1YRTB

Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Layse, toxin
molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yrtB00
5FYXA 3LK0A 1KQMC 1F70A 1CNPA 1N2DA 1S6IA 2KYCA 2MBXA 3I5HB 2PVBA 1TNPA 3D10A 3EVUA 3SG2A 1X02A 2JT0A 1QLKA 1DJWA 1ZUZA 2LE9B 1J7PA 1JSAA 4ZCUA 2E30A 2WOSA 1XYDA 2KSPA 1BF5A 1XFYO 1OZOA 4I5LB 3KO0A 2F2OA 1ZMZA 4PDZA 4P5OE 3D0YB 2I7AA 3A4UB 1J7QA 2L5XB 4A4CA 1JBAA 1C7WA 1K9PA 4DUQA 2AMIA 1NP8A 1SR6B 3SJSA 5CSJA 3FS7A 1Y6WA 2ZKMX 2BL0C 4XJKB 1KWOB 3A8RA 3TDUA 1Q80A 2KAXA 4YI9A 2JTTA 4NDCA 3PM8A 2KQYA 4CIDA 2BCBA 3LCPC 1IJ6A 2PMYA 2WCEA 2ZN8A 1DJXA 3BUOB 5AFPA 2HQWA 3I5GB 3OB2B 1M46A 5K89A 1TCFA 1B47A 2K7DA 2KBIA 2F3ZA 1AP4A 5GQQC 1NUBA 3WHUB 1CKKA 3NSOA 1CLBA 1MXLC 2NCPA 1LA3A 1QV1A 1ZFSA 1XK4C 3AAJA 4I5JA 1SPYA 2H61A 2PRUA 1QVIY 1AJ4A 2CBLA 1FI6A 5HLVA 1NX3A 2M0RA 2KI6C 3I5FC 2BBMA 3LLEA 3EK4A 1JF2A 5DKRA 2LVVA 1S36A 1NWDA 1QASA 2L0PA 4I5KA 1CDLA 2JQ6A 4HREE 2JT8A 1TIZA 2L51A 5HKWA 1RK9A 3IF7A 1PSRA 4PHMA 1QV0A 2HETA 1KFUS 1CDPA 2JWWA 1DJHA 2K8MB 4E68A 3WHTB 4AQJA 1W7JB 5HLOA 5B8IB 4OKHA 1SK6D 2KFHA 2QPTA 3O2PA 1GGZA 2DOQA 1CFFA 1YRUB 3TZ1A 2LMUA 1YURA 1L7ZA 4GGFC 1PVBA 4ORBB 1QS7A 1LKJA 3C1VA 5ER4X 4XYNA 1S3PA 2JRFA 2ZNEA 3AKBA 1PRWA 4A4BA 1SY9A 3OHMB 3ZWHA 1H8BA 1F4QA 3PALA 1M63B 2HF5A 3DVMA 1EG3A 3I5IC 4GGNA 1RJVA 4WQ3A 2K7BA 1XFZO 1D1OA 1NCXA 5HKZA 1FBVA 3FWBA 3VROA 2ZRTA 2JNXA 3CTNA 1TNXA 4MRXA 5G08A 2V53A 4JWQA 4MBEA 2FCDA 2M1KB 4F0ZB 1DF0B 1KFUL 1NCYA 1MWNA 2LP2A 3RLZA 2AUCA 1IQ5A 1OMDA 3TUYC 2P6BB 2CT9A 4FQOA 1IKUA 1JFKA 1U5IA 1TRFA 4ICBA 1WDCB 2O5GA 1HQVA 1KK7Y 1KSOA 1SCVA 1ZACA 4MZJA 4PCWA 1NYAA 4DRWA 1NX2A 4MN0A 2Y4QA 2I94A 2JXLA 3EVRA 1TNQA 1A03A 1F71A 2LHLA 4MZLA 3OB1B 1PVAA 1DJYA 1K90D 1B8LA 1CFDA 2NLNA 3PN7B 1OOJA 1YRTB 3RM1A 1KK8C 1MR8A 4DS7A 2MRDA 2OTGB 2BKIB 5IBWA 2K2FA 1JWDA 2F8PA 1CTRA 1UHNA 1UWOA 2ZRSA 4OVNF 4PE7A 2LNKA 4PE1A 3BUWB 2HPSA 4JPZB 4QJ5B 2G2BA 1UP5A 2LP3A 4ORCB 1IQ3A 2LVKA 1NCZA 1EXRA 1LA0A 1DT7B 4NQGA 2G9BA 1WLMA 1OZSA 4DIRA 2ZNDA 1TTXA 1ALWA 1R6PA 1TNWA 2ZN9A 3CGAA 2KAVA 4C0LA 4QJ3B 1BR1B 1XO5A 3M0WA 2K7OA 2KAYA 3EKJA 4TNCA 3H4SE 1Y0VH 2COLB 2F3YA 1RECA 2ISDA 1WRKA 3JVTB 1KSMA 1HT9A 1OE9B 2H2KA 1CMFA 1KCYA 2FCEA 1K9UA 1UHKA 3DD4A 2E6WA 4M2OA 1B4CA 1EJ3A 1QTXA 2I2RE 2JTZA 3VRNA 1K94A 1L2OC 1SBJA 2WCBA 3CR5X 2L98A 2MLFC 3GK4X 1W7IB 4PALA 1SL7A 2SASA 1PULA 1YUTA 4YGBB 2OS8B 2M7LA 1JC2A 1F8HA 2M8UA 1A75B 3BXKA 2LMVA 1G8IA 3CZTX 1UURA 1KFXS 2NCOA 3TDZA 4CPVA 1U5IB 1CDMA 3F45A 3KEVA 3VGOA 4GFTA 4WQ2A 1XK4A 1BG1A 1S5GY 1XFUO 3EKHA 4FTGA 2L4IA 3TS5B 1GJYA 1CFCA 2NZ0A 3BUMB 1TN4A 3GK1A 1DMOA 5AXIA 2BKHB 1SKTA 2QACA 1SCMB 4BY4A 1G4YR 1LVCD 4OV2A 1CLLA 3SG3A 2WCFA 1XVJA 1EH2A 1SW8A 1KK7Z 1TOPA 1YTZC 3O4YA 1WLZA 1KQMB 2GGZA 3DF0A 5KSZA 2M3WA 2RGIA 5AEQA 1C7VA 2KOTA 3FWCA 1V1FA 1BLQA 1SMGA 3IQOA 3BOWA 1K9KA 1EL4A 4Q04A 1CDNA 1B8RA 4PHJA 2K0JA 3LK1A 1KFXL 1JF0A 3AKAA 1C07A 3I5HC 1QIWA 1CM1A 1J1EA 2BE4A 4GPLB 2F33A 2BE6A 3BYAA 1AHRA 1YR5A 1A2XA 4YBHB 4GGFA 4AQIA 3AAKA 1K96A 3VRRA 1K8UA 1SL8A 2PASA 5DKNA 1NSHA 3MSEB 4CFRA 1OSAA 4BY5A 2LC5A 1AUIB 2F2PA 2LUXA 2M7NA 4PHNA 1QIVA 3PLFB 2MLEC 2BL0B 2Y1NA 4GNKB 4L9MA 4YRUA 1K95A 2KGBC 3KPXA 4JQ0D 2CXJA 2LVIA 4U8DA 2K7CA 1SR6C 1BOCA 1B7TY 2M9GA 1Y1AA 2JT3A 1BMOA 2KDHA 1KWOC 1RTP1 5PALA 1VRKA 2JC2A 1YUUA 2KNEA 2LMTA 2ZFDA 4AOMA 1KQVA 1AK8A 1B1GA 2KI4C 4CLNA 2M49B 5D7FA 5I2LA 4CFQA 1FI5A 3SIBA 1BODA 5F6TA 3CLNA 1SL9A 3I5GC 1NPQA 4C0JA 4NDBA 2LM5A 3HX4A 1J7RA 1WRZA 1H4BA 4ZCVA 3SG7A 1DJIA 1J1DA 5HKYA 2HQ8A 4OR9B 2GGMA 3TDIA 1XFVO 2LHIA 2CCMA 3O6BA 1DGUA 3I5FB 1IGVA 5AERA 1S1EA 1XFWO 2D8NA 2LANA 1Y1UA 1QLSA 1N65A 1BJFA 1K93D 1QX2A 1QVIZ 4N5XA 1M31A 3DF0B 1S5GZ 1DGVA 1F4OA 1MUXA 2WC8A 2VRGA 1S26D 4HRGA 5J3XA 3VRQA 4N1FA 1AJ5A 3JTDC 4PHKA 3SG5A 3BOWB 4YGDB 2EC6C 1FPWA 4PE4A 3GOFA 5ER5A 3WXAA 1SRAA 3NXAA 4M2QA 1J7OA 2EGDA 4I5NB 1IWQA 3IQQA 5BPJA 3SG4A 5KTYA 1DJGA 1YUSA 4NDDA 3OX5A 2CNPA 5I2QA 1ALVA 2KFFA 4WRIA 4GUKA 4YGCB 1Y1XA 4MSPA 2JXCA 4N1GA 4ORAB 1F55A 4MEWA 4P2YB 4QJ4B 3I5IB 2MJWB 3NSIA 2PALA 3SG6A 3O78A 1MQ1A 2LAPA 3K21A 2WNDA 1CMGA 1UUSA 2O60A 2Q91A 5D69A 3DVKA 3NSLA 1K2HA 3EK7A 2KHNA 4YGEB 4IL1A 3NSKA 2KFGA 1NX1A 2MA2A 1NIWA 4YI8A 1BT6A 2CTNA 3GK2A 3SIAA 1GQMA 2MHHA 3TUYB 2GV5A 2KI4B 3EK8A 1B7TZ 5KU1A 1WY9A 1RWYA 2BCAA 2K2AA 1DF0A 2BCXA 1LXFC 1YX7A 1LINA 1DTLA 2B1UA 1XFXO 2NXQA 3CS1A 5DKQA 2LLUA 3ZNIA 1WDCC 1ZOTB 2LLSA 3VRPA 3DVJA 4C0KA 1XA5A 2LVJA 1IH0A 1QX5B 1UHJA 2M1UA 3QRXA 1KK8B 1M45A 5CSNA 2H61C 1CFPA 1QJTA 1S6CA 5JOLA 2LV7A 5CSFA 2KI6D 3PN7C 2JOJA 2TN4A 1CB1A 1A29A 1ODBA 4YGAA 2JZIA 1IRJA 2OTGC 2PSRA 1YVLA 5CSIA 1QX7A 3JTDB 1BU3A 1YX8A 2EC6B 1SNLA 4MVFA 5JJGA 3BQ3A 3OP0A 3CR2A 5HYDA 2L50A 3LL8B 4USLA 3KF9A 5I2OA 1DJZA 1JFJA 2M29A 2BECA 3FIAA 3KHEA 1B9AA 3DVEA 2LUCA 3PATA 2MAZA 1CM4A 3D0YA 1OMVA 2BBNA 1MHOA 1GGWA 1IG5A 1PALA 1S6JA 1TCOB 2KQ6A 3BUNB 3EVVA 1EG4A 3JVTC 1E8AA 4DCKA 4XJKA 1L2OB 2JULA 3PSRA 1RFJA 1IJ5A 1DVIA 1MXEA 1PSBA 1V1GA 2OPOA 4MRYA 1YVHA 4GAOA 1N0YA 2IS9A 2KBMA 1A4PA 3PFVA 5AANA 1F54A 1B8CA 2Q4UA 3BUXB 1J55A 2KGRA 4PE0A 4OCIA 1FF1A 2KYFA 1OMRA 2SCPA 3CWGA 2L4HA 2LCPA 2Y1MA 5I8NA 1FW4A 2OS8C 4MLWA 1BR4B 2R2IA 1PK0D 1OQPA 2AAOA 2I18A 2L2EA 1QXPA 4HSZA 1AVSA 5TNCA 4MZKA 4ETOA 1A75A 1SYMA 2A4JA 1MF8B 3HCMA 4UPGA 4HRHA 1RROA 2K61A 1CLMA 2FOTA 3CR4X 1UHHA 2JU0A 1M39A 2JPTA 2WORA 1UHIA 1WRLA 5CPVA 1QATA 3TS5C 2Y5IA 4M2PA 1G33A 4GBAA 3E3RA 3OX6A 2JNFA 2FJUB 3WNXB 1NX0A 1SCMC 2EHBA 4D1EA 2LLTA 2M97A 1JUOA 3ICBA 1R2UA 4R1EA
