2BE6A

2.0 a crystal structure of the cav1.2 iq domain-ca/cam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
141
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin 2
publication title Insights into voltage-gated calcium channel regulation from the structure of the Ca(V)1.2 IQ domain-Ca(2+)/calmodulin complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 51
structure length 141
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A02
1ZUZA 1EJ3A 1LKJA 2BKIB 4PCWA 1VRKA 1NCZA 1KFUL 3KPXA 2CTNA 2JXLA 2HQWA 1G33A 2LVIA 3QRXA 3PFVA 5FYXA 1PALA 2M7LA 1XVJA 1PRWA 1NSHA 1N2DA 1BR4B 3BQ3A 3JTDB 3TDUA 1WDCC 1DVIA 3I5HC 2EGDA 1MUXA 2F8PA 2MA2A 4N1FA 4PHJA 3LLEA 1AUIB 1NYAA 1C7WA 1SR6B 2M9GA 1SKTA 1X02A 2F2OA 3HX4A 2A4JA 4I5LB 5I8NA 3TUYC 1CLMA 3I5GB 2NLNA 1K93D 1ZOTB 4N5XA 2BBMA 4ORBB 2KGBC 1CLLA 3IQQA 1S1EA 1XA5A 3BOWB 3O6BA 1EG4A 1K9UA 5DKRA 2JWWA 1B7TZ 1S6CA 2GGZA 1JBAA 1YR5A 3TS5B 4CFRA 3NSIA 2L0PA 2IS9A 2NZ0A 5KU1A 1XFWO 2HETA 3D0YA 3ZNIA 2K7CA 5JJGA 3EKJA 3VROA 1MF8B 4MZJA 1XFUO 2ISDA 2JQ6A 1YURA 3WNXB 4AQJA 1GGWA 2WOSA 1XK4C 1N65A 1TN4A 3CTNA 1IG5A 5AERA 1A29A 4YGAA 2L51A 2E30A 2PALA 1V1GA 2FCDA 2BCXA 2JOJA 1NX3A 4PE1A 1K96A 4NDCA 1FPWA 1DJWA 2I18A 2JTZA 2LMTA 1NWDA 4P2YB 4QJ4B 4XYNA 3PALA 2KBMA 1J7OA 2JRFA 1WDCB 3I5HB 1EG3A 4GGFA 1KWOC 3DVMA 4ORAB 3TDZA 1DT7B 3PLFB 1BG1A 1JF0A 2G2BA 1FBVA 5GQQC 4WQ2A 4Q04A 1J1DA 2KI6D 2KYFA 3GK1A 4HSZA 1TTXA 2KI6C 1WLMA 2K8MB 5J3XA 1A75A 1Q80A 4U8DA 3VRQA 4FTGA 1BJFA 1GGZA 3AKAA 4PALA 1W7JB 3CR2A 2LANA 1XFYO 4MZLA 2JU0A 3EVVA 2LLTA 1JUOA 1QX7A 1PVAA 1CNPA 1XFZO 1J7QA 2L4IA 4WQ3A 5KSZA 1K2HA 2LP2A 3SG6A 1AJ5A 2GGMA 2K2AA 3IQOA 1SK6D 4M2PA 1OSAA 1QJTA 4A4CA 2ZRTA 1MWNA 1B8LA 2ZNDA 4P5OE 1K8UA 3NSLA 5K89A 3D10A 5AFPA 2CBLA 4MBEA 3BUMB 5KTYA 1D1OA 1CTRA 2L50A 1SR6C 3I5IB 2F3ZA 2LM5A 1KFUS 3KF9A 1CKKA 2M1KB 3KHEA 1F55A 1DJIA 3WHTB 1K94A 3JVTC 4N1GA 4L9MA 2BL0B 2RGIA 4OR9B 1TNWA 1L2OC 3FWCA 1DGUA 1CFCA 1B8CA 3LK1A 4WRIA 3EVUA 1SL9A 4I5JA 2VRGA 1ZMZA 2M49B 4YGDB 1RECA 1LXFC 1UURA 1SBJA 1BMOA 5HKWA 2LMUA 4NDBA 1KSMA 2M29A 2E6WA 1BT6A 2WCEA 1Y1XA 2JT8A 5AXIA 1ALVA 2BE6A 4GBAA 3WXAA 1QLSA 1YUTA 1ZACA 2PVBA 4YGEB 3VRRA 1CMGA 2F3YA 4PHNA 1IQ5A 1QV1A 1YTZC 4GPLB 4PDZA 1R2UA 5CSIA 1HT9A 1J7PA 3I5FC 1KQVA 4GGFC 1BODA 1LA3A 4YGCB 3CZTX 1M31A 1BOCA 2AAOA 2Y1MA 3BXKA 3CWGA 4M2QA 3TDIA 2I94A 3ZWHA 4ZCUA 1YX8A 1Y6WA 1SMGA 2K61A 4MLWA 5HYDA 2L2EA 1K9PA 1QATA 3O2PA 1YUSA 3NSKA 2K7BA 1L7ZA 4CLNA 1N0YA 1S6JA 1CB1A 1UHNA 1B8RA 3JVTB 3LL8B 1OOJA 1Y1AA 2KBIA 3SG5A 3D0YB 1L2OB 2M7NA 1CDMA 2F33A 4GFTA 2KAVA 4BY4A 1JSAA 1QIVA 1YVLA 3WHUB 1M63B 1TNQA 2BCBA 2KGRA 4MZKA 3SJSA 2BE4A 4USLA 2GV5A 4C0JA 2R2IA 1G4YR 4ICBA 3O4YA 4UPGA 2LVVA 4OKHA 2MLFC 1PVBA 2LC5A 2PASA 2KFGA 1OQPA 1UUSA 3SIBA 3DVKA 3EK4A 4PE4A 4GNKB 2LHLA 2MLEC 1DJYA 2FOTA 1V1FA 1IWQA 1OMRA 2TN4A 4IL1A 1WRZA 5CSFA 1F8HA 5I2QA 1KQMC 1WRKA 3E3RA 2F2PA 1MXLC 1WY9A 1OZSA 3PSRA 1CDNA 3K21A 3I5FB 3I5IC 1CDLA 1SL7A 2ZKMX 4PE0A 3SIAA 3EK8A 2I7AA 1RJVA 2BCAA 3BYAA 3SG7A 2BL0C 1NX0A 1MQ1A 4NDDA 1FW4A 2LLUA 3FIAA 2KYCA 2KAXA 3NXAA 1A75B 1GQMA 2CT9A 3VGOA 2COLB 2LVKA 1SL8A 2BKHB 2LHIA 1QVIZ 5G08A 1DF0B 1HQVA 1TRFA 1UHHA 5HLOA 5TNCA 1WLZA 2K7OA 4C0LA 2CXJA 5F6TA 1BR1B 3PN7C 1EXRA 3IF7A 1IKUA 3EKHA 1W7IB 1EL4A 1U5IA 4GUKA 2EHBA 4OCIA 3VRPA 1KCYA 1QV0A 2BBNA 2CNPA 2MAZA 2Y1NA 2QPTA 1IJ5A 2KAYA 2CCMA 3PM8A 1LVCD 2LCPA 3CR5X 3OHMB 5CSNA 2SASA 1B9AA 4HREE 1J7RA 3GK2A 4QJ3B 1B4CA 1SW8A 3AKBA 2HQ8A 1SPYA 1XYDA 2JPTA 1KQMB 4M2OA 2LV7A 5ER5A 1H4BA 4MEWA 2KQ6A 1BU3A 3NSOA 2H61A 4GGNA 5AEQA 4BY5A 1YX7A 3BUWB 1YUUA 1OMDA 2PSRA 4HRHA 3C1VA 2H2KA 2QACA 1YRTB 1KK8C 1MHOA 1UHJA 2I2RE 2MJWB 4XJKA 4YGBB 3PATA 1JF2A 1ALWA 3CR4X 1CM1A 1K90D 1F4QA 3LK0A 2PRUA 1M45A 2NXQA 3BUXB 1DMOA 1AVSA 2Q91A 3LCPC 2Q4UA 1NIWA 4MVFA 1FF1A 1IJ6A 1YVHA 1M46A 1WRLA 3PN7B 4CIDA 2B1UA 3RLZA 1DJZA 1RROA 3CGAA 1Y1UA 1XK4A 5DKQA 3O78A 4QJ5B 2G9BA 2NCOA 1MR8A 2FCEA 3SG4A 2JT3A 2JNXA 1FI6A 2JXCA 2Y5IA 1OMVA 1TNPA 1QVIY 3A8RA 3KEVA 1DJHA 2L4HA 1M39A 3OX6A 5CSJA 1PULA 2ZRSA 5HKZA 1NX2A 2P6BB 2ZN8A 3EK7A 1CFDA 1F71A 1XFVO 2O5GA 1K95A 5DKNA 2DOQA 4YRUA 1UHKA 4D1EA 3DVEA 1KFXL 2LUXA 1KK8B 3H4SE 1CFPA 2FJUB 2JTTA 1NCXA 1DJGA 1CMFA 2ZN9A 1TOPA 1S36A 2KHNA 3DF0A 1J1EA 2WCBA 5D69A 5BPJA 1SY9A 1UP5A 2AMIA 2OS8C 1AP4A 4YI9A 1R6PA 1RK9A 1RFJA 2LP3A 2M1UA 2KOTA 1KK7Y 1J55A 1IH0A 2KNEA 2M8UA 2ZNEA 4OVNF 3DVJA 2H61C 1TNXA 1QS7A 2WORA 2M0RA 1QTXA 1TCFA 2KI4B 1SYMA 2KDHA 1F54A 1S6IA 1BLQA 1F70A 1A2XA 4DS7A 4OV2A 1F4OA 1DTLA 4MSPA 1Y0VH 4DRWA 1H8BA 3DD4A 2JT0A 2KSPA 1QX5B 3BOWA 1NP8A 2LE9B 3M0WA 3OB2B 4YBHB 2EC6C 2M3WA 1S5GZ 1CFFA 2LNKA 2MHHA 1U5IB 5HLVA 3VRNA 2WNDA 1NX1A 1C07A 4ORCB 4A4BA 1SCMC 2O60A 2OPOA 3RM1A 2JZIA 1NUBA 1TIZA 1DJXA 2K7DA 2LUCA 3ICBA 1PK0D 4TNCA 1KSOA 4MRXA 4DIRA 5B8IB 1JFJA 4NQGA 1AJ4A 2OTGC 4JQ0D 1ZFSA 2OS8B 2MRDA 1MXEA 2LMVA 2Y4QA 1S26D 4F0ZB 1S3PA 1BF5A 2HF5A 3TUYB 2KFFA 5IBWA 1QX2A 1UWOA 2NCPA 2LLSA 1NPQA 3BUOB 5AANA 4AQIA 1NCYA 4PE7A 1E8AA 3BUNB 5D7FA 3OB1B 3A4UB 1JC2A 1QIWA 2LVJA 2JC2A 4XJKB 2V53A 1QLKA 5ER4X 1DGVA 3CS1A 1CM4A 5JOLA 4DUQA 1DF0A 4ETOA 1SNLA 1XO5A 3SG3A 1B1GA 1KK7Z 2KFHA 4HRGA 1OZOA 2KQYA 4ZCVA 2M97A 2EC6B 1TCOB 1PSBA 3GK4X 5PALA 2K0JA 1SCVA 4C0KA 3OP0A 4CPVA 4I5NB 4I5KA 1SCMB 1XFXO 1B7TY 1OE9B 3JTDC 1CDPA 4PHKA 3KO0A 1KFXS 3MSEB 1QXPA 1IRJA 3OX5A 4E68A 1C7VA 1RWYA 3AAKA 1FI5A 5I2OA 1GJYA 3I5GC 5I2LA 2SCPA 5HKYA 1K9KA 1S5GY 2OTGB 2JNFA 1IQ3A 4R1EA 2LAPA 3SG2A 3TZ1A 1CLBA 2KI4C 4GAOA 2L5XB 4YI8A 2WC8A 1SRAA 3EVRA 4MRYA 1LINA 1KWOB 1AK8A 1YRUB 2WCFA 2L98A 4JWQA 3TS5C 2HPSA 3FWBA 3FS7A 1QASA 3AAJA 3F45A 4AOMA 1UHIA 3HCMA 2PMYA 1JFKA 2ZFDA 5CPVA 4FQOA 1JWDA 1LA0A 1IGVA 1PSRA 2K2FA 4DCKA 2JULA 2MBXA 3CLNA 3GOFA 1A4PA 2D8NA 4PHMA 2BECA 1A03A 1G8IA 4CFQA 1AHRA 3DF0B 1B47A 1EH2A 4MN0A 2AUCA 4JPZB 1RTP1 1ODBA
