1YRTB

Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Layse, toxin
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yrtB00
1UURA 1B4CA 2K7OA 4GGFC 2JXLA 3OP0A 2AUCA 4GUKA 2LHIA 2BKHB 1TIZA 2ZFDA 1J7PA 2KHNA 5HYDA 2KQYA 3BUMB 2MBXA 1QIWA 1YRTB 3VRNA 1TCOB 2LAPA 1DMOA 1J55A 2D8NA 4PE0A 2FJUB 4GPLB 3A8RA 5HLVA 1RTP1 1UHNA 1KK8C 2PALA 1JF0A 2M7LA 2BECA 2H61A 3KF9A 4P5OE 4C0JA 1D1OA 1NX1A 2EHBA 1V1FA 3E3RA 1RWYA 2GGMA 1Y0VH 2WCFA 2ZRTA 4GBAA 2LLUA 3FWBA 3LL8B 1EG4A 3VGOA 3I5GC 1B47A 4M2OA 1XVJA 1CMFA 3SG5A 1CFPA 1NWDA 1CB1A 1V1GA 1A4PA 3TUYB 1SKTA 1C7VA 4GAOA 2H2KA 1XA5A 2NLNA 1IGVA 1BU3A 2JT8A 5GQQC 1YR5A 4F0ZB 1IG5A 2ZRSA 1JSAA 1LVCD 1BT6A 1XFXO 2DOQA 3DVJA 1WRZA 3KO0A 4HREE 1WRKA 4ORAB 3I5FC 4JQ0D 1TRFA 2NCOA 2OS8C 2HQ8A 2Y4QA 3DVKA 4YI8A 3VRRA 1BR4B 4YBHB 1VRKA 2LV7A 5AFPA 3NSKA 1PALA 3BUXB 2JNXA 1CLBA 3ICBA 1J1EA 1SMGA 1GJYA 5I8NA 1QX5B 1TNWA 2R2IA 1OZSA 4MEWA 1UHHA 1OZOA 1F70A 1BMOA 1L2OB 1DT7B 2JC2A 2KGBC 1KFXL 2JNFA 3BYAA 5I2QA 1WLMA 3SG2A 1QS7A 2EC6C 5CSIA 3VRQA 3DVEA 1K9UA 3KEVA 5HKZA 1CNPA 3BXKA 2KFHA 2NXQA 1CDPA 1ZOTB 3AAJA 4N5XA 4HSZA 1K90D 2LP3A 2MAZA 3D10A 1F4OA 1FBVA 4R1EA 1KFXS 1KSMA 3GK1A 4XYNA 1MXLC 4MSPA 4YGDB 2A4JA 1JFJA 1NX0A 1Y6WA 4HRHA 3TZ1A 2WNDA 1FF1A 2BL0B 4YGCB 3I5IC 1WLZA 3HCMA 1AP4A 3M0WA 1RJVA 1SR6C 2KAYA 3O4YA 2JTZA 2HETA 5PALA 1WDCC 3TS5B 2M8UA 1XK4C 1XFUO 4IL1A 4DIRA 1W7IB 3EK4A 5ER4X 4ZCVA 1TCFA 1TOPA 1XO5A 1R6PA 1ALVA 4CFRA 1S5GY 4MLWA 1G8IA 1AK8A 1LINA 5CSNA 3D0YA 1IJ5A 2ISDA 1IJ6A 3BUNB 4AQJA 1N2DA 2KSPA 2MHHA 1QLKA 1WY9A 5JOLA 3EK8A 4FTGA 1OMRA 3O78A 1H4BA 1ZFSA 1M45A 1XK4A 1A03A 2LVVA 2Y5IA 4YGBB 5IBWA 1YUSA 1J7RA 4GFTA 2G2BA 4I5LB 1QIVA 3EVVA 3D0YB 2F2PA 4PHNA 2K0JA 2VRGA 1LA0A 2RGIA 4MBEA 2MRDA 3H4SE 5B8IB 2O60A 5TNCA 1DJYA 3SG7A 1WDCB 2WOSA 1NSHA 4PCWA 2KI4C 1NX3A 5G08A 2M3WA 5KTYA 1XFVO 2OTGC 2JOJA 1OE9B 4WRIA 1S6IA 2F2OA 2JWWA 2LE9B 2M1KB 1LA3A 1SCVA 1DJZA 2CBLA 2HPSA 4PHMA 1B1GA 1CFFA 3IF7A 5AEQA 1M31A 2PVBA 1SK6D 4MRXA 2LMTA 1S3PA 1LKJA 5KSZA 3QRXA 4NDCA 1BG1A 2M9GA 2Q4UA 3WXAA 1J7QA 3PLFB 4GGFA 4QJ4B 1QV1A 1YRUB 4OCIA 4M2QA 4WQ2A 2KFFA 4U8DA 2FCEA 2QACA 1R2UA 1CDMA 2E6WA 3JTDC 2BCAA 2EGDA 2K2FA 3KPXA 1OMVA 3MSEB 1KFUL 1PULA 2NCPA 4YGEB 4YRUA 1J1DA 1BOCA 1TN4A 1EH2A 3GK2A 2ZNEA 3TDUA 4L9MA 1SCMC 3CR4X 1AJ4A 1UHIA 1YX7A 1QX2A 2BE6A 3CTNA 1E8AA 2WORA 2I7AA 1CM4A 1KFUS 1RROA 1YUUA 5CSFA 1F54A 5ER5A 1IQ5A 5D7FA 2K7CA 2KYFA 2KBMA 1TNXA 2JQ6A 1DJXA 1CDLA 1QTXA 1B8CA 5I2OA 5AERA 2KDHA 4HRGA 1M63B 3JVTC 2L2EA 1SPYA 1YTZC 1HT9A 1KK8B 2M0RA 1DJIA 4OKHA 4C0LA 2LC5A 3BOWA 4ORCB 4JPZB 4I5NB 3HX4A 4PHKA 2KI6C 2LVKA 1YUTA 4GNKB 1L7ZA 2CXJA 2BBMA 5DKRA 5BPJA 2KQ6A 4TNCA 1CLMA 1IKUA 3OB2B 2M29A 3I5GB 4A4BA 1M46A 2KGRA 1QASA 1SL9A 4CFQA 4FQOA 1NYAA 5DKQA 1SBJA 1QATA 2K8MB 1DVIA 4OVNF 1JWDA 4MZJA 1RECA 3AKBA 2L5XB 3EK7A 4ICBA 3BOWB 3RLZA 2HQWA 1XFWO 3IQOA 1UHKA 2E30A 3EVUA 1EJ3A 4USLA 4PE1A 1KQMC 3I5FB 1NPQA 2LUCA 1Y1AA 2OS8B 3C1VA 2KNEA 4XJKA 1MHOA 1CFDA 2COLB 1KSOA 1RFJA 4NDDA 4PDZA 1PSRA 1OSAA 1QVIZ 2JXCA 2LNKA 2PRUA 4N1FA 4DCKA 1SL7A 1PK0D 1K8UA 1TTXA 1MWNA 1H8BA 1MQ1A 2IS9A 2M1UA 2OPOA 2NZ0A 1EG3A 3PFVA 4DS7A 4MN0A 3SIAA 2EC6B 3EKHA 4AQIA 2ZN8A 4UPGA 4XJKB 1XYDA 1UHJA 1SY9A 3K21A 1RK9A 4QJ3B 3FWCA 1B7TZ 1A29A 4NQGA 3LK1A 2I94A 3I5HC 2WCEA 1IH0A 3SJSA 3F45A 4ETOA 1BLQA 2LP2A 2Q91A 2ZN9A 4AOMA 5HLOA 1KQMB 3PM8A 1GGWA 1QJTA 4ORBB 4NDBA 2KBIA 2KFGA 1DTLA 2LMUA 3PALA 2ZKMX 3SG6A 1N0YA 2K7BA 4BY4A 4DUQA 3NSIA 1CTRA 1EL4A 3I5IB 2HF5A 2WC8A 3WHTB 1SR6B 2BE4A 1DGUA 4A4CA 1KWOC 2JTTA 3CZTX 1YX8A 3CWGA 1W7JB 2MLEC 4DRWA 2BKIB 1UP5A 1K9KA 1IQ3A 5F6TA 1AHRA 1C07A 1TNQA 1JC2A 1A75A 1ZACA 1SNLA 1CFCA 1S1EA 1Y1UA 2K2AA 3NSLA 1KCYA 4MRYA 1S6CA 1F71A 1XFZO 1NCZA 2K61A 1A2XA 3AAKA 4Q04A 1S26D 4JWQA 3TUYC 1HQVA 3NXAA 1OMDA 4MZKA 3TDZA 3VROA 2CT9A 2K7DA 1QXPA 2Y1MA 1PSBA 3BQ3A 1JUOA 1DJGA 2LUXA 1A75B 2H61C 2MJWB 3PSRA 3PN7C 1JFKA 1FI6A 2GV5A 2TN4A 1IWQA 4M2PA 2L4HA 1ZMZA 1B8LA 1KK7Z 1SL8A 4OV2A 1F4QA 2KI6D 1KWOB 1SW8A 3RM1A 5KU1A 1G4YR 2M97A 2JT3A 2KYCA 2KI4B 2LHLA 5AXIA 1BODA 1DJWA 1CM1A 1GQMA 2LMVA 4GGNA 2AAOA 3GOFA 3ZWHA 2OTGB 4PALA 2Y1NA 1S36A 1YURA 2CTNA 2KAVA 3ZNIA 3LCPC 1QLSA 5HKYA 1UUSA 1M39A 2BCBA 1U5IA 1AJ5A 1ZUZA 1K2HA 1GGZA 1JF2A 2KOTA 1PRWA 3LLEA 1ODBA 1L2OC 2ZNDA 3DVMA 1J7OA 4I5JA 1FW4A 1G33A 1MF8B 3EVRA 4CPVA 2QPTA 1X02A 1K95A 1NCXA 2MLFC 2P6BB 3SG3A 2JPTA 1F55A 3PN7B 3NSOA 4CIDA 3LK0A 1U5IB 3JTDB 1OQPA 1CMGA 4P2YB 2FCDA 2I18A 1F8HA 1K9PA 3BUOB 4WQ3A 1NCYA 4YGAA 3CLNA 1KQVA 1QVIY 1K96A 3OB1B 1JBAA 2JZIA 4I5KA 1XFYO 1MUXA 1SCMB 2BL0C 2F33A 4E68A 2PMYA 4PE7A 2SCPA 4YI9A 1CDNA 5JJGA 1LXFC 2LANA 3CR5X 3TS5C 2B1UA 3BUWB 1MXEA 3WNXB 2BBNA 1SYMA 5D69A 4N1GA 3JVTB 2V53A 1QV0A 1DJHA 1B7TY 5HKWA 3FIAA 3SIBA 3DD4A 1FI5A 2O5GA 3EKJA 5I2LA 2L98A 2LCPA 2M7NA 4BY5A 4PHJA 3PATA 2PASA 1B8RA 2AMIA 2SASA 5DKNA 5J3XA 3IQQA 2BCXA 1PVAA 1OOJA 1AVSA 2CNPA 2F3ZA 2LLSA 2CCMA 2L0PA 2GGZA 1EXRA 4ZCUA 1C7WA 1BJFA 1UWOA 1MR8A 1FPWA 2G9BA 2L50A 1ALWA 1B9AA 1BR1B 4QJ5B 4MVFA 1BF5A 3O6BA 3FS7A 1S6JA 3OHMB 3OX6A 2WCBA 2LVJA 1Y1XA 2JT0A 1YVLA 2JU0A 2LLTA 3DF0A 5FYXA 3TDIA 3CGAA 4OR9B 1K93D 2F3YA 3WHUB 1PVBA 1NUBA 1DGVA 2PSRA 3OX5A 1N65A 1AUIB 1IRJA 3A4UB 1CKKA 3AKAA 3SG4A 5CPVA 1DF0A 2F8PA 1QX7A 4D1EA 3VRPA 2MA2A 1K94A 4C0KA 3DF0B 4PE4A 2L4IA 3CS1A 1Q80A 2L51A 2LM5A 1WRLA 1S5GZ 2M49B 5K89A 1TNPA 1KK7Y 4CLNA 3KHEA 2JRFA 1NX2A 3I5HB 1SRAA 1YVHA 2I2RE 2LVIA 5AANA 4MZLA 5CSJA 2KAXA 3O2PA 3CR2A 2JULA 3GK4X 2FOTA 1NP8A 1NIWA 1CLLA 1DF0B