chains in the Genus database with same CATH superfamily
5FYXA 3LK0A 1KQMC 1F70A 1CNPA 1N2DA 1S6IA 2KYCA 2MBXA 3I5HB 2PVBA 1TNPA 3D10A 3EVUA 3SG2A 1X02A 2JT0A 3L47A 1QLKA 1DJWA 1ZUZA 2LE9B 5FI7A 1J7PA 1JSAA 4ZCUA 2E30A 2WOSA 1XYDA 2KSPA 1BF5A 3CABA 1XFYO 1OZOA 4I5LB 3KO0A 2F2OA 1ZMZA 2WCLA 4PDZA 4P5OE 3D0YB 2WC6A 2I7AA 3A4UB 1J7QA 2L5XB 4A4CA 1JBAA 1C7WA 3B86A 1K9PA 4DUQA 2AMIA 1NP8A 1SR6B 2WCHA 5CSJA 3FS7A 3SJSA 3D76A 1Y6WA 2ZKMX 2BL0C 4XJKB 1KWOB 3A8RA 3TDUA 3SS5A 1Q80A 2KAXA 3R72A 4YI9A 2JTTA 4NDCA 3PM8A 2KQYA 4CIDA 2BCBA 3LCPC 1IJ6A 2PMYA 2WCEA 2ZN8A 1DJXA 3BFBA 3BUOB 5AFPA 2HQWA 3I5GB 3OB2B 1M46A 4INWA 3VB1A 5K89A 1TCFA 3QMEA 1B47A 2K7DA 2KBIA 2F3ZA 1AP4A 3UNWA 5GQQC 1NUBA 3WHUB 1CKKA 3NSOA 1CLBA 1MXLC 2NCPA 1LA3A 1QV1A 3B7AA 1ZFSA 1XK4C 3AAJA 4I5JA 2YGUA 1SPYA 1OW4A 2H61A 2PRUA 1QVIY 1AJ4A 2CBLA 1FI6A 5HLVA 1NX3A 2M0RA 2KI6C 1DEKA 3I5FC 1W9ZA 2BBMA 3LLEA 3EK4A 1JF2A 1Z2CB 5DKRA 2LVVA 1S36A 1NWDA 1QASA 2L0PA 3DY9A 1CDLA 4I5KA 4OZDA 2JQ6A 4HREE 2JT8A 4PT1A 2WCMA 3D75A 1TIZA 2L51A 5HKWA 1RK9A 3IF7A 1PSRA 4PHMA 1QV0A 2HETA 1KFUS 1CDPA 2JWWA 1DJHA 2K8MB 4E68A 5FI2A 3WHTB 4AQJA 1W7JB 5HLOA 3CZ2A 5B8IB 4OKHA 1SK6D 2KFHA 3B6XA 3RZSA 2QPTA 3O2PA 1GGZA 2DOQA 1CFFA 1YRUB 3TZ1A 2LMUA 1YURA 1L7ZA 3PM2A 1PVBA 4GGFC 1QS7A 4ORBB 1LKJA 3C1VA 5ER4X 4XYNA 1S3PA 2JRFA 2ZNEA 3AKBA 3PJIA 1PRWA 4A4BA 1SY9A 3OHMB 3ZWHA 1GM0A 1F4QA 3PALA 1M63B 2HF5A 3DVMA 3SS4A 1EG3A 2KPHA 3FE9A 1RJVA 3I5IC 4GGNA 4WQ3A 2K7BA 5I94A 1XFZO 1D1OA 1NCXA 5HKZA 1FBVA 3FWBA 3VROA 2ZRTA 2JNXA 3CTNA 1TNXA 4MRXA 5G08A 4INXA 2V53A 3DXLA 4JWQA 4MBEA 1TUZA 1T14A 2FCDA 2M1KB 1H8BA 4F0ZB 1DF0B 1KFUL 1NCYA 1MWNA 2LP2A 3RLZA 2AUCA 1IQ5A 1OMDA 3TUYC 2BAPA 1TWOA 2P6BB 2CT9A 4FQOA 1IKUA 1JFKA 1U5IA 1TRFA 4ICBA 1WDCB 2O5GA 1HQVA 1KK7Y 1KSOA 1SCVA 1ZACA 2WCJA 4MZJA 1NYAA 4PCWA 5D3OA 1NX2A 4MN0A 4DRWA 2Y4QA 2I94A 2JXLA 3NGVA 3EVRA 1TNQA 3S0AA 3L4LA 1A03A 1F71A 2LHLA 4MZLA 3OB1B 1PVAA 4JD9A 1DJYA 1K90D 1B8LA 1CFDA 2NLNA 3PN7B 5DICA 1OOJA 1YRTB 3RM1A 1KK8C 1MR8A 3EG5B 4DS7A 2MRDA 2OTGB 2BKIB 5IBWA 2K2FA 1OOFA 1JWDA 2F8PA 1CTRA 1UHNA 1UWOA 2ZRSA 4OVNF 4PE7A 2LNKA 4PE1A 3BUWB 2HPSA 4JPZB 4QJ5B 2G2BA 1UP5A 2LP3A 4ORCB 1P28A 1IQ3A 2LVKA 1NCZA 1EXRA 1LA0A 1DT7B 2FJYA 4NQGA 2G9BA 1WLMA 1OZSA 4DIRA 2ZNDA 1TTXA 3OBVA 1ALWA 1ORGA 1R6PA 1TNWA 2ZN9A 3CGAA 3CZ1A 2KAVA 4C0LA 4QJ3B 1BR1B 1XO5A 3M0WA 2K7OA 2KAYA 3EKJA 4TNCA 3H4SE 4FQTA 1Y0VH 2COLB 2F3YA 1RECA 2ISDA 1WRKA 1OOGA 3JVTB 1KSMA 1Z4HA 1HT9A 1OE9B 2H2KA 1CMFA 1KCYA 2FCEA 1K9UA 1UHKA 3DD4A 2E6WA 4M2OA 1B4CA 1EJ3A 1QTXA 1C3YA 2I2RE 2JTZA 3VRNA 1K94A 1L2OC 1SBJA 2WCBA 3CR5X 2L98A 2MLFC 3GK4X 3R1PA 1W7IB 4PALA 1SL7A 3S0FA 2SASA 1PULA 4JKTA 1YUTA 4YGBB 2OS8B 2M7LA 1JC2A 1F8HA 2M8UA 1A75B 3BXKA 2LMVA 3DYEA 3V2LA 1G8IA 3CZTX 1UURA 4IJ7A 1KFXS 2NCOA 3TDZA 4CPVA 1U5IB 1CDMA 3F45A 3KEVA 3VGOA 4GFTA 4WQ2A 1XK4A 1BG1A 1S5GY 1XFUO 3EKHA 4FTGA 3BFAA 2L4IA 3TS5B 1GJYA 1CFCA 2NZ0A 3BUMB 1TN4A 3GK1A 1DMOA 5AXIA 2GTEA 2BKHB 1SKTA 2QACA 1SCMB 4BY4A 1G4YR 1LVCD 4OV2A 1CLLA 3SG3A 3B87A 2WCFA 1XVJA 1EH2A 1SW8A 1KK7Z 1TOPA 1YTZC 1TUJA 1WLZA 1KQMB 2GGZA 3DF0A 3O4YA 5KSZA 5FI6A 2M3WA 2RGIA 3NHTA 5AEQA 1C7VA 2KOTA 2P71A 3FWCA 1V1FA 1BLQA 1SMGA 3IQOA 3BOWA 1K9KA 1EL4A 3Q8IA 4Q04A 1CDNA 1B8RA 4PHJA 2K0JA 3D77A 3LK1A 1KFXL 1QWVA 1JF0A 3AKAA 1C07A 3I5HC 1QIWA 2WC5A 1CM1A 1J1EA 2BE4A 4GPLB 2F33A 2BE6A 3BYAA 1AHRA 1YR5A 1A2XA 4YBHB 4GGFA 4AQIA 3AAKA 3D78A 1K96A 3VRRA 1K8UA 1SL8A 2PASA 5DKNA 1NSHA 3MSEB 4CFRA 1OSAA 4BY5A 2LC5A 1AUIB 2F2PA 2H8VA 2LUXA 2M7NA 4PHNA 1QIVA 3PLFB 2MLEC 2BL0B 2Y1NA 4GNKB 4L9MA 4YRUA 1K95A 2KGBC 3D74A 3KPXA 4JQ0D 2CXJA 3R1OA 2LVIA 4U8DA 2K7CA 1SR6C 1BOCA 1B7TY 2M9GA 1Y1AA 2JT3A 1BMOA 2KDHA 1KWOC 1RTP1 5PALA 1VRKA 2JC2A 1YUUA 2KNEA 2LMTA 2ZFDA 3L4AA 4AOMA 1KQVA 1AK8A 1B1GA 2KI4C 4CLNA 2M49B 1C3ZA 5D7FA 5I2LA 1DQEA 4CFQA 1FI5A 2P70A 2QEBA 2QDIA 3SIBA 1BODA 5F6TA 1LS8A 3CLNA 1SL9A 3CYZA 3I5GC 1NPQA 4C0JA 2L2CA 2LM5A 3HX4A 4NDBA 1J7RA 1WRZA 3CDNA 4ZCVA 3S0EA 1H4BA 3SG7A 1DJIA 1J1DA 5HKYA 1OOIX 2HQ8A 4OR9B 2GGMA 3TDIA 3K1EA 4F7FA 1XFVO 2LHIA 2CCMA 3O6BA 1DGUA 3I5FB 1IGVA 5AERA 3CZ0A 1S1EA 1XFWO 2D8NA 2LANA 1Y1UA 1QLSA 1N65A 1BJFA 1K93D 1QX2A 1QVIZ 4N5XA 1M31A 3DF0B 1S5GZ 1DGVA 1F4OA 3R1VA 1MUXA 2WC8A 2VRGA 1S26D 2BNXA 4HRGA 3UO9A 5J3XA 3VRQA 4N1FA 1AJ5A 3BFHA 3JTDC 4PHKA 3SS3A 3SG5A 3BOWB 4YGDB 2EC6C 2WCKA 1FPWA 4PE4A 3GOFA 5ER5A 3WXAA 1SRAA 3NXAA 4M2QA 1J7OA 2EGDA 4I5NB 1IWQA 3IQQA 3S0GA 5BPJA 3SG4A 5KTYA 1DJGA 1YUSA 4NDDA 3OX5A 2CNPA 5I2QA 1ALVA 2KFFA 4WRIA 4GUKA 4YGCB 1Y1XA 4MSPA 1SSEB 2JXCA 4N1GA 4ORAB 1F55A 4MEWA 4P2YB 2L5YA 4QJ4B 3I5IB 2MJWB 3NSIA 3S0DA 2PALA 2PQLA 2QEHA 3SG6A 3O78A 1MQ1A 2LAPA 3K21A 2WNDA 1CMGA 1UUSA 2O60A 2Q91A 5D69A 3DVKA 3S0BA 3NSLA 1K2HA 3EK7A 2KHNA 4YGEB 4IL1A 3NSKA 2KFGA 1NX1A 2MA2A 3FE6A 1NIWA 4YI8A 1BT6A 2CTNA 3GK2A 3SIAA 1GQMA 2MHHA 3TUYB 2GV5A 2KI4B 3EK8A 5HL1A 1B7TZ 5KU1A 1WY9A 1RWYA 2BCAA 2K2AA 3DZTA 1DF0A 2BCXA 1LXFC 2KLDA 1YX7A 1LINA 1DTLA 2B1UA 1XFXO 2NXQA 3CS1A 5DKQA 2LLUA 3IVTA 1WDCC 3ZNIA 1ZOTB 2LLSA 4KYNA 3VRPA 3DVJA 4C0KA 1XA5A 2LVJA 1IH0A 1QX5B 1UHJA 2M1UA 3QRXA 1KK8B 1M45A 5CSNA 2H61C 1CFPA 1QJTA 3D73A 1S6CA 5JOLA 2LV7A 2PYQA 5CSFA 2ERBA 