1YRTB

Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Layse, toxin
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yrtB00
1KFXL 1MXLC 1VRKA 2M7LA 3DF0A 1FI5A 3CTNA 2IS9A 2SASA 5B8IB 2EGDA 1SNLA 2KAYA 2KI6D 4A4BA 2Q91A 5FYXA 4ZCUA 1X02A 4CPVA 1BR1B 1QTXA 1DJGA 3PM8A 2Q4UA 1F4OA 3NSLA 3JTDC 3PN7C 2K2AA 5J3XA 3TUYC 1B7TZ 1ALWA 3ICBA 1NYAA 2M7NA 1LVCD 2K61A 4WRIA 1OOJA 1YUSA 4BY5A 1OQPA 4CFQA 1KK7Y 4MBEA 4YGBB 1NCZA 3OX5A 1PSBA 2K8MB 3GOFA 2JZIA 1C07A 2PRUA 1AJ5A 2A4JA 2WCFA 5AXIA 4GFTA 4M2PA 1Y1UA 1A75A 4BY4A 1J7PA 1F4QA 1RWYA 2KFGA 3OP0A 4YGEB 1CDMA 1CLLA 3SG3A 3WXAA 1R2UA 3KF9A 1BG1A 1CDNA 4FQOA 1XYDA 1IKUA 1NUBA 3CWGA 2OS8B 1S6JA 1WLZA 4NQGA 3SG2A 4UPGA 2LM5A 1DGVA 1IG5A 3RM1A 1NX3A 2ZKMX 1M39A 1WRKA 4CFRA 1K93D 4C0KA 2JNXA 1KCYA 3CR5X 1SPYA 1IQ5A 2I2RE 4JQ0D 1BODA 1YR5A 4N1FA 1WY9A 1K95A 1K8UA 1CMGA 1NX1A 1NWDA 3DVEA 1NPQA 5AFPA 1YRUB 1NIWA 2L4HA 4XYNA 4E68A 1CFFA 2JXCA 2V53A 4WQ3A 2K7CA 1BF5A 5D69A 2M0RA 1CLBA 3C1VA 1AUIB 4YBHB 1G4YR 4QJ4B 4I5KA 2LP3A 2WOSA 4YI8A 4YGDB 3I5GC 1LA3A 2LNKA 1PVBA 2KI4C 1A2XA 1HT9A 2O60A 3TDIA 3WHTB 1FW4A 5HLOA 3RLZA 2K0JA 4GGFC 2DOQA 1TNQA 1J7QA 3OB2B 2FCEA 1FBVA 1OZSA 1YVHA 1QIVA 3CR4X 3WHUB 3KHEA 4WQ2A 2JRFA 3EKHA 3FWBA 3OX6A 4DCKA 1CFPA 1DF0B 1MHOA 2F3ZA 3CZTX 4YGAA 1B1GA 1FI6A 1RECA 2NCPA 3I5IB 5JJGA 2HQWA 2KHNA 2BE6A 3DVJA 3JVTB 4AQIA 3D0YB 2WORA 1EG3A 5I2LA 1F71A 1BU3A 1EXRA 1U5IB 4MRYA 4HRHA 2FJUB 1JF2A 1TNPA 3IF7A 4GAOA 1CMFA 2JOJA 3E3RA 1OE9B 2HPSA 1UP5A 2ZRTA 2LV7A 2LLUA 1KQMC 1CM4A 3DVMA 1K94A 1M63B 1QIWA 2LAPA 3JTDB 3PN7B 4GUKA 4DUQA 1BT6A 2BBNA 2BCXA 1H4BA 1M31A 4FTGA 1AJ4A 4MZLA 3BOWB 2D8NA 2Y1MA 5JOLA 1CDPA 2BKIB 1SK6D 1GGZA 3SIBA 2LVJA 2M3WA 2P6BB 4L9MA 2I7AA 2MJWB 2WNDA 1TNWA 2LHIA 2WCEA 2ZRSA 4NDCA 3BXKA 4MSPA 4AOMA 1DMOA 3PSRA 2JT0A 4YGCB 1K96A 2BCAA 2JT3A 1S5GZ 4CLNA 4TNCA 3TS5C 2L0PA 1K2HA 1B47A 2L50A 3PATA 3O78A 1KFXS 1QVIZ 3ZWHA 1N0YA 5K89A 1SCMC 2M49B 5KTYA 3AKBA 2LMVA 1RROA 2LVKA 1LA0A 3CLNA 1ZFSA 4GPLB 1TTXA 5HKYA 1B9AA 3I5GB 1PALA 4JPZB 2KI4B 1TNXA 5TNCA 3IQOA 2I94A 2B1UA 2CCMA 1XA5A 1S1EA 1JFJA 2M97A 3EKJA 1ODBA 2BL0C 4GGNA 3PLFB 1RFJA 5CSJA 2F8PA 1B8CA 3BYAA 2LLSA 2KAVA 2LCPA 1AK8A 1W7JB 2L51A 1QV0A 4HRGA 1CFCA 2KSPA 4PHJA 2KFHA 2KGBC 2E6WA 2K7DA 1QASA 4C0JA 3VRPA 1QLKA 2ZNDA 4PE0A 1E8AA 1NSHA 1QX7A 3NSIA 4A4CA 2M29A 4C0LA 1OSAA 1BMOA 3GK4X 1K9UA 1XVJA 3AKAA 3BUNB 3VGOA 1OMDA 2G9BA 1UHIA 4QJ5B 2HETA 5DKQA 2PASA 1KQMB 1YX7A 2H2KA 3M0WA 2PSRA 1RK9A 1PVAA 2K7BA 1QV1A 1EG4A 1DF0A 1XK4C 3AAKA 3KPXA 4ORCB 2M8UA 1CDLA 2E30A 1S36A 3A4UB 3D0YA 1XFUO 1IJ6A 1YTZC 2BKHB 2MHHA 3KO0A 2CBLA 1U5IA 3HX4A 2L5XB 2F2PA 3EVRA 3GK2A 3IQQA 1PULA 1SRAA 1SBJA 3AAJA 5HKZA 2AMIA 1Y0VH 1QATA 1UWOA 1GGWA 1B7TY 1JF0A 1ZUZA 4ETOA 5KU1A 1EH2A 1S26D 4PALA 5GQQC 1J1EA 1G8IA 2LMTA 2PALA 3HCMA 1WDCB 3OHMB 4PE4A 5DKRA 2JTZA 4YRUA 2ZN9A 1K90D 1TRFA 3BOWA 3TS5B 3LL8B 1TCFA 1BOCA 1UHKA 1NX0A 1QXPA 5G08A 4U8DA 1SCMB 1SL8A 1XO5A 1YUUA 2LMUA 4P2YB 1IGVA 1K9KA 1JC2A 2KYFA 3FIAA 3EVUA 2JWWA 3BUOB 4ZCVA 2ZNEA 5IBWA 3VRQA 1YRTB 1JUOA 2AAOA 2KQ6A 4OVNF 1A29A 1MUXA 1N2DA 1XFZO 4GBAA 3I5FC 1OZOA 4GNKB 2K7OA 1H8BA 2TN4A 2BL0B 1TN4A 3GK1A 1UUSA 2KAXA 2NLNA 1Y1XA 1EL4A 1S6IA 2M9GA 4DRWA 1IJ5A 1ZACA 1UHHA 5I2QA 1S3PA 1B8RA 1J7OA 2CT9A 1OMVA 1SYMA 1KSOA 3BUMB 3MSEB 3SG4A 2M1KB 2NZ0A 1MR8A 1HQVA 2WCBA 2MRDA 3LCPC 1WDCC 4PE1A 3O2PA 2FOTA 3FWCA 3LK1A 2ISDA 1KK7Z 1NP8A 5D7FA 5F6TA 3SG7A 1XFWO 4PHMA 4GGFA 4Q04A 5PALA 3SG5A 1UURA 5AANA 3I5HC 4IL1A 1AHRA 1C7WA 1QJTA 5CSNA 1FPWA 1XFXO 2AUCA 2EHBA 1AP4A 1Q80A 1DGUA 1EJ3A 2LE9B 1BR4B 3QRXA 1IWQA 1SR6C 3VRRA 1L7ZA 3F45A 1JWDA 1JFKA 2OTGC 4OKHA 2LVVA 1F8HA 2H61C 1KSMA 2GGZA 1V1GA 1S6CA 4N1GA 1CFDA 2MAZA 2KBIA 1A4PA 2F33A 1DJYA 1G33A 2LLTA 1CLMA 1PK0D 1FF1A 1SY9A 1KFUL 1M45A 2O5GA 1DVIA 3VRNA 2LUCA 1KFUS 1TCOB 1OMRA 2LHLA 1IQ3A 1KK8C 1WRZA 3SIAA 4R1EA 5HYDA 3ZNIA 1DJZA 1CTRA 3D10A 4PHKA 1C7VA 1QX5B 3NSKA 1W7IB 2KFFA 2HF5A 3BUWB 3SJSA 2EC6C 1MF8B 1MWNA 2LUXA 3EK8A 1YURA 1ZOTB 2I18A 2NCOA 1DJXA 2OPOA 1D1OA 1QX2A 2KDHA 3PALA 2QACA 3EVVA 4XJKB 2L98A 2M1UA 1L2OC 2BCBA 4N5XA 1JBAA 1QS7A 1S5GY 3DF0B 1IRJA 1J55A 1RJVA 1ZMZA 2GGMA 1SW8A 3NSOA 4NDBA 1KWOC 1LINA 5BPJA 2L4IA 1M46A 4HSZA 4USLA 4I5LB 1QVIY 3DVKA 2JULA 2KGRA 4MLWA 3I5FB 1K9PA 2LC5A 3LLEA 1QLSA 3A8RA 1YVLA 2HQ8A 1UHNA 3VROA 4QJ3B 1BJFA 1XFYO 2JTTA 3EK7A 4F0ZB 1JSAA 4OR9B 5I2OA 3TDZA 2K2FA 1F55A 1RTP1 2KBMA 4NDDA 4HREE 3O6BA 1MXEA 4M2OA 1SKTA 4DIRA 1MQ1A 3BUXB 4OV2A 3K21A 5HKWA 4OCIA 3LK0A 1A75B 2H61A 2JNFA 1NX2A 3CR2A 4ICBA 3O4YA 3WNXB 1CKKA 5ER5A 2R2IA 1Y1AA 2LANA 1SCVA 4M2QA 2MA2A 4MRXA 4DS7A 4I5NB 4MN0A 3I5HB 2KQYA 2BBMA 4AQJA 2CXJA 2JU0A 2ZFDA 4I5JA 1DJIA 5AEQA 1ALVA 1J1DA 2PMYA 1GJYA 1CNPA 2KNEA 1LXFC 1SR6B 5CSFA 1DTLA 5AERA 1TOPA 2Y5IA 2G2BA 4JWQA 1J7RA 2CNPA 2L2EA 2JXLA 2OTGB 2WC8A 3BQ3A 3PFVA 1B4CA 2GV5A 2QPTA 2LVIA 3TDUA 5CPVA 2NXQA 4PDZA 2F2OA 5HLVA 1XFVO 1KQVA 5KSZA 1IH0A 1SL9A 2OS8C 1B8LA 1YUTA 1NCXA 1V1FA 3NXAA 1PSRA 3CS1A 1KK8B 2FCDA 2KYCA 1XK4A 1YX8A 2KI6C 1Y6WA 4MZKA 2EC6B 1GQMA 5ER4X 2ZN8A 3EK4A 1DJWA 1CM1A 1LKJA 3OB1B 2CTNA 4ORAB 4D1EA 2JC2A 4MEWA 5I8NA 1TIZA 2MLFC 1SMGA 3FS7A 3TUYB 2BE4A 2JPTA 4MVFA 1L2OB 2JQ6A 4MZJA 4ORBB 2SCPA 4YI9A 1DJHA 1KWOB 1PRWA 2MBXA 2LP2A 3CGAA 2RGIA 2F3YA 2Y4QA 2JT8A 2PVBA 1F54A 2MLEC 1SL7A 1N65A 2BECA 4PHNA 1CB1A 4PE7A 5CSIA 2KOTA 2COLB 2VRGA 3KEVA 1R6PA 3DD4A 2Y1NA 1F70A 5DKNA 1DT7B 1UHJA 3I5IC 3SG6A 3TZ1A 4CIDA 1A03A 1WRLA 1AVSA 1BLQA 3JVTC 3H4SE 4P5OE 1WLMA 4XJKA 1NCYA 4PCWA
