2FJYA

Crystal structure of b-form bombyx mori pheromone binding protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
136
structure length
136
Chain Sequence
NLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Pheromone-binding protein
publication title Coil-to-helix transition and ligand release of Bombyx mori pheromone-binding protein.
pubmed doi rcsb
source organism Bombyx mori
total genus 43
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2fjyA00
3FE9A 3B88A 2QDIA 1OOHA 2WC6A 3S0FA 2WCJA 4OZDA 3NGVA 2KPHA 1C3YA 2P71A 2WCHA 3CDNA 2L2CA 3D74A 2QEOA 5EL2A 4JD9A 2PQLA 4FQTA 4INXA 3DY9A 1TUJA 3QMEA 3CZ0A 1OOIX 1T14A 3B86A 3B87A 2H8VA 1QWVA 1DQEA 2QEVA 1C3ZA 3R1PA 3DXLA 3S0DA 3R72A 3R1VA 3L4LA 3OGNA 1OOFA 2WCMA 2WCKA 3CZ2A 2WCLA 3D75A 1OW4A 3D78A 3NHTA 3B7AA 3PJIA 3B6XA 4F7FA 3RZSA 2ERBA 1XFRA 3S0AA 3FE6A 3K1EA 3R1OA 2QEBA 2JPOA 3DYEA 3N7HA 3CYZA 3DZTA 2GTEA 3CABA 3CZ1A 1P28A 1LS8A 3D73A 3Q8IA 2QEHA 3S0BA 5DICA 3BJHA 3VB1A 3L47A 3D76A 3FE8A 3S0EA 4PT1A 2FJYA 1OOGA 1TWOA 3BFHA 3V2LA 3BFAA 2P70A 3S0GA 3NHIA 3BFBA 3D77A 2WC5A 3L4AA 1ORGA 4INWA 1GM0A
chains in the Genus database with same CATH superfamily
1M63B 2KQYA 2QDIA 5CSIA 1ZMZA 3HCMA 1B9AA 1JC2A 5DKRA 1QX2A 2M9GA 2LCPA 5K89A 2Y5IA 1IWQA 2KFFA 2M97A 1KFXS 3KPXA 5PALA 1OZSA 4OZDA 3VRPA 3FIAA 1LXFC 1KWOB 1YX7A 3I5FB 4XJKA 1QX5B 1XFUO 1JF0A 1K93D 3SS3A 4GGFA 5D3OA 2QEOA 4JD9A 2PQLA 2JULA 2WOSA 1YUTA 1OOJA 4YGEB 2M49B 1K9PA 4P2YB 4YGDB 4DS7A 1DGUA 1SR6C 4WRIA 3PN7B 4GBAA 2KI6C 2LVKA 5FI7A 1RTP1 1NUBA 1WRLA 1DJZA 3TDIA 2Y4QA 2OS8B 3LK1A 4DUQA 1BT6A 1DJWA 3VRNA 5AFPA 1CB1A 2L51A 1YRUB 1ALVA 3B87A 3A4UB 1VRKA 1AUIB 2M29A 3LK0A 5KTYA 2HF5A 1RJVA 4C0KA 2BBMA 4KYNA 1DQEA 1A4PA 1B7TY 3JTDC 3RLZA 4Q04A 3DXLA 1LINA 1YX8A 1Y1AA 4MZJA 3CGAA 2WC8A 4PE7A 3S0DA 4AOMA 3R72A 4DIRA 1S6CA 2KYFA 1S26D 1BF5A 4FQOA 2MAZA 2H61C 1A75A 1TNQA 2G2BA 1S6IA 1Z4HA 3WNXB 2I94A 2KOTA 2WCMA 5BPJA 2K7DA 4JWQA 1YUUA 2M0RA 1MF8B 4MSPA 1W7JB 1B47A 3OX6A 1J7PA 2LLTA 4MZLA 1SMGA 1WDCB 2K2AA 2L98A 1L2OC 3CR5X 5GQQC 4F7FA 1NCYA 1SSEB 1F54A 2ERBA 1KFUS 2BL0B 3OX5A 1SK6D 4IJ7A 5TNCA 3OBVA 3R1OA 1SYMA 3I5IB 1YVHA 1Y1UA 2QEBA 1R6PA 1JFKA 2MJWB 2KI4C 1KK8B 3N7HA 3CYZA 2Q4UA 4P5OE 1J1EA 1SL7A 3EK7A 1C3YA 2OTGB 3DVKA 2D8NA 1AK8A 2K7CA 1KSOA 2CTNA 3BYAA 4MRXA 1DF0A 2K61A 2LV7A 3BQ3A 1H4BA 3WHUB 1MR8A 1RROA 2KFGA 3EVVA 4PCWA 3JVTB 2F3YA 1IJ6A 2F8PA 1K9UA 1GGZA 2LHLA 3D76A 