2KI6D 3PN7C 2JOJA 2TN4A 3N7HA 1CB1A 1A29A 1ODBA 4YGAA 3FE8A 2JZIA 1IRJA 2OTGC 1DC1A 2PSRA 1YVLA 5CSIA 1QX7A 3JTDB 1BU3A 3NHIA 1YX8A 2EC6B 1SNLA 4MVFA 5JJGA 3BQ3A 3OP0A 3CR2A 5HYDA 2L50A 3LL8B 4USLA 3KF9A 5I2OA 1DJZA 1JFJA 2M29A 2BECA 3FIAA 3KHEA 1B9AA 3DVEA 2LUCA 3PATA 2MAZA 2QEOA 1IIOA 1CM4A 1OOHA 1OMVA 2BBNA 3D0YA 1MHOA 1GGWA 1IG5A 1PALA 1S6JA 1TCOB 1XFRA 2KQ6A 3BUNB 3EVVA 1EG4A 3O4XA 3JVTC 1E8AA 4DCKA 4XJKA 1L2OB 2JULA 3PSRA 1RFJA 2JPOA 1IJ5A 1DVIA 1MXEA 1PSBA 1V1GA 2OPOA 4MRYA 1YVHA 4GAOA 1N0YA 2IS9A 2KBMA 1A4PA 2KLEA 3PFVA 5AANA 1B8CA 2Q4UA 3BUXB 1F54A 1J55A 2KGRA 4PE0A 4OCIA 1FF1A 2KYFA 1OMRA 3OGNA 2SCPA 3CWGA 2L4HA 2LCPA 2Y1MA 5I8NA 1FW4A 2OS8C 4MLWA 3B88A 1BR4B 2R2IA 1PK0D 1OQPA 2AAOA 2I18A 2L2EA 1QXPA 4HSZA 2QEVA 1AVSA 5TNCA 4MZKA 4ETOA 1A75A 1SYMA 2A4JA 1MF8B 3HCMA 4UPGA 4HRHA 1RROA 2K61A 1CLMA 2FOTA 3CR4X 1UHHA 5EL2A 2JU0A 1M39A 2JPTA 2WORA 1UHIA 1WRLA 5CPVA 1QATA 3TS5C 2Y5IA 3BJHA 4M2PA 1G33A 4GBAA 1DELA 3E3RA 3OX6A 2JNFA 2FJUB 2K60A 1NX0A 1SCMC 2EHBA 3WNXB 2LLTA 2M97A 4D1EA 1JUOA 3ICBA 1R2UA 4R1EA
chains in the Genus database with same CATH topology
5FYXA 3LK0A 1KQMC 1F70A 1CNPA 1N2DA 1S6IA 2KYCA 2MBXA 3I5HB 2PVBA 1TNPA 3D10A 3EVUA 3SG2A 1X02A 2JT0A 1QLKA 1DJWA 1ZUZA 2LE9B 1J7PA 1JSAA 4ZCUA 2E30A 2WOSA 1XYDA 2KSPA 1BF5A 1XFYO 1OZOA 4I5LB 3KO0A 2F2OA 1ZMZA 4PDZA 4P5OE 3D0YB 2I7AA 3A4UB 1J7QA 2L5XB 4A4CA 1JBAA 1C7WA 1K9PA 4DUQA 2AMIA 1NP8A 1SR6B 3SJSA 5CSJA 3FS7A 1Y6WA 2ZKMX 2BL0C 4XJKB 1KWOB 3A8RA 3TDUA 1Q80A 2KAXA 4YI9A 2JTTA 4NDCA 3PM8A 2KQYA 4CIDA 2BCBA 3LCPC 1IJ6A 2PMYA 2WCEA 2ZN8A 1DJXA 3BUOB 5AFPA 2HQWA 3I5GB 3OB2B 1M46A 5K89A 1TCFA 1B47A 2K7DA 2KBIA 2F3ZA 1AP4A 5GQQC 1NUBA 3WHUB 1CKKA 3NSOA 1CLBA 1MXLC 2NCPA 1LA3A 1QV1A 1ZFSA 1XK4C 3AAJA 4I5JA 1SPYA 2H61A 2PRUA 1QVIY 1AJ4A 2CBLA 1FI6A 5HLVA 1NX3A 2M0RA 2KI6C 3I5FC 2BBMA 3LLEA 3EK4A 1JF2A 5DKRA 2LVVA 1S36A 1NWDA 1QASA 2L0PA 4I5KA 1CDLA 2JQ6A 4HREE 2JT8A 1TIZA 2L51A 5HKWA 1RK9A 3IF7A 1PSRA 4PHMA 1QV0A 2HETA 1KFUS 1CDPA 2JWWA 1DJHA 2K8MB 4E68A 3WHTB 4AQJA 1W7JB 5HLOA 5B8IB 4OKHA 1SK6D 2KFHA 2QPTA 3O2PA 1GGZA 2DOQA 1CFFA 1YRUB 3TZ1A 2LMUA 1YURA 1L7ZA 4GGFC 1PVBA 4ORBB 1QS7A 1LKJA 3C1VA 5ER4X 4XYNA 1S3PA 2JRFA 2ZNEA 3AKBA 1PRWA 4A4BA 1SY9A 3OHMB 3ZWHA 1H8BA 1F4QA 3PALA 1M63B 2HF5A 3DVMA 1EG3A 3I5IC 4GGNA 1RJVA 4WQ3A 2K7BA 1XFZO 1D1OA 1NCXA 5HKZA 1FBVA 3FWBA 3VROA 2ZRTA 2JNXA 3CTNA 1TNXA 4MRXA 5G08A 2V53A 4JWQA 4MBEA 2FCDA 2M1KB 4F0ZB 1DF0B 1KFUL 1NCYA 1MWNA 2LP2A 3RLZA 2AUCA 1IQ5A 1OMDA 3TUYC 2P6BB 2CT9A 4FQOA 1IKUA 1JFKA 1U5IA 1TRFA 4ICBA 1WDCB 2O5GA 1HQVA 1KK7Y 1KSOA 1SCVA 1ZACA 4MZJA 4PCWA 1NYAA 4DRWA 1NX2A 4MN0A 2Y4QA 2I94A 2JXLA 3EVRA 1TNQA 1A03A 1F71A 2LHLA 4MZLA 3OB1B 1PVAA 1DJYA 1K90D 1B8LA 1CFDA 2NLNA 3PN7B 1OOJA 1YRTB 3RM1A 1KK8C 1MR8A 4DS7A 2MRDA 2OTGB 2BKIB 5IBWA 2K2FA 1JWDA 2F8PA 1CTRA 1UHNA 1UWOA 2ZRSA 4OVNF 4PE7A 2LNKA 4PE1A 3BUWB 2HPSA 4JPZB 4QJ5B 2G2BA 1UP5A 2LP3A 4ORCB 1IQ3A 2LVKA 1NCZA 1EXRA 1LA0A 1DT7B 4NQGA 2G9BA 1WLMA 1OZSA 4DIRA 2ZNDA 1TTXA 1ALWA 1R6PA 1TNWA 2ZN9A 3CGAA 2KAVA 4C0LA 4QJ3B 1BR1B 1XO5A 3M0WA 2K7OA 2KAYA 3EKJA 4TNCA 3H4SE 1Y0VH 2COLB 2F3YA 1RECA 2ISDA 1WRKA 3JVTB 1KSMA 1HT9A 1OE9B 2H2KA 1CMFA 1KCYA 2FCEA 1K9UA 1UHKA 3DD4A 2E6WA 4M2OA 1B4CA 1EJ3A 1QTXA 2I2RE 2JTZA 3VRNA 1K94A 1L2OC 1SBJA 2WCBA 3CR5X 2L98A 2MLFC 3GK4X 1W7IB 4PALA 1SL7A 2SASA 1PULA 1YUTA 4YGBB 2OS8B 2M7LA 1JC2A 1F8HA 2M8UA 1A75B 3BXKA 2LMVA 1G8IA 3CZTX 1UURA 1KFXS 2NCOA 3TDZA 4CPVA 1U5IB 1CDMA 3F45A 3KEVA 3VGOA 4GFTA 4WQ2A 1XK4A 1BG1A 1S5GY 1XFUO 3EKHA 4FTGA 2L4IA 3TS5B 1GJYA 1CFCA 2NZ0A 3BUMB 1TN4A 3GK1A 1DMOA 5AXIA 2BKHB 1SKTA 2QACA 1SCMB 4BY4A 1G4YR 1LVCD 4OV2A 1CLLA 3SG3A 2WCFA 1XVJA 1EH2A 1SW8A 1KK7Z 1TOPA 1YTZC 3O4YA 1WLZA 1KQMB 2GGZA 3DF0A 5KSZA 2M3WA 2RGIA 5AEQA 1C7VA 2KOTA 3FWCA 1V1FA 1BLQA 1SMGA 3IQOA 3BOWA 1K9KA 1EL4A 4Q04A 1CDNA 1B8RA 4PHJA 2K0JA 3LK1A 1KFXL 1JF0A 3AKAA 1C07A 3I5HC 1QIWA 1CM1A 1J1EA 2BE4A 4GPLB 2F33A 2BE6A 3BYAA 1AHRA 1YR5A 1A2XA 4YBHB 4GGFA 4AQIA 3AAKA 1K96A 3VRRA 1K8UA 1SL8A 2PASA 5DKNA 1NSHA 3MSEB 4CFRA 1OSAA 4BY5A 2LC5A 1AUIB 2F2PA 2LUXA 2M7NA 4PHNA 1QIVA 3PLFB 2MLEC 2BL0B 2Y1NA 4GNKB 4L9MA 4YRUA 1K95A 2KGBC 3KPXA 4JQ0D 2CXJA 2LVIA 4U8DA 2K7CA 1SR6C 1BOCA 1B7TY 2M9GA 1Y1AA 2JT3A 1BMOA 2KDHA 1KWOC 1RTP1 5PALA 1VRKA 2JC2A 1YUUA 2KNEA 2LMTA 2ZFDA 4AOMA 1KQVA 1AK8A 1B1GA 2KI4C 4CLNA 2M49B 5D7FA 5I2LA 4CFQA 1FI5A 3SIBA 1BODA 5F6TA 3CLNA 1SL9A 3I5GC 1NPQA 4C0JA 4NDBA 2LM5A 3HX4A 1J7RA 1WRZA 1H4BA 4ZCVA 3SG7A 1DJIA 1J1DA 5HKYA 2HQ8A 4OR9B 2GGMA 3TDIA 1XFVO 2LHIA 2CCMA 3O6BA 1DGUA 3I5FB 1IGVA 5AERA 1S1EA 1XFWO 2D8NA 2LANA 1Y1UA 1QLSA 1N65A 1BJFA 1K93D 1QX2A 1QVIZ 4N5XA 1M31A 3DF0B 1S5GZ 1DGVA 1F4OA 1MUXA 2WC8A 2VRGA 1S26D 4HRGA 5J3XA 3VRQA 4N1FA 1AJ5A 3JTDC 4PHKA 3SG5A 3BOWB 4YGDB 2EC6C 1FPWA 4PE4A 3GOFA 5ER5A 3WXAA 1SRAA 3NXAA 4M2QA 1J7OA 2EGDA 4I5NB 1IWQA 3IQQA 5BPJA 3SG4A 5KTYA 1DJGA 1YUSA 4NDDA 3OX5A 2CNPA 5I2QA 1ALVA 2KFFA 4WRIA 4GUKA 4YGCB 1Y1XA 4MSPA 2JXCA 4N1GA 4ORAB 1F55A 4MEWA 4P2YB 4QJ4B 3I5IB 2MJWB 3NSIA 2PALA 3SG6A 3O78A 1MQ1A 2LAPA 3K21A 2WNDA 1CMGA 1UUSA 2O60A 2Q91A 5D69A 3DVKA 3NSLA 1K2HA 3EK7A 2KHNA 4YGEB 4IL1A 3NSKA 2KFGA 1NX1A 2MA2A 1NIWA 4YI8A 1BT6A 2CTNA 3GK2A 3SIAA 1GQMA 2MHHA 3TUYB 2GV5A 2KI4B 3EK8A 1B7TZ 5KU1A 1WY9A 1RWYA 2BCAA 2K2AA 1DF0A 2BCXA 1LXFC 1YX7A 1LINA 1DTLA 2B1UA 1XFXO 2NXQA 