chains in the Genus database with same CATH superfamily
1KFXL 1MXLC 1VRKA 2M7LA 2FJYA 3DF0A 2L2CA 1FI5A 1LS8A 3CTNA 2KPHA 2IS9A 2SASA 5B8IB 2EGDA 1SNLA 2KAYA 5I94A 2KI6D 4A4BA 2Q91A 5FYXA 4ZCUA 1X02A 4CPVA 1BR1B 1QTXA 1DJGA 3PM8A 2Q4UA 1F4OA 3NSLA 3JTDC 3PN7C 2K2AA 3S0BA 5J3XA 3TUYC 2BAPA 1B7TZ 1ALWA 3ICBA 1NYAA 2M7NA 1LVCD 2K61A 4WRIA 1OOJA 1YUSA 4BY5A 1OQPA 4CFQA 1KK7Y 4MBEA 4YGBB 1NCZA 3OX5A 1PSBA 2K8MB 3GOFA 2JZIA 1C07A 1Z4HA 2PRUA 1AJ5A 2A4JA 2WCFA 5AXIA 4GFTA 4M2PA 1Y1UA 1A75A 4BY4A 1J7PA 1F4QA 1RWYA 2KFGA 3OP0A 4YGEB 1CDMA 1CLLA 3SG3A 3WXAA 1R2UA 3KF9A 1BG1A 1CDNA 4FQOA 1XYDA 1IKUA 1NUBA 3CWGA 2OS8B 3BFBA 1S6JA 4OZDA 1WLZA 4NQGA 3SG2A 4UPGA 2LM5A 1DGVA 1IG5A 3RM1A 1NX3A 2ZKMX 1M39A 1WRKA 4CFRA 1K93D 4C0KA 2JNXA 1KCYA 3CR5X 1SPYA 3CZ1A 1IQ5A 2I2RE 4JQ0D 1BODA 1YR5A 4N1FA 1WY9A 3CABA 1K95A 1K8UA 1CMGA 1NX1A 1NWDA 3DVEA 1NPQA 5AFPA 1YRUB 1NIWA 2L4HA 3D76A 4XYNA 4E68A 2JXCA 1CFFA 2V53A 4WQ3A 2K7CA 1BF5A 5D69A 3V2LA 2M0RA 1CLBA 3C1VA 1AUIB 3K1EA 4YBHB 1G4YR 2P71A 3D74A 4QJ4B 4I5KA 5FI2A 2LP3A 2WOSA 3DYEA 4YI8A 4YGDB 3I5GC 1LA3A 2LNKA 1PVBA 2KI4C 1A2XA 1HT9A 2O60A 3TDIA 3WHTB 1FW4A 5HLOA 3RLZA 2K0JA 4GGFC 2DOQA 1TNQA 1J7QA 3OB2B 2FCEA 1FBVA 1OZSA 3L4AA 1YVHA 1QIVA 3CR4X 3WHUB 3KHEA 4IJ7A 4WQ2A 2JRFA 3EKHA 3FWBA 2KLDA 3OX6A 4DCKA 1CFPA 1DF0B 3D73A 1MHOA 2F3ZA 3CZTX 4YGAA 1B1GA 4INWA 1FI6A 1RECA 2NCPA 3I5IB 5JJGA 2HQWA 2KHNA 2BE6A 3DVJA 3JVTB 4AQIA 3D0YB 2WORA 3OBVA 1EG3A 5I2LA 1F71A 5DICA 1BU3A 1EXRA 1U5IB 4MRYA 4HRHA 2FJUB 1JF2A 1TNPA 3IF7A 4GAOA 1CMFA 2JOJA 3E3RA 1OE9B 2HPSA 1UP5A 1XFRA 2ZRTA 2LV7A 2LLUA 3B87A 1KQMC 1CM4A 3DVMA 1K94A 1M63B 1QIWA 2LAPA 3JTDB 3PN7B 4GUKA 4DUQA 1BT6A 2BBNA 2BCXA 1H4BA 1M31A 4FTGA 1AJ4A 4F7FA 4MZLA 3BOWB 2D8NA 2Y1MA 3OGNA 5JOLA 1CDPA 2QEHA 2BKIB 1SK6D 2WCKA 1GGZA 5EL2A 3SIBA 2LVJA 2M3WA 2P6BB 4L9MA 2I7AA 3DZTA 2MJWB 2WNDA 1TNWA 2LHIA 2WCEA 2ZRSA 3CZ0A 4NDCA 3BXKA 3O4XA 3S0DA 4MSPA 4AOMA 1DMOA 3PSRA 2JT0A 4YGCB 1K96A 2BCAA 2JT3A 1S5GZ 4CLNA 4TNCA 2H8VA 2YGUA 3TS5C 2L0PA 1K2HA 1B47A 2L50A 3PATA 3O78A 1KFXS 1QVIZ 1TUJA 1N0YA 3SS4A 3ZWHA 5K89A 1SCMC 2M49B 5KTYA 3AKBA 2LMVA 1RROA 2LVKA 1LA0A 3CLNA 1ZFSA 2WCJA 1TTXA 3BFAA 1B9AA 3DY9A 4GPLB 5HKYA 3I5GB 1PALA 4JPZB 2KI4B 1TNXA 5TNCA 3IQOA 2I94A 2B1UA 2CCMA 1XA5A 1S1EA 2ERBA 1JFJA 2M97A 3S0AA 3EKJA 1ODBA 2BL0C 3QMEA 4GGNA 3PLFB 3R1VA 1RFJA 5CSJA 2F8PA 1B8CA 2GTEA 3BYAA 2LLSA 2KAVA 2LCPA 1AK8A 1W7JB 2L51A 2QEOA 1QV0A 4HRGA 1CFCA 2KSPA 4PHJA 2KFHA 2KGBC 2E6WA 2K7DA 1QASA 1OOFA 3FE6A 4C0JA 3VRPA 1QLKA 2ZNDA 3R72A 4PE0A 1E8AA 1NSHA 1QX7A 3NSIA 4A4CA 2M29A 4C0LA 1OSAA 1BMOA 3GK4X 1K9UA 1XVJA 3AKAA 3UO9A 3BUNB 3VGOA 1OMDA 2G9BA 1UHIA 4QJ5B 2HETA 5DKQA 2PASA 1KQMB 1YX7A 2H2KA 3M0WA 2PSRA 1RK9A 1PVAA 2K7BA 2QEBA 1QV1A 3D77A 3D75A 1P28A 1EG4A 1DF0A 1XK4C 3AAKA 3KPXA 4ORCB 2M8UA 1CDLA 2E30A 1S36A 3A4UB 3D0YA 1XFUO 1IJ6A 4JD9A 1YTZC 2BKHB 2MHHA 3KO0A 2CBLA 1OOGA 1U5IA 3HX4A 2L5XB 2F2PA 3EVRA 3GK2A 3IQQA 1PULA 3FE8A 1SRAA 1SBJA 3AAJA 5HKZA 2AMIA 1Y0VH 1QATA 1UWOA 1DC1A 1GGWA 1B7TY 1OOIX 1JF0A 1ZUZA 4ETOA 5KU1A 1EH2A 1S26D 4PALA 5GQQC 1J1EA 1G8IA 2LMTA 2PALA 1TWOA 1WDCB 3HCMA 3OHMB 3VB1A 4PE4A 5DKRA 2JTZA 4YRUA 2ZN9A 1K90D 1TRFA 3BOWA 3TS5B 3LL8B 1TCFA 3Q8IA 1BOCA 1UHKA 1NX0A 1QXPA 5G08A 4U8DA 1SCMB 1SL8A 1XO5A 1YUUA 2LMUA 4P2YB 1IGVA 1K9KA 3NHTA 1JC2A 2KYFA 3FIAA 3EVUA 2JWWA 3BUOB 2JPOA 4ZCVA 2WC5A 2ZNEA 5D3OA 5IBWA 3VRQA 1YRTB 1JUOA 2AAOA 2KQ6A 4OVNF 1A29A 1MUXA 1N2DA 1XFZO 4GBAA 3I5FC 1OZOA 3D78A 4GNKB 2K7OA 1H8BA 2TN4A 2BL0B 1TN4A 3GK1A 1UUSA 2KAXA 3BJHA 2QDIA 1OW4A 2NLNA 1Y1XA 1EL4A 3CDNA 1S6IA 2M9GA 3CZ2A 4DRWA 1IJ5A 1ZACA 5HL1A 1UHHA 5I2QA 1S3PA 1B8RA 1J7OA 4FQTA 2CT9A 1OMVA 1SYMA 1KSOA 3BUMB 3MSEB 3R1PA 4JKTA 3SG4A 2M1KB 2NZ0A 1MR8A 1HQVA 2WCBA 2MRDA 3LCPC 1WDCC 4PE1A 3O2PA 2FOTA 3FWCA 3LK1A 2ISDA 2K60A 1KK7Z 1NP8A 5D7FA 5F6TA 3SG7A 1XFWO 4PHMA 3B86A 4GGFA 4Q04A 5PALA 3SG5A 1UURA 3IVTA 5AANA 3B6XA 2P70A 3I5HC 4IL1A 1AHRA 1C7WA 1QWVA 1QJTA 3S0FA 5CSNA 1FPWA 1XFXO 2AUCA 2EHBA 1AP4A 1Q80A 1DGUA 1EJ3A 2LE9B 1BR4B 3QRXA 3BFHA 1IWQA 1SR6C 3VRRA 1L7ZA 3F45A 5FI6A 1JWDA 1JFKA 2OTGC 4OKHA 2LVVA 2WCMA 2H61C 1F8HA 1KSMA 2GGZA 1V1GA 1S6CA 4N1GA 1CFDA 2MAZA 2KBIA 1A4PA 2F33A 1DELA 1DJYA 1G33A 2LLTA 1CLMA 1SSEB 4PT1A 1PK0D 1DEKA 1FF1A 1SY9A 1KFUL 1M45A 2O5GA 1DVIA 3VRNA 2LUCA 1KFUS 2PYQA 1TCOB 1OMRA 2LHLA 1IQ3A 1KK8C 1WRZA 3SIAA 4R1EA 5HYDA 3ZNIA 1DJZA 1CTRA 3D10A 4PHKA 1C7VA 1QX5B 1T14A 3NSKA 1W7IB 2KFFA 2HF5A 3BUWB 3SJSA 2EC6C 1MF8B 1MWNA 2LUXA 3EK8A 1YURA 1ZOTB 1Z2CB 2I18A 2NCOA 1DJXA 2OPOA 1D1OA 3L4LA 1QX2A 2KDHA 3PALA 2QACA 3EVVA 1TUZA 4XJKB 2L98A 2M1UA 2L5YA 1L2OC 2BCBA 4N5XA 3EG5B 1JBAA 1QS7A 1S5GY 3DF0B 1IRJA 1J55A 1RJVA 1ZMZA 2GGMA 1SW8A 3NSOA 4NDBA 1KWOC 1LINA 5BPJA 2L4IA 1M46A 4HSZA 4USLA 2WCLA 1QVIY 3DVKA 3FE9A 4I5LB 2JULA 2KGRA 3PJIA 3I5FB 1K9PA 1W9ZA 2LC5A 4MLWA 1ORGA 3LLEA 1QLSA 3A8RA 1YVLA 2HQ8A 1UHNA 3VROA 4QJ3B 1BJFA 1XFYO 2JTTA 3EK7A 4F0ZB 1JSAA 4OR9B 5I2OA 3TDZA 2K2FA 1F55A 1RTP1 2KBMA 4NDDA 4HREE 3O6BA 1MXEA 4M2OA 2WC6A 1SKTA 4DIRA 3UNWA 1MQ1A 3BUXB 4OV2A 3CYZA 3K21A 5HKWA 4OCIA 3LK0A 1A75B 2H61A 2JNFA 1NX2A 3CR2A 3RZSA 4ICBA 3O4YA 3WNXB 1CKKA 5ER5A 2KLEA 2R2IA 1Y1AA 2LANA 1SCVA 3L47A 