  2Y1M A;  1QX2 A;  1H4B A;  1LKJ A;  2M49 B;  1CM1 A;  4A4B A;  2F2P A;  2BL0 C;  1SL7 A;  2MBX A;  1BJF A;  1CLL A;  1TNX A;  1M46 A;  2LAN A;  5ER5 A;  2HQW A;  2H8V A;  1P28 A;  3VRQ A;  1DVI A;  1S36 A;  5FI6 A;  1TNQ A;  1ZFS A;  1KWO B;  1KK7 Y;  3D0Y B;  1N2D A;  1GM0 A;  1T14 A;  3BOW A;  3B86 A;  1SW8 A;  3LLE A;  2ZN8 A;  5FI7 A;  2JXC A;  2K7O A;  1UUS A;  4GFT A;  2JXL A;  4PHK A;  4M2Q A;  2ZFD A;  1J1E A;  2I2R E;  1DC1 A;  1Y1A A;  5CSI A;  4AQJ A;  1J1D A;  4D1E A;  1CDP A;  2LAP A;  1CLM A;  3SS3 A;  1WRL A;  4INX A;  3A4U B;  5I2L A;  3D0Y A;  1HQV A;  3SG3 A;  1A75 B;  1ALV A;  1XFZ O;  4YGD B;  3SG2 A;  1WDC C;  4UPG A;  2GGZ A;  1DJW A;  1S1E A;  1TNW A;  3PLF B;  1FF1 A;  2FJY A;  3LK0 A;  1A2X A;  2H2K A;  3WHT B;  2L51 A;  1DT7 B;  1PRW A;  1XA5 A;  1LA3 A;  2BCB A;  1FBV A;  2MA2 A;  4XYN A;  1A75 A;  1L7Z A;  2LVK A;  1ODB A;  1QIV A;  3EK4 A;  3R1P A;  1Z2C B;  4C0L A;  1CDL A;  2E6W A;  3E3R A;  4MLW A;  1TTX A;  1XFY O;  1J7Q A;  4CPV A;  1CB1 A;  2LUX A;  3VGO A;  1DJX A;  3EVU A;  3FS7 A;  3CGA A;  3BUM B;  3R72 A;  4E68 A;  2G2B A;  3CYZ A;  1CM4 A;  3OX5 A;  1DTL A;  1QV1 A;  2JQ6 A;  2JT8 A;  2MJW B;  2QEV A;  1S6I A;  3D10 A;  3PFV A;  5DIC A;  3QME A;  2FOT A;  2O5G A;  4XJK B;  1SNL A;  3KHE A;  1TOP A;  2BBM A;  2JC2 A;  5FYX A;  1CNP A;  2I18 A;  1YX8 A;  4P5O E;  3B6X A;  1FI5 A;  1F4Q A;  4DS7 A;  3F45 A;  1CLB A;  1TIZ A;  2MHH A;  1EJ3 A; 
#chains in the Genus database with same CATH homology
 3DZT A;  3DXL A;  1OW4 A;  3D77 A;  2GTE A;  2L2C A;  3K1E A;  2QDI A;  4F7F A;  3D74 A;  4INW A;  3FE9 A;  5EL2 A;  1DQE A;  3D73 A;  4FQT A;  2ERB A;  3CDN A;  3V2L A;  3FE8 A;  3NHI A;  3S0A A;  2QEH A;  3S0B A;  2JPO A;  3BFB A;  3L4L A;  3N7H A;  3OGN A;  3NHT A;  3RZS A;  4JD9 A;  3CZ0 A;  3NGV A;  2QEB A;  2P71 A;  3CZ1 A;  1OOI X;  1XFR A;  1ORG A;  4OZD A;  1OOG A;  3DYE A;  2H8V A;  1P28 A;  3CZ2 A;  1OOH A;  3D78 A;  1GM0 A;  3S0F A;  1T14 A;  3B7A A;  3B86 A;  2QEO A;  2WCJ A;  3S0G A;  2P70 A;  3DY9 A;  3PJI A;  3Q8I A;  4INX A;  1TWO A;  1C3Z A;  3CAB A;  2PQL A;  2FJY A;  1OOF A;  3B87 A;  4PT1 A;  1QWV A;  3R1P A;  3R1O A;  3BFH A;  3L4A A;  2WCL A;  3BFA A;  3R72 A;  2WC5 A;  3CYZ A;  2WC6 A;  2KPH A;  2QEV A;  3BJH A;  3R1V A;  5DIC A;  1C3Y A;  3B88 A;  3QME A;  3D75 A;  2WCM A;  3VB1 A;  3B6X A;  2WCH A;  3D76 A;  3S0D A;  2WCK A;  3FE6 A;  1LS8 A;  3L47 A;  1TUJ A;  3S0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...