3CS1A 5DKQA 2LLUA 3ZNIA 1WDCC 1ZOTB 2LLSA 3VRPA 3DVJA 4C0KA 1XA5A 2LVJA 1IH0A 1QX5B 1UHJA 2M1UA 3QRXA 1KK8B 1M45A 5CSNA 2H61C 1CFPA 1QJTA 1S6CA 5JOLA 2LV7A 5CSFA 2KI6D 3PN7C 2JOJA 2TN4A 1CB1A 1A29A 1ODBA 4YGAA 2JZIA 1IRJA 2OTGC 2PSRA 1YVLA 5CSIA 1QX7A 3JTDB 1BU3A 1YX8A 2EC6B 1SNLA 4MVFA 5JJGA 3BQ3A 3OP0A 3CR2A 5HYDA 2L50A 3LL8B 4USLA 3KF9A 5I2OA 1DJZA 1JFJA 2M29A 2BECA 3FIAA 3KHEA 1B9AA 3DVEA 2LUCA 3PATA 2MAZA 1CM4A 3D0YA 1OMVA 2BBNA 1MHOA 1GGWA 1IG5A 1PALA 1S6JA 1TCOB 2KQ6A 3BUNB 3EVVA 1EG4A 3JVTC 1E8AA 4DCKA 4XJKA 1L2OB 2JULA 3PSRA 1RFJA 1IJ5A 1DVIA 1MXEA 1PSBA 1V1GA 2OPOA 4MRYA 1YVHA 4GAOA 1N0YA 2IS9A 2KBMA 1A4PA 3PFVA 5AANA 1F54A 1B8CA 2Q4UA 3BUXB 1J55A 2KGRA 4PE0A 4OCIA 1FF1A 2KYFA 1OMRA 2SCPA 3CWGA 2L4HA 2LCPA 2Y1MA 5I8NA 1FW4A 2OS8C 4MLWA 1BR4B 2R2IA 1PK0D 1OQPA 2AAOA 2I18A 2L2EA 1QXPA 4HSZA 1AVSA 5TNCA 4MZKA 4ETOA 1A75A 1SYMA 2A4JA 1MF8B 3HCMA 4UPGA 4HRHA 1RROA 2K61A 1CLMA 2FOTA 3CR4X 1UHHA 2JU0A 1M39A 2JPTA 2WORA 1UHIA 1WRLA 5CPVA 1QATA 3TS5C 2Y5IA 4M2PA 1G33A 4GBAA 3E3RA 3OX6A 2JNFA 2FJUB 3WNXB 1NX0A 1SCMC 2EHBA 4D1EA 2LLTA 2M97A 1JUOA 3ICBA 1R2UA 4R1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYX A;  3LK0 A;  1KQM C;  1F70 A;  1CNP A;  1N2D A;  1S6I A;  2KYC A;  2MBX A;  3I5H B;  2PVB A;  1TNP A;  3D10 A;  3EVU A;  3SG2 A;  1X02 A;  2JT0 A;  1QLK A;  1DJW A;  1ZUZ A;  2LE9 B;  1J7P A;  1JSA A;  4ZCU A;  2E30 A;  2WOS A;  1XYD A;  2KSP A;  1BF5 A;  1XFY O;  1OZO A;  4I5L B;  3KO0 A;  2F2O A;  1ZMZ A;  4PDZ A;  4P5O E;  3D0Y B;  2I7A A;  3A4U B;  1J7Q A;  2L5X B;  4A4C A;  1JBA A;  1C7W A;  1K9P A;  4DUQ A;  2AMI A;  1NP8 A;  1SR6 B;  3SJS A;  5CSJ A;  3FS7 A;  1Y6W A;  2ZKM X;  2BL0 C;  4XJK B;  1KWO B;  3A8R A;  3TDU A;  1Q80 A;  2KAX A;  4YI9 A;  2JTT A;  4NDC A;  3PM8 A;  2KQY A;  4CID A;  2BCB A;  3LCP C;  1IJ6 A;  2PMY A;  2WCE A;  2ZN8 A;  1DJX A;  3BUO B;  5AFP A;  2HQW A;  3I5G B;  3OB2 B;  1M46 A;  5K89 A;  1TCF A;  1B47 A;  2K7D A;  2KBI A;  2F3Z A;  1AP4 A;  5GQQ C;  1NUB A;  3WHU B;  1CKK A;  3NSO A;  1CLB A;  1MXL C;  2NCP A;  1LA3 A;  1QV1 A;  1ZFS A;  1XK4 C;  3AAJ A;  4I5J A;  1SPY A;  2H61 A;  2PRU A;  1QVI Y;  1AJ4 A;  2CBL A;  1FI6 A;  5HLV A;  1NX3 A;  2M0R A;  2KI6 C;  3I5F C;  2BBM A;  3LLE A;  3EK4 A;  1JF2 A;  5DKR A;  2LVV A;  1S36 A;  1NWD A;  1QAS A;  2L0P A;  4I5K A;  1CDL A;  2JQ6 A;  4HRE E;  2JT8 A;  1TIZ A;  2L51 A;  5HKW A;  1RK9 A;  3IF7 A;  1PSR A;  4PHM A;  1QV0 A;  2HET A;  1KFU S;  1CDP A;  2JWW A;  1DJH A;  2K8M B;  4E68 A;  3WHT B;  4AQJ A;  1W7J B;  5HLO A;  5B8I B;  4OKH A;  1SK6 D;  2KFH A;  2QPT A;  3O2P A;  1GGZ A;  2DOQ A;  1CFF A;  1YRU B;  3TZ1 A;  2LMU A;  1YUR A;  1L7Z A;  4GGF C;  1PVB A;  4ORB B;  1QS7 A;  1LKJ A;  3C1V A;  5ER4 X;  4XYN A;  1S3P A;  2JRF A;  2ZNE A;  3AKB A;  1PRW A;  4A4B A;  1SY9 A;  3OHM B;  3ZWH A;  1H8B A;  1F4Q A;  3PAL A;  1M63 B;  2HF5 A;  3DVM A;  1EG3 A;  3I5I C;  4GGN A;  1RJV A;  4WQ3 A;  2K7B A;  1XFZ O;  1D1O A;  1NCX A;  5HKZ A;  1FBV A;  3FWB A;  3VRO A;  2ZRT A;  2JNX A;  3CTN A;  1TNX A;  4MRX A;  5G08 A;  2V53 A;  4JWQ A;  4MBE A;  2FCD A;  2M1K B;  4F0Z B;  1DF0 B;  1KFU L;  1NCY A;  1MWN A;  2LP2 A;  3RLZ A;  2AUC A;  1IQ5 A;  1OMD A;  3TUY C;  2P6B B;  2CT9 A;  4FQO A;  1IKU A;  1JFK A;  1U5I A;  1TRF A;  4ICB A;  1WDC B;  2O5G A;  1HQV A;  1KK7 Y;  1KSO A;  1SCV A;  1ZAC A;  4MZJ A;  4PCW A;  1NYA A;  4DRW A;  1NX2 A;  4MN0 A;  2Y4Q A;  2I94 A;  2JXL A;  3EVR A;  1TNQ A;  1A03 A;  1F71 A;  2LHL A;  4MZL A;  3OB1 B;  1PVA A;  1DJY A;  1K90 D;  1B8L A;  1CFD A;  2NLN A;  3PN7 B;  1OOJ A;  1YRT B;  3RM1 A;  1KK8 C;  1MR8 A;  4DS7 A;  2MRD A;  2OTG B;  2BKI B;  5IBW A;  2K2F A;  1JWD A;  2F8P A;  1CTR A;  1UHN A;  1UWO A;  2ZRS A;  4OVN F;  4PE7 A;  2LNK A;  4PE1 A;  3BUW B;  2HPS A;  4JPZ B;  4QJ5 B;  2G2B A;  1UP5 A;  2LP3 A;  4ORC B;  1IQ3 A;  2LVK A;  1NCZ A;  1EXR A;  1LA0 A;  1DT7 B;  4NQG A;  2G9B A;  1WLM A;  1OZS A;  4DIR A;  2ZND A;  1TTX A;  1ALW A;  1R6P A;  1TNW A;  2ZN9 A;  3CGA A;  2KAV A;  4C0L A;  4QJ3 B;  1BR1 B;  1XO5 A;  3M0W A;  2K7O A;  2KAY A;  3EKJ A;  4TNC A;  3H4S E;  1Y0V H;  2COL B;  2F3Y A;  1REC A;  2ISD A;  1WRK A;  3JVT B;  1KSM A;  1HT9 A;  1OE9 B;  2H2K A;  1CMF A;  1KCY A;  2FCE A;  1K9U A;  1UHK A;  3DD4 A;  2E6W A;  4M2O A;  1B4C A;  1EJ3 A;  1QTX A;  2I2R E;  2JTZ A;  3VRN A;  1K94 A;  1L2O C;  1SBJ A;  2WCB A;  3CR5 X;  2L98 A;  2MLF C;  3GK4 X;  1W7I B;  4PAL A;  1SL7 A;  2SAS A;  1PUL A;  1YUT A;  4YGB B;  2OS8 B;  2M7L A;  1JC2 A;  1F8H A;  2M8U A;  1A75 B;  3BXK A;  2LMV A;  1G8I A;  3CZT X;  1UUR A;  1KFX S;  2NCO A;  3TDZ A;  4CPV A;  1U5I B;  1CDM A;  3F45 A;  3KEV A;  3VGO A;  4GFT A;  4WQ2 A;  1XK4 A;  1BG1 A;  1S5G Y;  1XFU O;  3EKH A;  4FTG A;  2L4I A;  3TS5 B;  1GJY A;  1CFC A;  2NZ0 A;  3BUM B;  1TN4 A;  3GK1 A;  1DMO A;  5AXI A;  2BKH B;  1SKT A;  2QAC A;  1SCM B;  4BY4 A;  1G4Y R;  1LVC D;  4OV2 A;  1CLL A;  3SG3 A;  2WCF A;  1XVJ A;  1EH2 A;  1SW8 A;  1KK7 Z;  1TOP A;  1YTZ C;  3O4Y A;  1WLZ A;  1KQM B;  2GGZ A;  3DF0 A;  5KSZ A;  2M3W A;  2RGI A;  5AEQ A;  1C7V A;  2KOT A;  3FWC A;  1V1F A;  1BLQ A;  1SMG A;  3IQO A;  3BOW A;  1K9K A;  1EL4 A;  4Q04 A;  1CDN A;  1B8R A;  4PHJ A;  2K0J A;  3LK1 A;  1KFX L;  1JF0 A;  3AKA A;  1C07 A;  