4M2QA 2MA2A 4MRXA 4DS7A 4I5NB 4MN0A 3I5HB 2KQYA 2BBMA 4AQJA 2CXJA 2JU0A 3S0EA 2ZFDA 4I5JA 1DJIA 5AEQA 1ALVA 1J1DA 2PMYA 1GJYA 1CNPA 2KNEA 1LXFC 1SR6B 5CSFA 1DTLA 5AERA 1TOPA 2Y5IA 2G2BA 4JWQA 1J7RA 2CNPA 2L2EA 2JXLA 2OTGB 2WC8A 3BQ3A 3PFVA 1B4CA 2GV5A 2QPTA 2LVIA 3NGVA 3B88A 3TDUA 5CPVA 4KYNA 2NXQA 1C3ZA 4PDZA 2F2OA 5HLVA 1XFVO 1GM0A 3PM2A 1OOHA 5KSZA 1IH0A 1KQVA 1SL9A 2OS8C 3SS5A 1B8LA 1YUTA 1NCXA 1V1FA 3NXAA 1PSRA 2BNXA 1KK8B 3CS1A 1C3YA 2FCDA 2KYCA 1XK4A 1YX8A 2KI6C 1Y6WA 4MZKA 2EC6B 3S0GA 1GQMA 5ER4X 3SS3A 2ZN8A 3EK4A 1DJWA 1CM1A 1LKJA 3OB1B 2CTNA 2PQLA 4ORAB 2JC2A 4MEWA 4D1EA 1TIZA 2MLFC 5I8NA 1SMGA 3FS7A 3TUYB 3DXLA 3R1OA 5FI7A 2BE4A 2JPTA 4MVFA 1L2OB 2JQ6A 4MZJA 4ORBB 2SCPA 4YI9A 1DJHA 1DQEA 1KWOB 1PRWA 2LP2A 2MBXA 3N7HA 3NHIA 3CGAA 2RGIA 2F3YA 2Y4QA 1IIOA 2JT8A 2PVBA 1F54A 2MLEC 1SL7A 1N65A 2BECA 3B7AA 4PHNA 1CB1A 4PE7A 5CSIA 2KOTA 2COLB 2VRGA 3KEVA 1R6PA 3DD4A 2Y1NA 4INXA 1F70A 5DKNA 2QEVA 1DT7B 1UHJA 2WCHA 3I5IC 3SG6A 3TZ1A 4CIDA 1A03A 1WRLA 1AVSA 1BLQA 3JVTC 3H4SE 4P5OE 1WLMA 4XJKA 1NCYA 4PCWA
chains in the Genus database with same CATH topology
1KFXL 1MXLC 1VRKA 2M7LA 3DF0A 1FI5A 3CTNA 2IS9A 2SASA 5B8IB 2EGDA 1SNLA 2KAYA 2KI6D 4A4BA 2Q91A 5FYXA 4ZCUA 1X02A 4CPVA 1BR1B 1QTXA 1DJGA 3PM8A 2Q4UA 1F4OA 3NSLA 3JTDC 3PN7C 2K2AA 5J3XA 3TUYC 1B7TZ 1ALWA 3ICBA 1NYAA 2M7NA 1LVCD 2K61A 4WRIA 1OOJA 1YUSA 4BY5A 1OQPA 4CFQA 1KK7Y 4MBEA 4YGBB 1NCZA 3OX5A 1PSBA 2K8MB 3GOFA 2JZIA 1C07A 2PRUA 1AJ5A 2A4JA 2WCFA 5AXIA 4GFTA 4M2PA 1Y1UA 1A75A 4BY4A 1J7PA 1F4QA 1RWYA 2KFGA 3OP0A 4YGEB 1CDMA 1CLLA 3SG3A 3WXAA 1R2UA 3KF9A 1BG1A 1CDNA 4FQOA 1XYDA 1IKUA 1NUBA 3CWGA 2OS8B 1S6JA 1WLZA 4NQGA 3SG2A 4UPGA 2LM5A 1DGVA 1IG5A 3RM1A 1NX3A 2ZKMX 1M39A 1WRKA 4CFRA 1K93D 4C0KA 2JNXA 1KCYA 3CR5X 1SPYA 1IQ5A 2I2RE 4JQ0D 1BODA 1YR5A 4N1FA 1WY9A 1K95A 1K8UA 1CMGA 1NX1A 1NWDA 3DVEA 1NPQA 5AFPA 1YRUB 1NIWA 2L4HA 4XYNA 4E68A 1CFFA 2JXCA 2V53A 4WQ3A 2K7CA 1BF5A 5D69A 2M0RA 1CLBA 3C1VA 1AUIB 4YBHB 1G4YR 4QJ4B 4I5KA 2LP3A 2WOSA 4YI8A 4YGDB 3I5GC 1LA3A 2LNKA 1PVBA 2KI4C 1A2XA 1HT9A 2O60A 3TDIA 3WHTB 1FW4A 5HLOA 3RLZA 2K0JA 4GGFC 2DOQA 1TNQA 1J7QA 3OB2B 2FCEA 1FBVA 1OZSA 1YVHA 1QIVA 3CR4X 3WHUB 3KHEA 4WQ2A 2JRFA 3EKHA 3FWBA 3OX6A 4DCKA 1CFPA 1DF0B 1MHOA 2F3ZA 3CZTX 4YGAA 1B1GA 1FI6A 1RECA 2NCPA 3I5IB 5JJGA 2HQWA 2KHNA 2BE6A 3DVJA 3JVTB 4AQIA 3D0YB 2WORA 1EG3A 5I2LA 1F71A 1BU3A 1EXRA 1U5IB 4MRYA 4HRHA 2FJUB 1JF2A 1TNPA 3IF7A 4GAOA 1CMFA 2JOJA 3E3RA 1OE9B 2HPSA 1UP5A 2ZRTA 2LV7A 2LLUA 1KQMC 1CM4A 3DVMA 1K94A 1M63B 1QIWA 2LAPA 3JTDB 3PN7B 4GUKA 4DUQA 1BT6A 2BBNA 2BCXA 1H4BA 1M31A 4FTGA 1AJ4A 4MZLA 3BOWB 2D8NA 2Y1MA 5JOLA 1CDPA 2BKIB 1SK6D 1GGZA 3SIBA 2LVJA 2M3WA 2P6BB 4L9MA 2I7AA 2MJWB 2WNDA 1TNWA 2LHIA 2WCEA 2ZRSA 4NDCA 3BXKA 4MSPA 4AOMA 1DMOA 3PSRA 2JT0A 4YGCB 1K96A 2BCAA 2JT3A 1S5GZ 4CLNA 4TNCA 3TS5C 2L0PA 1K2HA 1B47A 2L50A 3PATA 3O78A 1KFXS 1QVIZ 3ZWHA 1N0YA 5K89A 1SCMC 2M49B 5KTYA 3AKBA 2LMVA 1RROA 2LVKA 1LA0A 3CLNA 1ZFSA 4GPLB 1TTXA 5HKYA 1B9AA 3I5GB 1PALA 4JPZB 2KI4B 1TNXA 5TNCA 3IQOA 2I94A 2B1UA 2CCMA 1XA5A 1S1EA 1JFJA 2M97A 3EKJA 1ODBA 2BL0C 4GGNA 3PLFB 1RFJA 5CSJA 2F8PA 1B8CA 3BYAA 2LLSA 2KAVA 2LCPA 1AK8A 1W7JB 2L51A 1QV0A 4HRGA 1CFCA 2KSPA 4PHJA 2KFHA 2KGBC 2E6WA 2K7DA 1QASA 4C0JA 3VRPA 1QLKA 2ZNDA 4PE0A 1E8AA 1NSHA 1QX7A 3NSIA 4A4CA 2M29A 4C0LA 1OSAA 1BMOA 3GK4X 1K9UA 1XVJA 3AKAA 3BUNB 3VGOA 1OMDA 2G9BA 1UHIA 4QJ5B 2HETA 5DKQA 2PASA 1KQMB 1YX7A 2H2KA 3M0WA 2PSRA 1RK9A 1PVAA 2K7BA 1QV1A 1EG4A 1DF0A 1XK4C 3AAKA 3KPXA 4ORCB 2M8UA 1CDLA 2E30A 1S36A 3A4UB 3D0YA 1XFUO 1IJ6A 1YTZC 2BKHB 2MHHA 3KO0A 2CBLA 1U5IA 3HX4A 2L5XB 2F2PA 3EVRA 3GK2A 3IQQA 1PULA 1SRAA 1SBJA 3AAJA 5HKZA 2AMIA 1Y0VH 1QATA 1UWOA 1GGWA 1B7TY 1JF0A 1ZUZA 4ETOA 5KU1A 1EH2A 1S26D 4PALA 5GQQC 1J1EA 1G8IA 2LMTA 2PALA 3HCMA 1WDCB 3OHMB 4PE4A 5DKRA 2JTZA 4YRUA 2ZN9A 1K90D 1TRFA 3BOWA 3TS5B 3LL8B 1TCFA 1BOCA 1UHKA 1NX0A 1QXPA 5G08A 4U8DA 1SCMB 1SL8A 1XO5A 1YUUA 2LMUA 4P2YB 1IGVA 1K9KA 1JC2A 2KYFA 3FIAA 3EVUA 2JWWA 3BUOB 4ZCVA 2ZNEA 5IBWA 3VRQA 1YRTB 1JUOA 2AAOA 2KQ6A 4OVNF 1A29A 1MUXA 1N2DA 1XFZO 4GBAA 3I5FC 1OZOA 4GNKB 2K7OA 1H8BA 2TN4A 2BL0B 1TN4A 3GK1A 1UUSA 2KAXA 2NLNA 1Y1XA 1EL4A 1S6IA 2M9GA 4DRWA 1IJ5A 1ZACA 1UHHA 5I2QA 1S3PA 1B8RA 1J7OA 2CT9A 1OMVA 1SYMA 1KSOA 3BUMB 3MSEB 3SG4A 2M1KB 2NZ0A 1MR8A 1HQVA 2WCBA 2MRDA 3LCPC 1WDCC 4PE1A 3O2PA 2FOTA 3FWCA 3LK1A 2ISDA 1KK7Z 1NP8A 5D7FA 5F6TA 3SG7A 1XFWO 4PHMA 4GGFA 4Q04A 5PALA 3SG5A 1UURA 5AANA 3I5HC 4IL1A 1AHRA 1C7WA 1QJTA 5CSNA 1FPWA 1XFXO 2AUCA 2EHBA 1AP4A 1Q80A 1DGUA 1EJ3A 2LE9B 1BR4B 3QRXA 1IWQA 1SR6C 3VRRA 1L7ZA 3F45A 1JWDA 1JFKA 2OTGC 4OKHA 2LVVA 1F8HA 2H61C 1KSMA 2GGZA 1V1GA 1S6CA 4N1GA 1CFDA 2MAZA 2KBIA 1A4PA 2F33A 1DJYA 1G33A 2LLTA 1CLMA 1PK0D 1FF1A 1SY9A 1KFUL 1M45A 2O5GA 1DVIA 3VRNA 2LUCA 1KFUS 1TCOB 1OMRA 2LHLA 1IQ3A 1KK8C 1WRZA 3SIAA 4R1EA 5HYDA 3ZNIA 1DJZA 1CTRA 3D10A 4PHKA 1C7VA 1QX5B 3NSKA 1W7IB 2KFFA 2HF5A 3BUWB 3SJSA 2EC6C 1MF8B 1MWNA 2LUXA 3EK8A 1YURA 1ZOTB 2I18A 2NCOA 1DJXA 2OPOA 1D1OA 1QX2A 2KDHA 3PALA 2QACA 3EVVA 4XJKB 2L98A 2M1UA 1L2OC 2BCBA 4N5XA 1JBAA 1QS7A 1S5GY 3DF0B 1IRJA 1J55A 1RJVA 1ZMZA 2GGMA 1SW8A 3NSOA 4NDBA 1KWOC 1LINA 5BPJA 2L4IA 1M46A 4HSZA 4USLA 4I5LB 1QVIY 3DVKA 2JULA 2KGRA 4MLWA 3I5FB 1K9PA 2LC5A 3LLEA 1QLSA 3A8RA 1YVLA 2HQ8A 1UHNA 3VROA 4QJ3B 1BJFA 1XFYO 2JTTA 3EK7A 4F0ZB 1JSAA 