2BE6A

2.0 a crystal structure of the cav1.2 iq domain-ca/cam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
141
Chain Sequence
b'QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin 2
publication title Insights into voltage-gated calcium channel regulation from the structure of the Ca(V)1.2 IQ domain-Ca(2+)/calmodulin complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 51
structure length 141
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A02
1IGVA 5IBWA 1OQPA 2HPSA 1C7WA 2M29A 1L2OB 1UHHA 3MSEB 1NYAA 2JTZA 1JF2A 1S1EA 3LK1A 1TN4A 4N5XA 4TNCA 1JWDA 1SK6D 1B8RA 1SCMC 4Q04A 2BECA 3TDUA 2LANA 1KFUS 2LAPA 4YGCB 2IS9A 4QJ3B 4PE4A 4YI9A 1RWYA 2I94A 1CLMA 1B9AA 1KQVA 1ALVA 5HKZA 5I2OA 1DF0A 2CNPA 1BT6A 2KI4B 1QLKA 1SL7A 4HRGA 1KFXS 4QJ5B 1CFCA 1UHKA 2ZRTA 4DRWA 2PSRA 2SASA 1MXEA 1WDCC 1WRKA 3EVVA 3OHMB 1A2XA 2KQYA 3AAKA 1DGUA 2K61A 2JU0A 3CTNA 3BUWB 1DJYA 1ZUZA 1PSRA 3NSKA 1QLSA 1TTXA 3SG2A 2LLUA 4OR9B 3SG5A 1Y1XA 3M0WA 4XYNA 2EGDA 4GGFA 2HF5A 4I5NB 2KOTA 3ZWHA 2Y4QA 1M46A 1IWQA 2MHHA 2CTNA 4M2PA 2L4IA 3AKBA 4IL1A 3GOFA 1W7IB 2BBMA 1MF8B 4MN0A 1OZSA 4DIRA 2MRDA 5DKNA 1RTP1 2EC6B 3FIAA 2M8UA 2HETA 2HQWA 4AQIA 1XFVO 5J3XA 1BJFA 4M2OA 1KFUL 2MA2A 1J7PA 4YGBB 4YRUA 2JOJA 1AJ4A 4P5OE 2FOTA 3BOWA 4U8DA 2KI4C 4XJKA 1S5GY 1ZACA 1RROA 2JXLA 4MBEA 5AXIA 3I5HB 2ZNDA 3DF0A 1K9KA 5G08A 2LUXA 1NX3A 2F8PA 4HRHA 2NLNA 1IJ5A 1VRKA 2L4HA 2FCEA 1L7ZA 1MHOA 1AHRA 4JPZB 2M49B 4PDZA 1B8LA 2JNXA 3SG3A 3WHTB 1KQMC 1TNQA 2K8MB 1U5IA 4L9MA 2KSPA 3I5IC 3VRPA 4PHJA 2WCFA 1NCYA 2ZNEA 2LV7A 1FPWA 1YUTA 2K7BA 2Y5IA 1KSOA 1SNLA 2JZIA 4CIDA 2PRUA 5HKWA 2E30A 2O5GA 3BUNB 1Q80A 5D69A 3VRRA 3WXAA 1QV0A 2JT3A 2LM5A 2Y1MA 2M9GA 2EC6C 5I2LA 4DCKA 2K0JA 4WQ2A 3JVTB 1DTLA 4CPVA 1YX8A 1EJ3A 1C07A 5GQQC 2F3ZA 3TZ1A 1WRLA 1S6IA 3SIBA 3BYAA 1K96A 1K93D 