3FE8A 3S0EA 4MVFA 3SIAA 2BE6A 2YGUA 2E6WA 3EG5B 1WLMA 1K90D 1ODBA 3BFHA 2LVVA 3VROA 4YRUA 1HT9A 2KQ6A 2K2FA 5CSJA 2JT0A 2WC5A 4JKTA 2K7BA 2LAPA 4JPZB 2WCEA 2M7NA 3CZTX 2BKIB 1JBAA 1KK7Z 1K94A 3B88A 1AP4A 3SG3A 1S5GY 1MXLC 2IS9A 4YGBB 3TS5B 2LP2A 1K96A 1S3PA 1XFWO 1OOHA 2K60A 2BCXA 2JNXA 2VRGA 5HKWA 1NCZA 3S0FA 2WCJA 2PASA 1CDNA 4MEWA 3NGVA 2KPHA 5B8IB 2P71A 2WCHA 3PM2A 2L2CA 3I5HC 3SG5A 2SCPA 3NSLA 1QTXA 1F4QA 2L50A 5EL2A 5AEQA 5CPVA 1F70A 2KBIA 4PHJA 1QLSA 4FQTA 4INXA 3I5IC 1IQ5A 1A75B 1SCVA 2LNKA 1OZOA 3DVMA 1TOPA 3DY9A 1XK4A 1BG1A 1TUJA 3NXAA 1CFCA 1UWOA 1BR4B 1B8LA 2P6BB 3CZ0A 3EKJA 2PALA 2ISDA 5KSZA 1J7OA 4MZKA 1XYDA 2BNXA 1SKTA 1N2DA 4OCIA 1BU3A 1PVAA 2BCBA 2LVIA 4GGFC 2JZIA 1T14A 3VRQA 3RM1A 1B1GA 2JQ6A 3JVTC 1DT7B 1A03A 2Y1MA 3TUYB 2GV5A 3B86A 1OE9B 2LE9B 3F45A 4YI9A 2H8VA 3VRRA 2KDHA 1NX3A 2O5GA 2AUCA 4I5KA 2COLB 2RGIA 1G33A 1EJ3A 2ZRSA 3KF9A 1Y1XA 1TNXA 1XO5A 1DF0B 1RK9A 2A4JA 1TUZA 5FI6A 3I5GB 3L4LA 1SBJA 4NDDA 5G08A 2R2IA 1K95A 4WQ2A 4YI8A 1NWDA 1NX0A 2G9BA 1UUSA 2V53A 3OGNA 1CM1A 1DJIA 3GK2A 1NCXA 1CFFA 1XA5A 2JTTA 1E8AA 1PSRA 3D75A 3PALA 1V1FA 2WNDA 3CR2A 4M2QA 1B7TZ 1QASA 2ZRTA 3SIBA 3BUXB 1WLZA 2LMTA 1W9ZA 3BOWB 3B7AA 1WY9A 1CFDA 3NSIA 2MLFC 3IQOA 4YBHB 2BAPA 1TIZA 3RZSA 2KGRA 1QXPA 1XFZO 3FE6A 3K1EA 3S0AA 1H8BA 3DVEA 2MA2A 1TTXA 1OQPA 1IRJA 1SRAA 4FTGA 2B1UA 5FI2A 1XFVO 4U8DA 1NYAA 2GTEA 2JC2A 1NPQA 3DZTA 3O2PA 1FI5A 3CZ1A 3M0WA 1DTLA 1LS8A 2KGBC 1FBVA 3KO0A 3Q8IA 1CLBA 3WXAA 5I2QA 1NX1A 3IVTA 3O6BA 4PE0A 5D7FA 4N1FA 5I94A 3LCPC 1EH2A 1PK0D 2JTZA 3BJHA 4NDBA 3VB1A 3L47A 3VGOA 1KWOC 3I5FC 1HQVA 2MBXA 3AKAA 3TUYC 1CMFA 1CDPA 1TNPA 1X02A 1B8RA 3EK4A 3OP0A 5DKQA 1CFPA 3OHMB 2EC6B 4C0LA 1CDMA 4OV2A 1QX7A 3S0GA 2HETA 4JQ0D 1LVCD 2KLDA 1TCFA 3BFBA 2CCMA 2L4IA 5J3XA 3QRXA 2WCBA 4ZCUA 4WQ3A 1SNLA 4NQGA 4INWA 4MBEA 3SJSA 3SS4A 1XFYO 3TDUA 1S6JA 1U5IA 2L5XB 4E68A 5ER5A 3PN7C 4IL1A 2NZ0A 4MLWA 4QJ3B 1XFXO 1KQMB 2WC6A 5KU1A 1IKUA 1QLKA 1J7QA 2KAYA 1CTRA 2OS8C 1WRZA 2ZNDA 1QV0A 4QJ5B 1DJGA 1TN4A 4I5LB 1SY9A 1MQ1A 2F3ZA 3TZ1A 2LLSA 1QJTA 1LA3A 1MWNA 2HQ8A 1JF2A 1YURA 2ZKMX 2O60A 3EK8A 1A2XA 1GJYA 1BJFA 2BECA 5JOLA 1CNPA 1S5GZ 1QV1A 2KHNA 2LC5A 4R1EA 2I7AA 4CFQA 1W7IB 1JSAA 3BOWA 5HL1A 2H2KA 1C7VA 1DEKA 2LANA 2JWWA 2KLEA 2PYQA 5CSFA 2LMVA 3DF0B 4I5NB 3SG6A 4CFRA 1BMOA 5FYXA 5D69A 3ZWHA 1G4YR 1A29A 3PM8A 1K2HA 1MUXA 1UHHA 3PSRA 1PSBA 4MRYA 2ZN8A 1F8HA 1CDLA 1F4OA 1RECA 3BXKA 4YGCB 1B4CA 