4OR9B 5I2OA 3TDZA 2K2FA 1F55A 1RTP1 2KBMA 4NDDA 4HREE 3O6BA 1MXEA 4M2OA 1SKTA 4DIRA 1MQ1A 3BUXB 4OV2A 3K21A 5HKWA 4OCIA 3LK0A 1A75B 2H61A 2JNFA 1NX2A 3CR2A 4ICBA 3O4YA 3WNXB 1CKKA 5ER5A 2R2IA 1Y1AA 2LANA 1SCVA 4M2QA 2MA2A 4MRXA 4DS7A 4I5NB 4MN0A 3I5HB 2KQYA 2BBMA 4AQJA 2CXJA 2JU0A 2ZFDA 4I5JA 1DJIA 5AEQA 1ALVA 1J1DA 2PMYA 1GJYA 1CNPA 2KNEA 1LXFC 1SR6B 5CSFA 1DTLA 5AERA 1TOPA 2Y5IA 2G2BA 4JWQA 1J7RA 2CNPA 2L2EA 2JXLA 2OTGB 2WC8A 3BQ3A 3PFVA 1B4CA 2GV5A 2QPTA 2LVIA 3TDUA 5CPVA 2NXQA 4PDZA 2F2OA 5HLVA 1XFVO 1KQVA 5KSZA 1IH0A 1SL9A 2OS8C 1B8LA 1YUTA 1NCXA 1V1FA 3NXAA 1PSRA 3CS1A 1KK8B 2FCDA 2KYCA 1XK4A 1YX8A 2KI6C 1Y6WA 4MZKA 2EC6B 1GQMA 5ER4X 2ZN8A 3EK4A 1DJWA 1CM1A 1LKJA 3OB1B 2CTNA 4ORAB 4D1EA 2JC2A 4MEWA 5I8NA 1TIZA 2MLFC 1SMGA 3FS7A 3TUYB 2BE4A 2JPTA 4MVFA 1L2OB 2JQ6A 4MZJA 4ORBB 2SCPA 4YI9A 1DJHA 1KWOB 1PRWA 2MBXA 2LP2A 3CGAA 2RGIA 2F3YA 2Y4QA 2JT8A 2PVBA 1F54A 2MLEC 1SL7A 1N65A 2BECA 4PHNA 1CB1A 4PE7A 5CSIA 2KOTA 2COLB 2VRGA 3KEVA 1R6PA 3DD4A 2Y1NA 1F70A 5DKNA 1DT7B 1UHJA 3I5IC 3SG6A 3TZ1A 4CIDA 1A03A 1WRLA 1AVSA 1BLQA 3JVTC 3H4SE 4P5OE 1WLMA 4XJKA 1NCYA 4PCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  1MXL C;  1VRK A;  2M7L A;  3DF0 A;  1FI5 A;  3CTN A;  2IS9 A;  2SAS A;  5B8I B;  2EGD A;  1SNL A;  2KAY A;  2KI6 D;  4A4B A;  2Q91 A;  5FYX A;  4ZCU A;  1X02 A;  4CPV A;  1BR1 B;  1QTX A;  1DJG A;  3PM8 A;  2Q4U A;  1F4O A;  3NSL A;  3JTD C;  3PN7 C;  2K2A A;  5J3X A;  3TUY C;  1B7T Z;  1ALW A;  3ICB A;  1NYA A;  2M7N A;  1LVC D;  2K61 A;  4WRI A;  1OOJ A;  1YUS A;  4BY5 A;  1OQP A;  4CFQ A;  1KK7 Y;  4MBE A;  4YGB B;  1NCZ A;  3OX5 A;  1PSB A;  2K8M B;  3GOF A;  2JZI A;  1C07 A;  2PRU A;  1AJ5 A;  2A4J A;  2WCF A;  5AXI A;  4GFT A;  4M2P A;  1Y1U A;  1A75 A;  4BY4 A;  1J7P A;  1F4Q A;  1RWY A;  2KFG A;  3OP0 A;  4YGE B;  1CDM A;  1CLL A;  3SG3 A;  3WXA A;  1R2U A;  3KF9 A;  1BG1 A;  1CDN A;  4FQO A;  1XYD A;  1IKU A;  1NUB A;  3CWG A;  2OS8 B;  1S6J A;  1WLZ A;  4NQG A;  3SG2 A;  4UPG A;  2LM5 A;  1DGV A;  1IG5 A;  3RM1 A;  1NX3 A;  2ZKM X;  1M39 A;  1WRK A;  4CFR A;  1K93 D;  4C0K A;  2JNX A;  1KCY A;  3CR5 X;  1SPY A;  1IQ5 A;  2I2R E;  4JQ0 D;  1BOD A;  1YR5 A;  4N1F A;  1WY9 A;  1K95 A;  1K8U A;  1CMG A;  1NX1 A;  1NWD A;  3DVE A;  1NPQ A;  5AFP A;  1YRU B;  1NIW A;  2L4H A;  4XYN A;  4E68 A;  1CFF A;  2JXC A;  2V53 A;  4WQ3 A;  2K7C A;  1BF5 A;  5D69 A;  2M0R A;  1CLB A;  3C1V A;  1AUI B;  4YBH B;  1G4Y R;  4QJ4 B;  4I5K A;  2LP3 A;  2WOS A;  4YI8 A;  4YGD B;  3I5G C;  1LA3 A;  2LNK A;  1PVB A;  2KI4 C;  1A2X A;  1HT9 A;  2O60 A;  3TDI A;  3WHT B;  1FW4 A;  5HLO A;  3RLZ A;  2K0J A;  4GGF C;  2DOQ A;  1TNQ A;  1J7Q A;  3OB2 B;  2FCE A;  1FBV A;  1OZS A;  1YVH A;  1QIV A;  3CR4 X;  3WHU B;  3KHE A;  4WQ2 A;  2JRF A;  3EKH A;  3FWB A;  3OX6 A;  4DCK A;  1CFP A;  1DF0 B;  1MHO A;  2F3Z A;  3CZT X;  4YGA A;  1B1G A;  1FI6 A;  1REC A;  2NCP A;  3I5I B;  5JJG A;  2HQW A;  2KHN A;  2BE6 A;  3DVJ A;  3JVT B;  4AQI A;  3D0Y B;  2WOR A;  1EG3 A;  5I2L A;  1F71 A;  1BU3 A;  1EXR A;  1U5I B;  4MRY A;  4HRH A;  2FJU B;  1JF2 A;  1TNP A;  3IF7 A;  4GAO A;  1CMF A;  2JOJ A;  3E3R A;  1OE9 B;  2HPS A;  1UP5 A;  2ZRT A;  2LV7 A;  2LLU A;  1KQM C;  1CM4 A;  3DVM A;  1K94 A;  1M63 B;  1QIW A;  2LAP A;  3JTD B;  3PN7 B;  4GUK A;  4DUQ A;  1BT6 A;  2BBN A;  2BCX A;  1H4B A;  1M31 A;  4FTG A;  1AJ4 A;  4MZL A;  3BOW B;  2D8N A;  2Y1M A;  5JOL A;  1CDP A;  2BKI B;  1SK6 D;  1GGZ A;  3SIB A;  2LVJ A;  2M3W A;  2P6B B;  4L9M A;  2I7A A;  2MJW B;  2WND A;  1TNW A;  2LHI A;  2WCE A;  2ZRS A;  4NDC A;  3BXK A;  4MSP A;  4AOM A;  1DMO A;  3PSR A;  2JT0 A;  4YGC B;  1K96 A;  2BCA A;  2JT3 A;  1S5G Z;  4CLN A;  4TNC A;  3TS5 C;  2L0P A;  1K2H A;  1B47 A;  2L50 A;  3PAT A;  3O78 A;  1KFX S;  1QVI Z;  3ZWH A;  1N0Y A;  5K89 A;  1SCM C;  2M49 B;  5KTY A;  3AKB A;  2LMV A;  1RRO A;  2LVK A;  1LA0 A;  3CLN A;  1ZFS A;  4GPL B;  1TTX A;  5HKY A;  1B9A A;  3I5G B;  1PAL A;  4JPZ B;  2KI4 B;  1TNX A;  5TNC A;  3IQO A;  2I94 A;  2B1U A;  2CCM A;  1XA5 A;  1S1E A;  1JFJ A;  2M97 A;  3EKJ A;  1ODB A;  2BL0 C;  4GGN A;  3PLF B;  1RFJ A;  5CSJ A;  2F8P A;  1B8C A;  3BYA A;  2LLS A;  2KAV A;  2LCP A;  1AK8 A;  1W7J B;  2L51 A;  1QV0 A;  4HRG A;  1CFC A;  2KSP A;  4PHJ A;  2KFH A;  2KGB C;  2E6W A;  2K7D A;  1QAS A;  4C0J A;  3VRP A;  1QLK A;  2ZND A;  4PE0 A;  1E8A A;  1NSH A;  1QX7 A;  3NSI A;  4A4C A;  2M29 A;  4C0L A;  1OSA A;  1BMO A;  3GK4 X;  1K9U A;  1XVJ A;  3AKA A;  3BUN B;  3VGO A;  1OMD A;  2G9B A;  1UHI A;  4QJ5 B;  2HET A;  5DKQ A;  2PAS A;  1KQM B;  1YX7 A;  2H2K A;  3M0W A;  2PSR A;  1RK9 A;  1PVA A;  2K7B A;  1QV1 A;  1EG4 A;  1DF0 A;  1XK4 C;  3AAK A;  3KPX A;  4ORC B;  2M8U A;  1CDL A;  2E30 A;  1S36 A;  3A4U B;  3D0Y A;  1XFU O;  1IJ6 A;  1YTZ C;  2BKH B;  2MHH A;  3KO0 A;  2CBL A;  1U5I A;  3HX4 A;  2L5X B;  2F2P A;  3EVR A;  3GK2 A;  3IQQ A;  1PUL A;  1SRA A;  1SBJ A;  3AAJ A;  5HKZ A;  2AMI A;  1Y0V H;  1QAT A;  1UWO A;  1GGW A;  1B7T Y;  1JF0 A;  1ZUZ A;  4ETO A;  5KU1 A;  1EH2 A;  1S26 D;  4PAL A;  5GQQ C;  1J1E A;  1G8I A;  2LMT A;  2PAL A;  3HCM A;  1WDC B;  3OHM B;  4PE4 A;  5DKR A;  2JTZ A;  4YRU A;  2ZN9 A;  1K90 D;  1TRF A;  3BOW A;  3TS5 B;  3LL8 B;  1TCF A;  1BOC A;  1UHK A;  1NX0 A;  1QXP