chains in the Genus database with same CATH superfamily
1UURA 1B4CA 2K7OA 4GGFC 2JXLA 3OP0A 2AUCA 4GUKA 2LHIA 2BKHB 3L4AA 1TIZA 2ZFDA 1J7PA 2KHNA 5HYDA 3V2LA 2KQYA 3BUMB 3R1OA 2MBXA 1XFRA 1QIWA 3SS4A 1YRTB 3VRNA 1TCOB 2LAPA 1DMOA 1J55A 2D8NA 4PE0A 2FJUB 3R1PA 2L2CA 4GPLB 3A8RA 5HLVA 1RTP1 1UHNA 1KK8C 2PALA 1JF0A 2M7LA 2BECA 2H61A 3KF9A 4P5OE 4C0JA 1D1OA 1NX1A 1CFFA 2EHBA 1V1FA 3E3RA 1RWYA 2GGMA 1Y0VH 2WCFA 2ZRTA 4GBAA 2LLUA 5DICA 3FWBA 3LL8B 1EG4A 3VGOA 3I5GC 1B47A 4M2OA 1XVJA 1CMFA 3SG5A 1CFPA 1NWDA 1CB1A 3S0BA 1V1GA 1A4PA 3TUYB 1SKTA 1C7VA 4GAOA 2H2KA 2FJYA 1XA5A 2NLNA 1IGVA 1Z4HA 4KYNA 3BJHA 1BU3A 2JT8A 5GQQC 1YR5A 4F0ZB 1IG5A 2ZRSA 1JSAA 1LVCD 1BT6A 1XFXO 2DOQA 3DVJA 1WRZA 3KO0A 4HREE 3R72A 1WRKA 4ORAB 2WCLA 2L5YA 3I5FC 4JQ0D 1TRFA 2NCOA 2OS8C 2HQ8A 2Y4QA 3DVKA 4YI8A 3B88A 3VRRA 1BR4B 4YBHB 1VRKA 2LV7A 5AFPA 3NSKA 1PALA 3BUXB 2JNXA 1CLBA 3ICBA 1J1EA 1SMGA 1GJYA 5I8NA 1QX5B 1TNWA 2R2IA 1OZSA 4MEWA 4FQTA 1UHHA 1OZOA 2P71A 1F70A 3UNWA 1BMOA 1L2OB 1DT7B 3S0AA 2JC2A 2KGBC 1KFXL 2JNFA 2QEOA 3BYAA 5I2QA 1WLMA 3FE6A 3SG2A 1QS7A 2EC6C 5CSIA 3VRQA 3DVEA 1K9UA 3KEVA 5HKZA 1CNPA 3BFAA 3BXKA 2KFHA 2NXQA 1C3YA 1CDPA 1ZOTB 3AAJA 4N5XA 4HSZA 1K90D 2LP3A 2MAZA 3D10A 1F4OA 1FBVA 4R1EA 1KFXS 3L47A 1KSMA 3GK1A 4XYNA 3D76A 1MXLC 2JPOA 4MSPA 4YGDB 4PT1A 4INWA 2A4JA 1JFJA 3CABA 1NX0A 1Y6WA 4HRHA 3TZ1A 2WNDA 1C3ZA 1FF1A 2BL0B 4YGCB 3I5IC 1WLZA 3HCMA 3B7AA 1AP4A 3M0WA 3N7HA 1RJVA 1SR6C 2KAYA 3O4YA 1GM0A 2JTZA 2HETA 5PALA 1WDCC 1TUJA 3TS5B 2M8UA 1XK4C 1XFUO 4IL1A 3DY9A 4DIRA 1W7IB 3EK4A 5ER4X 4ZCVA 1TCFA 1TOPA 1XO5A 1R6PA 1ALVA 4CFRA 1S5GY 4MLWA 1G8IA 1AK8A 1LINA 5CSNA 3D0YA 1IJ5A 2ISDA 1IJ6A 3BUNB 3K1EA 4AQJA 1N2DA 2KSPA 2MHHA 1QLKA 1WY9A 5JOLA 1OOHA 3EK8A 4FTGA 1OMRA 3O78A 1H4BA 1ZFSA 1M45A 1XK4A 1A03A 4OZDA 2LVVA 2Y5IA 4YGBB 5IBWA 1YUSA 1J7RA 4GFTA 2G2BA 4I5LB 1QIVA 3EVVA 3D0YB 2F2PA 4PHNA 2K0JA 3L4LA 2VRGA 1LA0A 2RGIA 4MBEA 2KLDA 2MRDA 3H4SE 5B8IB 2O60A 5TNCA 1DJYA 3SG7A 1WDCB 2WOSA 1NSHA 4PCWA 2KI4C 1NX3A 5G08A 2M3WA 5KTYA 1XFVO 2OTGC 2JOJA 1OE9B 4WRIA 1S6IA 2F2OA 2JWWA 2LE9B 2M1KB 1LA3A 1SCVA 1DJZA 2CBLA 2HPSA 3B6XA 3NGVA 3NHIA 4PHMA 3IF7A 2WCMA 1B1GA 5AEQA 1M31A 2PVBA 1SK6D 4MRXA 2LMTA 2QDIA 1S3PA 1LKJA 5KSZA 3QRXA 4NDCA 1BG1A 2M9GA 2Q4UA 3WXAA 1J7QA 3PLFB 3QMEA 4GGFA 1QV1A 4QJ4B 1W9ZA 1YRUB 4OCIA 4M2QA 4WQ2A 2KFFA 4U8DA 2FCEA 4INXA 2QACA 1R2UA 1CDMA 2E6WA 3JTDC 2BCAA 2EGDA 2K2FA 3KPXA 1OMVA 3MSEB 1KFUL 1PULA 2NCPA 4YGEB 4YRUA 1J1DA 1BOCA 1TN4A 1EH2A 3GK2A 2ZNEA 3TDUA 4L9MA 1SCMC 3CR4X 1AJ4A 1UHIA 1YX7A 1QX2A 2BE6A 3CTNA 1E8AA 2WORA 2I7AA 1CM4A 1KFUS 1RROA 1YUUA 3DXLA 5CSFA 5EL2A 5ER5A 1F54A 1IQ5A 5D7FA 2K7CA 2KYFA 2KBMA 1TNXA 2JQ6A 1DJXA 1CDLA 1QTXA 1B8CA 5I2OA 5AERA 2KDHA 4HRGA 1M63B 3JVTC 2L2EA 1SPYA 1YTZC 1HT9A 1KK8B 2M0RA 1DJIA 4OKHA 4C0LA 2LC5A 3BOWA 4ORCB 3D78A 4JPZB 4I5NB 3HX4A 4PHKA 2KLEA 2KPHA 2KI6C 3DZTA 3S0EA 2LVKA 1YUTA 4GNKB 1OW4A 1L7ZA 2CXJA 2BAPA 2BBMA 5DKRA 5BPJA 2KQ6A 4TNCA 1CLMA 1IKUA 3OB2B 2M29A 3I5GB 3D73A 4A4BA 1M46A 2KGRA 1QASA 1SL9A 4CFQA 4FQOA 1NYAA 5DKQA 1SBJA 1QATA 2K8MB 1DVIA 2GTEA 1DELA 4OVNF 1JWDA 4MZJA 1RECA 3AKBA 2L5XB 3EK7A 2H8VA 3BOWB 3IVTA 4ICBA 3RLZA 2HQWA 1QWVA 1XFWO 3IQOA 1UHKA 2E30A 3EVUA 1EJ3A 4USLA 4PE1A 1KQMC 3I5FB 1NPQA 2LUCA 1Y1AA 3D74A 2OS8B 1T14A 3C1VA 2KNEA 4XJKA 3B86A 1MHOA 1CFDA 1KSOA 1RFJA 2COLB 4NDDA 4PDZA 1PSRA 1OSAA 1QVIZ 4JD9A 2JXCA 2LNKA 3NHTA 2PRUA 4N1FA 4DCKA 1SL7A 1PK0D 1K8UA 1TTXA 3B87A 1MWNA 1H8BA 3S0GA 1MQ1A 2IS9A 2M1UA 2OPOA 2NZ0A 1EG3A 3PFVA 4DS7A 4MN0A 3SIAA 2EC6B 3EKHA 4AQIA 2ZN8A 4UPGA 2WC5A 4XJKB 1XYDA 1UHJA 1SY9A 3K21A 3BFBA 1RK9A 4QJ3B 3FWCA 1B7TZ 1A29A 4NQGA 3LK1A 1TWOA 2I94A 3I5HC 2WCEA 1IH0A 1Z2CB 3BFHA 3F45A 3SJSA 4ETOA 1BLQA 2LP2A 2Q91A 2ZN9A 4AOMA 5HLOA 1KQMB 3PM8A 2QEVA 1QJTA 4ORBB 4NDBA 1GGWA 5I94A 3PM2A 2KBIA 2KFGA 1DTLA 5FI7A 2LMUA 3PALA 2ZKMX 3SG6A 1N0YA 2WCHA 2K7BA 4BY4A 3SS5A 4DUQA 3NSIA 1CTRA 1EL4A 3I5IB 4IJ7A 2HF5A 2WC8A 3WHTB 1SR6B 2BE4A 1DGUA 1ORGA 4A4CA 5D3OA 1KWOC 3FE8A 2JTTA 3CZTX 1YX8A 3CWGA 1W7JB 2MLEC 3SS3A 4DRWA 5HL1A 1UP5A 1K9KA 2BKIB 1IQ3A 5F6TA 1AHRA 1C07A 2QEBA 1TNQA 1JC2A 1A75A 1ZACA 1SNLA 1CFCA 1S1EA 1Y1UA 2K2AA 3NSLA 1KCYA 4MRYA 1S6CA 1F71A 1XFZO 1NCZA 1P28A 1A2XA 2K61A 3AAKA 2PQLA 1S26D 4JWQA 4Q04A 1HQVA 3NXAA 3TUYC 5FI6A 1OMDA 4MZKA 2BNXA 3TDZA 3VROA 2CT9A 2K7DA 1QXPA 2Y1MA 1PSBA 3BQ3A 1JUOA 1DJGA 2LUXA 1A75B 2H61C 2MJWB 3PSRA 3PN7C 1JFKA 1FI6A 2GV5A 2TN4A 1IWQA 4M2PA 2L4HA 1ZMZA 1B8LA 1KK7Z 1SL8A 4OV2A 3TDIA 3D75A 1F4QA 2KI6D 1KWOB 1SW8A 3RM1A 5KU1A 1G4YR 2M97A 2JT3A 2KYCA 2KI4B 2LHLA 2P70A 5AXIA 1BODA 1DJWA 3UO9A 1CM1A 1GQMA 2LMVA 2WC6A 4GGNA 2AAOA 3GOFA 3ZWHA 2OTGB 4PALA 2Y1NA 1S36A 1YURA 2CTNA 2KAVA 3ZNIA 3LCPC 1QLSA 5HKYA 1UUSA 1M39A 2BCBA 1U5IA 1AJ5A 1ZUZA 1K2HA 1GGZA 1JF2A 3OGNA 1DQEA 2KOTA 1PRWA 3LLEA 1ODBA 1L2OC 2ZNDA 3DVMA 1J7OA 4I5JA 1FW4A 1G33A 1MF8B 3EVRA 4CPVA 2QPTA 3RZSA 1X02A 1K95A 1NCXA 2MLFC 2P6BB 3SG3A 1DEKA 2JPTA 3S0DA 1OOIX 1TUZA 1F55A 3PN7B 3NSOA 4CIDA 3LK0A 1U5IB 1DC1A 3JTDB 1OQPA 1CMGA 4P2YB 2FCDA 4JKTA 3CZ2A 2I18A 1F8HA 1K9PA 3BUOB 4WQ3A 1NCYA 4YGAA 3CLNA 1KQVA 1QVIY 1K96A 3OB1B 1JBAA 2JZIA 4I5KA 1XFYO 1MUXA 1SCMB 2BL0C 2F33A 4E68A 2PMYA 1OOGA 4PE7A 