chains in the Genus database with same CATH superfamily
1ZUZA 1EJ3A 1LKJA 2BKIB 4PCWA 1P28A 1VRKA 1NCZA 1KFUL 3KPXA 2CTNA 2JXLA 2HQWA 1G33A 2LVIA 3QRXA 3PFVA 5FYXA 1PALA 2M7LA 1XVJA 1PRWA 1NSHA 1N2DA 1BR4B 3BQ3A 3JTDB 3TDUA 1WDCC 1DVIA 3I5HC 2EGDA 1MUXA 1OOFA 2F8PA 2MA2A 3R1OA 4N1FA 3LLEA 1AUIB 1NYAA 3S0AA 1C7WA 1SR6B 2M9GA 1SKTA 1X02A 2F2OA 3HX4A 2A4JA 4I5LB 5I8NA 1C3ZA 1CLMA 2BNXA 3I5GB 3R1PA 5I94A 3TUYC 2NLNA 1K93D 1ZOTB 2K60A 4N5XA 2BBMA 4ORBB 2KGBC 1CLLA 3IQQA 1S1EA 1XA5A 3BOWB 3O6BA 1EG4A 1K9UA 5DKRA 2JWWA 1B7TZ 1S6CA 2GGZA 1JBAA 3BJHA 1YR5A 3TS5B 4CFRA 3NSIA 2L0PA 2IS9A 2NZ0A 5KU1A 1XFWO 2HETA 3D0YA 3ZNIA 2K7CA 3N7HA 5JJGA 3EKJA 3VROA 1MF8B 4MZJA 1XFUO 2ISDA 2JQ6A 1YURA 3WNXB 4AQJA 1GGWA 2WOSA 1XK4C 1N65A 1TN4A 3BFAA 3CTNA 3NHTA 1IG5A 5AERA 1A29A 4YGAA 2L51A 2E30A 2PALA 1V1GA 2FCDA 2BCXA 2JOJA 1NX3A 4PE1A 1K96A 4NDCA 5D3OA 1FPWA 1DJWA 2I18A 2JTZA 2LMTA 1NWDA 4P2YB 3BFHA 3NHIA 4QJ4B 4XYNA 3PALA 2KBMA 4PHJA 1J7OA 2JRFA 1WDCB 3I5HB 1EG3A 4GGFA 1KWOC 3DVMA 4ORAB 3TDZA 1DT7B 3PLFB 1XFRA 1BG1A 1JF0A 3FE8A 2G2BA 1FBVA 5GQQC 4WQ2A 4Q04A 4PT1A 1J1DA 2KI6D 2KYFA 3GK1A 4HSZA 3S0BA 1TTXA 2KI6C 1WLMA 2K8MB 5J3XA 1A75A 1Q80A 4U8DA 2WCLA 3VRQA 4FTGA 1BJFA 1GGZA 3AKAA 1SSEB 4PALA 1W7JB 3CR2A 2LANA 1XFYO 4MZLA 2JU0A 3EVVA 2LLTA 1JUOA 3R72A 1QX7A 1PVAA 1CNPA 1XFZO 3CYZA 5FI7A 1J7QA 2L4IA 4WQ3A 5KSZA 1K2HA 2LP2A 3B87A 3SG6A 1AJ5A 2GGMA 2K2AA 3IQOA 1SK6D 4M2PA 1OSAA 1QJTA 4A4CA 2ZRTA 1MWNA 3B6XA 1B8LA 2ZNDA 4P5OE 1K8UA 3NSLA 5K89A 3D10A 5AFPA 2CBLA 4MBEA 3BUMB 5KTYA 1D1OA 1CTRA 2L50A 1SR6C 3OGNA 3I5IB 2L2CA 2F3ZA 2LM5A 1KFUS 3KF9A 3RZSA 1CKKA 2M1KB 3KHEA 1F55A 1DJIA 3WHTB 1K94A 3JVTC 2QEBA 4N1GA 4L9MA 2QEHA 2BL0B 2BAPA 2RGIA 4OR9B 1TNWA 1L2OC 3FWCA 1DGUA 1CFCA 1B8CA 3LK1A 4WRIA 3EVUA 3UO9A 1SL9A 3B88A 2VRGA 4I5JA 1ZMZA 2M49B 4YGDB 1RECA 1LXFC 1UURA 1SBJA 1BMOA 5HKWA 2LMUA 4NDBA 1KSMA 2M29A 3CZ0A 3S0GA 2E6WA 1BT6A 1DC1A 1T14A 2WCEA 1Y1XA 2JT8A 5AXIA 1ALVA 2BE6A 4GBAA 3WXAA 1QLSA 1YUTA 1ZACA 3O4XA 2PVBA 4YGEB 3VRRA 2H8VA 1CMGA 3DXLA 2F3YA 3CDNA 4PHNA 1IQ5A 1QV1A 1YTZC 4GPLB 4PDZA 1R2UA 5CSIA 1HT9A 3S0FA 3I5FC 1J7PA 4GGFC 1BODA 1KQVA 3D78A 1DELA 3Q8IA 1LA3A 4YGCB 3CZTX 1M31A 1BOCA 2AAOA 2Y1MA 3BXKA 3CWGA 4M2QA 3TDIA 2I94A 1TWOA 4ZCUA 1YX8A 3S0EA 3ZWHA 1Y6WA 1SMGA 2K61A 3K1EA 4MLWA 5HYDA 2L2EA 1K9PA 1QATA 3O2PA 1YUSA 3NSKA 2K7BA 1L7ZA 1ORGA 1N0YA 1S6JA 4CLNA 3CZ1A 1CB1A 1UHNA 2KLDA 1B8RA 2FJYA 2GTEA 3CABA 3JVTB 3LL8B 3EG5B 1OOJA 1Y1AA 1TUZA 1Z4HA 2KBIA 3SG5A 3D75A 3D0YB 1L2OB 2M7NA 1CDMA 2F33A 4GFTA 2KAVA 4BY4A 1JSAA 4F7FA 1QIVA 1YVLA 3WHUB 1M63B 1TNQA 2BCBA 2KGRA 4MZKA 3SJSA 2BE4A 4USLA 2GV5A 4C0JA 1DQEA 2R2IA 1G4YR 4ICBA 3O4YA 4UPGA 2LVVA 4OKHA 2MLFC 1PVBA 2LC5A 2PASA 2KFGA 1OQPA 1UUSA 3SIBA 3DVKA 3EK4A 4PE4A 4GNKB 2LHLA 2MLEC 1DJYA 2FOTA 1V1FA 1IWQA 1OMRA 2TN4A 4IL1A 1WRZA 5CSFA 1F8HA 5I2QA 1KQMC 1WRKA 3E3RA 2F2PA 1MXLC 1WY9A 1OZSA 3PSRA 1CDNA 3K21A 3I5FB 3OBVA 3I5IC 1CDLA 1SL7A 3PJIA 2ZKMX 4PE0A 3SIAA 3EK8A 2I7AA 1RJVA 2BCAA 3BYAA 3SG7A 2BL0C 1NX0A 1MQ1A 4NDDA 1FW4A 2LLUA 2KLEA 2KYCA 3FIAA 2KAXA 3NXAA 4JKTA 4OZDA 1A75B 1GQMA 2CT9A 3BFBA 3VGOA 1LS8A 2COLB 2LVKA 1SL8A 2BKHB 2LHIA 1QVIZ 5G08A 1DF0B 1HQVA 1TRFA 1UHHA 5HLOA 5TNCA 1WLZA 2K7OA 4C0LA 2CXJA 5F6TA 1BR1B 4JD9A 3PN7C 1EXRA 3IF7A 1IKUA 3EKHA 1W7IB 1EL4A 1U5IA 4GUKA 2EHBA 4OCIA 3VRPA 1KCYA 1QV0A 2BBNA 2CNPA 2MAZA 2Y1NA 1DEKA 2L5YA 2QPTA 1IJ5A 2KAYA 2CCMA 3PM8A 1LVCD 2LCPA 3CR5X 3OHMB 5CSNA 2SASA 1B9AA 4HREE 1J7RA 3GK2A 4QJ3B 1B4CA 1SW8A 4INWA 3AKBA 2HQ8A 1SPYA 1XYDA 2JPTA 1KQMB 4M2OA 2LV7A 5ER5A 1H4BA 4MEWA 2KQ6A 1BU3A 3NSOA 2H61A 4GGNA 5EL2A 5AEQA 4BY5A 1YX7A 3BUWB 1YUUA 1OMDA 2PSRA 3D74A 3FE9A 4HRHA 3C1VA 3SS5A 2H2KA 2QACA 1YRTB 1KK8C 3L4AA 1MHOA 1UHJA 2I2RE 2MJWB 4XJKA 4YGBB 3PATA 1JF2A 1ALWA 2YGUA 3CR4X 1CM1A 1K90D 1F4QA 3PM2A 3LK0A 3QMEA 2PRUA 1M45A 2NXQA 3BUXB 1DMOA 1AVSA 2Q91A 3LCPC 2Q4UA 1NIWA 4MVFA 3SS4A 1IJ6A 1FF1A 1YVHA 1M46A 1WRLA 3PN7B 4CIDA 2B1UA 2WCKA 3RLZA 1DJZA 2WC5A 1RROA 3CGAA 1Y1UA 1OOHA 1XK4A 5DKQA 3O78A 5DICA 4QJ5B 2G9BA 2NCOA 1MR8A 2FCEA 3SG4A 2JT3A 2JNXA 1FI6A 2JXCA 2Y5IA 1OMVA 1TNPA 1QVIY 3A8RA 3KEVA 1DJHA 2L4HA 1M39A 3OX6A 5CSJA 1PULA 2ZRSA 5HKZA 1IIOA 1QWVA 1NX2A 1OOIX 2P6BB 2ZN8A 1TUJA 3EK7A 1CFDA 1F71A 1XFVO 2O5GA 1K95A 2WC6A 2DOQA 5DKNA 1UHKA 4YRUA 4D1EA 3DVEA 1KFXL 2LUXA 1KK8B 3H4SE 1CFPA 2FJUB 2JTTA 1NCXA 3CZ2A 3R1VA 1DJGA 2PQLA 2ZN9A 1TOPA 1CMFA 1S36A 2KHNA 3DF0A 1J1EA 2WCBA 5D69A 5BPJA 1SY9A 1UP5A 2AMIA 2OS8C 1AP4A 4YI9A 2ERBA 1R6PA 1RK9A 1RFJA 2LP3A 2M1UA 2KOTA 1KK7Y 1J55A 1IH0A 2KNEA 2M8UA 2ZNEA 4OVNF 3DVJA 2H61C 1TNXA 1QS7A 2WORA 1Z2CB 2M0RA 1QTXA 1TCFA 2KI4B 1SYMA 2KDHA 1F54A 1S6IA 4INXA 1BLQA 1F70A 5FI6A 1A2XA 4DS7A 4OV2A 1F4OA 1DTLA 4MSPA 1Y0VH 4DRWA 1H8BA 3DD4A 2JT0A 2KSPA 1QX5B 3BOWA 1NP8A 2LE9B 3M0WA 3OB2B 4YBHB 2EC6C 2M3WA 1GM0A 1S5GZ 3NGVA 2P70A 5HL1A 1CFFA 2LNKA 2MHHA 1U5IB 5HLVA 3UNWA 3VRNA 4IJ7A 2WNDA 1NX1A 1C07A 1OOGA 4ORCB 4A4BA 1SCMC 