3I5H C;  1QIW A;  1CM1 A;  1J1E A;  2BE4 A;  4GPL B;  2F33 A;  2BE6 A;  3BYA A;  1AHR A;  1YR5 A;  1A2X A;  4YBH B;  4GGF A;  4AQI A;  3AAK A;  1K96 A;  3VRR A;  1K8U A;  1SL8 A;  2PAS A;  5DKN A;  1NSH A;  3MSE B;  4CFR A;  1OSA A;  4BY5 A;  2LC5 A;  1AUI B;  2F2P A;  2LUX A;  2M7N A;  4PHN A;  1QIV A;  3PLF B;  2MLE C;  2BL0 B;  2Y1N A;  4GNK B;  4L9M A;  4YRU A;  1K95 A;  2KGB C;  3KPX A;  4JQ0 D;  2CXJ A;  2LVI A;  4U8D A;  2K7C A;  1SR6 C;  1BOC A;  1B7T Y;  2M9G A;  1Y1A A;  2JT3 A;  1BMO A;  2KDH A;  1KWO C;  1RTP 1;  5PAL A;  1VRK A;  2JC2 A;  1YUU A;  2KNE A;  2LMT A;  2ZFD A;  4AOM A;  1KQV A;  1AK8 A;  1B1G A;  2KI4 C;  4CLN A;  2M49 B;  5D7F A;  5I2L A;  4CFQ A;  1FI5 A;  3SIB A;  1BOD A;  5F6T A;  3CLN A;  1SL9 A;  3I5G C;  1NPQ A;  4C0J A;  4NDB A;  2LM5 A;  3HX4 A;  1J7R A;  1WRZ A;  1H4B A;  4ZCV A;  3SG7 A;  1DJI A;  1J1D A;  5HKY A;  2HQ8 A;  4OR9 B;  2GGM A;  3TDI A;  1XFV O;  2LHI A;  2CCM A;  3O6B A;  1DGU A;  3I5F B;  1IGV A;  5AER A;  1S1E A;  1XFW O;  2D8N A;  2LAN A;  1Y1U A;  1QLS A;  1N65 A;  1BJF A;  1K93 D;  1QX2 A;  1QVI Z;  4N5X A;  1M31 A;  3DF0 B;  1S5G Z;  1DGV A;  1F4O A;  1MUX A;  2WC8 A;  2VRG A;  1S26 D;  4HRG A;  5J3X A;  3VRQ A;  4N1F A;  1AJ5 A;  3JTD C;  4PHK A;  3SG5 A;  3BOW B;  4YGD B;  2EC6 C;  1FPW A;  4PE4 A;  3GOF A;  5ER5 A;  3WXA A;  1SRA A;  3NXA A;  4M2Q A;  1J7O A;  2EGD A;  4I5N B;  1IWQ A;  3IQQ A;  5BPJ A;  3SG4 A;  5KTY A;  1DJG A;  1YUS A;  4NDD A;  3OX5 A;  2CNP A;  5I2Q A;  1ALV A;  2KFF A;  4WRI A;  4GUK A;  4YGC B;  1Y1X A;  4MSP A;  2JXC A;  4N1G A;  4ORA B;  1F55 A;  4MEW A;  4P2Y B;  4QJ4 B;  3I5I B;  2MJW B;  3NSI A;  2PAL A;  3SG6 A;  3O78 A;  1MQ1 A;  2LAP A;  3K21 A;  2WND A;  1CMG A;  1UUS A;  2O60 A;  2Q91 A;  5D69 A;  3DVK A;  3NSL A;  1K2H A;  3EK7 A;  2KHN A;  4YGE B;  4IL1 A;  3NSK A;  2KFG A;  1NX1 A;  2MA2 A;  1NIW A;  4YI8 A;  1BT6 A;  2CTN A;  3GK2 A;  3SIA A;  1GQM A;  2MHH A;  3TUY B;  2GV5 A;  2KI4 B;  3EK8 A;  1B7T Z;  5KU1 A;  1WY9 A;  1RWY A;  2BCA A;  2K2A A;  1DF0 A;  2BCX A;  1LXF C;  1YX7 A;  1LIN A;  1DTL A;  2B1U A;  1XFX O;  2NXQ A;  3CS1 A;  5DKQ A;  2LLU A;  3ZNI A;  1WDC C;  1ZOT B;  2LLS A;  3VRP A;  3DVJ A;  4C0K A;  1XA5 A;  2LVJ A;  1IH0 A;  1QX5 B;  1UHJ A;  2M1U A;  3QRX A;  1KK8 B;  1M45 A;  5CSN A;  2H61 C;  1CFP A;  1QJT A;  1S6C A;  5JOL A;  2LV7 A;  5CSF A;  2KI6 D;  3PN7 C;  2JOJ A;  2TN4 A;  1CB1 A;  1A29 A;  1ODB A;  4YGA A;  2JZI A;  1IRJ A;  2OTG C;  2PSR A;  1YVL A;  5CSI A;  1QX7 A;  3JTD B;  1BU3 A;  1YX8 A;  2EC6 B;  1SNL A;  4MVF A;  5JJG A;  3BQ3 A;  3OP0 A;  3CR2 A;  5HYD A;  2L50 A;  3LL8 B;  4USL A;  3KF9 A;  5I2O A;  1DJZ A;  1JFJ A;  2M29 A;  2BEC A;  3FIA A;  3KHE A;  1B9A A;  3DVE A;  2LUC A;  3PAT A;  2MAZ A;  1CM4 A;  3D0Y A;  1OMV A;  2BBN A;  1MHO A;  1GGW A;  1IG5 A;  1PAL A;  1S6J A;  1TCO B;  2KQ6 A;  3BUN B;  3EVV A;  1EG4 A;  3JVT C;  1E8A A;  4DCK A;  4XJK A;  1L2O B;  2JUL A;  3PSR A;  1RFJ A;  1IJ5 A;  1DVI A;  1MXE A;  1PSB A;  1V1G A;  2OPO A;  4MRY A;  1YVH A;  4GAO A;  1N0Y A;  2IS9 A;  2KBM A;  1A4P A;  3PFV A;  5AAN A;  1F54 A;  1B8C A;  2Q4U A;  3BUX B;  1J55 A;  2KGR A;  4PE0 A;  4OCI A;  1FF1 A;  2KYF A;  1OMR A;  2SCP A;  3CWG A;  2L4H A;  2LCP A;  2Y1M A;  5I8N A;  1FW4 A;  2OS8 C;  4MLW A;  1BR4 B;  2R2I A;  1PK0 D;  1OQP A;  2AAO A;  2I18 A;  2L2E A;  1QXP A;  4HSZ A;  1AVS A;  5TNC A;  4MZK A;  4ETO A;  1A75 A;  1SYM A;  2A4J A;  1MF8 B;  3HCM A;  4UPG A;  4HRH A;  1RRO A;  2K61 A;  1CLM A;  2FOT A;  3CR4 X;  1UHH A;  2JU0 A;  1M39 A;  2JPT A;  2WOR A;  1UHI A;  1WRL A;  5CPV A;  1QAT A;  3TS5 C;  2Y5I A;  4M2P A;  1G33 A;  4GBA A;  3E3R A;  3OX6 A;  2JNF A;  2FJU B;  3WNX B;  1NX0 A;  1SCM C;  2EHB A;  4D1E A;  2LLT A;  2M97 A;  1JUO A;  3ICB A;  1R2U A;  4R1E A; 
#chains in the Genus database with same CATH topology
 5FYX A;  3LK0 A;  1KQM C;  1F70 A;  1CNP A;  1N2D A;  1S6I A;  2KYC A;  2MBX A;  3I5H B;  2PVB A;  1TNP A;  3D10 A;  3EVU A;  3SG2 A;  1X02 A;  2JT0 A;  3L47 A;  1QLK A;  1DJW A;  1ZUZ A;  2LE9 B;  5FI7 A;  1J7P A;  1JSA A;  4ZCU A;  2E30 A;  2WOS A;  1XYD A;  2KSP A;  1BF5 A;  3CAB A;  1XFY O;  1OZO A;  4I5L B;  3KO0 A;  2F2O A;  1ZMZ A;  2WCL A;  4PDZ A;  4P5O E;  3D0Y B;  2WC6 A;  2I7A A;  3A4U B;  1J7Q A;  2L5X B;  4A4C A;  1JBA A;  1C7W A;  3B86 A;  1K9P A;  4DUQ A;  2AMI A;  1NP8 A;  1SR6 B;  2WCH A;  5CSJ A;  3FS7 A;  3SJS A;  3D76 A;  1Y6W A;  2ZKM X;  2BL0 C;  4XJK B;  1KWO B;  3A8R A;  3TDU A;  3SS5 A;  1Q80 A;  2KAX A;  3R72 A;  4YI9 A;  2JTT A;  4NDC A;  3PM8 A;  2KQY A;  4CID A;  2BCB A;  3LCP C;  1IJ6 A;  2PMY A;  2WCE A;  2ZN8 A;  1DJX A;  3BFB A;  3BUO B;  5AFP A;  2HQW A;  3I5G B;  3OB2 B;  1M46 A;  4INW A;  3VB1 A;  5K89 A;  1TCF A;  3QME A;  1B47 A;  2K7D A;  2KBI A;  2F3Z A;  1AP4 A;  3UNW A;  5GQQ C;  1NUB A;  3WHU B;  1CKK A;  3NSO A;  1CLB A;  1MXL C;  2NCP A;  1LA3 A;  1QV1 A;  3B7A A;  1ZFS A;  1XK4 C;  3AAJ A;  4I5J A;  2YGU A;  1SPY A;  1OW4 A;  2H61 A;  2PRU A;  1QVI Y;  1AJ4 A;  2CBL A;  1FI6 A;  5HLV A;  1NX3 A;  2M0R A;  2KI6 C;  1DEK A;  3I5F C;  1W9Z A;  2BBM A;  3LLE A;  3EK4 A;  1JF2 A;  1Z2C B;  5DKR A;  2LVV A;  1S36 A;  1NWD A;  1QAS A;  2L0P A;  3DY9 A;  1CDL A;  4I5K A;  4OZD A;  2JQ6 A;  4HRE