2SCPA 4YI9A 1CDNA 5JJGA 1LXFC 2LANA 3CR5X 3TS5C 2B1UA 3BUWB 1MXEA 3WNXB 2BBNA 1SSEB 3Q8IA 1SYMA 2WCJA 5D69A 4N1GA 3JVTB 2V53A 1QV0A 1DJHA 1B7TY 5HKWA 3FIAA 3SIBA 3DD4A 1FI5A 2O5GA 3EKJA 5I2LA 2L98A 1OOFA 2LCPA 2M7NA 3CDNA 4BY5A 4PHJA 3PATA 2PASA 1B8RA 2AMIA 2SASA 5DKNA 5J3XA 3IQQA 2BCXA 1PVAA 1OOJA 1AVSA 2CNPA 3CZ1A 2F3ZA 2LLSA 1IIOA 2CCMA 2L0PA 2GGZA 3S0FA 1EXRA 4ZCUA 2PYQA 1C7WA 4F7FA 1BJFA 3OBVA 1UWOA 2YGUA 3D77A 1MR8A 1LS8A 3DYEA 1FPWA 2G9BA 2L50A 1ALWA 1B9AA 1BR1B 4QJ5B 4MVFA 3CZ0A 1BF5A 3O6BA 3FS7A 1S6JA 2K60A 3OHMB 3OX6A 2WCBA 2LVJA 1Y1XA 2JT0A 1YVLA 2JU0A 2LLTA 3DF0A 3FE9A 3PJIA 3CGAA 5FYXA 4OR9B 1K93D 2F3YA 3WHUB 1PVBA 3CYZA 1NUBA 1DGVA 2PSRA 3OX5A 1N65A 1AUIB 1IRJA 3R1VA 3A4UB 1CKKA 3AKAA 3SG4A 5CPVA 3EG5B 1DF0A 2F8PA 2WCKA 1QX7A 2QEHA 4D1EA 3VRPA 2MA2A 1K94A 4C0KA 3DF0B 4PE4A 2L4IA 3CS1A 1Q80A 2L51A 2LM5A 1WRLA 1S5GZ 2M49B 5K89A 1TNPA 1KK7Y 4CLNA 3KHEA 2JRFA 1NX2A 3I5HB 2ERBA 1SRAA 1YVHA 3VB1A 2I2RE 2LVIA 5AANA 4MZLA 5CSJA 2KAXA 3O2PA 3CR2A 2JULA 3GK4X 5FI2A 2FOTA 1NP8A 3O4XA 1NIWA 1CLLA 1DF0B
chains in the Genus database with same CATH topology
1UURA 1B4CA 2K7OA 4GGFC 2JXLA 3OP0A 2AUCA 4GUKA 2LHIA 2BKHB 1TIZA 2ZFDA 1J7PA 2KHNA 5HYDA 2KQYA 3BUMB 2MBXA 1QIWA 1YRTB 3VRNA 1TCOB 2LAPA 1DMOA 1J55A 2D8NA 4PE0A 2FJUB 4GPLB 3A8RA 5HLVA 1RTP1 1UHNA 1KK8C 2PALA 1JF0A 2M7LA 2BECA 2H61A 3KF9A 4P5OE 4C0JA 1D1OA 1NX1A 2EHBA 1V1FA 3E3RA 1RWYA 2GGMA 1Y0VH 2WCFA 2ZRTA 4GBAA 2LLUA 3FWBA 3LL8B 1EG4A 3VGOA 3I5GC 1B47A 4M2OA 1XVJA 1CMFA 3SG5A 1CFPA 1NWDA 1CB1A 1V1GA 1A4PA 3TUYB 1SKTA 1C7VA 4GAOA 2H2KA 1XA5A 2NLNA 1IGVA 1BU3A 2JT8A 5GQQC 1YR5A 4F0ZB 1IG5A 2ZRSA 1JSAA 1LVCD 1BT6A 1XFXO 2DOQA 3DVJA 1WRZA 3KO0A 4HREE 1WRKA 4ORAB 3I5FC 4JQ0D 1TRFA 2NCOA 2OS8C 2HQ8A 2Y4QA 3DVKA 4YI8A 3VRRA 1BR4B 4YBHB 1VRKA 2LV7A 5AFPA 3NSKA 1PALA 3BUXB 2JNXA 1CLBA 3ICBA 1J1EA 1SMGA 1GJYA 5I8NA 1QX5B 1TNWA 2R2IA 1OZSA 4MEWA 1UHHA 1OZOA 1F70A 1BMOA 1L2OB 1DT7B 2JC2A 2KGBC 1KFXL 2JNFA 3BYAA 5I2QA 1WLMA 3SG2A 1QS7A 2EC6C 5CSIA 3VRQA 3DVEA 1K9UA 3KEVA 5HKZA 1CNPA 3BXKA 2KFHA 2NXQA 1CDPA 1ZOTB 3AAJA 4N5XA 4HSZA 1K90D 2LP3A 2MAZA 3D10A 1F4OA 1FBVA 4R1EA 1KFXS 1KSMA 3GK1A 4XYNA 1MXLC 4MSPA 4YGDB 2A4JA 1JFJA 1NX0A 1Y6WA 4HRHA 3TZ1A 2WNDA 1FF1A 2BL0B 4YGCB 3I5IC 1WLZA 3HCMA 1AP4A 3M0WA 1RJVA 1SR6C 2KAYA 3O4YA 2JTZA 2HETA 5PALA 1WDCC 3TS5B 2M8UA 1XK4C 1XFUO 4IL1A 4DIRA 1W7IB 3EK4A 5ER4X 4ZCVA 1TCFA 1TOPA 1XO5A 1R6PA 1ALVA 4CFRA 1S5GY 4MLWA 1G8IA 1AK8A 1LINA 5CSNA 3D0YA 1IJ5A 2ISDA 1IJ6A 3BUNB 4AQJA 1N2DA 2KSPA 2MHHA 1QLKA 1WY9A 5JOLA 3EK8A 4FTGA 1OMRA 3O78A 1H4BA 1ZFSA 1M45A 1XK4A 1A03A 2LVVA 2Y5IA 4YGBB 5IBWA 1YUSA 1J7RA 4GFTA 2G2BA 4I5LB 1QIVA 3EVVA 3D0YB 2F2PA 4PHNA 2K0JA 2VRGA 1LA0A 2RGIA 4MBEA 2MRDA 3H4SE 5B8IB 2O60A 5TNCA 1DJYA 3SG7A 1WDCB 2WOSA 1NSHA 4PCWA 2KI4C 1NX3A 5G08A 2M3WA 5KTYA 1XFVO 2OTGC 2JOJA 1OE9B 4WRIA 1S6IA 2F2OA 2JWWA 2LE9B 2M1KB 1LA3A 1SCVA 1DJZA 2CBLA 2HPSA 4PHMA 1B1GA 1CFFA 3IF7A 5AEQA 1M31A 2PVBA 1SK6D 4MRXA 2LMTA 1S3PA 1LKJA 5KSZA 3QRXA 4NDCA 1BG1A 2M9GA 2Q4UA 3WXAA 1J7QA 3PLFB 4GGFA 4QJ4B 1QV1A 1YRUB 4OCIA 4M2QA 4WQ2A 2KFFA 4U8DA 2FCEA 2QACA 1R2UA 1CDMA 2E6WA 3JTDC 2BCAA 2EGDA 2K2FA 3KPXA 1OMVA 3MSEB 1KFUL 1PULA 2NCPA 4YGEB 4YRUA 1J1DA 1BOCA 1TN4A 1EH2A 3GK2A 2ZNEA 3TDUA 4L9MA 1SCMC 3CR4X 1AJ4A 1UHIA 1YX7A 1QX2A 2BE6A 3CTNA 1E8AA 2WORA 2I7AA 1CM4A 1KFUS 1RROA 1YUUA 5CSFA 1F54A 5ER5A 1IQ5A 5D7FA 2K7CA 2KYFA 2KBMA 1TNXA 2JQ6A 1DJXA 1CDLA 1QTXA 1B8CA 5I2OA 5AERA 2KDHA 4HRGA 1M63B 3JVTC 2L2EA 1SPYA 1YTZC 1HT9A 1KK8B 2M0RA 1DJIA 4OKHA 4C0LA 2LC5A 3BOWA 4ORCB 4JPZB 4I5NB 3HX4A 4PHKA 2KI6C 2LVKA 1YUTA 4GNKB 1L7ZA 2CXJA 2BBMA 5DKRA 5BPJA 2KQ6A 4TNCA 1CLMA 1IKUA 3OB2B 2M29A 3I5GB 4A4BA 1M46A 2KGRA 1QASA 1SL9A 4CFQA 4FQOA 1NYAA 5DKQA 1SBJA 1QATA 2K8MB 1DVIA 4OVNF 1JWDA 4MZJA 1RECA 3AKBA 2L5XB 3EK7A 4ICBA 3BOWB 3RLZA 2HQWA 1XFWO 3IQOA 1UHKA 2E30A 3EVUA 1EJ3A 4USLA 4PE1A 1KQMC 3I5FB 1NPQA 2LUCA 1Y1AA 2OS8B 3C1VA 2KNEA 4XJKA 1MHOA 1CFDA 2COLB 1KSOA 1RFJA 4NDDA 4PDZA 1PSRA 1OSAA 1QVIZ 2JXCA 2LNKA 2PRUA 4N1FA 4DCKA 1SL7A 1PK0D 1K8UA 1TTXA 1MWNA 1H8BA 1MQ1A 2IS9A 2M1UA 2OPOA 2NZ0A 1EG3A 3PFVA 4DS7A 4MN0A 3SIAA 2EC6B 3EKHA 4AQIA 2ZN8A 4UPGA 4XJKB 1XYDA 1UHJA 1SY9A 3K21A 1RK9A 4QJ3B 3FWCA 1B7TZ 1A29A 4NQGA 3LK1A 2I94A 3I5HC 2WCEA 1IH0A 3SJSA 3F45A 4ETOA 1BLQA 2LP2A 2Q91A 2ZN9A 4AOMA 5HLOA 1KQMB 3PM8A 1GGWA 1QJTA 4ORBB 4NDBA 2KBIA 2KFGA 1DTLA 2LMUA 3PALA 2ZKMX 3SG6A 1N0YA 2K7BA 4BY4A 4DUQA 3NSIA 1CTRA 1EL4A 3I5IB 2HF5A 2WC8A 3WHTB 1SR6B 2BE4A 1DGUA 4A4CA 1KWOC 2JTTA 3CZTX 1YX8A 3CWGA 1W7JB 2MLEC 4DRWA 2BKIB 1UP5A 1K9KA 1IQ3A 5F6TA 1AHRA 1C07A 1TNQA 1JC2A 1A75A 1ZACA 1SNLA 1CFCA 1S1EA 1Y1UA 2K2AA 3NSLA 1KCYA 4MRYA 1S6CA 1F71A 1XFZO 1NCZA 2K61A 1A2XA 3AAKA 4Q04A 1S26D 4JWQA 3TUYC 1HQVA 3NXAA 1OMDA 4MZKA 3TDZA 3VROA 2CT9A 2K7DA 1QXPA 2Y1MA 1PSBA 3BQ3A 1JUOA 1DJGA 2LUXA 1A75B 2H61C 2MJWB 3PSRA 3PN7C 1JFKA 1FI6A 2GV5A 2TN4A 1IWQA 4M2PA 2L4HA 1ZMZA 1B8LA 1KK7Z 1SL8A 4OV2A 1F4QA 2KI6D 1KWOB 1SW8A 3RM1A 5KU1A 1G4YR 2M97A 2JT3A 2KYCA 2KI4B 2LHLA 5AXIA 1BODA 1DJWA 1CM1A 1GQMA 2LMVA 4GGNA 2AAOA 3GOFA 3ZWHA 2OTGB 4PALA 2Y1NA 1S36A 1YURA 2CTNA 2KAVA 3ZNIA 3LCPC 1QLSA 5HKYA 1UUSA 1M39A 2BCBA 1U5IA 1AJ5A 1ZUZA 1K2HA 1GGZA 1JF2A 2KOTA 1PRWA 3LLEA 1ODBA 1L2OC 2ZNDA 3DVMA 1J7OA 4I5JA 1FW4A 1G33A 1MF8B 3EVRA 4CPVA 2QPTA 1X02A 1K95A 1NCXA 2MLFC 