2P71A 2O60A 2OPOA 3RM1A 2JZIA 1NUBA 1TIZA 1DJXA 2K7DA 2LUCA 3ICBA 3D76A 1PK0D 4TNCA 1KSOA 4MRXA 4DIRA 3V2LA 5B8IB 4NQGA 1JFJA 1AJ4A 2OTGC 4JQ0D 1ZFSA 2OS8B 3FE6A 2MRDA 1MXEA 2LMVA 2Y4QA 1S26D 2QEVA 2KPHA 4F0ZB 1S3PA 1BF5A 2HF5A 3TUYB 2KFFA 5IBWA 1QX2A 1UWOA 2NCPA 2LLSA 1NPQA 3BUOB 5AANA 4AQIA 1NCYA 4PE7A 1E8AA 3BUNB 5D7FA 3OB1B 3A4UB 1JC2A 1QIWA 2LVJA 2JC2A 4XJKB 2V53A 3VB1A 1QLKA 5ER4X 1DGVA 3CS1A 1CM4A 5JOLA 4DUQA 1DF0A 4ETOA 1SNLA 1XO5A 3B7AA 3SG3A 1KK7Z 2KFHA 1B1GA 1W9ZA 1OZOA 2KQYA 2QDIA 4HRGA 4ZCVA 5FI2A 3DZTA 2M97A 2EC6B 3L4LA 4KYNA 1TCOB 3D73A 3B86A 3DY9A 1PSBA 3GK4X 5PALA 2K0JA 1SCVA 4C0KA 3OP0A 4CPVA 2JPOA 4I5NB 4I5KA 1SCMB 1XFXO 1B7TY 1OE9B 3JTDC 1CDPA 4PHKA 3KO0A 1KFXS 3MSEB 1QXPA 1IRJA 3OX5A 4E68A 1C7VA 1RWYA 3AAKA 1FI5A 5I2OA 1GJYA 3I5GC 5I2LA 3L47A 2SCPA 5HKYA 1K9KA 1S5GY 2OTGB 3D77A 2JNFA 3DYEA 4FQTA 1IQ3A 4R1EA 2LAPA 3S0DA 3SG2A 3TZ1A 1CLBA 2KI4C 4GAOA 2L5XB 4YI8A 3SS3A 2WC8A 1SRAA 3EVRA 4MRYA 1C3YA 1LINA 1KWOB 1AK8A 1YRUB 2WCFA 2L98A 4JWQA 2WCMA 3TS5C 2HPSA 3FWBA 2PYQA 3FS7A 1QASA 3AAJA 3F45A 4AOMA 1UHIA 2QEOA 3HCMA 2PMYA 1JFKA 2ZFDA 5CPVA 4FQOA 1JWDA 1LA0A 1IGVA 1PSRA 2K2FA 4DCKA 2JULA 2MBXA 3CLNA 3GOFA 1A4PA 2D8NA 4PHMA 3IVTA 2WCJA 1OW4A 2BECA 1A03A 1G8IA 2WCHA 4CFQA 1AHRA 3DF0B 1B47A 1EH2A 4MN0A 2AUCA 4JPZB 1RTP1 1ODBA
chains in the Genus database with same CATH topology
1ZUZA 1EJ3A 1LKJA 2BKIB 4PCWA 1VRKA 1NCZA 1KFUL 3KPXA 2CTNA 2JXLA 2HQWA 1G33A 2LVIA 3QRXA 3PFVA 5FYXA 1PALA 2M7LA 1XVJA 1PRWA 1NSHA 1N2DA 1BR4B 3BQ3A 3JTDB 3TDUA 1WDCC 1DVIA 3I5HC 2EGDA 1MUXA 2F8PA 2MA2A 4N1FA 4PHJA 3LLEA 1AUIB 1NYAA 1C7WA 1SR6B 2M9GA 1SKTA 1X02A 2F2OA 3HX4A 2A4JA 4I5LB 5I8NA 3TUYC 1CLMA 3I5GB 2NLNA 1K93D 1ZOTB 4N5XA 2BBMA 4ORBB 2KGBC 1CLLA 3IQQA 1S1EA 1XA5A 3BOWB 3O6BA 1EG4A 1K9UA 5DKRA 2JWWA 1B7TZ 1S6CA 2GGZA 1JBAA 1YR5A 3TS5B 4CFRA 3NSIA 2L0PA 2IS9A 2NZ0A 5KU1A 1XFWO 2HETA 3D0YA 3ZNIA 2K7CA 5JJGA 3EKJA 3VROA 1MF8B 4MZJA 1XFUO 2ISDA 2JQ6A 1YURA 3WNXB 4AQJA 1GGWA 2WOSA 1XK4C 1N65A 1TN4A 3CTNA 1IG5A 5AERA 1A29A 4YGAA 2L51A 2E30A 2PALA 1V1GA 2FCDA 2BCXA 2JOJA 1NX3A 4PE1A 1K96A 4NDCA 1FPWA 1DJWA 2I18A 2JTZA 2LMTA 1NWDA 4P2YB 4QJ4B 4XYNA 3PALA 2KBMA 1J7OA 2JRFA 1WDCB 3I5HB 1EG3A 4GGFA 1KWOC 3DVMA 4ORAB 3TDZA 1DT7B 3PLFB 1BG1A 1JF0A 2G2BA 1FBVA 5GQQC 4WQ2A 4Q04A 1J1DA 2KI6D 2KYFA 3GK1A 4HSZA 1TTXA 2KI6C 1WLMA 2K8MB 5J3XA 1A75A 1Q80A 4U8DA 3VRQA 4FTGA 1BJFA 1GGZA 3AKAA 4PALA 1W7JB 3CR2A 2LANA 1XFYO 4MZLA 2JU0A 3EVVA 2LLTA 1JUOA 1QX7A 1PVAA 1CNPA 1XFZO 1J7QA 2L4IA 4WQ3A 5KSZA 1K2HA 2LP2A 3SG6A 1AJ5A 2GGMA 2K2AA 3IQOA 1SK6D 4M2PA 1OSAA 1QJTA 4A4CA 2ZRTA 1MWNA 1B8LA 2ZNDA 4P5OE 1K8UA 3NSLA 5K89A 3D10A 5AFPA 2CBLA 4MBEA 3BUMB 5KTYA 1D1OA 1CTRA 2L50A 1SR6C 3I5IB 2F3ZA 2LM5A 1KFUS 3KF9A 1CKKA 2M1KB 3KHEA 1F55A 1DJIA 3WHTB 1K94A 3JVTC 4N1GA 4L9MA 2BL0B 2RGIA 4OR9B 1TNWA 1L2OC 3FWCA 1DGUA 1CFCA 1B8CA 3LK1A 4WRIA 3EVUA 1SL9A 4I5JA 2VRGA 1ZMZA 2M49B 4YGDB 1RECA 1LXFC 1UURA 1SBJA 1BMOA 5HKWA 2LMUA 4NDBA 1KSMA 2M29A 2E6WA 1BT6A 2WCEA 1Y1XA 2JT8A 5AXIA 1ALVA 2BE6A 4GBAA 3WXAA 1QLSA 1YUTA 1ZACA 2PVBA 4YGEB 3VRRA 1CMGA 2F3YA 4PHNA 1IQ5A 1QV1A 1YTZC 4GPLB 4PDZA 1R2UA 5CSIA 1HT9A 1J7PA 3I5FC 1KQVA 4GGFC 1BODA 1LA3A 4YGCB 3CZTX 1M31A 1BOCA 2AAOA 2Y1MA 3BXKA 3CWGA 4M2QA 3TDIA 2I94A 3ZWHA 4ZCUA 1YX8A 1Y6WA 1SMGA 2K61A 4MLWA 5HYDA 2L2EA 1K9PA 1QATA 3O2PA 1YUSA 3NSKA 2K7BA 1L7ZA 4CLNA 1N0YA 1S6JA 1CB1A 1UHNA 1B8RA 3JVTB 3LL8B 1OOJA 1Y1AA 2KBIA 3SG5A 3D0YB 1L2OB 2M7NA 1CDMA 2F33A 4GFTA 2KAVA 4BY4A 1JSAA 1QIVA 1YVLA 3WHUB 1M63B 1TNQA 2BCBA 2KGRA 4MZKA 3SJSA 2BE4A 4USLA 2GV5A 4C0JA 2R2IA 1G4YR 4ICBA 3O4YA 4UPGA 2LVVA 4OKHA 2MLFC 1PVBA 2LC5A 2PASA 2KFGA 1OQPA 1UUSA 3SIBA 3DVKA 3EK4A 4PE4A 4GNKB 2LHLA 2MLEC 1DJYA 2FOTA 1V1FA 1IWQA 1OMRA 2TN4A 4IL1A 1WRZA 5CSFA 1F8HA 5I2QA 1KQMC 1WRKA 3E3RA 2F2PA 1MXLC 1WY9A 1OZSA 3PSRA 1CDNA 3K21A 3I5FB 3I5IC 1CDLA 1SL7A 2ZKMX 4PE0A 3SIAA 3EK8A 2I7AA 1RJVA 2BCAA 3BYAA 3SG7A 2BL0C 1NX0A 1MQ1A 4NDDA 1FW4A 2LLUA 3FIAA 2KYCA 2KAXA 3NXAA 1A75B 1GQMA 2CT9A 3VGOA 2COLB 2LVKA 1SL8A 2BKHB 2LHIA 1QVIZ 5G08A 1DF0B 1HQVA 1TRFA 1UHHA 5HLOA 5TNCA 1WLZA 2K7OA 4C0LA 2CXJA 5F6TA 1BR1B 3PN7C 1EXRA 3IF7A 1IKUA 3EKHA 1W7IB 1EL4A 1U5IA 4GUKA 2EHBA 4OCIA 3VRPA 1KCYA 1QV0A 2BBNA 2CNPA 2MAZA 2Y1NA 2QPTA 1IJ5A 2KAYA 2CCMA 3PM8A 1LVCD 2LCPA 3CR5X 3OHMB 5CSNA 2SASA 1B9AA 4HREE 1J7RA 3GK2A 4QJ3B 1B4CA 1SW8A 3AKBA 2HQ8A 1SPYA 1XYDA 2JPTA 1KQMB 4M2OA 2LV7A 5ER5A 1H4BA 4MEWA 2KQ6A 1BU3A 3NSOA 2H61A 4GGNA 5AEQA 4BY5A 1YX7A 3BUWB 1YUUA 1OMDA 2PSRA 4HRHA 3C1VA 2H2KA 2QACA 1YRTB 1KK8C 1MHOA 1UHJA 2I2RE 2MJWB 4XJKA 4YGBB 3PATA 1JF2A 1ALWA 3CR4X 1CM1A 1K90D 1F4QA 3LK0A 2PRUA 1M45A 2NXQA 3BUXB 1DMOA 1AVSA 2Q91A 3LCPC 2Q4UA 1NIWA 4MVFA 1FF1A 1IJ6A 1YVHA 1M46A 1WRLA 3PN7B 4CIDA 2B1UA 3RLZA 1DJZA 1RROA 3CGAA 1Y1UA 1XK4A 5DKQA 3O78A 4QJ5B 2G9BA 2NCOA 1MR8A 2FCEA 3SG4A 2JT3A 2JNXA 1FI6A 2JXCA 2Y5IA 1OMVA 1TNPA 1QVIY 3A8RA 3KEVA 1DJHA 2L4HA 1M39A 3OX6A 5CSJA 1PULA 2ZRSA 5HKZA 1NX2A 2P6BB 2ZN8A 3EK7A 1CFDA 1F71A 1XFVO 2O5GA 1K95A 5DKNA 2DOQA 4YRUA 1UHKA 4D1EA 3DVEA 1KFXL 2LUXA 1KK8B 3H4SE 1CFPA 2FJUB 2JTTA 1NCXA 1DJGA 1CMFA 2ZN9A 1TOPA 1S36A 2KHNA 3DF0A 1J1EA 2WCBA 5D69A 5BPJA 1SY9A 1UP5A 2AMIA 2OS8C 1AP4A 4YI9A 1R6PA 1RK9A 1RFJA 2LP3A 2M1UA 2KOTA 1KK7Y 1J55A 1IH0A 2KNEA 2M8UA 2ZNEA 4OVNF 3DVJA 2H61C 1TNXA 1QS7A 2WORA 2M0RA 1QTXA 1TCFA 2KI4B 1SYMA 2KDHA 1F54A 1S6IA 1BLQA 