E;  2JT8 A;  4PT1 A;  2WCM A;  3D75 A;  1TIZ A;  2L51 A;  5HKW A;  1RK9 A;  3IF7 A;  1PSR A;  4PHM A;  1QV0 A;  2HET A;  1KFU S;  1CDP A;  2JWW A;  1DJH A;  2K8M B;  4E68 A;  5FI2 A;  3WHT B;  4AQJ A;  1W7J B;  5HLO A;  3CZ2 A;  5B8I B;  4OKH A;  1SK6 D;  2KFH A;  3B6X A;  3RZS A;  2QPT A;  3O2P A;  1GGZ A;  2DOQ A;  1CFF A;  1YRU B;  3TZ1 A;  2LMU A;  1YUR A;  1L7Z A;  3PM2 A;  1PVB A;  4GGF C;  1QS7 A;  4ORB B;  1LKJ A;  3C1V A;  5ER4 X;  4XYN A;  1S3P A;  2JRF A;  2ZNE A;  3AKB A;  3PJI A;  1PRW A;  4A4B A;  1SY9 A;  3OHM B;  3ZWH A;  1GM0 A;  1F4Q A;  3PAL A;  1M63 B;  2HF5 A;  3DVM A;  3SS4 A;  1EG3 A;  2KPH A;  3FE9 A;  1RJV A;  3I5I C;  4GGN A;  4WQ3 A;  2K7B A;  5I94 A;  1XFZ O;  1D1O A;  1NCX A;  5HKZ A;  1FBV A;  3FWB A;  3VRO A;  2ZRT A;  2JNX A;  3CTN A;  1TNX A;  4MRX A;  5G08 A;  4INX A;  2V53 A;  3DXL A;  4JWQ A;  4MBE A;  1TUZ A;  1T14 A;  2FCD A;  2M1K B;  1H8B A;  4F0Z B;  1DF0 B;  1KFU L;  1NCY A;  1MWN A;  2LP2 A;  3RLZ A;  2AUC A;  1IQ5 A;  1OMD A;  3TUY C;  2BAP A;  1TWO A;  2P6B B;  2CT9 A;  4FQO A;  1IKU A;  1JFK A;  1U5I A;  1TRF A;  4ICB A;  1WDC B;  2O5G A;  1HQV A;  1KK7 Y;  1KSO A;  1SCV A;  1ZAC A;  2WCJ A;  4MZJ A;  1NYA A;  4PCW A;  5D3O A;  1NX2 A;  4MN0 A;  4DRW A;  2Y4Q A;  2I94 A;  2JXL A;  3NGV A;  3EVR A;  1TNQ A;  3S0A A;  3L4L A;  1A03 A;  1F71 A;  2LHL A;  4MZL A;  3OB1 B;  1PVA A;  4JD9 A;  1DJY A;  1K90 D;  1B8L A;  1CFD A;  2NLN A;  3PN7 B;  5DIC A;  1OOJ A;  1YRT B;  3RM1 A;  1KK8 C;  1MR8 A;  3EG5 B;  4DS7 A;  2MRD A;  2OTG B;  2BKI B;  5IBW A;  2K2F A;  1OOF A;  1JWD A;  2F8P A;  1CTR A;  1UHN A;  1UWO A;  2ZRS A;  4OVN F;  4PE7 A;  2LNK A;  4PE1 A;  3BUW B;  2HPS A;  4JPZ B;  4QJ5 B;  2G2B A;  1UP5 A;  2LP3 A;  4ORC B;  1P28 A;  1IQ3 A;  2LVK A;  1NCZ A;  1EXR A;  1LA0 A;  1DT7 B;  2FJY A;  4NQG A;  2G9B A;  1WLM A;  1OZS A;  4DIR A;  2ZND A;  1TTX A;  3OBV A;  1ALW A;  1ORG A;  1R6P A;  1TNW A;  2ZN9 A;  3CGA A;  3CZ1 A;  2KAV A;  4C0L A;  4QJ3 B;  1BR1 B;  1XO5 A;  3M0W A;  2K7O A;  2KAY A;  3EKJ A;  4TNC A;  3H4S E;  4FQT A;  1Y0V H;  2COL B;  2F3Y A;  1REC A;  2ISD A;  1WRK A;  1OOG A;  3JVT B;  1KSM A;  1Z4H A;  1HT9 A;  1OE9 B;  2H2K A;  1CMF A;  1KCY A;  2FCE A;  1K9U A;  1UHK A;  3DD4 A;  2E6W A;  4M2O A;  1B4C A;  1EJ3 A;  1QTX A;  1C3Y A;  2I2R E;  2JTZ A;  3VRN A;  1K94 A;  1L2O C;  1SBJ A;  2WCB A;  3CR5 X;  2L98 A;  2MLF C;  3GK4 X;  3R1P A;  1W7I B;  4PAL A;  1SL7 A;  3S0F A;  2SAS A;  1PUL A;  4JKT A;  1YUT A;  4YGB B;  2OS8 B;  2M7L A;  1JC2 A;  1F8H A;  2M8U A;  1A75 B;  3BXK A;  2LMV A;  3DYE A;  3V2L A;  1G8I A;  3CZT X;  1UUR A;  4IJ7 A;  1KFX S;  2NCO A;  3TDZ A;  4CPV A;  1U5I B;  1CDM A;  3F45 A;  3KEV A;  3VGO A;  4GFT A;  4WQ2 A;  1XK4 A;  1BG1 A;  1S5G Y;  1XFU O;  3EKH A;  4FTG A;  3BFA A;  2L4I A;  3TS5 B;  1GJY A;  1CFC A;  2NZ0 A;  3BUM B;  1TN4 A;  3GK1 A;  1DMO A;  5AXI A;  2GTE A;  2BKH B;  1SKT A;  2QAC A;  1SCM B;  4BY4 A;  1G4Y R;  1LVC D;  4OV2 A;  1CLL A;  3SG3 A;  3B87 A;  2WCF A;  1XVJ A;  1EH2 A;  1SW8 A;  1KK7 Z;  1TOP A;  1YTZ C;  1TUJ A;  1WLZ A;  1KQM B;  2GGZ A;  3DF0 A;  3O4Y A;  5KSZ A;  5FI6 A;  2M3W A;  2RGI A;  3NHT A;  5AEQ A;  1C7V A;  2KOT A;  2P71 A;  3FWC A;  1V1F A;  1BLQ A;  1SMG A;  3IQO A;  3BOW A;  1K9K A;  1EL4 A;  3Q8I A;  4Q04 A;  1CDN A;  1B8R A;  4PHJ A;  2K0J A;  3D77 A;  3LK1 A;  1KFX L;  1QWV A;  1JF0 A;  3AKA A;  1C07 A;  3I5H C;  1QIW A;  2WC5 A;  1CM1 A;  1J1E A;  2BE4 A;  4GPL B;  2F33 A;  2BE6 A;  3BYA A;  1AHR A;  1YR5 A;  1A2X A;  4YBH B;  4GGF A;  4AQI A;  3AAK A;  3D78 A;  1K96 A;  3VRR A;  1K8U A;  1SL8 A;  2PAS A;  5DKN A;  1NSH A;  3MSE B;  4CFR A;  1OSA A;  4BY5 A;  2LC5 A;  1AUI B;  2F2P A;  2H8V A;  2LUX A;  2M7N A;  4PHN A;  1QIV A;  3PLF B;  2MLE C;  2BL0 B;  2Y1N A;  4GNK B;  4L9M A;  4YRU A;  1K95 A;  2KGB C;  3D74 A;  3KPX A;  4JQ0 D;  2CXJ A;  3R1O A;  2LVI A;  4U8D A;  2K7C A;  1SR6 C;  1BOC A;  1B7T Y;  2M9G A;  1Y1A A;  2JT3 A;  1BMO A;  2KDH A;  1KWO C;  1RTP 1;  5PAL A;  1VRK A;  2JC2 A;  1YUU A;  2KNE A;  2LMT A;  2ZFD A;  3L4A A;  4AOM A;  1KQV A;  1AK8 A;  1B1G A;  2KI4 C;  4CLN A;  2M49 B;  1C3Z A;  5D7F A;  5I2L A;  1DQE A;  4CFQ A;  1FI5 A;  2P70 A;  2QEB A;  2QDI A;  3SIB A;  1BOD A;  5F6T A;  1LS8 A;  3CLN A;  1SL9 A;  3CYZ A;  3I5G C;  1NPQ A;  4C0J A;  2L2C A;  2LM5 A;  3HX4 A;  4NDB A;  1J7R A;  1WRZ A;  3CDN A;  4ZCV A;  3S0E A;  1H4B A;  3SG7 A;  1DJI A;  1J1D A;  5HKY A;  1OOI X;  2HQ8 A;  4OR9 B;  2GGM A;  3TDI A;  3K1E A;  4F7F A;  1XFV O;  2LHI A;  2CCM A;  3O6B A;  1DGU A;  3I5F B;  1IGV A;  5AER A;  3CZ0 A;  1S1E A;  1XFW O;  2D8N A;  2LAN A;  1Y1U A;  1QLS A;  1N65 A;  1BJF A;  1K93 D;  1QX2 A;  1QVI Z;  4N5X A;  1M31 A;  3DF0 B;  1S5G Z;  1DGV A;  1F4O A;  3R1V A;  1MUX A;  2WC8 A;  2VRG A;  1S26 D;  2BNX A;  4HRG A;  3UO9 A;  5J3X A;  3VRQ A;  4N1F A;  1AJ5 A;  3BFH A;  3JTD C;  4PHK A;  3SS3 A;  3SG5 A;  3BOW B;  4YGD B;  2EC6 C;  2WCK A;  1FPW A;  4PE4 A;  3GOF A;  5ER5 A;  3WXA A;  1SRA A;  3NXA A;  4M2Q A;  1J7O A;  2EGD A;  4I5N B;  1IWQ A;  3IQQ A;  3S0G A;  5BPJ A;  3SG4 A;  5KTY A;  1DJG A;  1YUS A;  4NDD A;  3OX5 A;  2CNP A;  5I2Q A;  1ALV A;  2KFF A;  4WRI A;  4GUK A;  4YGC B;  1Y1X A;  4MSP A;  1SSE B;  2JXC A;  4N1G