2P6BB 3SG3A 2JPTA 1F55A 3PN7B 3NSOA 4CIDA 3LK0A 1U5IB 3JTDB 1OQPA 1CMGA 4P2YB 2FCDA 2I18A 1F8HA 1K9PA 3BUOB 4WQ3A 1NCYA 4YGAA 3CLNA 1KQVA 1QVIY 1K96A 3OB1B 1JBAA 2JZIA 4I5KA 1XFYO 1MUXA 1SCMB 2BL0C 2F33A 4E68A 2PMYA 4PE7A 2SCPA 4YI9A 1CDNA 5JJGA 1LXFC 2LANA 3CR5X 3TS5C 2B1UA 3BUWB 1MXEA 3WNXB 2BBNA 1SYMA 5D69A 4N1GA 3JVTB 2V53A 1QV0A 1DJHA 1B7TY 5HKWA 3FIAA 3SIBA 3DD4A 1FI5A 2O5GA 3EKJA 5I2LA 2L98A 2LCPA 2M7NA 4BY5A 4PHJA 3PATA 2PASA 1B8RA 2AMIA 2SASA 5DKNA 5J3XA 3IQQA 2BCXA 1PVAA 1OOJA 1AVSA 2CNPA 2F3ZA 2LLSA 2CCMA 2L0PA 2GGZA 1EXRA 4ZCUA 1C7WA 1BJFA 1UWOA 1MR8A 1FPWA 2G9BA 2L50A 1ALWA 1B9AA 1BR1B 4QJ5B 4MVFA 1BF5A 3O6BA 3FS7A 1S6JA 3OHMB 3OX6A 2WCBA 2LVJA 1Y1XA 2JT0A 1YVLA 2JU0A 2LLTA 3DF0A 5FYXA 3TDIA 3CGAA 4OR9B 1K93D 2F3YA 3WHUB 1PVBA 1NUBA 1DGVA 2PSRA 3OX5A 1N65A 1AUIB 1IRJA 3A4UB 1CKKA 3AKAA 3SG4A 5CPVA 1DF0A 2F8PA 1QX7A 4D1EA 3VRPA 2MA2A 1K94A 4C0KA 3DF0B 4PE4A 2L4IA 3CS1A 1Q80A 2L51A 2LM5A 1WRLA 1S5GZ 2M49B 5K89A 1TNPA 1KK7Y 4CLNA 3KHEA 2JRFA 1NX2A 3I5HB 1SRAA 1YVHA 2I2RE 2LVIA 5AANA 4MZLA 5CSJA 2KAXA 3O2PA 3CR2A 2JULA 3GK4X 2FOTA 1NP8A 1NIWA 1CLLA 1DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUR A;  1B4C A;  2K7O A;  4GGF C;  2JXL A;  3OP0 A;  2AUC A;  4GUK A;  2LHI A;  2BKH B;  1TIZ A;  2ZFD A;  1J7P A;  2KHN A;  5HYD A;  2KQY A;  3BUM B;  2MBX A;  1QIW A;  1YRT B;  3VRN A;  1TCO B;  2LAP A;  1DMO A;  1J55 A;  2D8N A;  4PE0 A;  2FJU B;  4GPL B;  3A8R A;  5HLV A;  1RTP 1;  1UHN A;  1KK8 C;  2PAL A;  1JF0 A;  2M7L A;  2BEC A;  2H61 A;  3KF9 A;  4P5O E;  4C0J A;  1D1O A;  1NX1 A;  2EHB A;  1V1F A;  3E3R A;  1RWY A;  2GGM A;  1Y0V H;  2WCF A;  2ZRT A;  4GBA A;  2LLU A;  3FWB A;  3LL8 B;  1EG4 A;  3VGO A;  3I5G C;  1B47 A;  4M2O A;  1XVJ A;  1CMF A;  3SG5 A;  1CFP A;  1NWD A;  1CB1 A;  1V1G A;  1A4P A;  3TUY B;  1SKT A;  1C7V A;  4GAO A;  2H2K A;  1XA5 A;  2NLN A;  1IGV A;  1BU3 A;  2JT8 A;  5GQQ C;  1YR5 A;  4F0Z B;  1IG5 A;  2ZRS A;  1JSA A;  1LVC D;  1BT6 A;  1XFX O;  2DOQ A;  3DVJ A;  1WRZ A;  3KO0 A;  4HRE E;  1WRK A;  4ORA B;  3I5F C;  4JQ0 D;  1TRF A;  2NCO A;  2OS8 C;  2HQ8 A;  2Y4Q A;  3DVK A;  4YI8 A;  3VRR A;  1BR4 B;  4YBH B;  1VRK A;  2LV7 A;  5AFP A;  3NSK A;  1PAL A;  3BUX B;  2JNX A;  1CLB A;  3ICB A;  1J1E A;  1SMG A;  1GJY A;  5I8N A;  1QX5 B;  1TNW A;  2R2I A;  1OZS A;  4MEW A;  1UHH A;  1OZO A;  1F70 A;  1BMO A;  1L2O B;  1DT7 B;  2JC2 A;  2KGB C;  1KFX L;  2JNF A;  3BYA A;  5I2Q A;  1WLM A;  3SG2 A;  1QS7 A;  2EC6 C;  5CSI A;  3VRQ A;  3DVE A;  1K9U A;  3KEV A;  5HKZ A;  1CNP A;  3BXK A;  2KFH A;  2NXQ A;  1CDP A;  1ZOT B;  3AAJ A;  4N5X A;  4HSZ A;  1K90 D;  2LP3 A;  2MAZ A;  3D10 A;  1F4O A;  1FBV A;  4R1E A;  1KFX S;  1KSM A;  3GK1 A;  4XYN A;  1MXL C;  4MSP A;  4YGD B;  2A4J A;  1JFJ A;  1NX0 A;  1Y6W A;  4HRH A;  3TZ1 A;  2WND A;  1FF1 A;  2BL0 B;  4YGC B;  3I5I C;  1WLZ A;  3HCM A;  1AP4 A;  3M0W A;  1RJV A;  1SR6 C;  2KAY A;  3O4Y A;  2JTZ A;  2HET A;  5PAL A;  1WDC C;  3TS5 B;  2M8U A;  1XK4 C;  1XFU O;  4IL1 A;  4DIR A;  1W7I B;  3EK4 A;  5ER4 X;  4ZCV A;  1TCF A;  1TOP A;  1XO5 A;  1R6P A;  1ALV A;  4CFR A;  1S5G Y;  4MLW A;  1G8I A;  1AK8 A;  1LIN A;  5CSN A;  3D0Y A;  1IJ5 A;  2ISD A;  1IJ6 A;  3BUN B;  4AQJ A;  1N2D A;  2KSP A;  2MHH A;  1QLK A;  1WY9 A;  5JOL A;  3EK8 A;  4FTG A;  1OMR A;  3O78 A;  1H4B A;  1ZFS A;  1M45 A;  1XK4 A;  1A03 A;  2LVV A;  2Y5I A;  4YGB B;  5IBW A;  1YUS A;  1J7R A;  4GFT A;  2G2B A;  4I5L B;  1QIV A;  3EVV A;  3D0Y B;  2F2P A;  4PHN A;  2K0J A;  2VRG A;  1LA0 A;  2RGI A;  4MBE A;  2MRD A;  3H4S E;  5B8I B;  2O60 A;  5TNC A;  1DJY A;  3SG7 A;  1WDC B;  2WOS A;  1NSH A;  4PCW A;  2KI4 C;  1NX3 A;  5G08 A;  2M3W A;  5KTY A;  1XFV O;  2OTG C;  2JOJ A;  1OE9 B;  4WRI A;  1S6I A;  2F2O A;  2JWW A;  2LE9 B;  2M1K B;  1LA3 A;  1SCV A;  1DJZ A;  2CBL A;  2HPS A;  4PHM A;  1B1G A;  1CFF A;  3IF7 A;  5AEQ A;  1M31 A;  2PVB A;  1SK6 D;  4MRX A;  2LMT A;  1S3P A;  1LKJ A;  5KSZ A;  3QRX A;  4NDC A;  1BG1 A;  2M9G A;  2Q4U A;  3WXA A;  1J7Q A;  3PLF B;  4GGF A;  4QJ4 B;  1QV1 A;  1YRU B;  4OCI A;  4M2Q A;  4WQ2 A;  2KFF A;  4U8D A;  2FCE A;  2QAC A;  1R2U A;  1CDM A;  2E6W A;  3JTD C;  2BCA A;  2EGD A;  2K2F A;  3KPX A;  1OMV A;  3MSE B;  1KFU L;  1PUL A;  2NCP A;  4YGE B;  4YRU A;  1J1D A;  1BOC A;  1TN4 A;  1EH2 A;  3GK2 A;  2ZNE A;  3TDU A;  4L9M A;  1SCM C;  3CR4 X;  1AJ4 A;  1UHI A;  1YX7 A;  1QX2 A;  2BE6 A;  3CTN A;  1E8A A;  2WOR A;  2I7A A;  1CM4 A;  1KFU S;  1RRO A;  1YUU A;  5CSF A;  1F54 A;  5ER5 A;  1IQ5 A;  5D7F A;  2K7C A;  2KYF A;  2KBM A;  1TNX A;  2JQ6 A;  1DJX A;  1CDL A;  1QTX A;  1B8C A;  5I2O A;  5AER A;  2KDH A;  4HRG A;  1M63 B;  3JVT C;  2L2E A;  1SPY A;  1YTZ C;  1HT9 A;  1KK8 B;  2M0R A;  1DJI A;  4OKH A;  4C0L A;  2LC5 A;  3BOW A;  4ORC B;  4JPZ B;  4I5N B;  3HX4 A;  4PHK A;  2KI6 C;  2LVK A;  1YUT A;  4GNK B;  1L7Z A;  2CXJ A;  2BBM A;  5DKR A;  5BPJ A;  2KQ6 A;  4TNC A;  1CLM A;  1IKU A;  3OB2 B;  2M29 A;  3I5G B;  4A4B A;  1M46 A;  2KGR A;  1QAS A;  1SL9 A;  4CFQ A;  4FQO A;  1NYA A;  5DKQ A;  1SBJ A;  1QAT A;  2K8M B;  1DVI A;  4OVN F;  1JWD A;  4MZJ A;  1REC A;  3AKB A;  2L5X B;  3EK7 A;  4ICB A;  3BOW B;  3RLZ A;  2HQW A;  1XFW O;  3IQO A;  1UHK A;  2E30 A;  3EVU A;  1EJ3 A;  4USL A;  4PE1 A;  