2LUCA 3PFVA 1UHJA 4PALA 2BKHB 5F6TA 5I8NA 3CS1A 4GUKA 1XK4C 1UHIA 3EVUA 1WDCC 2EC6C 2QEVA 1DMOA 1S36A 3R1PA 2BL0C 3GK4X 4PHNA 3FWCA 2JT8A 3UNWA 1SR6B 4BY4A 1KK8C 2FCEA 3R1VA 2CNPA 4TNCA 5AERA 4OVNF 4PE4A 1CMGA 2OTGC 1YVLA 2F33A 1C7WA 1YR5A 1OOFA 1DJHA 3BUWB 2WCKA 3CZ2A 1NX2A 1KQMC 1Y0VH 1V1GA 1QIVA 2BCAA 2K8MB 3SG7A 1DC1A 1OMVA 2WORA 5I2LA 1F55A 1OW4A 4DCKA 3FS7A 2KYCA 1AJ4A 2NXQA 3NHTA 2ZN9A 1UHKA 2KSPA 2FJUB 1CLMA 3IF7A 4ETOA 3JTDB 1QVIY 2Q91A 2JU0A 1J55A 1Z2CB 1IQ3A 3BUMB 2LUXA 1CKKA 1OMRA 1U5IB 4I5JA 2PVBA 4HSZA 1DJXA 2LP3A 3MSEB 4ORBB 1D1OA 3CABA 2QPTA 4HREE 1GGWA 3D73A 1ZFSA 1OSAA 1PALA 1Q80A 1SL9A 1PULA 5DICA 3TS5C 1CLLA 2HQWA 1TCOB 1J1DA 1SCMB 1K8UA 2NLNA 3DF0A 5JJGA 2KAXA 2E30A 2OPOA 4L9MA 4HRHA 4PT1A 1L2OB 1FI6A 1OOGA 1TWOA 2FOTA 2KAVA 1DJYA 3BFAA 2EGDA 2P70A 4GGNA 3NHIA 3O4XA 4GFTA 4NDCA 5ER4X 2JRFA 2JNFA 2CT9A 2KI4B 4AQJA 4C0JA 5HYDA 1CM4A 1BLQA 2LLUA 2LMUA 2NCPA 2BBNA 1XVJA 1GM0A 3FE9A 3HX4A 1Y6WA 3O4YA 4GPLB 4DRWA 4YGAA 1J7RA 1RFJA 1NSHA 1UP5A 2PSRA 3EVRA 5DKNA 4CIDA 4N5XA 3AKBA 2LVJA 5HLVA 2M8UA 4ORCB 2L4HA 2JPTA 3GOFA 1YRTB 2I2RE 1IJ5A 5AANA 1EXRA 1G8IA 3SG2A 1BODA 3CDNA 3D74A 1LKJA 1IH0A 1IIOA 1NP8A 2KBMA 4UPGA 4OR9B 2BE4A 3AAJA 1MXEA 2FCDA 1TRFA 1ZACA 4D1EA 5IBWA 1JFJA 3C1VA 1EL4A 1KFUL 3ICBA 1OMDA 1SPYA 2PMYA 3TDZA 3QMEA 2DOQA 2JXCA 3D0YB 1QATA 3PLFB 1PRWA 4PHMA 1M31A 3I5GC 1YTZC 1PVBA 2JOJA 3KHEA 1UHNA 3OB2B 2GGZA 4ORAB 4AQIA 3CLNA 2F2OA 4PDZA 1KQVA 1OOIX 1SCMC 4A4CA 2K0JA 2CBLA 2H61A 4A4BA 1IG5A 1KCYA 5HKYA 3I5HB 4PE1A 3UO9A 2K7OA 2SASA 2NCOA 4CLNA 1YUSA 2M3WA 1NIWA 1JWDA 1M39A 2TN4A 3EKHA 1UURA 5HKZA 1QWVA 1BR1B 1FW4A 1GQMA 3NSKA 1C3ZA 1M46A 4OKHA 3GK1A 4M2OA 1IGVA 2MRDA 3CWGA 2JXLA 2ZFDA 1KSMA 3A8RA 2F2PA 2JT3A 1WRKA 2GGMA 3CR4X 2KFHA 1EG4A 3BUOB 3O78A 1C07A 2QACA 1FPWA 1R2UA 2M1KB 3BUNB 2MHHA 5CSNA 2M7LA 2AMIA 4USLA 4XJKB 2KNEA 2Y1NA 4ZCVA 5HLOA 3WHTB 1ZUZA 3SS5A 1TNWA 5I2OA 2M1UA 2HPSA 3NSOA 2WCLA 1QIWA 2I18A 2L2EA 4BY5A 2LHIA 1SL8A 3D78A 3PATA 3PJIA 4GAOA 4GNKB 3B6XA 4F0ZB 3ZNIA 2WCFA 1EG3A 2PRUA 1XFRA 2EHBA 2LM5A 3IQQA 3DVJA 4CPVA 3SG4A 3OB1B 4QJ4B 1K9KA 1AHRA 1N0YA 2JPOA 3DYEA 2ZNEA 3D10A 1P28A 1F71A 3S0BA 2QEHA 2AAOA 1QS7A 3CTNA 1N65A 4N1GA 2CXJA 3H4SE 1KK7Y 1RWYA 3AAKA 4PHKA 3D0YA 4HRGA 4M2PA 1S1EA 1L7ZA 1MHOA 1LA0A 1QVIZ 4ICBA 2KI6D 2L0PA 3FWBA 3K21A 1AJ5A 1KFXL 1ALWA 1BOCA 2FJYA 3LL8B 1DVIA 1FF1A 1B8CA 3V2LA 2MLEC 4MN0A 3DD4A 1DELA 5AXIA 3LLEA 1JUOA 3E3RA 3KEVA 4XYNA 3D77A 3L4AA 2L5YA 1DGVA 1SW8A 1M45A 1ORGA 1ZOTB 1AVSA