A;  4ORA B;  1F55 A;  4MEW A;  4P2Y B;  2L5Y A;  4QJ4 B;  3I5I B;  2MJW B;  3NSI A;  3S0D A;  2PAL A;  2PQL A;  2QEH A;  3SG6 A;  3O78 A;  1MQ1 A;  2LAP A;  3K21 A;  2WND A;  1CMG A;  1UUS A;  2O60 A;  2Q91 A;  5D69 A;  3DVK A;  3S0B A;  3NSL A;  1K2H A;  3EK7 A;  2KHN A;  4YGE B;  4IL1 A;  3NSK A;  2KFG A;  1NX1 A;  2MA2 A;  3FE6 A;  1NIW A;  4YI8 A;  1BT6 A;  2CTN A;  3GK2 A;  3SIA A;  1GQM A;  2MHH A;  3TUY B;  2GV5 A;  2KI4 B;  3EK8 A;  5HL1 A;  1B7T Z;  5KU1 A;  1WY9 A;  1RWY A;  2BCA A;  2K2A A;  3DZT A;  1DF0 A;  2BCX A;  1LXF C;  2KLD A;  1YX7 A;  1LIN A;  1DTL A;  2B1U A;  1XFX O;  2NXQ A;  3CS1 A;  5DKQ A;  2LLU A;  3IVT A;  1WDC C;  3ZNI A;  1ZOT B;  2LLS A;  4KYN A;  3VRP A;  3DVJ A;  4C0K A;  1XA5 A;  2LVJ A;  1IH0 A;  1QX5 B;  1UHJ A;  2M1U A;  3QRX A;  1KK8 B;  1M45 A;  5CSN A;  2H61 C;  1CFP A;  1QJT A;  3D73 A;  1S6C A;  5JOL A;  2LV7 A;  2PYQ A;  5CSF A;  2ERB A;  2KI6 D;  3PN7 C;  2JOJ A;  2TN4 A;  3N7H A;  1CB1 A;  1A29 A;  1ODB A;  4YGA A;  3FE8 A;  2JZI A;  1IRJ A;  2OTG C;  1DC1 A;  2PSR A;  1YVL A;  5CSI A;  1QX7 A;  3JTD B;  1BU3 A;  3NHI A;  1YX8 A;  2EC6 B;  1SNL A;  4MVF A;  5JJG A;  3BQ3 A;  3OP0 A;  3CR2 A;  5HYD A;  2L50 A;  3LL8 B;  4USL A;  3KF9 A;  5I2O A;  1DJZ A;  1JFJ A;  2M29 A;  2BEC A;  3FIA A;  3KHE A;  1B9A A;  3DVE A;  2LUC A;  3PAT A;  2MAZ A;  2QEO A;  1IIO A;  1CM4 A;  1OOH A;  1OMV A;  2BBN A;  3D0Y A;  1MHO A;  1GGW A;  1IG5 A;  1PAL A;  1S6J A;  1TCO B;  1XFR A;  2KQ6 A;  3BUN B;  3EVV A;  1EG4 A;  3O4X A;  3JVT C;  1E8A A;  4DCK A;  4XJK A;  1L2O B;  2JUL A;  3PSR A;  1RFJ A;  2JPO A;  1IJ5 A;  1DVI A;  1MXE A;  1PSB A;  1V1G A;  2OPO A;  4MRY A;  1YVH A;  4GAO A;  1N0Y A;  2IS9 A;  2KBM A;  1A4P A;  2KLE A;  3PFV A;  5AAN A;  1B8C A;  2Q4U A;  3BUX B;  1F54 A;  1J55 A;  2KGR A;  4PE0 A;  4OCI A;  1FF1 A;  2KYF A;  1OMR A;  3OGN A;  2SCP A;  3CWG A;  2L4H A;  2LCP A;  2Y1M A;  5I8N A;  1FW4 A;  2OS8 C;  4MLW A;  3B88 A;  1BR4 B;  2R2I A;  1PK0 D;  1OQP A;  2AAO A;  2I18 A;  2L2E A;  1QXP A;  4HSZ A;  2QEV A;  1AVS A;  5TNC A;  4MZK A;  4ETO A;  1A75 A;  1SYM A;  2A4J A;  1MF8 B;  3HCM A;  4UPG A;  4HRH A;  1RRO A;  2K61 A;  1CLM A;  2FOT A;  3CR4 X;  1UHH A;  5EL2 A;  2JU0 A;  1M39 A;  2JPT A;  2WOR A;  1UHI A;  1WRL A;  5CPV A;  1QAT A;  3TS5 C;  2Y5I A;  3BJH A;  4M2P A;  1G33 A;  4GBA A;  1DEL A;  3E3R A;  3OX6 A;  2JNF A;  2FJU B;  2K60 A;  1NX0 A;  1SCM C;  2EHB A;  3WNX B;  2LLT A;  2M97 A;  4D1E A;  1JUO A;  3ICB A;  1R2U A;  4R1E A; 
#chains in the Genus database with same CATH homology
 5FYX A;  3LK0 A;  1KQM C;  1F70 A;  1CNP A;  1N2D A;  1S6I A;  2KYC A;  2MBX A;  3I5H B;  2PVB A;  1TNP A;  3D10 A;  3EVU A;  3SG2 A;  1X02 A;  2JT0 A;  1QLK A;  1DJW A;  1ZUZ A;  2LE9 B;  1J7P A;  1JSA A;  4ZCU A;  2E30 A;  2WOS A;  1XYD A;  2KSP A;  1BF5 A;  1XFY O;  1OZO A;  4I5L B;  3KO0 A;  2F2O A;  1ZMZ A;  4PDZ A;  4P5O E;  3D0Y B;  2I7A A;  3A4U B;  1J7Q A;  2L5X B;  4A4C A;  1JBA A;  1C7W A;  1K9P A;  4DUQ A;  2AMI A;  1NP8 A;  1SR6 B;  3SJS A;  5CSJ A;  3FS7 A;  1Y6W A;  2ZKM X;  2BL0 C;  4XJK B;  1KWO B;  3A8R A;  3TDU A;  1Q80 A;  2KAX A;  4YI9 A;  2JTT A;  4NDC A;  3PM8 A;  2KQY A;  4CID A;  2BCB A;  3LCP C;  1IJ6 A;  2PMY A;  2WCE A;  2ZN8 A;  1DJX A;  3BUO B;  5AFP A;  2HQW A;  3I5G B;  3OB2 B;  1M46 A;  5K89 A;  1TCF A;  1B47 A;  2K7D A;  2KBI A;  2F3Z A;  1AP4 A;  5GQQ C;  1NUB A;  3WHU B;  1CKK A;  3NSO A;  1CLB A;  1MXL C;  2NCP A;  1LA3 A;  1QV1 A;  1ZFS A;  1XK4 C;  3AAJ A;  4I5J A;  1SPY A;  2H61 A;  2PRU A;  1QVI Y;  1AJ4 A;  2CBL A;  1FI6 A;  5HLV A;  1NX3 A;  2M0R A;  2KI6 C;  3I5F C;  2BBM A;  3LLE A;  3EK4 A;  1JF2 A;  5DKR A;  2LVV A;  1S36 A;  1NWD A;  1QAS A;  2L0P A;  4I5K A;  1CDL A;  2JQ6 A;  4HRE E;  2JT8 A;  1TIZ A;  2L51 A;  5HKW A;  1RK9 A;  3IF7 A;  1PSR A;  4PHM A;  1QV0 A;  2HET A;  1KFU S;  1CDP A;  2JWW A;  1DJH A;  2K8M B;  4E68 A;  3WHT B;  4AQJ A;  1W7J B;  5HLO A;  5B8I B;  4OKH A;  1SK6 D;  2KFH A;  2QPT A;  3O2P A;  1GGZ A;  2DOQ A;  1CFF A;  1YRU B;  3TZ1 A;  2LMU A;  1YUR A;  1L7Z A;  4GGF C;  1PVB A;  4ORB B;  1QS7 A;  1LKJ A;  3C1V A;  5ER4 X;  4XYN A;  1S3P A;  2JRF A;  2ZNE A;  3AKB A;  1PRW A;  4A4B A;  1SY9 A;  3OHM B;  3ZWH A;  1H8B A;  1F4Q A;  3PAL A;  1M63 B;  2HF5 A;  3DVM A;  1EG3 A;  3I5I C;  4GGN A;  1RJV A;  4WQ3 A;  2K7B A;  1XFZ O;  1D1O A;  1NCX A;  5HKZ A;  1FBV A;  3FWB A;  3VRO A;  2ZRT A;  2JNX A;  3CTN A;  1TNX A;  4MRX A;  5G08 A;  2V53 A;  4JWQ A;  4MBE A;  2FCD A;  2M1K B;  4F0Z B;  1DF0 B;  1KFU L;  1NCY A;  1MWN A;  2LP2 A;  3RLZ A;  2AUC A;  1IQ5 A;  1OMD A;  3TUY C;  2P6B B;  2CT9 A;  4FQO A;  1IKU A;  1JFK A;  1U5I A;  1TRF A;  4ICB A;  1WDC B;  2O5G A;  1HQV A;  1KK7 Y;  1KSO A;  1SCV A;  1ZAC A;  4MZJ A;  4PCW A;  1NYA A;  4DRW A;  1NX2 A;  4MN0 A;  2Y4Q A;  2I94 A;  2JXL A;  3EVR A;  1TNQ A;  1A03 A;  1F71 A;  2LHL A;  4MZL A;  3OB1 B;  1PVA A;  1DJY A;  1K90 D;  1B8L A;  1CFD A;  2NLN A;  3PN7 B;  1OOJ A;  1YRT B;  3RM1 A;  1KK8 C;  1MR8 A;  4DS7 A;  2MRD A;  2OTG B;  2BKI B;  5IBW A;  2K2F A;  1JWD A;  2F8P A;  1CTR A;  1UHN A;  1UWO A;  2ZRS A;  4OVN F;  4PE7 A;  2LNK A;  4PE1 A;  3BUW B;  2HPS A;  4JPZ B;  4QJ5 B;  2G2B A;  1UP5 A;  2LP3 A;  4ORC B;  1IQ3 A;  2LVK A;  