1KQM C;  3I5F B;  1NPQ A;  2LUC A;  1Y1A A;  2OS8 B;  3C1V A;  2KNE A;  4XJK A;  1MHO A;  1CFD A;  2COL B;  1KSO A;  1RFJ A;  4NDD A;  4PDZ A;  1PSR A;  1OSA A;  1QVI Z;  2JXC A;  2LNK A;  2PRU A;  4N1F A;  4DCK A;  1SL7 A;  1PK0 D;  1K8U A;  1TTX A;  1MWN A;  1H8B A;  1MQ1 A;  2IS9 A;  2M1U A;  2OPO A;  2NZ0 A;  1EG3 A;  3PFV A;  4DS7 A;  4MN0 A;  3SIA A;  2EC6 B;  3EKH A;  4AQI A;  2ZN8 A;  4UPG A;  4XJK B;  1XYD A;  1UHJ A;  1SY9 A;  3K21 A;  1RK9 A;  4QJ3 B;  3FWC A;  1B7T Z;  1A29 A;  4NQG A;  3LK1 A;  2I94 A;  3I5H C;  2WCE A;  1IH0 A;  3SJS A;  3F45 A;  4ETO A;  1BLQ A;  2LP2 A;  2Q91 A;  2ZN9 A;  4AOM A;  5HLO A;  1KQM B;  3PM8 A;  1GGW A;  1QJT A;  4ORB B;  4NDB A;  2KBI A;  2KFG A;  1DTL A;  2LMU A;  3PAL A;  2ZKM X;  3SG6 A;  1N0Y A;  2K7B A;  4BY4 A;  4DUQ A;  3NSI A;  1CTR A;  1EL4 A;  3I5I B;  2HF5 A;  2WC8 A;  3WHT B;  1SR6 B;  2BE4 A;  1DGU A;  4A4C A;  1KWO C;  2JTT A;  3CZT X;  1YX8 A;  3CWG A;  1W7J B;  2MLE C;  4DRW A;  2BKI B;  1UP5 A;  1K9K A;  1IQ3 A;  5F6T A;  1AHR A;  1C07 A;  1TNQ A;  1JC2 A;  1A75 A;  1ZAC A;  1SNL A;  1CFC A;  1S1E A;  1Y1U A;  2K2A A;  3NSL A;  1KCY A;  4MRY A;  1S6C A;  1F71 A;  1XFZ O;  1NCZ A;  2K61 A;  1A2X A;  3AAK A;  4Q04 A;  1S26 D;  4JWQ A;  3TUY C;  1HQV A;  3NXA A;  1OMD A;  4MZK A;  3TDZ A;  3VRO A;  2CT9 A;  2K7D A;  1QXP A;  2Y1M A;  1PSB A;  3BQ3 A;  1JUO A;  1DJG A;  2LUX A;  1A75 B;  2H61 C;  2MJW B;  3PSR A;  3PN7 C;  1JFK A;  1FI6 A;  2GV5 A;  2TN4 A;  1IWQ A;  4M2P A;  2L4H A;  1ZMZ A;  1B8L A;  1KK7 Z;  1SL8 A;  4OV2 A;  1F4Q A;  2KI6 D;  1KWO B;  1SW8 A;  3RM1 A;  5KU1 A;  1G4Y R;  2M97 A;  2JT3 A;  2KYC A;  2KI4 B;  2LHL A;  5AXI A;  1BOD A;  1DJW A;  1CM1 A;  1GQM A;  2LMV A;  4GGN A;  2AAO A;  3GOF A;  3ZWH A;  2OTG B;  4PAL A;  2Y1N A;  1S36 A;  1YUR A;  2CTN A;  2KAV A;  3ZNI A;  3LCP C;  1QLS A;  5HKY A;  1UUS A;  1M39 A;  2BCB A;  1U5I A;  1AJ5 A;  1ZUZ A;  1K2H A;  1GGZ A;  1JF2 A;  2KOT A;  1PRW A;  3LLE A;  1ODB A;  1L2O C;  2ZND A;  3DVM A;  1J7O A;  4I5J A;  1FW4 A;  1G33 A;  1MF8 B;  3EVR A;  4CPV A;  2QPT A;  1X02 A;  1K95 A;  1NCX A;  2MLF C;  2P6B B;  3SG3 A;  2JPT A;  1F55 A;  3PN7 B;  3NSO A;  4CID A;  3LK0 A;  1U5I B;  3JTD B;  1OQP A;  1CMG A;  4P2Y B;  2FCD A;  2I18 A;  1F8H A;  1K9P A;  3BUO B;  4WQ3 A;  1NCY A;  4YGA A;  3CLN A;  1KQV A;  1QVI Y;  1K96 A;  3OB1 B;  1JBA A;  2JZI A;  4I5K A;  1XFY O;  1MUX A;  1SCM B;  2BL0 C;  2F33 A;  4E68 A;  2PMY A;  4PE7 A;  2SCP A;  4YI9 A;  1CDN A;  5JJG A;  1LXF C;  2LAN A;  3CR5 X;  3TS5 C;  2B1U A;  3BUW B;  1MXE A;  3WNX B;  2BBN A;  1SYM A;  5D69 A;  4N1G A;  3JVT B;  2V53 A;  1QV0 A;  1DJH A;  1B7T Y;  5HKW A;  3FIA A;  3SIB A;  3DD4 A;  1FI5 A;  2O5G A;  3EKJ A;  5I2L A;  2L98 A;  2LCP A;  2M7N A;  4BY5 A;  4PHJ A;  3PAT A;  2PAS A;  1B8R A;  2AMI A;  2SAS A;  5DKN A;  5J3X A;  3IQQ A;  2BCX A;  1PVA A;  1OOJ A;  1AVS A;  2CNP A;  2F3Z A;  2LLS A;  2CCM A;  2L0P A;  2GGZ A;  1EXR A;  4ZCU A;  1C7W A;  1BJF A;  1UWO A;  1MR8 A;  1FPW A;  2G9B A;  2L50 A;  1ALW A;  1B9A A;  1BR1 B;  4QJ5 B;  4MVF A;  1BF5 A;  3O6B A;  3FS7 A;  1S6J A;  3OHM B;  3OX6 A;  2WCB A;  2LVJ A;  1Y1X A;  2JT0 A;  1YVL A;  2JU0 A;  2LLT A;  3DF0 A;  5FYX A;  3TDI A;  3CGA A;  4OR9 B;  1K93 D;  2F3Y A;  3WHU B;  1PVB A;  1NUB A;  1DGV A;  2PSR A;  3OX5 A;  1N65 A;  1AUI B;  1IRJ A;  3A4U B;  1CKK A;  3AKA A;  3SG4 A;  5CPV A;  1DF0 A;  2F8P A;  1QX7 A;  4D1E A;  3VRP A;  2MA2 A;  1K94 A;  4C0K A;  3DF0 B;  4PE4 A;  2L4I A;  3CS1 A;  1Q80 A;  2L51 A;  2LM5 A;  1WRL A;  1S5G Z;  2M49 B;  5K89 A;  1TNP A;  1KK7 Y;  4CLN A;  3KHE A;  2JRF A;  1NX2 A;  3I5H B;  1SRA A;  1YVH A;  2I2R E;  2LVI A;  5AAN A;  4MZL A;  5CSJ A;  2KAX A;  3O2P A;  3CR2 A;  2JUL A;  3GK4 X;  2FOT A;  1NP8 A;  1NIW A;  1CLL A;  1DF0 B; 
#chains in the Genus database with same CATH topology
 1UUR A;  1B4C A;  2K7O A;  4GGF C;  2JXL A;  3OP0 A;  2AUC A;  4GUK A;  2LHI A;  2BKH B;  3L4A A;  1TIZ A;  2ZFD A;  1J7P A;  2KHN A;  5HYD A;  3V2L A;  2KQY A;  3BUM B;  3R1O A;  2MBX A;  1XFR A;  1QIW A;  3SS4 A;  1YRT B;  3VRN A;  1TCO B;  2LAP A;  1DMO A;  1J55 A;  2D8N A;  4PE0 A;  2FJU B;  3R1P A;  2L2C A;  4GPL B;  3A8R A;  5HLV A;  1RTP 1;  1UHN A;  1KK8 C;  2PAL A;  1JF0 A;  2M7L A;  2BEC A;  2H61 A;  3KF9 A;  4P5O E;  4C0J A;  1D1O A;  1NX1 A;  1CFF A;  2EHB A;  1V1F A;  3E3R A;  1RWY A;  2GGM A;  1Y0V H;  2WCF A;  2ZRT A;  4GBA A;  2LLU A;  5DIC A;  3FWB A;  3LL8 B;  1EG4 A;  3VGO A;  3I5G C;  1B47 A;  4M2O A;  1XVJ A;  1CMF A;  3SG5 A;  1CFP A;  1NWD A;  1CB1 A;  3S0B A;  1V1G A;  1A4P A;  3TUY B;  1SKT A;  1C7V A;  4GAO A;  2H2K A;  2FJY A;  1XA5 A;  2NLN A;  1IGV A;  1Z4H A;  4KYN A;  3BJH A;  1BU3 A;  2JT8 A;  5GQQ C;  1YR5 A;  4F0Z B;  1IG5 A;  2ZRS A;  1JSA A;  1LVC D;  1BT6 A;  1XFX O;  2DOQ A;  3DVJ A;  1WRZ A;  3KO0 A;  4HRE E;  3R72 A;  1WRK A;  4ORA B;  2WCL A;  2L5Y A;  3I5F C;  4JQ0 D;  1TRF A;  2NCO A;  2OS8 C;  2HQ8 A;  2Y4Q A;  3DVK A;  4YI8 A;  3B88 A;  3VRR A;  1BR4 B;  4YBH B;  1VRK A;  2LV7 A;  5AFP A;  3NSK A;  1PAL A;  3BUX B;  2JNX A;  1CLB A;  3ICB A;  1J1E A;  1SMG A;  1GJY A;  5I8N A;  1QX5 B;  1TNW A;  2R2I A;  1OZS A;  4MEW A;  4FQT A;  1UHH A;  1OZO A;  2P71 A;  1F70 A;  3UNW A;  1BMO A;  1L2O