chains in the Genus database with same CATH topology
3FE9A 3B88A 2QDIA 1OOHA 2WC6A 3S0FA 2WCJA 4OZDA 3NGVA 2KPHA 1C3YA 2P71A 2WCHA 3CDNA 2L2CA 3D74A 2QEOA 5EL2A 4JD9A 2PQLA 4FQTA 4INXA 3DY9A 1TUJA 3QMEA 3CZ0A 1OOIX 1T14A 3B86A 3B87A 2H8VA 1QWVA 1DQEA 2QEVA 1C3ZA 3R1PA 3DXLA 3S0DA 3R72A 3R1VA 3L4LA 3OGNA 1OOFA 2WCMA 2WCKA 3CZ2A 2WCLA 3D75A 1OW4A 3D78A 3NHTA 3B7AA 3PJIA 3B6XA 4F7FA 3RZSA 2ERBA 1XFRA 3S0AA 3FE6A 3K1EA 3R1OA 2QEBA 2JPOA 3DYEA 3N7HA 3CYZA 3DZTA 2GTEA 3CABA 3CZ1A 1P28A 1LS8A 3D73A 3Q8IA 2QEHA 3S0BA 5DICA 3BJHA 3VB1A 3L47A 3D76A 3FE8A 3S0EA 4PT1A 2FJYA 1OOGA 1TWOA 3BFHA 3V2LA 3BFAA 2P70A 3S0GA 3NHIA 3BFBA 3D77A 2WC5A 3L4AA 1ORGA 4INWA 1GM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE9 A;  3B88 A;  2QDI A;  1OOH A;  2WC6 A;  3S0F A;  2WCJ A;  4OZD A;  3NGV A;  2KPH A;  1C3Y A;  2P71 A;  2WCH A;  3CDN A;  2L2C A;  3D74 A;  2QEO A;  5EL2 A;  4JD9 A;  2PQL A;  4FQT A;  4INX A;  3DY9 A;  1TUJ A;  3QME A;  3CZ0 A;  1OOI X;  1T14 A;  3B86 A;  3B87 A;  2H8V A;  1QWV A;  1DQE A;  2QEV A;  1C3Z A;  3R1P A;  3DXL A;  3S0D A;  3R72 A;  3R1V A;  3L4L A;  3OGN A;  1OOF A;  2WCM A;  2WCK A;  3CZ2 A;  2WCL A;  3D75 A;  1OW4 A;  3D78 A;  3NHT A;  3B7A A;  3PJI A;  3B6X A;  4F7F A;  3RZS A;  2ERB A;  1XFR A;  3S0A A;  3FE6 A;  3K1E A;  3R1O A;  2QEB A;  2JPO A;  3DYE A;  3N7H A;  3CYZ A;  3DZT A;  2GTE A;  3CAB A;  3CZ1 A;  1P28 A;  1LS8 A;  3D73 A;  3Q8I A;  2QEH A;  3S0B A;  5DIC A;  3BJH A;  3VB1 A;  3L47 A;  3D76 A;  3FE8 A;  3S0E A;  4PT1 A;  2FJY A;  1OOG A;  1TWO A;  3BFH A;  3V2L A;  3BFA A;  2P70 A;  3S0G A;  3NHI A;  3BFB A;  3D77 A;  2WC5 A;  3L4A A;  1ORG A;  4INW A;  1GM0 A; 
#chains in the Genus database with same CATH topology
 1M63 B;  2KQY A;  2QDI A;  5CSI A;  1ZMZ A;  3HCM A;  1B9A A;  1JC2 A;  5DKR A;  1QX2 A;  2M9G A;  2LCP A;  5K89 A;  2Y5I A;  1IWQ A;  2KFF A;  2M97 A;  1KFX S;  3KPX A;  5PAL A;  1OZS A;  4OZD A;  3VRP A;  3FIA A;  1LXF C;  1KWO B;  1YX7 A;  3I5F B;  4XJK A;  1QX5 B;  1XFU O;  1JF0 A;  1K93 D;  3SS3 A;  4GGF A;  5D3O A;  2QEO A;  4JD9 A;  2PQL A;  2JUL A;  2WOS A;  1YUT A;  1OOJ A;  4YGE B;  2M49 B;  1K9P A;  4P2Y B;  4YGD B;  4DS7 A;  1DGU A;  1SR6 C;  4WRI A;  3PN7 B;  4GBA A;  2KI6 C;  2LVK A;  5FI7 A;  1RTP 1;  1NUB A;  1WRL A;  1DJZ A;  3TDI A;  2Y4Q A;  2OS8 B;  3LK1 A;  