A;  5G08 A;  4U8D A;  1SCM B;  1SL8 A;  1XO5 A;  1YUU A;  2LMU A;  4P2Y B;  1IGV A;  1K9K A;  1JC2 A;  2KYF A;  3FIA A;  3EVU A;  2JWW A;  3BUO B;  4ZCV A;  2ZNE A;  5IBW A;  3VRQ A;  1YRT B;  1JUO A;  2AAO A;  2KQ6 A;  4OVN F;  1A29 A;  1MUX A;  1N2D A;  1XFZ O;  4GBA A;  3I5F C;  1OZO A;  4GNK B;  2K7O A;  1H8B A;  2TN4 A;  2BL0 B;  1TN4 A;  3GK1 A;  1UUS A;  2KAX A;  2NLN A;  1Y1X A;  1EL4 A;  1S6I A;  2M9G A;  4DRW A;  1IJ5 A;  1ZAC A;  1UHH A;  5I2Q A;  1S3P A;  1B8R A;  1J7O A;  2CT9 A;  1OMV A;  1SYM A;  1KSO A;  3BUM B;  3MSE B;  3SG4 A;  2M1K B;  2NZ0 A;  1MR8 A;  1HQV A;  2WCB A;  2MRD A;  3LCP C;  1WDC C;  4PE1 A;  3O2P A;  2FOT A;  3FWC A;  3LK1 A;  2ISD A;  1KK7 Z;  1NP8 A;  5D7F A;  5F6T A;  3SG7 A;  1XFW O;  4PHM A;  4GGF A;  4Q04 A;  5PAL A;  3SG5 A;  1UUR A;  5AAN A;  3I5H C;  4IL1 A;  1AHR A;  1C7W A;  1QJT A;  5CSN A;  1FPW A;  1XFX O;  2AUC A;  2EHB A;  1AP4 A;  1Q80 A;  1DGU A;  1EJ3 A;  2LE9 B;  1BR4 B;  3QRX A;  1IWQ A;  1SR6 C;  3VRR A;  1L7Z A;  3F45 A;  1JWD A;  1JFK A;  2OTG C;  4OKH A;  2LVV A;  1F8H A;  2H61 C;  1KSM A;  2GGZ A;  1V1G A;  1S6C A;  4N1G A;  1CFD A;  2MAZ A;  2KBI A;  1A4P A;  2F33 A;  1DJY A;  1G33 A;  2LLT A;  1CLM A;  1PK0 D;  1FF1 A;  1SY9 A;  1KFU L;  1M45 A;  2O5G A;  1DVI A;  3VRN A;  2LUC A;  1KFU S;  1TCO B;  1OMR A;  2LHL A;  1IQ3 A;  1KK8 C;  1WRZ A;  3SIA A;  4R1E A;  5HYD A;  3ZNI A;  1DJZ A;  1CTR A;  3D10 A;  4PHK A;  1C7V A;  1QX5 B;  3NSK A;  1W7I B;  2KFF A;  2HF5 A;  3BUW B;  3SJS A;  2EC6 C;  1MF8 B;  1MWN A;  2LUX A;  3EK8 A;  1YUR A;  1ZOT B;  2I18 A;  2NCO A;  1DJX A;  2OPO A;  1D1O A;  1QX2 A;  2KDH A;  3PAL A;  2QAC A;  3EVV A;  4XJK B;  2L98 A;  2M1U A;  1L2O C;  2BCB A;  4N5X A;  1JBA A;  1QS7 A;  1S5G Y;  3DF0 B;  1IRJ A;  1J55 A;  1RJV A;  1ZMZ A;  2GGM A;  1SW8 A;  3NSO A;  4NDB A;  1KWO C;  1LIN A;  5BPJ A;  2L4I A;  1M46 A;  4HSZ A;  4USL A;  4I5L B;  1QVI Y;  3DVK A;  2JUL A;  2KGR A;  4MLW A;  3I5F B;  1K9P A;  2LC5 A;  3LLE A;  1QLS A;  3A8R A;  1YVL A;  2HQ8 A;  1UHN A;  3VRO A;  4QJ3 B;  1BJF A;  1XFY O;  2JTT A;  3EK7 A;  4F0Z B;  1JSA A;  4OR9 B;  5I2O A;  3TDZ A;  2K2F A;  1F55 A;  1RTP 1;  2KBM A;  4NDD A;  4HRE E;  3O6B A;  1MXE A;  4M2O A;  1SKT A;  4DIR A;  1MQ1 A;  3BUX B;  4OV2 A;  3K21 A;  5HKW A;  4OCI A;  3LK0 A;  1A75 B;  2H61 A;  2JNF A;  1NX2 A;  3CR2 A;  4ICB A;  3O4Y A;  3WNX B;  1CKK A;  5ER5 A;  2R2I A;  1Y1A A;  2LAN A;  1SCV A;  4M2Q A;  2MA2 A;  4MRX A;  4DS7 A;  4I5N B;  4MN0 A;  3I5H B;  2KQY A;  2BBM A;  4AQJ A;  2CXJ A;  2JU0 A;  2ZFD A;  4I5J A;  1DJI A;  5AEQ A;  1ALV A;  1J1D A;  2PMY A;  1GJY A;  1CNP A;  2KNE A;  1LXF C;  1SR6 B;  5CSF A;  1DTL A;  5AER A;  1TOP A;  2Y5I A;  2G2B A;  4JWQ A;  1J7R A;  2CNP A;  2L2E A;  2JXL A;  2OTG B;  2WC8 A;  3BQ3 A;  3PFV A;  1B4C A;  2GV5 A;  2QPT A;  2LVI A;  3TDU A;  5CPV A;  2NXQ A;  4PDZ A;  2F2O A;  5HLV A;  1XFV O;  1KQV A;  5KSZ A;  1IH0 A;  1SL9 A;  2OS8 C;  1B8L A;  1YUT A;  1NCX A;  1V1F A;  3NXA A;  1PSR A;  3CS1 A;  1KK8 B;  2FCD A;  2KYC A;  1XK4 A;  1YX8 A;  2KI6 C;  1Y6W A;  4MZK A;  2EC6 B;  1GQM A;  5ER4 X;  2ZN8 A;  3EK4 A;  1DJW A;  1CM1 A;  1LKJ A;  3OB1 B;  2CTN A;  4ORA B;  4D1E A;  2JC2 A;  4MEW A;  5I8N A;  1TIZ A;  2MLF C;  1SMG A;  3FS7 A;  3TUY B;  2BE4 A;  2JPT A;  4MVF A;  1L2O B;  2JQ6 A;  4MZJ A;  4ORB B;  2SCP A;  4YI9 A;  1DJH A;  1KWO B;  1PRW A;  2MBX A;  2LP2 A;  3CGA A;  2RGI A;  2F3Y A;  2Y4Q A;  2JT8 A;  2PVB A;  1F54 A;  2MLE C;  1SL7 A;  1N65 A;  2BEC A;  4PHN A;  1CB1 A;  4PE7 A;  5CSI A;  2KOT A;  2COL B;  2VRG A;  3KEV A;  1R6P A;  3DD4 A;  2Y1N A;  1F70 A;  5DKN A;  1DT7 B;  1UHJ A;  3I5I C;  3SG6 A;  3TZ1 A;  4CID A;  1A03 A;  1WRL A;  1AVS A;  1BLQ A;  3JVT C;  3H4S E;  4P5O E;  1WLM A;  4XJK A;  1NCY A;  4PCW A; 
#chains in the Genus database with same CATH topology
 1KFX L;  1MXL C;  1VRK A;  2M7L A;  2FJY A;  3DF0 A;  2L2C A;  1FI5 A;  1LS8 A;  3CTN A;  2KPH A;  2IS9 A;  2SAS A;  5B8I B;  2EGD A;  1SNL A;  2KAY A;  5I94 A;  2KI6 D;  4A4B A;  2Q91 A;  5FYX A;  4ZCU A;  1X02 A;  4CPV A;  1BR1 B;  1QTX A;  1DJG A;  3PM8 A;  2Q4U A;  1F4O A;  3NSL A;  3JTD C;  3PN7 C;  2K2A A;  3S0B A;  5J3X A;  3TUY C;  2BAP A;  1B7T Z;  1ALW A;  3ICB A;  1NYA A;  2M7N A;  1LVC D;  2K61 A;  4WRI A;  1OOJ A;  1YUS A;  4BY5 A;  1OQP A;  4CFQ A;  1KK7 Y;  4MBE A;  4YGB B;  1NCZ A;  3OX5 A;  1PSB A;  2K8M B;  3GOF A;  2JZI A;  1C07 A;  1Z4H A;  2PRU A;  1AJ5 A;  2A4J A;  2WCF A;  5AXI A;  4GFT A;  4M2P A;  1Y1U A;  1A75 A;  4BY4 A;  1J7P A;  1F4Q A;  1RWY A;  2KFG A;  3OP0 A;  4YGE B;  1CDM A;  1CLL A;  3SG3 A;  3WXA A;  1R2U A;  3KF9 A;  1BG1 A;  1CDN A;  4FQO A;  1XYD A;  1IKU A;  1NUB A;  3CWG A;  2OS8 B;  3BFB A;  1S6J A;  4OZD A;  1WLZ A;  4NQG A;  3SG2 A;  4UPG A;  2LM5 A;  1DGV A;  1IG5 A;  3RM1 A;  1NX3 A;  2ZKM X;  1M39 A;  1WRK A;  4CFR A;  1K93 D;  4C0K A;  2JNX A;  1KCY A;  3CR5 X;  1SPY A;  3CZ1 A;  1IQ5 A;  2I2R E;  4JQ0 D;  1BOD A;  1YR5 A;  4N1F A;  1WY9 A;  3CAB A;  1K95 A;  1K8U A;  1CMG A;  1NX1 A;  1NWD A;  3DVE A;  1NPQ A;  5AFP A;  1YRU B;  1NIW A;  2L4H A;  3D76 A;  4XYN A;  4E68 A;  2JXC A;  1CFF A;  2V53 A;  4WQ3 A;  2K7C A;  1BF5 A;  5D69 A;  3V2L A;  2M0R A;  1CLB A;  3C1V A;  1AUI B;  3K1E