B;  1DT7 B;  3S0A A;  2JC2 A;  2KGB C;  1KFX L;  2JNF A;  2QEO A;  3BYA A;  5I2Q A;  1WLM A;  3FE6 A;  3SG2 A;  1QS7 A;  2EC6 C;  5CSI A;  3VRQ A;  3DVE A;  1K9U A;  3KEV A;  5HKZ A;  1CNP A;  3BFA A;  3BXK A;  2KFH A;  2NXQ A;  1C3Y A;  1CDP A;  1ZOT B;  3AAJ A;  4N5X A;  4HSZ A;  1K90 D;  2LP3 A;  2MAZ A;  3D10 A;  1F4O A;  1FBV A;  4R1E A;  1KFX S;  3L47 A;  1KSM A;  3GK1 A;  4XYN A;  3D76 A;  1MXL C;  2JPO A;  4MSP A;  4YGD B;  4PT1 A;  4INW A;  2A4J A;  1JFJ A;  3CAB A;  1NX0 A;  1Y6W A;  4HRH A;  3TZ1 A;  2WND A;  1C3Z A;  1FF1 A;  2BL0 B;  4YGC B;  3I5I C;  1WLZ A;  3HCM A;  3B7A A;  1AP4 A;  3M0W A;  3N7H A;  1RJV A;  1SR6 C;  2KAY A;  3O4Y A;  1GM0 A;  2JTZ A;  2HET A;  5PAL A;  1WDC C;  1TUJ A;  3TS5 B;  2M8U A;  1XK4 C;  1XFU O;  4IL1 A;  3DY9 A;  4DIR A;  1W7I B;  3EK4 A;  5ER4 X;  4ZCV A;  1TCF A;  1TOP A;  1XO5 A;  1R6P A;  1ALV A;  4CFR A;  1S5G Y;  4MLW A;  1G8I A;  1AK8 A;  1LIN A;  5CSN A;  3D0Y A;  1IJ5 A;  2ISD A;  1IJ6 A;  3BUN B;  3K1E A;  4AQJ A;  1N2D A;  2KSP A;  2MHH A;  1QLK A;  1WY9 A;  5JOL A;  1OOH A;  3EK8 A;  4FTG A;  1OMR A;  3O78 A;  1H4B A;  1ZFS A;  1M45 A;  1XK4 A;  1A03 A;  4OZD A;  2LVV A;  2Y5I A;  4YGB B;  5IBW A;  1YUS A;  1J7R A;  4GFT A;  2G2B A;  4I5L B;  1QIV A;  3EVV A;  3D0Y B;  2F2P A;  4PHN A;  2K0J A;  3L4L A;  2VRG A;  1LA0 A;  2RGI A;  4MBE A;  2KLD A;  2MRD A;  3H4S E;  5B8I B;  2O60 A;  5TNC A;  1DJY A;  3SG7 A;  1WDC B;  2WOS A;  1NSH A;  4PCW A;  2KI4 C;  1NX3 A;  5G08 A;  2M3W A;  5KTY A;  1XFV O;  2OTG C;  2JOJ A;  1OE9 B;  4WRI A;  1S6I A;  2F2O A;  2JWW A;  2LE9 B;  2M1K B;  1LA3 A;  1SCV A;  1DJZ A;  2CBL A;  2HPS A;  3B6X A;  3NGV A;  3NHI A;  4PHM A;  3IF7 A;  2WCM A;  1B1G A;  5AEQ A;  1M31 A;  2PVB A;  1SK6 D;  4MRX A;  2LMT A;  2QDI A;  1S3P A;  1LKJ A;  5KSZ A;  3QRX A;  4NDC A;  1BG1 A;  2M9G A;  2Q4U A;  3WXA A;  1J7Q A;  3PLF B;  3QME A;  4GGF A;  1QV1 A;  4QJ4 B;  1W9Z A;  1YRU B;  4OCI A;  4M2Q A;  4WQ2 A;  2KFF A;  4U8D A;  2FCE A;  4INX A;  2QAC A;  1R2U A;  1CDM A;  2E6W A;  3JTD C;  2BCA A;  2EGD A;  2K2F A;  3KPX A;  1OMV A;  3MSE B;  1KFU L;  1PUL A;  2NCP A;  4YGE B;  4YRU A;  1J1D A;  1BOC A;  1TN4 A;  1EH2 A;  3GK2 A;  2ZNE A;  3TDU A;  4L9M A;  1SCM C;  3CR4 X;  1AJ4 A;  1UHI A;  1YX7 A;  1QX2 A;  2BE6 A;  3CTN A;  1E8A A;  2WOR A;  2I7A A;  1CM4 A;  1KFU S;  1RRO A;  1YUU A;  3DXL A;  5CSF A;  5EL2 A;  5ER5 A;  1F54 A;  1IQ5 A;  5D7F A;  2K7C A;  2KYF A;  2KBM A;  1TNX A;  2JQ6 A;  1DJX A;  1CDL A;  1QTX A;  1B8C A;  5I2O A;  5AER A;  2KDH A;  4HRG A;  1M63 B;  3JVT C;  2L2E A;  1SPY A;  1YTZ C;  1HT9 A;  1KK8 B;  2M0R A;  1DJI A;  4OKH A;  4C0L A;  2LC5 A;  3BOW A;  4ORC B;  3D78 A;  4JPZ B;  4I5N B;  3HX4 A;  4PHK A;  2KLE A;  2KPH A;  2KI6 C;  3DZT A;  3S0E A;  2LVK A;  1YUT A;  4GNK B;  1OW4 A;  1L7Z A;  2CXJ A;  2BAP A;  2BBM A;  5DKR A;  5BPJ A;  2KQ6 A;  4TNC A;  1CLM A;  1IKU A;  3OB2 B;  2M29 A;  3I5G B;  3D73 A;  4A4B A;  1M46 A;  2KGR A;  1QAS A;  1SL9 A;  4CFQ A;  4FQO A;  1NYA A;  5DKQ A;  1SBJ A;  1QAT A;  2K8M B;  1DVI A;  2GTE A;  1DEL A;  4OVN F;  1JWD A;  4MZJ A;  1REC A;  3AKB A;  2L5X B;  3EK7 A;  2H8V A;  3BOW B;  3IVT A;  4ICB A;  3RLZ A;  2HQW A;  1QWV A;  1XFW O;  3IQO A;  1UHK A;  2E30 A;  3EVU A;  1EJ3 A;  4USL A;  4PE1 A;  1KQM C;  3I5F B;  1NPQ A;  2LUC A;  1Y1A A;  3D74 A;  2OS8 B;  1T14 A;  3C1V A;  2KNE A;  4XJK A;  3B86 A;  1MHO A;  1CFD A;  1KSO A;  1RFJ A;  2COL B;  4NDD A;  4PDZ A;  1PSR A;  1OSA A;  1QVI Z;  4JD9 A;  2JXC A;  2LNK A;  3NHT A;  2PRU A;  4N1F A;  4DCK A;  1SL7 A;  1PK0 D;  1K8U A;  1TTX A;  3B87 A;  1MWN A;  1H8B A;  3S0G A;  1MQ1 A;  2IS9 A;  2M1U A;  2OPO A;  2NZ0 A;  1EG3 A;  3PFV A;  4DS7 A;  4MN0 A;  3SIA A;  2EC6 B;  3EKH A;  4AQI A;  2ZN8 A;  4UPG A;  2WC5 A;  4XJK B;  1XYD A;  1UHJ A;  1SY9 A;  3K21 A;  3BFB A;  1RK9 A;  4QJ3 B;  3FWC A;  1B7T Z;  1A29 A;  4NQG A;  3LK1 A;  1TWO A;  2I94 A;  3I5H C;  2WCE A;  1IH0 A;  1Z2C B;  3BFH A;  3F45 A;  3SJS A;  4ETO A;  1BLQ A;  2LP2 A;  2Q91 A;  2ZN9 A;  4AOM A;  5HLO A;  1KQM B;  3PM8 A;  2QEV A;  1QJT A;  4ORB B;  4NDB A;  1GGW A;  5I94 A;  3PM2 A;  2KBI A;  2KFG A;  1DTL A;  5FI7 A;  2LMU A;  3PAL A;  2ZKM X;  3SG6 A;  1N0Y A;  2WCH A;  2K7B A;  4BY4 A;  3SS5 A;  4DUQ A;  3NSI A;  1CTR A;  1EL4 A;  3I5I B;  4IJ7 A;  2HF5 A;  2WC8 A;  3WHT B;  1SR6 B;  2BE4 A;  1DGU A;  1ORG A;  4A4C A;  5D3O A;  1KWO C;  3FE8 A;  2JTT A;  3CZT X;  1YX8 A;  3CWG A;  1W7J B;  2MLE C;  3SS3 A;  4DRW A;  5HL1 A;  1UP5 A;  1K9K A;  2BKI B;  1IQ3 A;  5F6T A;  1AHR A;  1C07 A;  2QEB A;  1TNQ A;  1JC2 A;  1A75 A;  1ZAC A;  1SNL A;  1CFC A;  1S1E A;  1Y1U A;  2K2A A;  3NSL A;  1KCY A;  4MRY A;  1S6C A;  1F71 A;  1XFZ O;  1NCZ A;  1P28 A;  1A2X A;  2K61 A;  3AAK A;  2PQL A;  1S26 D;  4JWQ A;  4Q04 A;  1HQV A;  3NXA A;  3TUY C;  5FI6 A;  1OMD A;  4MZK A;  2BNX A;  3TDZ A;  3VRO A;  2CT9 A;  2K7D A;  1QXP A;  2Y1M A;  1PSB A;  3BQ3 A;  1JUO A;  1DJG A;  2LUX A;  1A75 B;  2H61 C;  2MJW B;  3PSR A;  3PN7 C;  1JFK A;  1FI6 A;  2GV5 A;  2TN4 A;  1IWQ A;  4M2P A;  2L4H A;  1ZMZ A;  1B8L A;  1KK7 Z;  1SL8 A;  4OV2 A;  3TDI A;  3D75 A;  1F4Q A;  2KI6 D;  1KWO B;  1SW8 A;  3RM1 A;  5KU1 A;  1G4Y R;  2M97 A;  2JT3 A;  2KYC A;  2KI4 B;  2LHL