4DUQ A;  1BT6 A;  1DJW A;  3VRN A;  5AFP A;  1CB1 A;  2L51 A;  1YRU B;  1ALV A;  3B87 A;  3A4U B;  1VRK A;  1AUI B;  2M29 A;  3LK0 A;  5KTY A;  2HF5 A;  1RJV A;  4C0K A;  2BBM A;  4KYN A;  1DQE A;  1A4P A;  1B7T Y;  3JTD C;  3RLZ A;  4Q04 A;  3DXL A;  1LIN A;  1YX8 A;  1Y1A A;  4MZJ A;  3CGA A;  2WC8 A;  4PE7 A;  3S0D A;  4AOM A;  3R72 A;  4DIR A;  1S6C A;  2KYF A;  1S26 D;  1BF5 A;  4FQO A;  2MAZ A;  2H61 C;  1A75 A;  1TNQ A;  2G2B A;  1S6I A;  1Z4H A;  3WNX B;  2I94 A;  2KOT A;  2WCM A;  5BPJ A;  2K7D A;  4JWQ A;  1YUU A;  2M0R A;  1MF8 B;  4MSP A;  1W7J B;  1B47 A;  3OX6 A;  1J7P A;  2LLT A;  4MZL A;  1SMG A;  1WDC B;  2K2A A;  2L98 A;  1L2O C;  3CR5 X;  5GQQ C;  4F7F A;  1NCY A;  1SSE B;  1F54 A;  2ERB A;  1KFU S;  2BL0 B;  3OX5 A;  1SK6 D;  4IJ7 A;  5TNC A;  3OBV A;  3R1O A;  1SYM A;  3I5I B;  1YVH A;  1Y1U A;  2QEB A;  1R6P A;  1JFK A;  2MJW B;  2KI4 C;  1KK8 B;  3N7H A;  3CYZ A;  2Q4U A;  4P5O E;  1J1E A;  1SL7 A;  3EK7 A;  1C3Y A;  2OTG B;  3DVK A;  2D8N A;  1AK8 A;  2K7C A;  1KSO A;  2CTN A;  3BYA A;  4MRX A;  1DF0 A;  2K61 A;  2LV7 A;  3BQ3 A;  1H4B A;  3WHU B;  1MR8 A;  1RRO A;  2KFG A;  3EVV A;  4PCW A;  3JVT B;  2F3Y A;  1IJ6 A;  2F8P A;  1K9U A;  1GGZ A;  2LHL A;  3D76 A;  3FE8 A;  3S0E A;  4MVF A;  3SIA A;  2BE6 A;  2YGU A;  2E6W A;  3EG5 B;  1WLM A;  1K90 D;  1ODB A;  3BFH A;  2LVV A;  3VRO A;  4YRU A;  1HT9 A;  2KQ6 A;  2K2F A;  5CSJ A;  2JT0 A;  2WC5 A;  4JKT A;  2K7B A;  2LAP A;  4JPZ B;  2WCE A;  2M7N A;  3CZT X;  2BKI B;  1JBA A;  1KK7 Z;  1K94 A;  3B88 A;  1AP4 A;  3SG3 A;  1S5G Y;  1MXL C;  2IS9 A;  4YGB B;  3TS5 B;  2LP2 A;  1K96 A;  1S3P A;  1XFW O;  1OOH A;  2K60 A;  2BCX A;  2JNX A;  2VRG A;  5HKW A;  1NCZ A;  3S0F A;  2WCJ A;  2PAS A;  1CDN A;  4MEW A;  3NGV A;  2KPH A;  5B8I B;  2P71 A;  2WCH A;  3PM2 A;  2L2C A;  3I5H C;  3SG5 A;  2SCP A;  3NSL A;  1QTX A;  1F4Q A;  2L50 A;  5EL2 A;  5AEQ A;  5CPV A;  1F70 A;  2KBI A;  4PHJ A;  1QLS A;  4FQT A;  4INX A;  3I5I C;  1IQ5 A;  1A75 B;  1SCV A;  2LNK A;  1OZO A;  3DVM A;  1TOP A;  3DY9 A;  1XK4 A;  1BG1 A;  1TUJ A;  3NXA A;  1CFC A;  1UWO A;  1BR4 B;  1B8L A;  2P6B B;  3CZ0 A;  3EKJ A;  2PAL A;  2ISD A;  5KSZ A;  1J7O A;  4MZK A;  1XYD A;  2BNX A;  1SKT A;  1N2D A;  4OCI A;  1BU3 A;  1PVA A;  2BCB A;  2LVI A;  4GGF C;  2JZI A;  1T14 A;  3VRQ A;  3RM1 A;  1B1G A;  2JQ6 A;  3JVT C;  1DT7 B;  1A03 A;  2Y1M A;  3TUY