1NCZ A;  1EXR A;  1LA0 A;  1DT7 B;  4NQG A;  2G9B A;  1WLM A;  1OZS A;  4DIR A;  2ZND A;  1TTX A;  1ALW A;  1R6P A;  1TNW A;  2ZN9 A;  3CGA A;  2KAV A;  4C0L A;  4QJ3 B;  1BR1 B;  1XO5 A;  3M0W A;  2K7O A;  2KAY A;  3EKJ A;  4TNC A;  3H4S E;  1Y0V H;  2COL B;  2F3Y A;  1REC A;  2ISD A;  1WRK A;  3JVT B;  1KSM A;  1HT9 A;  1OE9 B;  2H2K A;  1CMF A;  1KCY A;  2FCE A;  1K9U A;  1UHK A;  3DD4 A;  2E6W A;  4M2O A;  1B4C A;  1EJ3 A;  1QTX A;  2I2R E;  2JTZ A;  3VRN A;  1K94 A;  1L2O C;  1SBJ A;  2WCB A;  3CR5 X;  2L98 A;  2MLF C;  3GK4 X;  1W7I B;  4PAL A;  1SL7 A;  2SAS A;  1PUL A;  1YUT A;  4YGB B;  2OS8 B;  2M7L A;  1JC2 A;  1F8H A;  2M8U A;  1A75 B;  3BXK A;  2LMV A;  1G8I A;  3CZT X;  1UUR A;  1KFX S;  2NCO A;  3TDZ A;  4CPV A;  1U5I B;  1CDM A;  3F45 A;  3KEV A;  3VGO A;  4GFT A;  4WQ2 A;  1XK4 A;  1BG1 A;  1S5G Y;  1XFU O;  3EKH A;  4FTG A;  2L4I A;  3TS5 B;  1GJY A;  1CFC A;  2NZ0 A;  3BUM B;  1TN4 A;  3GK1 A;  1DMO A;  5AXI A;  2BKH B;  1SKT A;  2QAC A;  1SCM B;  4BY4 A;  1G4Y R;  1LVC D;  4OV2 A;  1CLL A;  3SG3 A;  2WCF A;  1XVJ A;  1EH2 A;  1SW8 A;  1KK7 Z;  1TOP A;  1YTZ C;  3O4Y A;  1WLZ A;  1KQM B;  2GGZ A;  3DF0 A;  5KSZ A;  2M3W A;  2RGI A;  5AEQ A;  1C7V A;  2KOT A;  3FWC A;  1V1F A;  1BLQ A;  1SMG A;  3IQO A;  3BOW A;  1K9K A;  1EL4 A;  4Q04 A;  1CDN A;  1B8R A;  4PHJ A;  2K0J A;  3LK1 A;  1KFX L;  1JF0 A;  3AKA A;  1C07 A;  3I5H C;  1QIW A;  1CM1 A;  1J1E A;  2BE4 A;  4GPL B;  2F33 A;  2BE6 A;  3BYA A;  1AHR A;  1YR5 A;  1A2X A;  4YBH B;  4GGF A;  4AQI A;  3AAK A;  1K96 A;  3VRR A;  1K8U A;  1SL8 A;  2PAS A;  5DKN A;  1NSH A;  3MSE B;  4CFR A;  1OSA A;  4BY5 A;  2LC5 A;  1AUI B;  2F2P A;  2LUX A;  2M7N A;  4PHN A;  1QIV A;  3PLF B;  2MLE C;  2BL0 B;  2Y1N A;  4GNK B;  4L9M A;  4YRU A;  1K95 A;  2KGB C;  3KPX A;  4JQ0 D;  2CXJ A;  2LVI A;  4U8D A;  2K7C A;  1SR6 C;  1BOC A;  1B7T Y;  2M9G A;  1Y1A A;  2JT3 A;  1BMO A;  2KDH A;  1KWO C;  1RTP 1;  5PAL A;  1VRK A;  2JC2 A;  1YUU A;  2KNE A;  2LMT A;  2ZFD A;  4AOM A;  1KQV A;  1AK8 A;  1B1G A;  2KI4 C;  4CLN A;  2M49 B;  5D7F A;  5I2L A;  4CFQ A;  1FI5 A;  3SIB A;  1BOD A;  5F6T A;  3CLN A;  1SL9 A;  3I5G C;  1NPQ A;  4C0J A;  4NDB A;  2LM5 A;  3HX4 A;  1J7R A;  1WRZ A;  1H4B A;  4ZCV A;  3SG7 A;  1DJI A;  1J1D A;  5HKY A;  2HQ8 A;  4OR9 B;  2GGM A;  3TDI A;  1XFV O;  2LHI A;  2CCM A;  3O6B A;  1DGU A;  3I5F B;  1IGV A;  5AER A;  1S1E A;  1XFW O;  2D8N A;  2LAN A;  1Y1U A;  1QLS A;  1N65 A;  1BJF A;  1K93 D;  1QX2 A;  1QVI Z;  4N5X A;  1M31 A;  3DF0 B;  1S5G Z;  1DGV A;  1F4O A;  1MUX A;  2WC8 A;  2VRG A;  1S26 D;  4HRG A;  5J3X A;  3VRQ A;  4N1F A;  1AJ5 A;  3JTD C;  4PHK A;  3SG5 A;  3BOW B;  4YGD B;  2EC6 C;  1FPW A;  4PE4 A;  3GOF A;  5ER5 A;  3WXA A;  1SRA A;  3NXA A;  4M2Q A;  1J7O A;  2EGD A;  4I5N B;  1IWQ A;  3IQQ A;  5BPJ A;  3SG4 A;  5KTY A;  1DJG A;  1YUS A;  4NDD A;  3OX5 A;  2CNP A;  5I2Q A;  1ALV A;  2KFF A;  4WRI A;  4GUK A;  4YGC B;  1Y1X A;  4MSP A;  2JXC A;  4N1G A;  4ORA B;  1F55 A;  4MEW A;  4P2Y B;  4QJ4 B;  3I5I B;  2MJW B;  3NSI A;  2PAL A;  3SG6 A;  3O78 A;  1MQ1 A;  2LAP A;  3K21 A;  2WND A;  1CMG A;  1UUS A;  2O60 A;  2Q91 A;  5D69 A;  3DVK A;  3NSL A;  1K2H A;  3EK7 A;  2KHN A;  4YGE B;  4IL1 A;  3NSK A;  2KFG A;  1NX1 A;  2MA2 A;  1NIW A;  4YI8 A;  1BT6 A;  2CTN A;  3GK2 A;  3SIA A;  1GQM A;  2MHH A;  3TUY B;  2GV5 A;  2KI4 B;  3EK8 A;  1B7T Z;  5KU1 A;  1WY9 A;  1RWY A;  2BCA A;  2K2A A;  1DF0 A;  2BCX A;  1LXF C;  1YX7 A;  1LIN A;  1DTL A;  2B1U A;  1XFX O;  2NXQ A;  3CS1 A;  5DKQ A;  2LLU A;  3ZNI A;  1WDC C;  1ZOT B;  2LLS A;  3VRP A;  3DVJ A;  4C0K A;  1XA5 A;  2LVJ A;  1IH0 A;  1QX5 B;  1UHJ A;  2M1U A;  3QRX A;  1KK8 B;  1M45 A;  5CSN A;  2H61 C;  1CFP A;  1QJT A;  1S6C A;  5JOL A;  2LV7 A;  5CSF A;  2KI6 D;  3PN7 C;  2JOJ A;  2TN4 A;  1CB1 A;  1A29 A;  1ODB A;  4YGA A;  2JZI A;  1IRJ A;  2OTG C;  2PSR A;  1YVL A;  5CSI A;  1QX7 A;  3JTD B;  1BU3 A;  1YX8 A;  2EC6 B;  1SNL A;  4MVF A;  5JJG A;  3BQ3 A;  3OP0 A;  3CR2 A;  5HYD A;  2L50 A;  3LL8 B;  4USL A;  3KF9 A;  5I2O A;  1DJZ A;  1JFJ A;  2M29 A;  2BEC A;  3FIA A;  3KHE A;  1B9A A;  3DVE A;  2LUC A;  3PAT A;  2MAZ A;  1CM4 A;  3D0Y A;  1OMV A;  2BBN A;  1MHO A;  1GGW A;  1IG5 A;  1PAL A;  1S6J A;  1TCO B;  2KQ6 A;  3BUN B;  3EVV A;  1EG4 A;  3JVT C;  1E8A A;  4DCK A;  4XJK A;  1L2O B;  2JUL A;  3PSR A;  1RFJ A;  1IJ5 A;  1DVI A;  1MXE A;  1PSB A;  1V1G A;  2OPO A;  4MRY A;  1YVH A;  4GAO A;  1N0Y A;  2IS9 A;  2KBM A;  1A4P A;  3PFV A;  5AAN A;  1F54 A;  1B8C A;  2Q4U A;  3BUX B;  1J55 A;  2KGR A;  4PE0 A;  4OCI A;  1FF1 A;  2KYF A;  1OMR A;  2SCP A;  3CWG A;  2L4H A;  2LCP A;  2Y1M A;  5I8N A;  1FW4 A;  2OS8 C;  4MLW A;  1BR4 B;  2R2I A;  1PK0 D;  1OQP A;  2AAO A;  2I18 A;  2L2E A;  1QXP A;  4HSZ A;  1AVS A;  5TNC A;  4MZK A;  4ETO A;  1A75 A;  1SYM A;  2A4J A;  1MF8 B;  3HCM A;  4UPG A;  4HRH A;  1RRO A;  2K61 A;  1CLM A;  2FOT A;  3CR4 X;  1UHH A;  2JU0 A;  1M39 A;  2JPT A;  2WOR A;  1UHI A;  1WRL A;  5CPV A;  1QAT A;  3TS5 C;  2Y5I A;  4M2P A;  1G33 A;  4GBA A;  3E3R A;  3OX6 A;  2JNF A;  2FJU B;  3WNX B;  1NX0 A;  1SCM C;  2EHB A;  4D1E A;  2LLT A;  2M97 A;  1JUO A;  3ICB A;  1R2U A;  4R1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...