1F70A 1A2XA 4DS7A 4OV2A 1F4OA 1DTLA 4MSPA 1Y0VH 4DRWA 1H8BA 3DD4A 2JT0A 2KSPA 1QX5B 3BOWA 1NP8A 2LE9B 3M0WA 3OB2B 4YBHB 2EC6C 2M3WA 1S5GZ 1CFFA 2LNKA 2MHHA 1U5IB 5HLVA 3VRNA 2WNDA 1NX1A 1C07A 4ORCB 4A4BA 1SCMC 2O60A 2OPOA 3RM1A 2JZIA 1NUBA 1TIZA 1DJXA 2K7DA 2LUCA 3ICBA 1PK0D 4TNCA 1KSOA 4MRXA 4DIRA 5B8IB 1JFJA 4NQGA 1AJ4A 2OTGC 4JQ0D 1ZFSA 2OS8B 2MRDA 1MXEA 2LMVA 2Y4QA 1S26D 4F0ZB 1S3PA 1BF5A 2HF5A 3TUYB 2KFFA 5IBWA 1QX2A 1UWOA 2NCPA 2LLSA 1NPQA 3BUOB 5AANA 4AQIA 1NCYA 4PE7A 1E8AA 3BUNB 5D7FA 3OB1B 3A4UB 1JC2A 1QIWA 2LVJA 2JC2A 4XJKB 2V53A 1QLKA 5ER4X 1DGVA 3CS1A 1CM4A 5JOLA 4DUQA 1DF0A 4ETOA 1SNLA 1XO5A 3SG3A 1B1GA 1KK7Z 2KFHA 4HRGA 1OZOA 2KQYA 4ZCVA 2M97A 2EC6B 1TCOB 1PSBA 3GK4X 5PALA 2K0JA 1SCVA 4C0KA 3OP0A 4CPVA 4I5NB 4I5KA 1SCMB 1XFXO 1B7TY 1OE9B 3JTDC 1CDPA 4PHKA 3KO0A 1KFXS 3MSEB 1QXPA 1IRJA 3OX5A 4E68A 1C7VA 1RWYA 3AAKA 1FI5A 5I2OA 1GJYA 3I5GC 5I2LA 2SCPA 5HKYA 1K9KA 1S5GY 2OTGB 2JNFA 1IQ3A 4R1EA 2LAPA 3SG2A 3TZ1A 1CLBA 2KI4C 4GAOA 2L5XB 4YI8A 2WC8A 1SRAA 3EVRA 4MRYA 1LINA 1KWOB 1AK8A 1YRUB 2WCFA 2L98A 4JWQA 3TS5C 2HPSA 3FWBA 3FS7A 1QASA 3AAJA 3F45A 4AOMA 1UHIA 3HCMA 2PMYA 1JFKA 2ZFDA 5CPVA 4FQOA 1JWDA 1LA0A 1IGVA 1PSRA 2K2FA 4DCKA 2JULA 2MBXA 3CLNA 3GOFA 1A4PA 2D8NA 4PHMA 2BECA 1A03A 1G8IA 4CFQA 1AHRA 3DF0B 1B47A 1EH2A 4MN0A 2AUCA 4JPZB 1RTP1 1ODBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUZ A;  1EJ3 A;  1LKJ A;  2BKI B;  4PCW A;  1VRK A;  1NCZ A;  1KFU L;  3KPX A;  2CTN A;  2JXL A;  2HQW A;  1G33 A;  2LVI A;  3QRX A;  3PFV A;  5FYX A;  1PAL A;  2M7L A;  1XVJ A;  1PRW A;  1NSH A;  1N2D A;  1BR4 B;  3BQ3 A;  3JTD B;  3TDU A;  1WDC C;  1DVI A;  3I5H C;  2EGD A;  1MUX A;  2F8P A;  2MA2 A;  4N1F A;  4PHJ A;  3LLE A;  1AUI B;  1NYA A;  1C7W A;  1SR6 B;  2M9G A;  1SKT A;  1X02 A;  2F2O A;  3HX4 A;  2A4J A;  4I5L B;  5I8N A;  3TUY C;  1CLM A;  3I5G B;  2NLN A;  1K93 D;  1ZOT B;  4N5X A;  2BBM A;  4ORB B;  2KGB C;  1CLL A;  3IQQ A;  1S1E A;  1XA5 A;  3BOW B;  3O6B A;  1EG4 A;  1K9U A;  5DKR A;  2JWW A;  1B7T Z;  1S6C A;  2GGZ A;  1JBA A;  1YR5 A;  3TS5 B;  4CFR A;  3NSI A;  2L0P A;  2IS9 A;  2NZ0 A;  5KU1 A;  1XFW O;  2HET A;  3D0Y A;  3ZNI A;  2K7C A;  5JJG A;  3EKJ A;  3VRO A;  1MF8 B;  4MZJ A;  1XFU O;  2ISD A;  2JQ6 A;  1YUR A;  3WNX B;  4AQJ A;  1GGW A;  2WOS A;  1XK4 C;  1N65 A;  1TN4 A;  3CTN A;  1IG5 A;  5AER A;  1A29 A;  4YGA A;  2L51 A;  2E30 A;  2PAL A;  1V1G A;  2FCD A;  2BCX A;  2JOJ A;  1NX3 A;  4PE1 A;  1K96 A;  4NDC A;  1FPW A;  1DJW A;  2I18 A;  2JTZ A;  2LMT A;  1NWD A;  4P2Y B;  4QJ4 B;  4XYN A;  3PAL A;  2KBM A;  1J7O A;  2JRF A;  1WDC B;  3I5H B;  1EG3 A;  4GGF A;  1KWO C;  3DVM A;  4ORA B;  3TDZ A;  1DT7 B;  3PLF B;  1BG1 A;  1JF0 A;  2G2B A;  1FBV A;  5GQQ C;  4WQ2 A;  4Q04 A;  1J1D A;  2KI6 D;  2KYF A;  3GK1 A;  4HSZ A;  1TTX A;  2KI6 C;  1WLM A;  2K8M B;  5J3X A;  1A75 A;  1Q80 A;  4U8D A;  3VRQ A;  4FTG A;  1BJF A;  1GGZ A;  3AKA A;  4PAL A;  1W7J B;  3CR2 A;  2LAN A;  1XFY O;  4MZL A;  2JU0 A;  3EVV A;  2LLT A;  1JUO A;  1QX7 A;  1PVA A;  1CNP A;  1XFZ O;  1J7Q A;  2L4I A;  4WQ3 A;  5KSZ A;  1K2H A;  2LP2 A;  3SG6 A;  1AJ5 A;  2GGM A;  2K2A A;  3IQO A;  1SK6 D;  4M2P A;  1OSA A;  1QJT A;  4A4C A;  2ZRT A;  1MWN A;  1B8L A;  2ZND A;  4P5O E;  1K8U A;  3NSL A;  5K89 A;  3D10 A;  5AFP A;  2CBL A;  4MBE A;  3BUM B;  5KTY A;  1D1O A;  1CTR A;  2L50 A;  1SR6 C;  3I5I B;  2F3Z A;  2LM5 A;  1KFU S;  3KF9 A;  1CKK A;  2M1K B;  3KHE A;  1F55 A;  1DJI A;  3WHT B;  1K94 A;  3JVT C;  4N1G A;  4L9M A;  2BL0 B;  2RGI A;  4OR9 B;  1TNW A;  1L2O C;  3FWC A;  1DGU A;  1CFC A;  1B8C A;  3LK1 A;  4WRI A;  3EVU A;  1SL9 A;  4I5J A;  2VRG A;  1ZMZ A;  2M49 B;  4YGD B;  1REC A;  1LXF C;  1UUR A;  1SBJ A;  1BMO A;  5HKW A;  2LMU A;  4NDB A;  1KSM A;  2M29 A;  2E6W A;  1BT6 A;  2WCE A;  1Y1X A;  2JT8 A;  5AXI A;  1ALV A;  2BE6 A;  4GBA A;  3WXA A;  1QLS A;  1YUT A;  1ZAC A;  2PVB A;  4YGE B;  3VRR A;  1CMG A;  2F3Y A;  4PHN A;  1IQ5 A;  1QV1 A;  1YTZ C;  4GPL B;  4PDZ A;  1R2U A;  5CSI A;  1HT9 A;  1J7P A;  3I5F C;  1KQV A;  4GGF C;  1BOD A;  1LA3 A;  4YGC B;  3CZT X;  1M31 A;  1BOC A;  2AAO A;  2Y1M A;  3BXK A;  3CWG A;  4M2Q A;  3TDI A;  2I94 A;  3ZWH A;  4ZCU A;  1YX8 A;  1Y6W A;  1SMG A;  2K61 A;  4MLW A;  5HYD A;  2L2E A;  1K9P A;  1QAT A;  3O2P A;  1YUS A;  3NSK A;  2K7B A;  1L7Z A;  4CLN A;  1N0Y A;  1S6J A;  1CB1 A;  1UHN A;  1B8R A;  3JVT B;  3LL8 B;  1OOJ A;  1Y1A A;  2KBI A;  3SG5 A;  3D0Y B;  1L2O B;  2M7N A;  1CDM A;  2F33 A;  4GFT A;  2KAV A;  4BY4 A;  1JSA A;  1QIV A;  1YVL A;  3WHU B;  1M63 B;  1TNQ A;  2BCB A;  2KGR A;  4MZK A;  3SJS A;  2BE4 A;  4USL A;  2GV5 A;  4C0J A;  2R2I A;  1G4Y R;  4ICB A;  3O4Y A;  4UPG A;  2LVV A;  4OKH A;  2MLF C;  1PVB A;  2LC5 A;  2PAS A;  2KFG A;  1OQP A;  1UUS A;  3SIB A;  3DVK A;  3EK4 A;  4PE4 A;  4GNK B;  2LHL A;  2MLE C;  1DJY A;  2FOT A;  1V1F A;  1IWQ A;  1OMR A;  2TN4 A;  4IL1 A;  1WRZ A;  5CSF A;  1F8H A;  5I2Q A;  1KQM C;  1WRK A;  3E3R A;  2F2P A;  1MXL C;  1WY9 A;  1OZS A;  3PSR A;  1CDN A;  3K21 A;  3I5F B;  3I5I C;  1CDL A;  1SL7 A;  2ZKM X;  4PE0 A;  3SIA A;  3EK8 A;  2I7A A;  1RJV A;  2BCA A;  3BYA A;  3SG7 A;  2BL0 C;  1NX0 A;  1MQ1 A;  4NDD A;  1FW4 A;  2LLU A;  3FIA A;  2KYC A;  2KAX A;  3NXA A;  1A75 B;  1GQM A;  2CT9 A;  3VGO A;  2COL B;  2LVK A;  1SL8 