A;  4YBH B;  1G4Y R;  2P71 A;  3D74 A;  4QJ4 B;  4I5K A;  5FI2 A;  2LP3 A;  2WOS A;  3DYE A;  4YI8 A;  4YGD B;  3I5G C;  1LA3 A;  2LNK A;  1PVB A;  2KI4 C;  1A2X A;  1HT9 A;  2O60 A;  3TDI A;  3WHT B;  1FW4 A;  5HLO A;  3RLZ A;  2K0J A;  4GGF C;  2DOQ A;  1TNQ A;  1J7Q A;  3OB2 B;  2FCE A;  1FBV A;  1OZS A;  3L4A A;  1YVH A;  1QIV A;  3CR4 X;  3WHU B;  3KHE A;  4IJ7 A;  4WQ2 A;  2JRF A;  3EKH A;  3FWB A;  2KLD A;  3OX6 A;  4DCK A;  1CFP A;  1DF0 B;  3D73 A;  1MHO A;  2F3Z A;  3CZT X;  4YGA A;  1B1G A;  4INW A;  1FI6 A;  1REC A;  2NCP A;  3I5I B;  5JJG A;  2HQW A;  2KHN A;  2BE6 A;  3DVJ A;  3JVT B;  4AQI A;  3D0Y B;  2WOR A;  3OBV A;  1EG3 A;  5I2L A;  1F71 A;  5DIC A;  1BU3 A;  1EXR A;  1U5I B;  4MRY A;  4HRH A;  2FJU B;  1JF2 A;  1TNP A;  3IF7 A;  4GAO A;  1CMF A;  2JOJ A;  3E3R A;  1OE9 B;  2HPS A;  1UP5 A;  1XFR A;  2ZRT A;  2LV7 A;  2LLU A;  3B87 A;  1KQM C;  1CM4 A;  3DVM A;  1K94 A;  1M63 B;  1QIW A;  2LAP A;  3JTD B;  3PN7 B;  4GUK A;  4DUQ A;  1BT6 A;  2BBN A;  2BCX A;  1H4B A;  1M31 A;  4FTG A;  1AJ4 A;  4F7F A;  4MZL A;  3BOW B;  2D8N A;  2Y1M A;  3OGN A;  5JOL A;  1CDP A;  2QEH A;  2BKI B;  1SK6 D;  2WCK A;  1GGZ A;  5EL2 A;  3SIB A;  2LVJ A;  2M3W A;  2P6B B;  4L9M A;  2I7A A;  3DZT A;  2MJW B;  2WND A;  1TNW A;  2LHI A;  2WCE A;  2ZRS A;  3CZ0 A;  4NDC A;  3BXK A;  3O4X A;  3S0D A;  4MSP A;  4AOM A;  1DMO A;  3PSR A;  2JT0 A;  4YGC B;  1K96 A;  2BCA A;  2JT3 A;  1S5G Z;  4CLN A;  4TNC A;  2H8V A;  2YGU A;  3TS5 C;  2L0P A;  1K2H A;  1B47 A;  2L50 A;  3PAT A;  3O78 A;  1KFX S;  1QVI Z;  1TUJ A;  1N0Y A;  3SS4 A;  3ZWH A;  5K89 A;  1SCM C;  2M49 B;  5KTY A;  3AKB A;  2LMV A;  1RRO A;  2LVK A;  1LA0 A;  3CLN A;  1ZFS A;  2WCJ A;  1TTX A;  3BFA A;  1B9A A;  3DY9 A;  4GPL B;  5HKY A;  3I5G B;  1PAL A;  4JPZ B;  2KI4 B;  1TNX A;  5TNC A;  3IQO A;  2I94 A;  2B1U A;  2CCM A;  1XA5 A;  1S1E A;  2ERB A;  1JFJ A;  2M97 A;  3S0A A;  3EKJ A;  1ODB A;  2BL0 C;  3QME A;  4GGN A;  3PLF B;  3R1V A;  1RFJ A;  5CSJ A;  2F8P A;  1B8C A;  2GTE A;  3BYA A;  2LLS A;  2KAV A;  2LCP A;  1AK8 A;  1W7J B;  2L51 A;  2QEO A;  1QV0 A;  4HRG A;  1CFC A;  2KSP A;  4PHJ A;  2KFH A;  2KGB C;  2E6W A;  2K7D A;  1QAS A;  1OOF A;  3FE6 A;  4C0J A;  3VRP A;  1QLK A;  2ZND A;  3R72 A;  4PE0 A;  1E8A A;  1NSH A;  1QX7 A;  3NSI A;  4A4C A;  2M29 A;  4C0L A;  1OSA A;  1BMO A;  3GK4 X;  1K9U A;  1XVJ A;  3AKA A;  3UO9 A;  3BUN B;  3VGO A;  1OMD A;  2G9B A;  1UHI A;  4QJ5 B;  2HET A;  5DKQ A;  2PAS A;  1KQM B;  1YX7 A;  2H2K A;  3M0W A;  2PSR A;  1RK9 A;  1PVA A;  2K7B A;  2QEB A;  1QV1 A;  3D77 A;  3D75 A;  1P28 A;  1EG4 A;  1DF0 A;  1XK4 C;  3AAK A;  3KPX A;  4ORC B;  2M8U A;  1CDL A;  2E30 A;  1S36 A;  3A4U B;  3D0Y A;  1XFU O;  1IJ6 A;  4JD9 A;  1YTZ C;  2BKH B;  2MHH A;  3KO0 A;  2CBL A;  1OOG A;  1U5I A;  3HX4 A;  2L5X B;  2F2P A;  3EVR A;  3GK2 A;  3IQQ A;  1PUL A;  3FE8 A;  1SRA A;  1SBJ A;  3AAJ A;  5HKZ A;  2AMI A;  1Y0V H;  1QAT A;  1UWO A;  1DC1 A;  1GGW A;  1B7T Y;  1OOI X;  1JF0 A;  1ZUZ A;  4ETO A;  5KU1 A;  1EH2 A;  1S26 D;  4PAL A;  5GQQ C;  1J1E A;  1G8I A;  2LMT A;  2PAL A;  1TWO A;  1WDC B;  3HCM A;  3OHM B;  3VB1 A;  4PE4 A;  5DKR A;  2JTZ A;  4YRU A;  2ZN9 A;  1K90 D;  1TRF A;  3BOW A;  3TS5 B;  3LL8 B;  1TCF A;  3Q8I A;  1BOC A;  1UHK A;  1NX0 A;  1QXP A;  5G08 A;  4U8D A;  1SCM B;  1SL8 A;  1XO5 A;  1YUU A;  2LMU A;  4P2Y B;  1IGV A;  1K9K A;  3NHT A;  1JC2 A;  2KYF A;  3FIA A;  3EVU A;  2JWW A;  3BUO B;  2JPO A;  4ZCV A;  2WC5 A;  2ZNE A;  5D3O A;  5IBW A;  3VRQ A;  1YRT B;  1JUO A;  2AAO A;  2KQ6 A;  4OVN F;  1A29 A;  1MUX A;  1N2D A;  1XFZ O;  4GBA A;  3I5F C;  1OZO A;  3D78 A;  4GNK B;  2K7O A;  1H8B A;  2TN4 A;  2BL0 B;  1TN4 A;  3GK1 A;  1UUS A;  2KAX A;  3BJH A;  2QDI A;  1OW4 A;  2NLN A;  1Y1X A;  1EL4 A;  3CDN A;  1S6I A;  2M9G A;  3CZ2 A;  4DRW A;  1IJ5 A;  1ZAC A;  5HL1 A;  1UHH A;  5I2Q A;  1S3P A;  1B8R A;  1J7O A;  4FQT A;  2CT9 A;  1OMV A;  1SYM A;  1KSO A;  3BUM B;  3MSE B;  3R1P A;  4JKT A;  3SG4 A;  2M1K B;  2NZ0 A;  1MR8 A;  1HQV A;  2WCB A;  2MRD A;  3LCP C;  1WDC C;  4PE1 A;  3O2P A;  2FOT A;  3FWC A;  3LK1 A;  2ISD A;  2K60 A;  1KK7 Z;  1NP8 A;  5D7F A;  5F6T A;  3SG7 A;  1XFW O;  4PHM A;  3B86 A;  4GGF A;  4Q04 A;  5PAL A;  3SG5 A;  1UUR A;  3IVT A;  5AAN A;  3B6X A;  2P70 A;  3I5H C;  4IL1 A;  1AHR A;  1C7W A;  1QWV A;  1QJT A;  3S0F A;  5CSN A;  1FPW A;  1XFX O;  2AUC A;  2EHB A;  1AP4 A;  1Q80 A;  1DGU A;  1EJ3 A;  2LE9 B;  1BR4 B;  3QRX A;  3BFH A;  1IWQ A;  1SR6 C;  3VRR A;  1L7Z A;  3F45 A;  5FI6 A;  1JWD A;  1JFK A;  2OTG C;  4OKH A;  2LVV A;  2WCM A;  2H61 C;  1F8H A;  1KSM A;  2GGZ A;  1V1G A;  1S6C A;  4N1G A;  1CFD A;  2MAZ A;  2KBI A;  1A4P A;  2F33 A;  1DEL A;  1DJY A;  1G33 A;  2LLT A;  1CLM A;  1SSE B;  4PT1 A;  1PK0 D;  1DEK A;  1FF1 A;  1SY9 A;  1KFU L;  1M45 A;  2O5G A;  1DVI A;  3VRN A;  2LUC A;  1KFU S;  2PYQ A;  1TCO B;  1OMR A;  2LHL A;  1IQ3 A;  1KK8 C;  1WRZ A;  3SIA A;  4R1E A;  5HYD A;  3ZNI A;  1DJZ A;  1CTR A;  3D10 A;  4PHK A;  1C7V A;  1QX5 B;  1T14 A;  3NSK A;  1W7I B;  2KFF A;  2HF5 A;  3BUW B;  3SJS A;  2EC6 C;  1MF8 B;  1MWN A;  2LUX A;  3EK8 A;  1YUR A;  1ZOT B;  1Z2C B;  2I18 A;  2NCO A;  1DJX A;  2OPO A;  1D1O A;  3L4L A;  1QX2 A;  2KDH A;  