B;  2GV5 A;  3B86 A;  1OE9 B;  2LE9 B;  3F45 A;  4YI9 A;  2H8V A;  3VRR A;  2KDH A;  1NX3 A;  2O5G A;  2AUC A;  4I5K A;  2COL B;  2RGI A;  1G33 A;  1EJ3 A;  2ZRS A;  3KF9 A;  1Y1X A;  1TNX A;  1XO5 A;  1DF0 B;  1RK9 A;  2A4J A;  1TUZ A;  5FI6 A;  3I5G B;  3L4L A;  1SBJ A;  4NDD A;  5G08 A;  2R2I A;  1K95 A;  4WQ2 A;  4YI8 A;  1NWD A;  1NX0 A;  2G9B A;  1UUS A;  2V53 A;  3OGN A;  1CM1 A;  1DJI A;  3GK2 A;  1NCX A;  1CFF A;  1XA5 A;  2JTT A;  1E8A A;  1PSR A;  3D75 A;  3PAL A;  1V1F A;  2WND A;  3CR2 A;  4M2Q A;  1B7T Z;  1QAS A;  2ZRT A;  3SIB A;  3BUX B;  1WLZ A;  2LMT A;  1W9Z A;  3BOW B;  3B7A A;  1WY9 A;  1CFD A;  3NSI A;  2MLF C;  3IQO A;  4YBH B;  2BAP A;  1TIZ A;  3RZS A;  2KGR A;  1QXP A;  1XFZ O;  3FE6 A;  3K1E A;  3S0A A;  1H8B A;  3DVE A;  2MA2 A;  1TTX A;  1OQP A;  1IRJ A;  1SRA A;  4FTG A;  2B1U A;  5FI2 A;  1XFV O;  4U8D A;  1NYA A;  2GTE A;  2JC2 A;  1NPQ A;  3DZT A;  3O2P A;  1FI5 A;  3CZ1 A;  3M0W A;  1DTL A;  1LS8 A;  2KGB C;  1FBV A;  3KO0 A;  3Q8I A;  1CLB A;  3WXA A;  5I2Q A;  1NX1 A;  3IVT A;  3O6B A;  4PE0 A;  5D7F A;  4N1F A;  5I94 A;  3LCP C;  1EH2 A;  1PK0 D;  2JTZ A;  3BJH A;  4NDB A;  3VB1 A;  3L47 A;  3VGO A;  1KWO C;  3I5F C;  1HQV A;  2MBX A;  3AKA A;  3TUY C;  1CMF A;  1CDP A;  1TNP A;  1X02 A;  1B8R A;  3EK4 A;  3OP0 A;  5DKQ A;  1CFP A;  3OHM B;  2EC6 B;  4C0L A;  1CDM A;  4OV2 A;  1QX7 A;  3S0G A;  2HET A;  4JQ0 D;  1LVC D;  2KLD A;  1TCF A;  3BFB A;  2CCM A;  2L4I A;  5J3X A;  3QRX A;  2WCB A;  4ZCU A;  4WQ3 A;  1SNL A;  4NQG A;  4INW A;  4MBE A;  3SJS A;  3SS4 A;  1XFY O;  3TDU A;  1S6J A;  1U5I A;  2L5X B;  4E68 A;  5ER5 A;  3PN7 C;  4IL1 A;  2NZ0 A;  4MLW A;  4QJ3 B;  1XFX O;  1KQM B;  2WC6 A;  5KU1 A;  1IKU A;  1QLK A;  1J7Q A;  2KAY A;  1CTR A;  2OS8 C;  1WRZ A;  2ZND A;  1QV0 A;  4QJ5 B;  1DJG A;  1TN4 A;  4I5L B;  1SY9 A;  1MQ1 A;  2F3Z A;  3TZ1 A;  2LLS A;  1QJT A;  1LA3 A;  1MWN A;  2HQ8 A;  1JF2 A;  1YUR A;  2ZKM X;  2O60 A;  3EK8 A;  1A2X A;  1GJY A;  1BJF A;  2BEC A;  5JOL A;  1CNP A;  1S5G Z;  1QV1 A;  2KHN A;  2LC5 A;  4R1E A;  2I7A A;  4CFQ A;  1W7I B;  1JSA A;  3BOW A;  5HL1 A;  2H2K A;  1C7V A;  1DEK A;  2LAN A;  2JWW A;  2KLE A;  2PYQ A;  5CSF A;  2LMV A;  3DF0 B;  4I5N B;  3SG6 A;  4CFR A;  1BMO A;  5FYX A;  5D69 A;  3ZWH A;  1G4Y R;  1A29 A;  3PM8 A;  1K2H A;  1MUX A;  1UHH A;  3PSR A;  1PSB A;  4MRY A;  2ZN8 A;  1F8H A;  1CDL A;  