A;  2BKH B;  2LHI A;  1QVI Z;  5G08 A;  1DF0 B;  1HQV A;  1TRF A;  1UHH A;  5HLO A;  5TNC A;  1WLZ A;  2K7O A;  4C0L A;  2CXJ A;  5F6T A;  1BR1 B;  3PN7 C;  1EXR A;  3IF7 A;  1IKU A;  3EKH A;  1W7I B;  1EL4 A;  1U5I A;  4GUK A;  2EHB A;  4OCI A;  3VRP A;  1KCY A;  1QV0 A;  2BBN A;  2CNP A;  2MAZ A;  2Y1N A;  2QPT A;  1IJ5 A;  2KAY A;  2CCM A;  3PM8 A;  1LVC D;  2LCP A;  3CR5 X;  3OHM B;  5CSN A;  2SAS A;  1B9A A;  4HRE E;  1J7R A;  3GK2 A;  4QJ3 B;  1B4C A;  1SW8 A;  3AKB A;  2HQ8 A;  1SPY A;  1XYD A;  2JPT A;  1KQM B;  4M2O A;  2LV7 A;  5ER5 A;  1H4B A;  4MEW A;  2KQ6 A;  1BU3 A;  3NSO A;  2H61 A;  4GGN A;  5AEQ A;  4BY5 A;  1YX7 A;  3BUW B;  1YUU A;  1OMD A;  2PSR A;  4HRH A;  3C1V A;  2H2K A;  2QAC A;  1YRT B;  1KK8 C;  1MHO A;  1UHJ A;  2I2R E;  2MJW B;  4XJK A;  4YGB B;  3PAT A;  1JF2 A;  1ALW A;  3CR4 X;  1CM1 A;  1K90 D;  1F4Q A;  3LK0 A;  2PRU A;  1M45 A;  2NXQ A;  3BUX B;  1DMO A;  1AVS A;  2Q91 A;  3LCP C;  2Q4U A;  1NIW A;  4MVF A;  1FF1 A;  1IJ6 A;  1YVH A;  1M46 A;  1WRL A;  3PN7 B;  4CID A;  2B1U A;  3RLZ A;  1DJZ A;  1RRO A;  3CGA A;  1Y1U A;  1XK4 A;  5DKQ A;  3O78 A;  4QJ5 B;  2G9B A;  2NCO A;  1MR8 A;  2FCE A;  3SG4 A;  2JT3 A;  2JNX A;  1FI6 A;  2JXC A;  2Y5I A;  1OMV A;  1TNP A;  1QVI Y;  3A8R A;  3KEV A;  1DJH A;  2L4H A;  1M39 A;  3OX6 A;  5CSJ A;  1PUL A;  2ZRS A;  5HKZ A;  1NX2 A;  2P6B B;  2ZN8 A;  3EK7 A;  1CFD A;  1F71 A;  1XFV O;  2O5G A;  1K95 A;  5DKN A;  2DOQ A;  4YRU A;  1UHK A;  4D1E A;  3DVE A;  1KFX L;  2LUX A;  1KK8 B;  3H4S E;  1CFP A;  2FJU B;  2JTT A;  1NCX A;  1DJG A;  1CMF A;  2ZN9 A;  1TOP A;  1S36 A;  2KHN A;  3DF0 A;  1J1E A;  2WCB A;  5D69 A;  5BPJ A;  1SY9 A;  1UP5 A;  2AMI A;  2OS8 C;  1AP4 A;  4YI9 A;  1R6P A;  1RK9 A;  1RFJ A;  2LP3 A;  2M1U A;  2KOT A;  1KK7 Y;  1J55 A;  1IH0 A;  2KNE A;  2M8U A;  2ZNE A;  4OVN F;  3DVJ A;  2H61 C;  1TNX A;  1QS7 A;  2WOR A;  2M0R A;  1QTX A;  1TCF A;  2KI4 B;  1SYM A;  2KDH A;  1F54 A;  1S6I A;  1BLQ A;  1F70 A;  1A2X A;  4DS7 A;  4OV2 A;  1F4O A;  1DTL A;  4MSP A;  1Y0V H;  4DRW A;  1H8B A;  3DD4 A;  2JT0 A;  2KSP A;  1QX5 B;  3BOW A;  1NP8 A;  2LE9 B;  3M0W A;  3OB2 B;  4YBH B;  2EC6 C;  2M3W A;  1S5G Z;  1CFF A;  2LNK A;  2MHH A;  1U5I B;  5HLV A;  3VRN A;  2WND A;  1NX1 A;  1C07 A;  4ORC B;  4A4B A;  1SCM C;  2O60 A;  2OPO A;  3RM1 A;  2JZI A;  1NUB A;  1TIZ A;  1DJX A;  2K7D A;  2LUC A;  3ICB A;  1PK0 D;  4TNC A;  1KSO A;  4MRX A;  4DIR A;  5B8I B;  1JFJ A;  4NQG A;  1AJ4 A;  2OTG C;  4JQ0 D;  1ZFS A;  2OS8 B;  2MRD A;  1MXE A;  2LMV A;  2Y4Q A;  1S26 D;  4F0Z B;  1S3P A;  1BF5 A;  2HF5 A;  3TUY B;  2KFF A;  5IBW A;  1QX2 A;  1UWO A;  2NCP A;  2LLS A;  1NPQ A;  3BUO B;  5AAN A;  4AQI A;  1NCY A;  4PE7 A;  1E8A A;  3BUN B;  5D7F A;  3OB1 B;  3A4U B;  1JC2 A;  1QIW A;  2LVJ A;  2JC2 A;  4XJK B;  2V53 A;  1QLK A;  5ER4 X;  1DGV A;  3CS1 A;  1CM4 A;  5JOL A;  4DUQ A;  1DF0 A;  4ETO A;  1SNL A;  1XO5 A;  3SG3 A;  1B1G A;  1KK7 Z;  2KFH A;  4HRG A;  1OZO A;  2KQY A;  4ZCV A;  2M97 A;  2EC6 B;  1TCO B;  1PSB A;  3GK4 X;  5PAL A;  2K0J A;  1SCV A;  4C0K A;  3OP0 A;  4CPV A;  4I5N B;  4I5K A;  1SCM B;  1XFX O;  1B7T Y;  1OE9 B;  3JTD C;  1CDP A;  4PHK A;  3KO0 A;  1KFX S;  3MSE B;  1QXP A;  1IRJ A;  3OX5 A;  4E68 A;  1C7V A;  1RWY A;  3AAK A;  1FI5 A;  5I2O A;  1GJY A;  3I5G C;  5I2L A;  2SCP A;  5HKY A;  1K9K A;  1S5G Y;  2OTG B;  2JNF A;  1IQ3 A;  4R1E A;  2LAP A;  3SG2 A;  3TZ1 A;  1CLB A;  2KI4 C;  4GAO A;  2L5X B;  4YI8 A;  2WC8 A;  1SRA A;  3EVR A;  4MRY A;  1LIN A;  1KWO B;  1AK8 A;  1YRU B;  2WCF A;  2L98 A;  4JWQ A;  3TS5 C;  2HPS A;  3FWB A;  3FS7 A;  1QAS A;  3AAJ A;  3F45 A;  4AOM A;  1UHI A;  3HCM A;  2PMY A;  1JFK A;  2ZFD A;  5CPV A;  4FQO A;  1JWD A;  1LA0 A;  1IGV A;  1PSR A;  2K2F A;  4DCK A;  2JUL A;  2MBX A;  3CLN A;  3GOF A;  1A4P A;  2D8N A;  4PHM A;  2BEC A;  1A03 A;  1G8I A;  4CFQ A;  1AHR A;  3DF0 B;  1B47 A;  1EH2 A;  4MN0 A;  2AUC A;  4JPZ B;  1RTP 1;  1ODB A; 
#chains in the Genus database with same CATH topology
 1ZUZ A;  1EJ3 A;  1LKJ A;  2BKI B;  4PCW A;  1P28 A;  1VRK A;  1NCZ A;  1KFU L;  3KPX A;  2CTN A;  2JXL A;  2HQW A;  1G33 A;  2LVI A;  3QRX A;  3PFV A;  5FYX A;  1PAL A;  2M7L A;  1XVJ A;  1PRW A;  1NSH A;  1N2D A;  1BR4 B;  3BQ3 A;  3JTD B;  3TDU A;  1WDC C;  1DVI A;  3I5H C;  2EGD A;  1MUX A;  1OOF A;  2F8P A;  2MA2 A;  3R1O A;  4N1F A;  3LLE A;  1AUI B;  1NYA A;  3S0A A;  1C7W A;  1SR6 B;  2M9G A;  1SKT A;  1X02 A;  2F2O A;  3HX4 A;  2A4J A;  4I5L B;  5I8N A;  1C3Z A;  1CLM A;  2BNX A;  3I5G B;  3R1P A;  5I94 A;  3TUY C;  2NLN A;  1K93 D;  1ZOT B;  2K60 A;  4N5X A;  2BBM A;  4ORB B;  2KGB C;  1CLL A;  3IQQ A;  1S1E A;  1XA5 A;  3BOW B;  3O6B A;  1EG4 A;  1K9U A;  5DKR A;  2JWW A;  1B7T Z;  1S6C A;  2GGZ A;  1JBA A;  3BJH A;  1YR5 A;  3TS5 B;  4CFR A;  3NSI A;  2L0P A;  2IS9 A;  2NZ0 A;  5KU1 A;  1XFW O;  2HET A;  3D0Y A;  3ZNI A;  2K7C A;  3N7H A;  5JJG A;  3EKJ A;  3VRO A;  1MF8 B;  4MZJ A;  1XFU O;  2ISD A;  2JQ6 A;  1YUR A;  3WNX B;  4AQJ A;  1GGW A;  2WOS A;  1XK4 C;  1N65 A;  1TN4 A;  3BFA A;  3CTN A;  3NHT A;  1IG5 A;  5AER A;  1A29 A;  4YGA A;  2L51 A;  2E30 A;  2PAL A;  1V1G A;  2FCD A;  2BCX A;  2JOJ A;  1NX3 A;  4PE1 A;  1K96 A;  4NDC A;  5D3O A;  1FPW A;  1DJW A;  2I18 A;  2JTZ A;  2LMT A;  1NWD A;  