1UP5A 1HT9A 5AEQA 1DF0B 1YTZC 5AANA 2M1KB 3O2PA 3LLEA 1B1GA 2E6WA 2K7DA 4DS7A 2K2FA 3I5HC 3O6BA 2G2BA 1LKJA 1M45A 2BBNA 2LP2A 2OPOA 3BUMB 1KK7Y 1CDMA 4JQ0D 2Q91A 2CCMA 2KGRA 2Q4UA 3EKHA 1RECA 3BUOB 2BCAA 1XVJA 1NIWA 1QV1A 4WQ3A 3PN7B 2PALA 1YVHA 2JNFA 5CSJA 4MRXA 1DJXA 2LMVA 1IKUA 5CPVA 2LHLA 1OOJA 2KAXA 2KBMA 3DVJA 1PSBA 1DJIA 1SR6B 2M0RA 2CBLA 1IRJA 1NUBA 2MLEC 2PMYA 2AMIA 3VRQA 4E68A 2M3WA 1J55A 4OCIA 2JT0A 4YGEB 5ER4X 4MEWA 4AQJA 3FS7A 2JRFA 1SMGA 4NDDA 2BL0B 2D8NA 3DVMA 1EH2A 4NDBA 4MZLA 2JQ6A 1YR5A 1FW4A 2LVJA 3I5FC 2NCOA 3CGAA 1F4OA 2KYFA 3JVTC 2OS8B 1NCXA 1GJYA 4MZKA 3QRXA 4YI8A 1KK8B 1UUSA 3HX4A 2F2OA 5HYDA 1QIVA 3AKAA 3BOWB 3BQ3A 1W7JB 1N0YA 3NSIA 1S6CA 2H2KA 4GNKB 3OP0A 5JJGA 4I5LB 2RGIA 1QX2A 3CS1A 4XJKB 1BF5A 1YUUA 4ZCUA 1Y1UA 2Y1NA 1F71A 1M63B 3GK4X 1DMOA 1J7RA 2CXJA 1DJZA 1G33A 1SPYA 3DF0B 4MSPA 1DVIA 2JULA 1S26D 1NP8A 3JTDB 2HQ8A 1JC2A 4NDCA 1L2OC 2KAVA 3F45A 3PN7C 2NXQA 1BOCA 3WHUB 4ETOA 1U5IB 3KEVA 4GGFC 1D1OA 3WNXB 3SG4A 3TDZA 2JXCA 4N1FA 1AK8A 2BKHB 1KSMA 1CFDA 1XFUO 2GGZA 4GPLB 4R1EA 5ER5A 4ORAB 2KYCA 2BL0C 1KCYA 5KU1A 1LA0A 4PCWA 4PHMA 2NCPA 1BR1B 1BLQA 2MJWB 2G9BA 3BXKA 2F33A 3A8RA 1XFWO 1K94A 4BY4A 1RJVA 1JSAA 2R2IA 2L0PA 2OS8C 3GK2A 2LMTA 2L50A 1QVIY 1R6PA 2KDHA 1K9PA 4ORCB 1KK8C 1OMVA 3GK1A 1CDPA 4BY5A 1YURA 1CM4A 4OKHA 3IF7A 2LUCA 3EKJA 4OVNF 1DJWA 2ZFDA 1KK7Z 2I18A 3NSLA 4GUKA 3SJSA 2ZN9A 1B7TY 4CLNA 1GGWA 1CM1A 1PVBA 1E8AA 1K9UA 1EG3A 1XFYO 2JTTA 1CLBA 1ZOTB 4GBAA 2GV5A 3PSRA 1NX0A 1B8CA 1QATA 1QXPA 2LLSA 2JT8A 4M2QA 1DT7B 1TNWA 4FQOA 4DUQA 3EK7A 2MAZA 2M7NA 1NWDA 2KGBC 5DKRA 1RK9A 1UHJA 2I2RE 3KPXA 2PASA 2SCPA 3BUXB 2KBIA 5HLVA 1RFJA 2V53A 1LINA 3NXAA 4FTGA 1M31A 1DJGA 1J1EA 3TUYB 5BPJA 2K2AA 1SW8A 1IQ5A 3LK0A 2TN4A 1MWNA 1AP4A 3DVKA 2F3YA 4HSZA 1WY9A 4YGDB 1XK4A 1CLLA 2BCBA 1OZOA 2LLTA 1FF1A 