A;  2P70 A;  5AXI A;  1BOD A;  1DJW A;  3UO9 A;  1CM1 A;  1GQM A;  2LMV A;  2WC6 A;  4GGN A;  2AAO A;  3GOF A;  3ZWH A;  2OTG B;  4PAL A;  2Y1N A;  1S36 A;  1YUR A;  2CTN A;  2KAV A;  3ZNI A;  3LCP C;  1QLS A;  5HKY A;  1UUS A;  1M39 A;  2BCB A;  1U5I A;  1AJ5 A;  1ZUZ A;  1K2H A;  1GGZ A;  1JF2 A;  3OGN A;  1DQE A;  2KOT A;  1PRW A;  3LLE A;  1ODB A;  1L2O C;  2ZND A;  3DVM A;  1J7O A;  4I5J A;  1FW4 A;  1G33 A;  1MF8 B;  3EVR A;  4CPV A;  2QPT A;  3RZS A;  1X02 A;  1K95 A;  1NCX A;  2MLF C;  2P6B B;  3SG3 A;  1DEK A;  2JPT A;  3S0D A;  1OOI X;  1TUZ A;  1F55 A;  3PN7 B;  3NSO A;  4CID A;  3LK0 A;  1U5I B;  1DC1 A;  3JTD B;  1OQP A;  1CMG A;  4P2Y B;  2FCD A;  4JKT A;  3CZ2 A;  2I18 A;  1F8H A;  1K9P A;  3BUO B;  4WQ3 A;  1NCY A;  4YGA A;  3CLN A;  1KQV A;  1QVI Y;  1K96 A;  3OB1 B;  1JBA A;  2JZI A;  4I5K A;  1XFY O;  1MUX A;  1SCM B;  2BL0 C;  2F33 A;  4E68 A;  2PMY A;  1OOG A;  4PE7 A;  2SCP A;  4YI9 A;  1CDN A;  5JJG A;  1LXF C;  2LAN A;  3CR5 X;  3TS5 C;  2B1U A;  3BUW B;  1MXE A;  3WNX B;  2BBN A;  1SSE B;  3Q8I A;  1SYM A;  2WCJ A;  5D69 A;  4N1G A;  3JVT B;  2V53 A;  1QV0 A;  1DJH A;  1B7T Y;  5HKW A;  3FIA A;  3SIB A;  3DD4 A;  1FI5 A;  2O5G A;  3EKJ A;  5I2L A;  2L98 A;  1OOF A;  2LCP A;  2M7N A;  3CDN A;  4BY5 A;  4PHJ A;  3PAT A;  2PAS A;  1B8R A;  2AMI A;  2SAS A;  5DKN A;  5J3X A;  3IQQ A;  2BCX A;  1PVA A;  1OOJ A;  1AVS A;  2CNP A;  3CZ1 A;  2F3Z A;  2LLS A;  1IIO A;  2CCM A;  2L0P A;  2GGZ A;  3S0F A;  1EXR A;  4ZCU A;  2PYQ A;  1C7W A;  4F7F A;  1BJF A;  3OBV A;  1UWO A;  2YGU A;  3D77 A;  1MR8 A;  1LS8 A;  3DYE A;  1FPW A;  2G9B A;  2L50 A;  1ALW A;  1B9A A;  1BR1 B;  4QJ5 B;  4MVF A;  3CZ0 A;  1BF5 A;  3O6B A;  3FS7 A;  1S6J A;  2K60 A;  3OHM B;  3OX6 A;  2WCB A;  2LVJ A;  1Y1X A;  2JT0 A;  1YVL A;  2JU0 A;  2LLT A;  3DF0 A;  3FE9 A;  3PJI A;  3CGA A;  5FYX A;  4OR9 B;  1K93 D;  2F3Y A;  3WHU B;  1PVB A;  3CYZ A;  1NUB A;  1DGV A;  2PSR A;  3OX5 A;  1N65 A;  1AUI B;  1IRJ A;  3R1V A;  3A4U B;  1CKK A;  3AKA A;  3SG4 A;  5CPV A;  3EG5 B;  1DF0 A;  2F8P A;  2WCK A;  1QX7 A;  2QEH A;  4D1E A;  3VRP A;  2MA2 A;  1K94 A;  4C0K A;  3DF0 B;  4PE4 A;  2L4I A;  3CS1 A;  1Q80 A;  2L51 A;  2LM5 A;  1WRL A;  1S5G Z;  2M49 B;  5K89 A;  1TNP A;  1KK7 Y;  4CLN A;  3KHE A;  2JRF A;  1NX2 A;  3I5H B;  2ERB A;  1SRA A;  1YVH A;  3VB1 A;  2I2R E;  2LVI A;  5AAN A;  4MZL A;  5CSJ A;  2KAX A;  3O2P A;  3CR2 A;  2JUL A;  3GK4 X;  5FI2 A;  2FOT A;  1NP8 A;  3O4X A;  1NIW A;  1CLL A;  1DF0 B; 
#chains in the Genus database with same CATH homology
 1UUR A;  1B4C A;  2K7O A;  4GGF C;  2JXL A;  3OP0 A;  2AUC A;  4GUK A;  2LHI A;  2BKH B;  1TIZ A;  2ZFD A;  1J7P A;  2KHN A;  5HYD A;  2KQY A;  3BUM B;  2MBX A;  1QIW A;  1YRT B;  3VRN A;  1TCO B;  2LAP A;  1DMO A;  1J55 A;  2D8N A;  4PE0 A;  2FJU B;  4GPL B;  3A8R A;  5HLV A;  1RTP 1;  1UHN A;  1KK8 C;  2PAL A;  1JF0 A;  2M7L A;  2BEC A;  2H61 A;  3KF9 A;  4P5O E;  4C0J A;  1D1O A;  1NX1 A;  2EHB A;  1V1F A;  3E3R A;  1RWY A;  2GGM A;  1Y0V H;  2WCF A;  2ZRT A;  4GBA A;  2LLU A;  3FWB A;  3LL8 B;  1EG4 A;  3VGO A;  3I5G C;  1B47 A;  4M2O A;  1XVJ A;  1CMF A;  3SG5 A;  1CFP A;  1NWD A;  1CB1 A;  1V1G A;  1A4P A;  3TUY B;  1SKT A;  1C7V A;  4GAO A;  2H2K A;  1XA5 A;  2NLN A;  1IGV A;  1BU3 A;  2JT8 A;  5GQQ C;  1YR5 A;  4F0Z B;  1IG5 A;  2ZRS A;  1JSA A;  1LVC D;  1BT6 A;  1XFX O;  2DOQ A;  3DVJ A;  1WRZ A;  3KO0 A;  4HRE E;  1WRK A;  4ORA B;  3I5F C;  4JQ0 D;  1TRF A;  2NCO A;  2OS8 C;  2HQ8 A;  2Y4Q A;  3DVK A;  4YI8 A;  3VRR A;  1BR4 B;  4YBH B;  1VRK A;  2LV7 A;  5AFP A;  3NSK A;  1PAL A;  3BUX B;  2JNX A;  1CLB A;  3ICB A;  1J1E A;  1SMG A;  1GJY A;  5I8N A;  1QX5 B;  1TNW A;  2R2I A;  1OZS A;  4MEW A;  1UHH A;  1OZO A;  1F70 A;  1BMO A;  1L2O B;  1DT7 B;  2JC2 A;  2KGB C;  1KFX L;  2JNF A;  3BYA A;  5I2Q A;  1WLM A;  3SG2 A;  1QS7 A;  2EC6 C;  5CSI A;  3VRQ A;  3DVE A;  1K9U A;  3KEV A;  5HKZ A;  1CNP A;  3BXK A;  2KFH A;  2NXQ A;  1CDP A;  1ZOT B;  3AAJ A;  4N5X A;  4HSZ A;  1K90 D;  2LP3 A;  2MAZ A;  3D10 A;  1F4O A;  1FBV A;  4R1E A;  1KFX S;  1KSM A;  3GK1 A;  4XYN A;  1MXL C;  4MSP A;  4YGD B;  2A4J A;  1JFJ A;  1NX0 A;  1Y6W A;  4HRH A;  3TZ1 A;  2WND A;  1FF1 A;  2BL0 B;  4YGC B;  3I5I C;  1WLZ A;  3HCM A;  1AP4 A;  3M0W A;  1RJV A;  1SR6 C;  2KAY A;  3O4Y A;  2JTZ A;  2HET A;  5PAL A;  1WDC C;  3TS5 B;  2M8U A;  1XK4 C;  1XFU O;  4IL1 A;  4DIR A;  1W7I B;  3EK4 A;  5ER4 X;  4ZCV A;  1TCF A;  1TOP A;  1XO5 A;  1R6P A;  1ALV A;  4CFR A;  1S5G Y;  4MLW A;  1G8I A;  1AK8 A;  1LIN A;  5CSN A;  3D0Y A;  1IJ5 A;  2ISD A;  1IJ6 A;  3BUN B;  4AQJ A;  1N2D A;  2KSP A;  2MHH A;  1QLK A;  1WY9 A;  5JOL A;  3EK8 A;  4FTG A;  1OMR A;  3O78 A;  1H4B A;  1ZFS A;  1M45 A;  1XK4 A;  1A03 A;  2LVV A;  2Y5I A;  4YGB B;  5IBW A;  1YUS A;  1J7R A;  4GFT A;  2G2B A;  4I5L B;  1QIV A;  3EVV A;  3D0Y B;  2F2P A;  4PHN A;  2K0J A;  2VRG A;  1LA0 A;  2RGI A;  4MBE A;  2MRD A;  3H4S E;  5B8I B;  2O60 A;  5TNC A;  1DJY A;  3SG7 A;  1WDC B;  2WOS A;  1NSH A;  4PCW A;  2KI4 C;  1NX3 A;  5G08 A;  2M3W A;  5KTY A;  1XFV O;  2OTG C;  2JOJ A;  1OE9 B;  4WRI A;  1S6I A;  2F2O A;  2JWW A;  2LE9 B;  2M1K B;  1LA3 A;  1SCV A;  1DJZ A;  2CBL A;  2HPS A;  4PHM A;  1B1G A;  1CFF A;  