3PAL A;  2QAC A;  3EVV A;  1TUZ A;  4XJK B;  2L98 A;  2M1U A;  2L5Y A;  1L2O C;  2BCB A;  4N5X A;  3EG5 B;  1JBA A;  1QS7 A;  1S5G Y;  3DF0 B;  1IRJ A;  1J55 A;  1RJV A;  1ZMZ A;  2GGM A;  1SW8 A;  3NSO A;  4NDB A;  1KWO C;  1LIN A;  5BPJ A;  2L4I A;  1M46 A;  4HSZ A;  4USL A;  2WCL A;  1QVI Y;  3DVK A;  3FE9 A;  4I5L B;  2JUL A;  2KGR A;  3PJI A;  3I5F B;  1K9P A;  1W9Z A;  2LC5 A;  4MLW A;  1ORG A;  3LLE A;  1QLS A;  3A8R A;  1YVL A;  2HQ8 A;  1UHN A;  3VRO A;  4QJ3 B;  1BJF A;  1XFY O;  2JTT A;  3EK7 A;  4F0Z B;  1JSA A;  4OR9 B;  5I2O A;  3TDZ A;  2K2F A;  1F55 A;  1RTP 1;  2KBM A;  4NDD A;  4HRE E;  3O6B A;  1MXE A;  4M2O A;  2WC6 A;  1SKT A;  4DIR A;  3UNW A;  1MQ1 A;  3BUX B;  4OV2 A;  3CYZ A;  3K21 A;  5HKW A;  4OCI A;  3LK0 A;  1A75 B;  2H61 A;  2JNF A;  1NX2 A;  3CR2 A;  3RZS A;  4ICB A;  3O4Y A;  3WNX B;  1CKK A;  5ER5 A;  2KLE A;  2R2I A;  1Y1A A;  2LAN A;  1SCV A;  3L47 A;  4M2Q A;  2MA2 A;  4MRX A;  4DS7 A;  4I5N B;  4MN0 A;  3I5H B;  2KQY A;  2BBM A;  4AQJ A;  2CXJ A;  2JU0 A;  3S0E A;  2ZFD A;  4I5J A;  1DJI A;  5AEQ A;  1ALV A;  1J1D A;  2PMY A;  1GJY A;  1CNP A;  2KNE A;  1LXF C;  1SR6 B;  5CSF A;  1DTL A;  5AER A;  1TOP A;  2Y5I A;  2G2B A;  4JWQ A;  1J7R A;  2CNP A;  2L2E A;  2JXL A;  2OTG B;  2WC8 A;  3BQ3 A;  3PFV A;  1B4C A;  2GV5 A;  2QPT A;  2LVI A;  3NGV A;  3B88 A;  3TDU A;  5CPV A;  4KYN A;  2NXQ A;  1C3Z A;  4PDZ A;  2F2O A;  5HLV A;  1XFV O;  1GM0 A;  3PM2 A;  1OOH A;  5KSZ A;  1IH0 A;  1KQV A;  1SL9 A;  2OS8 C;  3SS5 A;  1B8L A;  1YUT A;  1NCX A;  1V1F A;  3NXA A;  1PSR A;  2BNX A;  1KK8 B;  3CS1 A;  1C3Y A;  2FCD A;  2KYC A;  1XK4 A;  1YX8 A;  2KI6 C;  1Y6W A;  4MZK A;  2EC6 B;  3S0G A;  1GQM A;  5ER4 X;  3SS3 A;  2ZN8 A;  3EK4 A;  1DJW A;  1CM1 A;  1LKJ A;  3OB1 B;  2CTN A;  2PQL A;  4ORA B;  2JC2 A;  4MEW A;  4D1E A;  1TIZ A;  2MLF C;  5I8N A;  1SMG A;  3FS7 A;  3TUY B;  3DXL A;  3R1O A;  5FI7 A;  2BE4 A;  2JPT A;  4MVF A;  1L2O B;  2JQ6 A;  4MZJ A;  4ORB B;  2SCP A;  4YI9 A;  1DJH A;  1DQE A;  1KWO B;  1PRW A;  2LP2 A;  2MBX A;  3N7H A;  3NHI A;  3CGA A;  2RGI A;  2F3Y A;  2Y4Q A;  1IIO A;  2JT8 A;  2PVB A;  1F54 A;  2MLE C;  1SL7 A;  1N65 A;  2BEC A;  3B7A A;  4PHN A;  1CB1 A;  4PE7 A;  5CSI A;  2KOT A;  2COL B;  2VRG A;  3KEV A;  1R6P A;  3DD4 A;  2Y1N A;  4INX A;  1F70 A;  5DKN A;  2QEV A;  1DT7 B;  1UHJ A;  2WCH A;  3I5I C;  3SG6 A;  3TZ1 A;  4CID A;  1A03 A;  1WRL A;  1AVS A;  1BLQ A;  3JVT C;  3H4S E;  4P5O E;  1WLM A;  4XJK A;  1NCY A;  4PCW A; 
#chains in the Genus database with same CATH homology
 1KFX L;  1MXL C;  1VRK A;  2M7L A;  3DF0 A;  1FI5 A;  3CTN A;  2IS9 A;  2SAS A;  5B8I B;  2EGD A;  1SNL A;  2KAY A;  2KI6 D;  4A4B A;  2Q91 A;  5FYX A;  4ZCU A;  1X02 A;  4CPV A;  1BR1 B;  1QTX A;  1DJG A;  3PM8 A;  2Q4U A;  1F4O A;  3NSL A;  3JTD C;  3PN7 C;  2K2A A;  5J3X A;  3TUY C;  1B7T Z;  1ALW A;  3ICB A;  1NYA A;  2M7N A;  1LVC D;  2K61 A;  4WRI A;  1OOJ A;  1YUS A;  4BY5 A;  1OQP A;  4CFQ A;  1KK7 Y;  4MBE A;  4YGB B;  1NCZ A;  3OX5 A;  1PSB A;  2K8M B;  3GOF A;  2JZI A;  1C07 A;  2PRU A;  1AJ5 A;  2A4J A;  2WCF A;  5AXI A;  4GFT A;  4M2P A;  1Y1U A;  1A75 A;  4BY4 A;  1J7P A;  1F4Q A;  1RWY A;  2KFG A;  3OP0 A;  4YGE B;  1CDM A;  1CLL A;  3SG3 A;  3WXA A;  1R2U A;  3KF9 A;  1BG1 A;  1CDN A;  4FQO A;  1XYD A;  1IKU A;  1NUB A;  3CWG A;  2OS8 B;  1S6J A;  1WLZ A;  4NQG A;  3SG2 A;  4UPG A;  2LM5 A;  1DGV A;  1IG5 A;  3RM1 A;  1NX3 A;  2ZKM X;  1M39 A;  1WRK A;  4CFR A;  1K93 D;  4C0K A;  2JNX A;  1KCY A;  3CR5 X;  1SPY A;  1IQ5 A;  2I2R E;  4JQ0 D;  1BOD A;  1YR5 A;  4N1F A;  1WY9 A;  1K95 A;  1K8U A;  1CMG A;  1NX1 A;  1NWD A;  3DVE A;  1NPQ A;  5AFP A;  1YRU B;  1NIW A;  2L4H A;  4XYN A;  4E68 A;  1CFF A;  2JXC A;  2V53 A;  4WQ3 A;  2K7C A;  1BF5 A;  5D69 A;  2M0R A;  1CLB A;  3C1V A;  1AUI B;  4YBH B;  1G4Y R;  4QJ4 B;  4I5K A;  2LP3 A;  2WOS A;  4YI8 A;  4YGD B;  3I5G C;  1LA3 A;  2LNK A;  1PVB A;  2KI4 C;  1A2X A;  1HT9 A;  2O60 A;  3TDI A;  3WHT B;  1FW4 A;  5HLO A;  3RLZ A;  2K0J A;  4GGF C;  2DOQ A;  1TNQ A;  1J7Q A;  3OB2 B;  2FCE A;  1FBV A;  1OZS A;  1YVH A;  1QIV A;  3CR4 X;  3WHU B;  3KHE A;  4WQ2 A;  2JRF A;  3EKH A;  3FWB A;  3OX6 A;  4DCK A;  1CFP A;  1DF0 B;  1MHO A;  2F3Z A;  3CZT X;  4YGA A;  1B1G A;  1FI6 A;  1REC A;  2NCP A;  3I5I B;  5JJG A;  2HQW A;  2KHN A;  2BE6 A;  3DVJ A;  3JVT B;  4AQI A;  3D0Y B;  2WOR A;  1EG3 A;  5I2L A;  1F71 A;  1BU3 A;  1EXR A;  1U5I B;  4MRY A;  4HRH A;  2FJU B;  1JF2 A;  1TNP A;  3IF7 A;  4GAO A;  1CMF A;  2JOJ A;  3E3R A;  1OE9 B;  2HPS A;  1UP5 A;  2ZRT A;  2LV7 A;  2LLU A;  1KQM C;  1CM4 A;  3DVM A;  1K94 A;  1M63 B;  1QIW A;  2LAP A;  3JTD B;  3PN7 B;  4GUK A;  4DUQ A;  1BT6 A;  2BBN A;  2BCX A;  1H4B A;  1M31 A;  4FTG A;  1AJ4 A;  4MZL A;  3BOW B;  2D8N A;  2Y1M A;  5JOL A;  1CDP A;  2BKI B;  1SK6 D;  1GGZ A;  3SIB A;  2LVJ A;  2M3W A;  2P6B B;  4L9M A;  2I7A A;  2MJW B;  2WND A;  1TNW A;  2LHI A;  2WCE A;  2ZRS A;  4NDC A;  3BXK A;  4MSP A;  4AOM A;  1DMO A;  3PSR A;  2JT0 A;  4YGC B;  1K96 A;  2BCA A;  2JT3 A;  1S5G Z;  4CLN A;  4TNC A;  3TS5 C;  2L0P A;  1K2H A;  1B47 A;  2L50 A;  3PAT A;  3O78 A;  1KFX S;  1QVI Z;  3ZWH A;  1N0Y A;  5K89 A;  1SCM C;  2M49 B;  5KTY A;  3AKB A;  2LMV A;  