4P2Y B;  3BFH A;  3NHI A;  4QJ4 B;  4XYN A;  3PAL A;  2KBM A;  4PHJ A;  1J7O A;  2JRF A;  1WDC B;  3I5H B;  1EG3 A;  4GGF A;  1KWO C;  3DVM A;  4ORA B;  3TDZ A;  1DT7 B;  3PLF B;  1XFR A;  1BG1 A;  1JF0 A;  3FE8 A;  2G2B A;  1FBV A;  5GQQ C;  4WQ2 A;  4Q04 A;  4PT1 A;  1J1D A;  2KI6 D;  2KYF A;  3GK1 A;  4HSZ A;  3S0B A;  1TTX A;  2KI6 C;  1WLM A;  2K8M B;  5J3X A;  1A75 A;  1Q80 A;  4U8D A;  2WCL A;  3VRQ A;  4FTG A;  1BJF A;  1GGZ A;  3AKA A;  1SSE B;  4PAL A;  1W7J B;  3CR2 A;  2LAN A;  1XFY O;  4MZL A;  2JU0 A;  3EVV A;  2LLT A;  1JUO A;  3R72 A;  1QX7 A;  1PVA A;  1CNP A;  1XFZ O;  3CYZ A;  5FI7 A;  1J7Q A;  2L4I A;  4WQ3 A;  5KSZ A;  1K2H A;  2LP2 A;  3B87 A;  3SG6 A;  1AJ5 A;  2GGM A;  2K2A A;  3IQO A;  1SK6 D;  4M2P A;  1OSA A;  1QJT A;  4A4C A;  2ZRT A;  1MWN A;  3B6X A;  1B8L A;  2ZND A;  4P5O E;  1K8U A;  3NSL A;  5K89 A;  3D10 A;  5AFP A;  2CBL A;  4MBE A;  3BUM B;  5KTY A;  1D1O A;  1CTR A;  2L50 A;  1SR6 C;  3OGN A;  3I5I B;  2L2C A;  2F3Z A;  2LM5 A;  1KFU S;  3KF9 A;  3RZS A;  1CKK A;  2M1K B;  3KHE A;  1F55 A;  1DJI A;  3WHT B;  1K94 A;  3JVT C;  2QEB A;  4N1G A;  4L9M A;  2QEH A;  2BL0 B;  2BAP A;  2RGI A;  4OR9 B;  1TNW A;  1L2O C;  3FWC A;  1DGU A;  1CFC A;  1B8C A;  3LK1 A;  4WRI A;  3EVU A;  3UO9 A;  1SL9 A;  3B88 A;  2VRG A;  4I5J A;  1ZMZ A;  2M49 B;  4YGD B;  1REC A;  1LXF C;  1UUR A;  1SBJ A;  1BMO A;  5HKW A;  2LMU A;  4NDB A;  1KSM A;  2M29 A;  3CZ0 A;  3S0G A;  2E6W A;  1BT6 A;  1DC1 A;  1T14 A;  2WCE A;  1Y1X A;  2JT8 A;  5AXI A;  1ALV A;  2BE6 A;  4GBA A;  3WXA A;  1QLS A;  1YUT A;  1ZAC A;  3O4X A;  2PVB A;  4YGE B;  3VRR A;  2H8V A;  1CMG A;  3DXL A;  2F3Y A;  3CDN A;  4PHN A;  1IQ5 A;  1QV1 A;  1YTZ C;  4GPL B;  4PDZ A;  1R2U A;  5CSI A;  1HT9 A;  3S0F A;  3I5F C;  1J7P A;  4GGF C;  1BOD A;  1KQV A;  3D78 A;  1DEL A;  3Q8I A;  1LA3 A;  4YGC B;  3CZT X;  1M31 A;  1BOC A;  2AAO A;  2Y1M A;  3BXK A;  3CWG A;  4M2Q A;  3TDI A;  2I94 A;  1TWO A;  4ZCU A;  1YX8 A;  3S0E A;  3ZWH A;  1Y6W A;  1SMG A;  2K61 A;  3K1E A;  4MLW A;  5HYD A;  2L2E A;  1K9P A;  1QAT A;  3O2P A;  1YUS A;  3NSK A;  2K7B A;  1L7Z A;  1ORG A;  1N0Y A;  1S6J A;  4CLN A;  3CZ1 A;  1CB1 A;  1UHN A;  2KLD A;  1B8R A;  2FJY A;  2GTE A;  3CAB A;  3JVT B;  3LL8 B;  3EG5 B;  1OOJ A;  1Y1A A;  1TUZ A;  1Z4H A;  2KBI A;  3SG5 A;  3D75 A;  3D0Y B;  1L2O B;  2M7N A;  1CDM A;  2F33 A;  4GFT A;  2KAV A;  4BY4 A;  1JSA A;  4F7F A;  1QIV A;  1YVL A;  3WHU B;  1M63 B;  1TNQ A;  2BCB A;  2KGR A;  4MZK A;  3SJS A;  2BE4 A;  4USL A;  2GV5 A;  4C0J A;  1DQE A;  2R2I A;  1G4Y R;  4ICB A;  3O4Y A;  4UPG A;  2LVV A;  4OKH A;  2MLF C;  1PVB A;  2LC5 A;  2PAS A;  2KFG A;  1OQP A;  1UUS A;  3SIB A;  3DVK A;  3EK4 A;  4PE4 A;  4GNK B;  2LHL A;  2MLE C;  1DJY A;  2FOT A;  1V1F A;  1IWQ A;  1OMR A;  2TN4 A;  4IL1 A;  1WRZ A;  5CSF A;  1F8H A;  5I2Q A;  1KQM C;  1WRK A;  3E3R A;  2F2P A;  1MXL C;  1WY9 A;  1OZS A;  3PSR A;  1CDN A;  3K21 A;  3I5F B;  3OBV A;  3I5I C;  1CDL A;  1SL7 A;  3PJI A;  2ZKM X;  4PE0 A;  3SIA A;  3EK8 A;  2I7A A;  1RJV A;  2BCA A;  3BYA A;  3SG7 A;  2BL0 C;  1NX0 A;  1MQ1 A;  4NDD A;  1FW4 A;  2LLU A;  2KLE A;  2KYC A;  3FIA A;  2KAX A;  3NXA A;  4JKT A;  4OZD A;  1A75 B;  1GQM A;  2CT9 A;  3BFB A;  3VGO A;  1LS8 A;  2COL B;  2LVK A;  1SL8 A;  2BKH B;  2LHI A;  1QVI Z;  5G08 A;  1DF0 B;  1HQV A;  1TRF A;  1UHH A;  5HLO A;  5TNC A;  1WLZ A;  2K7O A;  4C0L A;  2CXJ A;  5F6T A;  1BR1 B;  4JD9 A;  3PN7 C;  1EXR A;  3IF7 A;  1IKU A;  3EKH A;  1W7I B;  1EL4 A;  1U5I A;  4GUK A;  2EHB A;  4OCI A;  3VRP A;  1KCY A;  1QV0 A;  2BBN A;  2CNP A;  2MAZ A;  2Y1N A;  1DEK A;  2L5Y A;  2QPT A;  1IJ5 A;  2KAY A;  2CCM A;  3PM8 A;  1LVC D;  2LCP A;  3CR5 X;  3OHM B;  5CSN A;  2SAS A;  1B9A A;  4HRE E;  1J7R A;  3GK2 A;  4QJ3 B;  1B4C A;  1SW8 A;  4INW A;  3AKB A;  2HQ8 A;  1SPY A;  1XYD A;  2JPT A;  1KQM B;  4M2O A;  2LV7 A;  5ER5 A;  1H4B A;  4MEW A;  2KQ6 A;  1BU3 A;  3NSO A;  2H61 A;  4GGN A;  5EL2 A;  5AEQ A;  4BY5 A;  1YX7 A;  3BUW B;  1YUU A;  1OMD A;  2PSR A;  3D74 A;  3FE9 A;  4HRH A;  3C1V A;  3SS5 A;  2H2K A;  2QAC A;  1YRT B;  1KK8 C;  3L4A A;  1MHO A;  1UHJ A;  2I2R E;  2MJW B;  4XJK A;  4YGB B;  3PAT A;  1JF2 A;  1ALW A;  2YGU A;  3CR4 X;  1CM1 A;  1K90 D;  1F4Q A;  3PM2 A;  3LK0 A;  3QME A;  2PRU A;  1M45 A;  2NXQ A;  3BUX B;  1DMO A;  1AVS A;  2Q91 A;  3LCP C;  2Q4U A;  1NIW A;  4MVF A;  3SS4 A;  1IJ6 A;  1FF1 A;  1YVH A;  1M46 A;  1WRL A;  3PN7 B;  4CID A;  2B1U A;  2WCK A;  3RLZ A;  1DJZ A;  2WC5 A;  1RRO A;  3CGA A;  1Y1U A;  1OOH A;  1XK4 A;  5DKQ A;  3O78 A;  5DIC A;  4QJ5 B;  2G9B A;  2NCO A;  1MR8 A;  2FCE A;  3SG4 A;  2JT3 A;  2JNX A;  1FI6 A;  2JXC A;  2Y5I A;  1OMV A;  1TNP A;  1QVI Y;  3A8R A;  3KEV A;  1DJH A;  2L4H A;  1M39 A;  3OX6 A;  5CSJ A;  1PUL A;  2ZRS A;  5HKZ A;  1IIO A;  1QWV A;  1NX2 A;  1OOI X;  2P6B B;  2ZN8 A;  1TUJ A;  3EK7 A;  1CFD A;  1F71 A;  1XFV O;  2O5G A;  1K95 A;  2WC6 A;  2DOQ A;  5DKN A;  1UHK A;  4YRU A;  4D1E A;  3DVE A;  1KFX L;  2LUX A;  1KK8 B;  3H4S E;  1CFP A;  2FJU B;  2JTT A;  1NCX A;  3CZ2 A;  3R1V A;  1DJG A;  2PQL A;  2ZN9 A;  1TOP A;  1CMF A;  1S36 A;  2KHN A;  3DF0 A;  1J1E A;  2WCB A;  5D69 A;  5BPJ A;  1SY9 A;  1UP5 A;  2AMI A;  2OS8 C;  1AP4 A;  4YI9 A;  2ERB A;  1R6P A;  1RK9 A;  1RFJ A;  