2WC8A 1QJTA 2EHBA 2KFHA 1AJ5A 1NCZA 1FBVA 4N1GA 1IQ3A 4YGAA 1YVLA 1IG5A 2A4JA 3DD4A 3DVEA 4HREE 1TCOB 1TNPA 4PE7A 1IH0A 4JWQA 1EG4A 3I5GB 5FYXA 1F8HA 2CT9A 1MXLC 1MQ1A 1XFXO 3TS5B 1BODA 2L5XB 1C7VA 1TNXA 4GFTA 3RLZA 1KWOB 2FJUB 2H61A 1A75A 2B1UA 1A4PA 1K95A 2NZ0A 5F6TA 2O60A 1FI5A 2M7LA 1WRZA 2QPTA 2LMUA 1CDNA 2MLFC 5B8IB 1JBAA 1R2UA 4MZJA 4WRIA 2K7CA 5K89A 4A4BA 1YUSA 2BCXA 5AFPA 2AUCA 1SCVA 2M97A 1AVSA 1QASA 3LL8B 3OX6A 5TNCA 1JF0A 4CFRA 1S3PA 5I8NA 1ALWA 2KNEA 2DOQA 3TUYC 3IQQA 4ZCVA 3SG7A 1MR8A 2KAYA 1EL4A 3A4UB 3D0YA 1CKKA 1QTXA 1S5GZ 1UWOA 1QVIZ 4P2YB 1F55A 4UPGA 3TDIA 1Y0VH 2WCEA 1A29A 1SKTA 2VRGA 4OV2A 1LA3A 1J7QA 3I5GC 3VROA 2LHIA 3PLFB 1B7TZ 3TS5C 2LP3A 1X02A 4QJ4B 2GGMA 1KWOC 1A03A 2PVBA 1CDLA 3HCMA 1XFZO 3PFVA 4PE1A 2OTGB 1MUXA 2F2PA 3CWGA 1K8UA 4NQGA 4I5JA 1CTRA 5JOLA 5KTYA 1N2DA 1CFPA 2I7AA 3OX5A 1SR6C 1FI6A 1UURA 2LC5A 1TRFA 4USLA 1OMRA 5DKQA 4YBHB 4AOMA 2LVVA 1XA5A 3ICBA 3VRNA 1BU3A 1KQMB 4PE0A 2L2EA 4PHKA 1Y6WA 1J1DA 1QS7A 1S36A 3I5IB 1PK0D 1K2HA 2ZRSA 1CB1A 1BMOA 1SL9A 1PVAA 3D10A 1GQMA 1YRUB 1PULA 1G4YR 3RM1A 1ZMZA 2BKIB 1NX2A 3PATA 1QIWA 3IQOA 1YRTB 2L51A 1ZFSA 3CLNA 4MLWA 1SL8A 1HQVA 2M1UA 3E3RA 4PHNA 4PALA 3H4SE 1BR4B 2FCDA 2QACA 1QX7A 1XO5A 1DJHA 2COLB 2BE6A 1OE9B 2KI6D 2ZKMX 3C1VA 1F54A 2L98A 3EVRA 1OSAA 1QX5B 1SYMA 2OTGC 1K90D 3CR5X 3JTDC 1A75B 5HLOA 1J7OA 1IJ6A 1G8IA 3EK8A 4CFQA 1GGZA 1TCFA 1WLMA 5D7FA 3SG6A 1M39A 1NPQA 1OMDA 1TIZA 2KHNA 2LE9B 4C0LA 1KFXL 1EXRA 1NX1A 1JUOA 1B4CA 3PALA 2K7OA 4GAOA 4GGNA 2LVKA 1CMFA 1H4BA 5KSZA 1PALA 2P6BB 5CSIA 3K21A 5HKYA 2JWWA 1V1FA 2JC2A 3FWBA 1SBJA 1CMGA 3O4YA 1SRAA 3FWCA 3OB2B 3EK4A 3KO0A 1F4QA 1AUIB 1UHIA 1LVCD 1PRWA 1Y1AA 4C0KA 4C0JA 3O78A 1TOPA 4A4CA 1SCMB 3PM8A 1ODBA 2WORA 1NSHA 2BE4A 3D0YB 4MVFA 1JFJA 2MBXA 1CFFA 1XK4C 2LCPA 4I5KA 4D1EA 1H8BA 1BG1A 2JPTA 