1F4O A;  1REC A;  3BXK A;  4YGC B;  1B4C A;  2LUC A;  3PFV A;  1UHJ A;  4PAL A;  2BKH B;  5F6T A;  5I8N A;  3CS1 A;  4GUK A;  1XK4 C;  1UHI A;  3EVU A;  1WDC C;  2EC6 C;  2QEV A;  1DMO A;  1S36 A;  3R1P A;  2BL0 C;  3GK4 X;  4PHN A;  3FWC A;  2JT8 A;  3UNW A;  1SR6 B;  4BY4 A;  1KK8 C;  2FCE A;  3R1V A;  2CNP A;  4TNC A;  5AER A;  4OVN F;  4PE4 A;  1CMG A;  2OTG C;  1YVL A;  2F33 A;  1C7W A;  1YR5 A;  1OOF A;  1DJH A;  3BUW B;  2WCK A;  3CZ2 A;  1NX2 A;  1KQM C;  1Y0V H;  1V1G A;  1QIV A;  2BCA A;  2K8M B;  3SG7 A;  1DC1 A;  1OMV A;  2WOR A;  5I2L A;  1F55 A;  1OW4 A;  4DCK A;  3FS7 A;  2KYC A;  1AJ4 A;  2NXQ A;  3NHT A;  2ZN9 A;  1UHK A;  2KSP A;  2FJU B;  1CLM A;  3IF7 A;  4ETO A;  3JTD B;  1QVI Y;  2Q91 A;  2JU0 A;  1J55 A;  1Z2C B;  1IQ3 A;  3BUM B;  2LUX A;  1CKK A;  1OMR A;  1U5I B;  4I5J A;  2PVB A;  4HSZ A;  1DJX A;  2LP3 A;  3MSE B;  4ORB B;  1D1O A;  3CAB A;  2QPT A;  4HRE E;  1GGW A;  3D73 A;  1ZFS A;  1OSA A;  1PAL A;  1Q80 A;  1SL9 A;  1PUL A;  5DIC A;  3TS5 C;  1CLL A;  2HQW A;  1TCO B;  1J1D A;  1SCM B;  1K8U A;  2NLN A;  3DF0 A;  5JJG A;  2KAX A;  2E30 A;  2OPO A;  4L9M A;  4HRH A;  4PT1 A;  1L2O B;  1FI6 A;  1OOG A;  1TWO A;  2FOT A;  2KAV A;  1DJY A;  3BFA A;  2EGD A;  2P70 A;  4GGN A;  3NHI A;  3O4X A;  4GFT A;  4NDC A;  5ER4 X;  2JRF A;  2JNF A;  2CT9 A;  2KI4 B;  4AQJ A;  4C0J A;  5HYD A;  1CM4 A;  1BLQ A;  2LLU A;  2LMU A;  2NCP A;  2BBN A;  1XVJ A;  1GM0 A;  3FE9 A;  3HX4 A;  1Y6W A;  3O4Y A;  4GPL B;  4DRW A;  4YGA A;  1J7R A;  1RFJ A;  1NSH A;  1UP5 A;  2PSR A;  3EVR A;  5DKN A;  4CID A;  4N5X A;  3AKB A;  2LVJ A;  5HLV A;  2M8U A;  4ORC B;  2L4H A;  2JPT A;  3GOF A;  1YRT B;  2I2R E;  1IJ5 A;  5AAN A;  1EXR A;  1G8I A;  3SG2 A;  1BOD A;  3CDN A;  3D74 A;  1LKJ A;  1IH0 A;  1IIO A;  1NP8 A;  2KBM A;  4UPG A;  4OR9 B;  2BE4 A;  3AAJ A;  1MXE A;  2FCD A;  1TRF A;  1ZAC A;  4D1E A;  5IBW A;  1JFJ A;  3C1V A;  1EL4 A;  1KFU L;  3ICB A;  1OMD A;  1SPY A;  2PMY A;  3TDZ A;  3QME A;  2DOQ A;  2JXC A;  3D0Y B;  1QAT A;  3PLF B;  1PRW A;  4PHM A;  1M31 A;  3I5G C;  1YTZ C;  1PVB A;  2JOJ A;  3KHE A;  1UHN A;  3OB2 B;  2GGZ A;  4ORA B;  4AQI A;  3CLN A;  2F2O A;  4PDZ A;  1KQV A;  1OOI X;  1SCM C;  4A4C A;  2K0J A;  2CBL A;  2H61 A;  4A4B A;  1IG5 A;  1KCY A;  5HKY A;  3I5H B;  4PE1 A;  3UO9 A;  2K7O A;  2SAS A;  2NCO A;  4CLN A;  1YUS A;  2M3W A;  1NIW A;  1JWD A;  