2LP3 A;  2M1U A;  2KOT A;  1KK7 Y;  1J55 A;  1IH0 A;  2KNE A;  2M8U A;  2ZNE A;  4OVN F;  3DVJ A;  2H61 C;  1TNX A;  1QS7 A;  2WOR A;  1Z2C B;  2M0R A;  1QTX A;  1TCF A;  2KI4 B;  1SYM A;  2KDH A;  1F54 A;  1S6I A;  4INX A;  1BLQ A;  1F70 A;  5FI6 A;  1A2X A;  4DS7 A;  4OV2 A;  1F4O A;  1DTL A;  4MSP A;  1Y0V H;  4DRW A;  1H8B A;  3DD4 A;  2JT0 A;  2KSP A;  1QX5 B;  3BOW A;  1NP8 A;  2LE9 B;  3M0W A;  3OB2 B;  4YBH B;  2EC6 C;  2M3W A;  1GM0 A;  1S5G Z;  3NGV A;  2P70 A;  5HL1 A;  1CFF A;  2LNK A;  2MHH A;  1U5I B;  5HLV A;  3UNW A;  3VRN A;  4IJ7 A;  2WND A;  1NX1 A;  1C07 A;  1OOG A;  4ORC B;  4A4B A;  1SCM C;  2P71 A;  2O60 A;  2OPO A;  3RM1 A;  2JZI A;  1NUB A;  1TIZ A;  1DJX A;  2K7D A;  2LUC A;  3ICB A;  3D76 A;  1PK0 D;  4TNC A;  1KSO A;  4MRX A;  4DIR A;  3V2L A;  5B8I B;  4NQG A;  1JFJ A;  1AJ4 A;  2OTG C;  4JQ0 D;  1ZFS A;  2OS8 B;  3FE6 A;  2MRD A;  1MXE A;  2LMV A;  2Y4Q A;  1S26 D;  2QEV A;  2KPH A;  4F0Z B;  1S3P A;  1BF5 A;  2HF5 A;  3TUY B;  2KFF A;  5IBW A;  1QX2 A;  1UWO A;  2NCP A;  2LLS A;  1NPQ A;  3BUO B;  5AAN A;  4AQI A;  1NCY A;  4PE7 A;  1E8A A;  3BUN B;  5D7F A;  3OB1 B;  3A4U B;  1JC2 A;  1QIW A;  2LVJ A;  2JC2 A;  4XJK B;  2V53 A;  3VB1 A;  1QLK A;  5ER4 X;  1DGV A;  3CS1 A;  1CM4 A;  5JOL A;  4DUQ A;  1DF0 A;  4ETO A;  1SNL A;  1XO5 A;  3B7A A;  3SG3 A;  1KK7 Z;  2KFH A;  1B1G A;  1W9Z A;  1OZO A;  2KQY A;  2QDI A;  4HRG A;  4ZCV A;  5FI2 A;  3DZT A;  2M97 A;  2EC6 B;  3L4L A;  4KYN A;  1TCO B;  3D73 A;  3B86 A;  3DY9 A;  1PSB A;  3GK4 X;  5PAL A;  2K0J A;  1SCV A;  4C0K A;  3OP0 A;  4CPV A;  2JPO A;  4I5N B;  4I5K A;  1SCM B;  1XFX O;  1B7T Y;  1OE9 B;  3JTD C;  1CDP A;  4PHK A;  3KO0 A;  1KFX S;  3MSE B;  1QXP A;  1IRJ A;  3OX5 A;  4E68 A;  1C7V A;  1RWY A;  3AAK A;  1FI5 A;  5I2O A;  1GJY A;  3I5G C;  5I2L A;  3L47 A;  2SCP A;  5HKY A;  1K9K A;  1S5G Y;  2OTG B;  3D77 A;  2JNF A;  3DYE A;  4FQT A;  1IQ3 A;  4R1E A;  2LAP A;  3S0D A;  3SG2 A;  3TZ1 A;  1CLB A;  2KI4 C;  4GAO A;  2L5X B;  4YI8 A;  3SS3 A;  2WC8 A;  1SRA A;  3EVR A;  4MRY A;  1C3Y A;  1LIN A;  1KWO B;  1AK8 A;  1YRU B;  2WCF A;  2L98 A;  4JWQ A;  2WCM A;  3TS5 C;  2HPS A;  3FWB A;  2PYQ A;  3FS7 A;  1QAS A;  3AAJ A;  3F45 A;  4AOM A;  1UHI A;  2QEO A;  3HCM A;  2PMY A;  1JFK A;  2ZFD A;  5CPV A;  4FQO A;  1JWD A;  1LA0 A;  1IGV A;  1PSR A;  2K2F A;  4DCK A;  2JUL A;  2MBX A;  3CLN A;  3GOF A;  1A4P A;  2D8N A;  4PHM A;  3IVT A;  2WCJ A;  1OW4 A;  2BEC A;  1A03 A;  1G8I A;  2WCH A;  4CFQ A;  1AHR A;  3DF0 B;  1B47 A;  1EH2 A;  4MN0 A;  2AUC A;  4JPZ B;  1RTP 1;  1ODB A; 
#chains in the Genus database with same CATH homology
 1ZUZ A;  1EJ3 A;  1LKJ A;  2BKI B;  4PCW A;  1VRK A;  1NCZ A;  1KFU L;  3KPX A;  2CTN A;  2JXL A;  2HQW A;  1G33 A;  2LVI A;  3QRX A;  3PFV A;  5FYX A;  1PAL A;  2M7L A;  1XVJ A;  1PRW A;  1NSH A;  1N2D A;  1BR4 B;  3BQ3 A;  3JTD B;  3TDU A;  1WDC C;  1DVI A;  3I5H C;  2EGD A;  1MUX A;  2F8P A;  2MA2 A;  4N1F A;  4PHJ A;  3LLE A;  1AUI B;  1NYA A;  1C7W A;  1SR6 B;  2M9G A;  1SKT A;  1X02 A;  2F2O A;  3HX4 A;  2A4J A;  4I5L B;  5I8N A;  3TUY C;  1CLM A;  3I5G B;  2NLN A;  1K93 D;  1ZOT B;  4N5X A;  2BBM A;  4ORB B;  2KGB C;  1CLL A;  3IQQ A;  1S1E A;  1XA5 A;  3BOW B;  3O6B A;  1EG4 A;  1K9U A;  5DKR A;  2JWW A;  1B7T Z;  1S6C A;  2GGZ A;  1JBA A;  1YR5 A;  3TS5 B;  4CFR A;  3NSI A;  2L0P A;  2IS9 A;  2NZ0 A;  5KU1 A;  1XFW O;  2HET A;  3D0Y A;  3ZNI A;  2K7C A;  5JJG A;  3EKJ A;  3VRO A;  1MF8 B;  4MZJ A;  1XFU O;  2ISD A;  2JQ6 A;  1YUR A;  3WNX B;  4AQJ A;  1GGW A;  2WOS A;  1XK4 C;  1N65 A;  1TN4 A;  3CTN A;  1IG5 A;  5AER A;  1A29 A;  4YGA A;  2L51 A;  2E30 A;  2PAL A;  1V1G A;  2FCD A;  2BCX A;  2JOJ A;  1NX3 A;  4PE1 A;  1K96 A;  4NDC A;  1FPW A;  1DJW A;  2I18 A;  2JTZ A;  2LMT A;  1NWD A;  4P2Y B;  4QJ4 B;  4XYN A;  3PAL A;  2KBM A;  1J7O A;  2JRF A;  1WDC B;  3I5H B;  1EG3 A;  4GGF A;  1KWO C;  3DVM A;  4ORA B;  3TDZ A;  1DT7 B;  3PLF B;  1BG1 A;  1JF0 A;  2G2B A;  1FBV A;  5GQQ C;  4WQ2 A;  4Q04 A;  1J1D A;  2KI6 D;  2KYF A;  3GK1 A;  4HSZ A;  1TTX A;  2KI6 C;  1WLM A;  2K8M B;  5J3X A;  1A75 A;  1Q80 A;  4U8D A;  3VRQ A;  4FTG A;  1BJF A;  1GGZ A;  3AKA A;  4PAL A;  1W7J B;  3CR2 A;  2LAN A;  1XFY O;  4MZL A;  2JU0 A;  3EVV A;  2LLT A;  1JUO A;  1QX7 A;  1PVA A;  1CNP A;  1XFZ O;  1J7Q A;  2L4I A;  4WQ3 A;  5KSZ A;  1K2H A;  2LP2 A;  3SG6 A;  1AJ5 A;  2GGM A;  2K2A A;  3IQO A;  1SK6 D;  4M2P A;  1OSA A;  1QJT A;  4A4C A;  2ZRT A;  1MWN A;  1B8L A;  2ZND A;  4P5O E;  1K8U A;  3NSL A;  5K89 A;  3D10 A;  5AFP A;  2CBL A;  4MBE A;  3BUM B;  5KTY A;  1D1O A;  1CTR A;  2L50 A;  1SR6 C;  3I5I B;  2F3Z A;  2LM5 A;  1KFU S;  3KF9 A;  1CKK A;  2M1K B;  3KHE A;  1F55 A;  1DJI A;  3WHT B;  1K94 A;  3JVT C;  4N1G A;  4L9M A;  2BL0 B;  2RGI A;  4OR9 B;  1TNW A;  1L2O C;  3FWC A;  1DGU A;  1CFC A;  1B8C A;  3LK1 A;  4WRI A;  3EVU A;  1SL9 A;  4I5J A;  2VRG A;  1ZMZ A;  2M49 B;  4YGD B;  1REC A;  1LXF C;  1UUR A;  1SBJ A;  1BMO A;  5HKW A;  2LMU A;  4NDB A;  1KSM A;  2M29 A;  2E6W A;  1BT6 A;  2WCE A;  1Y1X A;  2JT8 A;  5AXI A;  1ALV A;  2BE6 A;  4GBA A;  3WXA A;  1QLS A;  1YUT A;  1ZAC A;  2PVB A;  4YGE B;  3VRR A;  1CMG A;  2F3Y A;  4PHN A;  1IQ5 A;  1QV1 A;  1YTZ C;  4GPL B;  4PDZ A;  1R2U A;  5CSI A;  1HT9 A;  1J7P