3CR2A 5CSFA 1LXFC 2WCBA 4ICBA 5CSNA 1F70A 2KFFA 3I5FB 2LVIA 1N65A 2KFGA 4ORBB 3SIAA 2LNKA 5AERA 3EVUA 3ZNIA 2ZN8A 2KI6C 4MRYA 3LCPC 5I2QA 1JFKA 1CNPA 1WDCB 3VGOA 2H61C 3NSOA 2WNDA 1WLZA 5PALA 4F0ZB 3CR4X 1UHNA 3AAJA 1XYDA 1DGVA 2AAOA 3KHEA 1B47A 2ISDA 1S6JA 2KQ6A 3OB1B 3KF9A 3CZTX 2WOSA 1SY9A 1YX7A 1V1GA
chains in the Genus database with same CATH superfamily
1IGVA 5IBWA 1OQPA 2HPSA 1C7WA 1OOFA 2M29A 1L2OB 1UHHA 3MSEB 1NYAA 2JTZA 3D75A 1JF2A 4OZDA 1S1EA 3LK1A 1TN4A 4N5XA 4TNCA 1JWDA 1SK6D 1B8RA 1SCMC 4Q04A 2BECA 3TDUA 2LANA 1KFUS 2LAPA 4YGCB 2IS9A 4QJ3B 4PE4A 3BFBA 2WC5A 5HL1A 4YI9A 1RWYA 2I94A 1CLMA 3CABA 3CYZA 1B9AA 1KQVA 1ALVA 5HKZA 5I2OA 1DF0A 2CNPA 1BT6A 3R72A 2KI4B 1QLKA 1SL7A 4HRGA 1KFXS 3DYEA 4QJ5B 1UHKA 1CFCA 1IIOA 2ZRTA 4DRWA 2PSRA 2SASA 1MXEA 1WDCC 1WRKA 3EVVA 3OHMB 1A2XA 2KQYA 3AAKA 2BNXA 2KLDA 1DGUA 2K61A 2JU0A 3CTNA 3BUWB 2WCJA 1DJYA 1ZUZA 1PSRA 3NSKA 3R1VA 4JKTA 1QLSA 1TTXA 3SG2A 2LLUA 4OR9B 5EL2A 3SG5A 1Y1XA 3V2LA 3M0WA 4XYNA 2QEOA 2EGDA 4GGFA 2HF5A 4I5NB 2KOTA 3ZWHA 2Y4QA 1M46A 1IWQA 2MHHA 2CTNA 4M2PA 1OOHA 2L4IA 3AKBA 3B7AA 4IL1A 3GOFA 1W7IB 2BBMA 2L5YA 1MF8B 4MN0A 1OZSA 4DIRA 1C3ZA 2MRDA 5DKNA 3SS3A 1RTP1 2EC6B 3SS5A 3FIAA 2M8UA 2HETA 2HQWA 4AQIA 1XFVO 5J3XA 1BJFA 4M2OA 1KFUL 1LS8A 2MA2A 1J7PA 4YGBB 4YRUA 2JOJA 1AJ4A 4P5OE 2FOTA 2JPOA 3BOWA 4U8DA 4INXA 2KI4C 4XJKA 1S5GY 1ZACA 3DZTA 1RROA 2JXLA 4MBEA 1P28A 3EG5B 3I5HB 5AXIA 2ZNDA 3DF0A 1K9KA 5G08A 2LUXA 1NX3A 2F8PA 4HRHA 2NLNA 1IJ5A 1VRKA 2L4HA 2FCEA 1L7ZA 1MHOA 1AHRA 4JPZB 2M49B 4PDZA 3RZSA 1B8LA 2JNXA 3SG3A 3WHTB 1KQMC 3NHIA 1TNQA 2K8MB 1U5IA 4L9MA 2KSPA 3I5IC 1OW4A 3S0DA 3VRPA 4PHJA 2WCFA 1NCYA 2ZNEA 2LV7A 1FPWA 1YUTA 2K7BA 2Y5IA 1KSOA 1SNLA 5FI2A 2JZIA 3R1PA 4CIDA 2PRUA 4FQTA 5HKWA 2E30A 2O5GA 3BUNB 1Q80A 5D69A 3VRRA 3WXAA 1QV0A 2JT3A 2LM5A 2Y1MA 