3IF7 A;  5AEQ A;  1M31 A;  2PVB A;  1SK6 D;  4MRX A;  2LMT A;  1S3P A;  1LKJ A;  5KSZ A;  3QRX A;  4NDC A;  1BG1 A;  2M9G A;  2Q4U A;  3WXA A;  1J7Q A;  3PLF B;  4GGF A;  4QJ4 B;  1QV1 A;  1YRU B;  4OCI A;  4M2Q A;  4WQ2 A;  2KFF A;  4U8D A;  2FCE A;  2QAC A;  1R2U A;  1CDM A;  2E6W A;  3JTD C;  2BCA A;  2EGD A;  2K2F A;  3KPX A;  1OMV A;  3MSE B;  1KFU L;  1PUL A;  2NCP A;  4YGE B;  4YRU A;  1J1D A;  1BOC A;  1TN4 A;  1EH2 A;  3GK2 A;  2ZNE A;  3TDU A;  4L9M A;  1SCM C;  3CR4 X;  1AJ4 A;  1UHI A;  1YX7 A;  1QX2 A;  2BE6 A;  3CTN A;  1E8A A;  2WOR A;  2I7A A;  1CM4 A;  1KFU S;  1RRO A;  1YUU A;  5CSF A;  1F54 A;  5ER5 A;  1IQ5 A;  5D7F A;  2K7C A;  2KYF A;  2KBM A;  1TNX A;  2JQ6 A;  1DJX A;  1CDL A;  1QTX A;  1B8C A;  5I2O A;  5AER A;  2KDH A;  4HRG A;  1M63 B;  3JVT C;  2L2E A;  1SPY A;  1YTZ C;  1HT9 A;  1KK8 B;  2M0R A;  1DJI A;  4OKH A;  4C0L A;  2LC5 A;  3BOW A;  4ORC B;  4JPZ B;  4I5N B;  3HX4 A;  4PHK A;  2KI6 C;  2LVK A;  1YUT A;  4GNK B;  1L7Z A;  2CXJ A;  2BBM A;  5DKR A;  5BPJ A;  2KQ6 A;  4TNC A;  1CLM A;  1IKU A;  3OB2 B;  2M29 A;  3I5G B;  4A4B A;  1M46 A;  2KGR A;  1QAS A;  1SL9 A;  4CFQ A;  4FQO A;  1NYA A;  5DKQ A;  1SBJ A;  1QAT A;  2K8M B;  1DVI A;  4OVN F;  1JWD A;  4MZJ A;  1REC A;  3AKB A;  2L5X B;  3EK7 A;  4ICB A;  3BOW B;  3RLZ A;  2HQW A;  1XFW O;  3IQO A;  1UHK A;  2E30 A;  3EVU A;  1EJ3 A;  4USL A;  4PE1 A;  1KQM C;  3I5F B;  1NPQ A;  2LUC A;  1Y1A A;  2OS8 B;  3C1V A;  2KNE A;  4XJK A;  1MHO A;  1CFD A;  2COL B;  1KSO A;  1RFJ A;  4NDD A;  4PDZ A;  1PSR A;  1OSA A;  1QVI Z;  2JXC A;  2LNK A;  2PRU A;  4N1F A;  4DCK A;  1SL7 A;  1PK0 D;  1K8U A;  1TTX A;  1MWN A;  1H8B A;  1MQ1 A;  2IS9 A;  2M1U A;  2OPO A;  2NZ0 A;  1EG3 A;  3PFV A;  4DS7 A;  4MN0 A;  3SIA A;  2EC6 B;  3EKH A;  4AQI A;  2ZN8 A;  4UPG A;  4XJK B;  1XYD A;  1UHJ A;  1SY9 A;  3K21 A;  1RK9 A;  4QJ3 B;  3FWC A;  1B7T Z;  1A29 A;  4NQG A;  3LK1 A;  2I94 A;  3I5H C;  2WCE A;  1IH0 A;  3SJS A;  3F45 A;  4ETO A;  1BLQ A;  2LP2 A;  2Q91 A;  2ZN9 A;  4AOM A;  5HLO A;  1KQM B;  3PM8 A;  1GGW A;  1QJT A;  4ORB B;  4NDB A;  2KBI A;  2KFG A;  1DTL A;  2LMU A;  3PAL A;  2ZKM X;  3SG6 A;  1N0Y A;  2K7B A;  4BY4 A;  4DUQ A;  3NSI A;  1CTR A;  1EL4 A;  3I5I B;  2HF5 A;  2WC8 A;  3WHT B;  1SR6 B;  2BE4 A;  1DGU A;  4A4C A;  1KWO C;  2JTT A;  3CZT X;  1YX8 A;  3CWG A;  1W7J B;  2MLE C;  4DRW A;  2BKI B;  1UP5 A;  1K9K A;  1IQ3 A;  5F6T A;  1AHR A;  1C07 A;  1TNQ A;  1JC2 A;  1A75 A;  1ZAC A;  1SNL A;  1CFC A;  1S1E A;  1Y1U A;  2K2A A;  3NSL A;  1KCY A;  4MRY A;  1S6C A;  1F71 A;  1XFZ O;  1NCZ A;  2K61 A;  1A2X A;  3AAK A;  4Q04 A;  1S26 D;  4JWQ A;  3TUY C;  1HQV A;  3NXA A;  1OMD A;  4MZK A;  3TDZ A;  3VRO A;  2CT9 A;  2K7D A;  1QXP A;  2Y1M A;  1PSB A;  3BQ3 A;  1JUO A;  1DJG A;  2LUX A;  1A75 B;  2H61 C;  2MJW B;  3PSR A;  3PN7 C;  1JFK A;  1FI6 A;  2GV5 A;  2TN4 A;  1IWQ A;  4M2P A;  2L4H A;  1ZMZ A;  1B8L A;  1KK7 Z;  1SL8 A;  4OV2 A;  1F4Q A;  2KI6 D;  1KWO B;  1SW8 A;  3RM1 A;  5KU1 A;  1G4Y R;  2M97 A;  2JT3 A;  2KYC A;  2KI4 B;  2LHL A;  5AXI A;  1BOD A;  1DJW A;  1CM1 A;  1GQM A;  2LMV A;  4GGN A;  2AAO A;  3GOF A;  3ZWH A;  2OTG B;  4PAL A;  2Y1N A;  1S36 A;  1YUR A;  2CTN A;  2KAV A;  3ZNI A;  3LCP C;  1QLS A;  5HKY A;  1UUS A;  1M39 A;  2BCB A;  1U5I A;  1AJ5 A;  1ZUZ A;  1K2H A;  1GGZ A;  1JF2 A;  2KOT A;  1PRW A;  3LLE A;  1ODB A;  1L2O C;  2ZND A;  3DVM A;  1J7O A;  4I5J A;  1FW4 A;  1G33 A;  1MF8 B;  3EVR A;  4CPV A;  2QPT A;  1X02 A;  1K95 A;  1NCX A;  2MLF C;  2P6B B;  3SG3 A;  2JPT A;  1F55 A;  3PN7 B;  3NSO A;  4CID A;  3LK0 A;  1U5I B;  3JTD B;  1OQP A;  1CMG A;  4P2Y B;  2FCD A;  2I18 A;  1F8H A;  1K9P A;  3BUO B;  4WQ3 A;  1NCY A;  4YGA A;  3CLN A;  1KQV A;  1QVI Y;  1K96 A;  3OB1 B;  1JBA A;  2JZI A;  4I5K A;  1XFY O;  1MUX A;  1SCM B;  2BL0 C;  2F33 A;  4E68 A;  2PMY A;  4PE7 A;  2SCP A;  4YI9 A;  1CDN A;  5JJG A;  1LXF C;  2LAN A;  3CR5 X;  3TS5 C;  2B1U A;  3BUW B;  1MXE A;  3WNX B;  2BBN A;  1SYM A;  5D69 A;  4N1G A;  3JVT B;  2V53 A;  1QV0 A;  1DJH A;  1B7T Y;  5HKW A;  3FIA A;  3SIB A;  3DD4 A;  1FI5 A;  2O5G A;  3EKJ A;  5I2L A;  2L98 A;  2LCP A;  2M7N A;  4BY5 A;  4PHJ A;  3PAT A;  2PAS A;  1B8R A;  2AMI A;  2SAS A;  5DKN A;  5J3X A;  3IQQ A;  2BCX A;  1PVA A;  1OOJ A;  1AVS A;  2CNP A;  2F3Z A;  2LLS A;  2CCM A;  2L0P A;  2GGZ A;  1EXR A;  4ZCU A;  1C7W A;  1BJF A;  1UWO A;  1MR8 A;  1FPW A;  2G9B A;  2L50 A;  1ALW A;  1B9A A;  1BR1 B;  4QJ5 B;  4MVF A;  1BF5 A;  3O6B A;  3FS7 A;  1S6J A;  3OHM B;  3OX6 A;  2WCB A;  2LVJ A;  1Y1X A;  2JT0 A;  1YVL A;  2JU0 A;  2LLT A;  3DF0 A;  5FYX A;  3TDI A;  3CGA A;  4OR9 B;  1K93 D;  2F3Y A;  3WHU B;  1PVB A;  1NUB A;  1DGV A;  2PSR A;  3OX5 A;  1N65 A;  1AUI B;  1IRJ A;  3A4U B;  1CKK A;  3AKA A;  3SG4 A;  5CPV A;  1DF0 A;  2F8P A;  1QX7 A;  4D1E A;  3VRP A;  2MA2 A;  1K94 A;  4C0K A;  3DF0 B;  4PE4 A;  2L4I A;  3CS1 A;  1Q80 A;  2L51 A;  2LM5 A;  1WRL A;  1S5G Z;  2M49 B;  5K89 A;  1TNP A;  1KK7 Y;  4CLN A;  3KHE A;  2JRF A;  1NX2 A;  3I5H B;  1SRA A;  1YVH A;  2I2R E;  2LVI A;  5AAN A;  4MZL A;  5CSJ A;  2KAX A;  3O2P A;  3CR2 A;  2JUL A;  3GK4 X;  2FOT A;  1NP8 A;  1NIW A;  1CLL A;  1DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...