A;  3I5F C;  1KQV A;  4GGF C;  1BOD A;  1LA3 A;  4YGC B;  3CZT X;  1M31 A;  1BOC A;  2AAO A;  2Y1M A;  3BXK A;  3CWG A;  4M2Q A;  3TDI A;  2I94 A;  3ZWH A;  4ZCU A;  1YX8 A;  1Y6W A;  1SMG A;  2K61 A;  4MLW A;  5HYD A;  2L2E A;  1K9P A;  1QAT A;  3O2P A;  1YUS A;  3NSK A;  2K7B A;  1L7Z A;  4CLN A;  1N0Y A;  1S6J A;  1CB1 A;  1UHN A;  1B8R A;  3JVT B;  3LL8 B;  1OOJ A;  1Y1A A;  2KBI A;  3SG5 A;  3D0Y B;  1L2O B;  2M7N A;  1CDM A;  2F33 A;  4GFT A;  2KAV A;  4BY4 A;  1JSA A;  1QIV A;  1YVL A;  3WHU B;  1M63 B;  1TNQ A;  2BCB A;  2KGR A;  4MZK A;  3SJS A;  2BE4 A;  4USL A;  2GV5 A;  4C0J A;  2R2I A;  1G4Y R;  4ICB A;  3O4Y A;  4UPG A;  2LVV A;  4OKH A;  2MLF C;  1PVB A;  2LC5 A;  2PAS A;  2KFG A;  1OQP A;  1UUS A;  3SIB A;  3DVK A;  3EK4 A;  4PE4 A;  4GNK B;  2LHL A;  2MLE C;  1DJY A;  2FOT A;  1V1F A;  1IWQ A;  1OMR A;  2TN4 A;  4IL1 A;  1WRZ A;  5CSF A;  1F8H A;  5I2Q A;  1KQM C;  1WRK A;  3E3R A;  2F2P A;  1MXL C;  1WY9 A;  1OZS A;  3PSR A;  1CDN A;  3K21 A;  3I5F B;  3I5I C;  1CDL A;  1SL7 A;  2ZKM X;  4PE0 A;  3SIA A;  3EK8 A;  2I7A A;  1RJV A;  2BCA A;  3BYA A;  3SG7 A;  2BL0 C;  1NX0 A;  1MQ1 A;  4NDD A;  1FW4 A;  2LLU A;  3FIA A;  2KYC A;  2KAX A;  3NXA A;  1A75 B;  1GQM A;  2CT9 A;  3VGO A;  2COL B;  2LVK A;  1SL8 A;  2BKH B;  2LHI A;  1QVI Z;  5G08 A;  1DF0 B;  1HQV A;  1TRF A;  1UHH A;  5HLO A;  5TNC A;  1WLZ A;  2K7O A;  4C0L A;  2CXJ A;  5F6T A;  1BR1 B;  3PN7 C;  1EXR A;  3IF7 A;  1IKU A;  3EKH A;  1W7I B;  1EL4 A;  1U5I A;  4GUK A;  2EHB A;  4OCI A;  3VRP A;  1KCY A;  1QV0 A;  2BBN A;  2CNP A;  2MAZ A;  2Y1N A;  2QPT A;  1IJ5 A;  2KAY A;  2CCM A;  3PM8 A;  1LVC D;  2LCP A;  3CR5 X;  3OHM B;  5CSN A;  2SAS A;  1B9A A;  4HRE E;  1J7R A;  3GK2 A;  4QJ3 B;  1B4C A;  1SW8 A;  3AKB A;  2HQ8 A;  1SPY A;  1XYD A;  2JPT A;  1KQM B;  4M2O A;  2LV7 A;  5ER5 A;  1H4B A;  4MEW A;  2KQ6 A;  1BU3 A;  3NSO A;  2H61 A;  4GGN A;  5AEQ A;  4BY5 A;  1YX7 A;  3BUW B;  1YUU A;  1OMD A;  2PSR A;  4HRH A;  3C1V A;  2H2K A;  2QAC A;  1YRT B;  1KK8 C;  1MHO A;  1UHJ A;  2I2R E;  2MJW B;  4XJK A;  4YGB B;  3PAT A;  1JF2 A;  1ALW A;  3CR4 X;  1CM1 A;  1K90 D;  1F4Q A;  3LK0 A;  2PRU A;  1M45 A;  2NXQ A;  3BUX B;  1DMO A;  1AVS A;  2Q91 A;  3LCP C;  2Q4U A;  1NIW A;  4MVF A;  1FF1 A;  1IJ6 A;  1YVH A;  1M46 A;  1WRL A;  3PN7 B;  4CID A;  2B1U A;  3RLZ A;  1DJZ A;  1RRO A;  3CGA A;  1Y1U A;  1XK4 A;  5DKQ A;  3O78 A;  4QJ5 B;  2G9B A;  2NCO A;  1MR8 A;  2FCE A;  3SG4 A;  2JT3 A;  2JNX A;  1FI6 A;  2JXC A;  2Y5I A;  1OMV A;  1TNP A;  1QVI Y;  3A8R A;  3KEV A;  1DJH A;  2L4H A;  1M39 A;  3OX6 A;  5CSJ A;  1PUL A;  2ZRS A;  5HKZ A;  1NX2 A;  2P6B B;  2ZN8 A;  3EK7 A;  1CFD A;  1F71 A;  1XFV O;  2O5G A;  1K95 A;  5DKN A;  2DOQ A;  4YRU A;  1UHK A;  4D1E A;  3DVE A;  1KFX L;  2LUX A;  1KK8 B;  3H4S E;  1CFP A;  2FJU B;  2JTT A;  1NCX A;  1DJG A;  1CMF A;  2ZN9 A;  1TOP A;  1S36 A;  2KHN A;  3DF0 A;  1J1E A;  2WCB A;  5D69 A;  5BPJ A;  1SY9 A;  1UP5 A;  2AMI A;  2OS8 C;  1AP4 A;  4YI9 A;  1R6P A;  1RK9 A;  1RFJ A;  2LP3 A;  2M1U A;  2KOT A;  1KK7 Y;  1J55 A;  1IH0 A;  2KNE A;  2M8U A;  2ZNE A;  4OVN F;  3DVJ A;  2H61 C;  1TNX A;  1QS7 A;  2WOR A;  2M0R A;  1QTX A;  1TCF A;  2KI4 B;  1SYM A;  2KDH A;  1F54 A;  1S6I A;  1BLQ A;  1F70 A;  1A2X A;  4DS7 A;  4OV2 A;  1F4O A;  1DTL A;  4MSP A;  1Y0V H;  4DRW A;  1H8B A;  3DD4 A;  2JT0 A;  2KSP A;  1QX5 B;  3BOW A;  1NP8 A;  2LE9 B;  3M0W A;  3OB2 B;  4YBH B;  2EC6 C;  2M3W A;  1S5G Z;  1CFF A;  2LNK A;  2MHH A;  1U5I B;  5HLV A;  3VRN A;  2WND A;  1NX1 A;  1C07 A;  4ORC B;  4A4B A;  1SCM C;  2O60 A;  2OPO A;  3RM1 A;  2JZI A;  1NUB A;  1TIZ A;  1DJX A;  2K7D A;  2LUC A;  3ICB A;  1PK0 D;  4TNC A;  1KSO A;  4MRX A;  4DIR A;  5B8I B;  1JFJ A;  4NQG A;  1AJ4 A;  2OTG C;  4JQ0 D;  1ZFS A;  2OS8 B;  2MRD A;  1MXE A;  2LMV A;  2Y4Q A;  1S26 D;  4F0Z B;  1S3P A;  1BF5 A;  2HF5 A;  3TUY B;  2KFF A;  5IBW A;  1QX2 A;  1UWO A;  2NCP A;  2LLS A;  1NPQ A;  3BUO B;  5AAN A;  4AQI A;  1NCY A;  4PE7 A;  1E8A A;  3BUN B;  5D7F A;  3OB1 B;  3A4U B;  1JC2 A;  1QIW A;  2LVJ A;  2JC2 A;  4XJK B;  2V53 A;  1QLK A;  5ER4 X;  1DGV A;  3CS1 A;  1CM4 A;  5JOL A;  4DUQ A;  1DF0 A;  4ETO A;  1SNL A;  1XO5 A;  3SG3 A;  1B1G A;  1KK7 Z;  2KFH A;  4HRG A;  1OZO A;  2KQY A;  4ZCV A;  2M97 A;  2EC6 B;  1TCO B;  1PSB A;  3GK4 X;  5PAL A;  2K0J A;  1SCV A;  4C0K A;  3OP0 A;  4CPV A;  4I5N B;  4I5K A;  1SCM B;  1XFX O;  1B7T Y;  1OE9 B;  3JTD C;  1CDP A;  4PHK A;  3KO0 A;  1KFX S;  3MSE B;  1QXP A;  1IRJ A;  3OX5 A;  4E68 A;  1C7V A;  1RWY A;  3AAK A;  1FI5 A;  5I2O A;  1GJY A;  3I5G C;  5I2L A;  2SCP A;  5HKY A;  1K9K A;  1S5G Y;  2OTG B;  2JNF A;  1IQ3 A;  4R1E A;  2LAP A;  3SG2 A;  3TZ1 A;  1CLB A;  2KI4 C;  4GAO A;  2L5X B;  4YI8 A;  2WC8 A;  1SRA A;  3EVR A;  4MRY A;  1LIN A;  1KWO B;  1AK8 A;  1YRU B;  2WCF A;  2L98 A;  4JWQ A;  3TS5 C;  2HPS A;  3FWB A;  3FS7 A;  1QAS A;  3AAJ A;  3F45 A;  4AOM A;  1UHI A;  3HCM A;  2PMY A;  1JFK A;  2ZFD A;  5CPV A;  4FQO A;  1JWD A;  1LA0 A;  1IGV A;  1PSR A;  2K2F A;  4DCK A;  2JUL A;  2MBX A;  3CLN A;  3GOF A;  1A4P A;  2D8N A;  4PHM A;  2BEC A;  1A03 A;  1G8I A;  4CFQ A;  1AHR A;  3DF0 B;  1B47 A;  1EH2 A;  4MN0 A;  2AUC A;  4JPZ B;  1RTP 1;  1ODB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...