1M39 A;  2TN4 A;  3EKH A;  1UUR A;  5HKZ A;  1QWV A;  1BR1 B;  1FW4 A;  1GQM A;  3NSK A;  1C3Z A;  1M46 A;  4OKH A;  3GK1 A;  4M2O A;  1IGV A;  2MRD A;  3CWG A;  2JXL A;  2ZFD A;  1KSM A;  3A8R A;  2F2P A;  2JT3 A;  1WRK A;  2GGM A;  3CR4 X;  2KFH A;  1EG4 A;  3BUO B;  3O78 A;  1C07 A;  2QAC A;  1FPW A;  1R2U A;  2M1K B;  3BUN B;  2MHH A;  5CSN A;  2M7L A;  2AMI A;  4USL A;  4XJK B;  2KNE A;  2Y1N A;  4ZCV A;  5HLO A;  3WHT B;  1ZUZ A;  3SS5 A;  1TNW A;  5I2O A;  2M1U A;  2HPS A;  3NSO A;  2WCL A;  1QIW A;  2I18 A;  2L2E A;  4BY5 A;  2LHI A;  1SL8 A;  3D78 A;  3PAT A;  3PJI A;  4GAO A;  4GNK B;  3B6X A;  4F0Z B;  3ZNI A;  2WCF A;  1EG3 A;  2PRU A;  1XFR A;  2EHB A;  2LM5 A;  3IQQ A;  3DVJ A;  4CPV A;  3SG4 A;  3OB1 B;  4QJ4 B;  1K9K A;  1AHR A;  1N0Y A;  2JPO A;  3DYE A;  2ZNE A;  3D10 A;  1P28 A;  1F71 A;  3S0B A;  2QEH A;  2AAO A;  1QS7 A;  3CTN A;  1N65 A;  4N1G A;  2CXJ A;  3H4S E;  1KK7 Y;  1RWY A;  3AAK A;  4PHK A;  3D0Y A;  4HRG A;  4M2P A;  1S1E A;  1L7Z A;  1MHO A;  1LA0 A;  1QVI Z;  4ICB A;  2KI6 D;  2L0P A;  3FWB A;  3K21 A;  1AJ5 A;  1KFX L;  1ALW A;  1BOC A;  2FJY A;  3LL8 B;  1DVI A;  1FF1 A;  1B8C A;  3V2L A;  2MLE C;  4MN0 A;  3DD4 A;  1DEL A;  5AXI A;  3LLE A;  1JUO A;  3E3R A;  3KEV A;  4XYN A;  3D77 A;  3L4A A;  2L5Y A;  1DGV A;  1SW8 A;  1M45 A;  1ORG A;  1ZOT B;  1AVS A; 
#chains in the Genus database with same CATH homology
 3FE9 A;  3B88 A;  2QDI A;  1OOH A;  2WC6 A;  3S0F A;  2WCJ A;  4OZD A;  3NGV A;  2KPH A;  1C3Y A;  2P71 A;  2WCH A;  3CDN A;  2L2C A;  3D74 A;  2QEO A;  5EL2 A;  4JD9 A;  2PQL A;  4FQT A;  4INX A;  3DY9 A;  1TUJ A;  3QME A;  3CZ0 A;  1OOI X;  1T14 A;  3B86 A;  3B87 A;  2H8V A;  1QWV A;  1DQE A;  2QEV A;  1C3Z A;  3R1P A;  3DXL A;  3S0D A;  3R72 A;  3R1V A;  3L4L A;  3OGN A;  1OOF A;  2WCM A;  2WCK A;  3CZ2 A;  2WCL A;  3D75 A;  1OW4 A;  3D78 A;  3NHT A;  3B7A A;  3PJI A;  3B6X A;  4F7F A;  3RZS A;  2ERB A;  1XFR A;  3S0A A;  3FE6 A;  3K1E A;  3R1O A;  2QEB A;  2JPO A;  3DYE A;  3N7H A;  3CYZ A;  3DZT A;  2GTE A;  3CAB A;  3CZ1 A;  1P28 A;  1LS8 A;  3D73 A;  3Q8I A;  2QEH A;  3S0B A;  5DIC A;  3BJH A;  3VB1 A;  3L47 A;  3D76 A;  3FE8 A;  3S0E A;  4PT1 A;  2FJY A;  1OOG A;  1TWO A;  3BFH A;  3V2L A;  3BFA A;  2P70 A;  3S0G A;  3NHI A;  3BFB A;  3D77 A;  2WC5 A;  3L4A A;  1ORG A;  4INW A;  1GM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...