1RRO A;  2LVK A;  1LA0 A;  3CLN A;  1ZFS A;  4GPL B;  1TTX A;  5HKY A;  1B9A A;  3I5G B;  1PAL A;  4JPZ B;  2KI4 B;  1TNX A;  5TNC A;  3IQO A;  2I94 A;  2B1U A;  2CCM A;  1XA5 A;  1S1E A;  1JFJ A;  2M97 A;  3EKJ A;  1ODB A;  2BL0 C;  4GGN A;  3PLF B;  1RFJ A;  5CSJ A;  2F8P A;  1B8C A;  3BYA A;  2LLS A;  2KAV A;  2LCP A;  1AK8 A;  1W7J B;  2L51 A;  1QV0 A;  4HRG A;  1CFC A;  2KSP A;  4PHJ A;  2KFH A;  2KGB C;  2E6W A;  2K7D A;  1QAS A;  4C0J A;  3VRP A;  1QLK A;  2ZND A;  4PE0 A;  1E8A A;  1NSH A;  1QX7 A;  3NSI A;  4A4C A;  2M29 A;  4C0L A;  1OSA A;  1BMO A;  3GK4 X;  1K9U A;  1XVJ A;  3AKA A;  3BUN B;  3VGO A;  1OMD A;  2G9B A;  1UHI A;  4QJ5 B;  2HET A;  5DKQ A;  2PAS A;  1KQM B;  1YX7 A;  2H2K A;  3M0W A;  2PSR A;  1RK9 A;  1PVA A;  2K7B A;  1QV1 A;  1EG4 A;  1DF0 A;  1XK4 C;  3AAK A;  3KPX A;  4ORC B;  2M8U A;  1CDL A;  2E30 A;  1S36 A;  3A4U B;  3D0Y A;  1XFU O;  1IJ6 A;  1YTZ C;  2BKH B;  2MHH A;  3KO0 A;  2CBL A;  1U5I A;  3HX4 A;  2L5X B;  2F2P A;  3EVR A;  3GK2 A;  3IQQ A;  1PUL A;  1SRA A;  1SBJ A;  3AAJ A;  5HKZ A;  2AMI A;  1Y0V H;  1QAT A;  1UWO A;  1GGW A;  1B7T Y;  1JF0 A;  1ZUZ A;  4ETO A;  5KU1 A;  1EH2 A;  1S26 D;  4PAL A;  5GQQ C;  1J1E A;  1G8I A;  2LMT A;  2PAL A;  3HCM A;  1WDC B;  3OHM B;  4PE4 A;  5DKR A;  2JTZ A;  4YRU A;  2ZN9 A;  1K90 D;  1TRF A;  3BOW A;  3TS5 B;  3LL8 B;  1TCF A;  1BOC A;  1UHK A;  1NX0 A;  1QXP A;  5G08 A;  4U8D A;  1SCM B;  1SL8 A;  1XO5 A;  1YUU A;  2LMU A;  4P2Y B;  1IGV A;  1K9K A;  1JC2 A;  2KYF A;  3FIA A;  3EVU A;  2JWW A;  3BUO B;  4ZCV A;  2ZNE A;  5IBW A;  3VRQ A;  1YRT B;  1JUO A;  2AAO A;  2KQ6 A;  4OVN F;  1A29 A;  1MUX A;  1N2D A;  1XFZ O;  4GBA A;  3I5F C;  1OZO A;  4GNK B;  2K7O A;  1H8B A;  2TN4 A;  2BL0 B;  1TN4 A;  3GK1 A;  1UUS A;  2KAX A;  2NLN A;  1Y1X A;  1EL4 A;  1S6I A;  2M9G A;  4DRW A;  1IJ5 A;  1ZAC A;  1UHH A;  5I2Q A;  1S3P A;  1B8R A;  1J7O A;  2CT9 A;  1OMV A;  1SYM A;  1KSO A;  3BUM B;  3MSE B;  3SG4 A;  2M1K B;  2NZ0 A;  1MR8 A;  1HQV A;  2WCB A;  2MRD A;  3LCP C;  1WDC C;  4PE1 A;  3O2P A;  2FOT A;  3FWC A;  3LK1 A;  2ISD A;  1KK7 Z;  1NP8 A;  5D7F A;  5F6T A;  3SG7 A;  1XFW O;  4PHM A;  4GGF A;  4Q04 A;  5PAL A;  3SG5 A;  1UUR A;  5AAN A;  3I5H C;  4IL1 A;  1AHR A;  1C7W A;  1QJT A;  5CSN A;  1FPW A;  1XFX O;  2AUC A;  2EHB A;  1AP4 A;  1Q80 A;  1DGU A;  1EJ3 A;  2LE9 B;  1BR4 B;  3QRX A;  1IWQ A;  1SR6 C;  3VRR A;  1L7Z A;  3F45 A;  1JWD A;  1JFK A;  2OTG C;  4OKH A;  2LVV A;  1F8H A;  2H61 C;  1KSM A;  2GGZ A;  1V1G A;  1S6C A;  4N1G A;  1CFD A;  2MAZ A;  2KBI A;  1A4P A;  2F33 A;  1DJY A;  1G33 A;  2LLT A;  1CLM A;  1PK0 D;  1FF1 A;  1SY9 A;  1KFU L;  1M45 A;  2O5G A;  1DVI A;  3VRN A;  2LUC A;  1KFU S;  1TCO B;  1OMR A;  2LHL A;  1IQ3 A;  1KK8 C;  1WRZ A;  3SIA A;  4R1E A;  5HYD A;  3ZNI A;  1DJZ A;  1CTR A;  3D10 A;  4PHK A;  1C7V A;  1QX5 B;  3NSK A;  1W7I B;  2KFF A;  2HF5 A;  3BUW B;  3SJS A;  2EC6 C;  1MF8 B;  1MWN A;  2LUX A;  3EK8 A;  1YUR A;  1ZOT B;  2I18 A;  2NCO A;  1DJX A;  2OPO A;  1D1O A;  1QX2 A;  2KDH A;  3PAL A;  2QAC A;  3EVV A;  4XJK B;  2L98 A;  2M1U A;  1L2O C;  2BCB A;  4N5X A;  1JBA A;  1QS7 A;  1S5G Y;  3DF0 B;  1IRJ A;  1J55 A;  1RJV A;  1ZMZ A;  2GGM A;  1SW8 A;  3NSO A;  4NDB A;  1KWO C;  1LIN A;  5BPJ A;  2L4I A;  1M46 A;  4HSZ A;  4USL A;  4I5L B;  1QVI Y;  3DVK A;  2JUL A;  2KGR A;  4MLW A;  3I5F B;  1K9P A;  2LC5 A;  3LLE A;  1QLS A;  3A8R A;  1YVL A;  2HQ8 A;  1UHN A;  3VRO A;  4QJ3 B;  1BJF A;  1XFY O;  2JTT A;  3EK7 A;  4F0Z B;  1JSA A;  4OR9 B;  5I2O A;  3TDZ A;  2K2F A;  1F55 A;  1RTP 1;  2KBM A;  4NDD A;  4HRE E;  3O6B A;  1MXE A;  4M2O A;  1SKT A;  4DIR A;  1MQ1 A;  3BUX B;  4OV2 A;  3K21 A;  5HKW A;  4OCI A;  3LK0 A;  1A75 B;  2H61 A;  2JNF A;  1NX2 A;  3CR2 A;  4ICB A;  3O4Y A;  3WNX B;  1CKK A;  5ER5 A;  2R2I A;  1Y1A A;  2LAN A;  1SCV A;  4M2Q A;  2MA2 A;  4MRX A;  4DS7 A;  4I5N B;  4MN0 A;  3I5H B;  2KQY A;  2BBM A;  4AQJ A;  2CXJ A;  2JU0 A;  2ZFD A;  4I5J A;  1DJI A;  5AEQ A;  1ALV A;  1J1D A;  2PMY A;  1GJY A;  1CNP A;  2KNE A;  1LXF C;  1SR6 B;  5CSF A;  1DTL A;  5AER A;  1TOP A;  2Y5I A;  2G2B A;  4JWQ A;  1J7R A;  2CNP A;  2L2E A;  2JXL A;  2OTG B;  2WC8 A;  3BQ3 A;  3PFV A;  1B4C A;  2GV5 A;  2QPT A;  2LVI A;  3TDU A;  5CPV A;  2NXQ A;  4PDZ A;  2F2O A;  5HLV A;  1XFV O;  1KQV A;  5KSZ A;  1IH0 A;  1SL9 A;  2OS8 C;  1B8L A;  1YUT A;  1NCX A;  1V1F A;  3NXA A;  1PSR A;  3CS1 A;  1KK8 B;  2FCD A;  2KYC A;  1XK4 A;  1YX8 A;  2KI6 C;  1Y6W A;  4MZK A;  2EC6 B;  1GQM A;  5ER4 X;  2ZN8 A;  3EK4 A;  1DJW A;  1CM1 A;  1LKJ A;  3OB1 B;  2CTN A;  4ORA B;  4D1E A;  2JC2 A;  4MEW A;  5I8N A;  1TIZ A;  2MLF C;  1SMG A;  3FS7 A;  3TUY B;  2BE4 A;  2JPT A;  4MVF A;  1L2O B;  2JQ6 A;  4MZJ A;  4ORB B;  2SCP A;  4YI9 A;  1DJH A;  1KWO B;  1PRW A;  2MBX A;  2LP2 A;  3CGA A;  2RGI A;  2F3Y A;  2Y4Q A;  2JT8 A;  2PVB A;  1F54 A;  2MLE C;  1SL7 A;  1N65 A;  2BEC A;  4PHN A;  1CB1 A;  4PE7 A;  5CSI A;  2KOT A;  2COL B;  2VRG A;  3KEV A;  1R6P A;  3DD4 A;  2Y1N A;  1F70 A;  5DKN A;  1DT7 B;  1UHJ A;  3I5I C;  3SG6 A;  3TZ1 A;  4CID A;  1A03 A;  1WRL A;  1AVS A;  1BLQ A;  3JVT C;  3H4S E;  4P5O E;  1WLM A;  4XJK A;  1NCY A;  4PCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...