3D78A 2M9GA 1OOIX 2EC6C 5I2LA 4DCKA 1OOGA 2K0JA 3B87A 4WQ2A 3JVTB 1DTLA 4CPVA 1YX8A 1EJ3A 1C07A 5GQQC 2F3ZA 3OGNA 1WRLA 3TZ1A 1S6IA 3SIBA 3BYAA 1K96A 4F7FA 2QEHA 1K93D 1UP5A 1HT9A 5AEQA 1DF0B 1YTZC 5AANA 2M1KB 3NHTA 3O2PA 3LLEA 3D73A 1B1GA 2E6WA 2K7DA 4DS7A 2K2FA 3I5HC 3O6BA 2G2BA 1LKJA 1M45A 2BBNA 2LP2A 2OPOA 3S0EA 3BUMB 1KK7Y 1CDMA 4JQ0D 2Q91A 2CCMA 2KGRA 2Q4UA 3EKHA 1RECA 3BUOB 2BCAA 1XVJA 1NIWA 1QV1A 4WQ3A 3PN7B 2PALA 1YVHA 1SSEB 2JNFA 5CSJA 4MRXA 1DJXA 2LMVA 1IKUA 5CPVA 2LHLA 1OOJA 2KAXA 2KBMA 3DVJA 1PSBA 1DJIA 1SR6B 2M0RA 2CBLA 1IRJA 1NUBA 2MLEC 2PMYA 2AMIA 3BJHA 3DXLA 3VRQA 2M3WA 1J55A 2FJYA 4OCIA 5FI6A 2JT0A 4YGEB 5ER4X 4MEWA 4AQJA 3FS7A 2JRFA 1SMGA 4NDDA 2BL0B 2D8NA 3DVMA 1EH2A 4NDBA 4MZLA 2JQ6A 4JD9A 1YR5A 1FW4A 2LVJA 2QEVA 3I5FC 3R1OA 2NCOA 3CGAA 1F4OA 2KYFA 2WCKA 3S0AA 3JVTC 2OS8B 1NCXA 1GJYA 4MZKA 3QRXA 4YI8A 3VB1A 1KK8B 1UUSA 2WCLA 2WCMA 2F2OA 3HX4A 5HYDA 1QIVA 3AKAA 3BOWB 3BQ3A 1W7JB 1N0YA 3NSIA 1S6CA 2H2KA 4GNKB 3UNWA 3OP0A 5JJGA 4I5LB 2RGIA 1QX2A 3CS1A 4XJKB 1BF5A 1YUUA 4ZCUA 1Y1UA 2Y1NA 1F71A 1M63B 3GK4X 1DMOA 1J7RA 2CXJA 1DJZA 1G33A 1SPYA 3D76A 3DF0B 4MSPA 1DVIA 2JULA 1S26D 1NP8A 3BFAA 2HQ8A 3JTDB 3OBVA 1JC2A 4NDCA 1L2OC 2KAVA 3CZ1A 2K60A 3F45A 4E68A 3PN7C 2NXQA 1BOCA 3WHUB 4ETOA 1U5IB 3IVTA 3KEVA 4GGFC 1D1OA 3WNXB 3SG4A 3TDZA 2JXCA 4N1FA 1AK8A 1XFRA 2BKHB 3L47A 1KSMA 1CFDA 1XFUO 2GGZA 4GPLB 4R1EA 3UO9A 5ER5A 4ORAB 2KYCA 2BL0C 1KCYA 5KU1A 1LA0A 4PCWA 1DEKA 2NCPA 4PHMA 1BR1B 1BLQA 2MJWB 2G9BA 3B86A 2F33A 3BXKA 3A8RA 1XFWO 1K94A 4BY4A 1RJVA 1JSAA 2R2IA 2L0PA 2OS8C 3GK2A 2LMTA 3SS4A 2L50A 1QVIY 1R6PA 2KDHA 1K9PA 4ORCB 1KK8C 1OMVA 2P71A 3CZ2A 1CDPA 3GK1A 4BY5A 1YURA 1CM4A 4IJ7A 3IF7A 4OKHA 2LUCA 3EKJA 4OVNF 3B88A 1DJWA 2ZFDA 1KK7Z 2I18A 3NSLA 4GUKA 3SJSA 2ZN9A 1B7TY 3FE9A 4CLNA 1GGWA 1CM1A 3BFHA 1PVBA 1E8AA 1K9UA 1EG3A 1XFYO 2JTTA 1TUZA 2L2CA 1CLBA 1ZOTB 4GBAA 2GV5A 3PSRA 3DY9A 1NX0A 1B8CA 1QATA 1QXPA 2LLSA 2JT8A 4M2QA 1DT7B 1TNWA 4FQOA 4DUQA 3EK7A 2MAZA 2M7NA 1NWDA 2KGBC 5DKRA 1RK9A 1UHJA 2I2RE 3KPXA 2PASA 2SCPA 1Z4HA 2KBIA 3BUXB 3CZ0A 1RFJA 2P70A 2V53A 5HLVA 1LINA 2QEBA 3NXAA 4FTGA 1M31A 1DJGA 1J1EA 3TUYB 5BPJA 2K2AA 1SW8A 1IQ5A 1QWVA 2PQLA 3LK0A 2TN4A 1MWNA 1AP4A 3DVKA 2F3YA 4HSZA 1ORGA 1WY9A 4YGDB 1XK4A 1CLLA 2BCBA 1OZOA 2LLTA 1FF1A 2WC8A 1QJTA 2EHBA 2KFHA 1AJ5A 1NCZA 1FBVA 4N1GA 1IQ3A 4YGAA 1YVLA 1IG5A 2A4JA 3DD4A 3DVEA 4HREE 1TCOB 1TNPA 4PE7A 1IH0A 4JWQA 2KLEA 1EG4A 3I5GB 5FYXA 3Q8IA 4PT1A 1MXLC 2CT9A 1MQ1A 1XFXO 3TS5B 1BODA 1F8HA 2L5XB 1C7VA 1TNXA 4GFTA 3RLZA 1KWOB 3NGVA 2FJUB 2H61A 3L4AA 1A75A 2B1UA 1A4PA 1K95A 2NZ0A 5F6TA 2O60A 1FI5A 2M7LA 1WRZA 2QPTA 2LMUA 1CDNA 2MLFC 5B8IB 1JBAA 4KYNA 1DQEA 1R2UA 4MZJA 4WRIA 2K7CA 5K89A 4A4BA 1T14A 1YUSA 2BCXA 5AFPA 2AUCA 1SCVA 2M97A 2WC6A 1AVSA 1QASA 3LL8B 3OX6A 5TNCA 1JF0A 4CFRA 1S3PA 5I8NA 1ALWA 2KNEA 2DOQA 3TUYC 3IQQA 4ZCVA 3SG7A 1MR8A 2KAYA 1EL4A 3A4UB 3D0YA 1CKKA 1QTXA 1S5GZ 1UWOA 1QVIZ 4P2YB 1F55A 3L4LA 4UPGA 3TDIA 1Y0VH 2WCEA 1A29A 1SKTA 2VRGA 1W9ZA 4OV2A 1LA3A 2PYQA 1J7QA 3I5GC 3VROA 2LHIA 3PLFB 1B7TZ 3TS5C 2LP3A 1X02A 3O4XA 4QJ4B 2GGMA 1KWOC 1A03A 2PVBA 1CDLA 1GM0A 3HCMA 1XFZO 3PFVA 4PE1A 2OTGB 1TWOA 1MUXA 2F2PA 3CWGA 1K8UA 3FE8A 4NQGA 2WCHA 3QMEA 4I5JA 1CTRA 5JOLA 5I94A 5KTYA 1N2DA 1CFPA 2I7AA 3OX5A 1SR6C 1FI6A 1UURA 2LC5A 1TRFA 1Z2CB 4USLA 1OMRA 5DKQA 4YBHB 4AOMA 2LVVA 1XA5A 3ICBA 3VRNA 1BU3A 1KQMB 4PE0A 2L2EA 4PHKA 1Y6WA 1J1DA 1QS7A 1S36A 3I5IB 1PK0D 1K2HA 2ZRSA 3N7HA 1CB1A 1BMOA 3D77A 1SL9A 1PVAA 3D10A 1GQMA 1YRUB 1PULA 3B6XA 1G4YR 3RM1A 1ZMZA 2BKIB 1NX2A 3PATA 1QIWA 3IQOA 1YRTB 2L51A 1ZFSA 3CLNA 4MLWA 1SL8A 1HQVA 1DELA 1DC1A 2M1UA 3E3RA 3CDNA 4PHNA 4PALA 3S0FA 3H4SE 1BR4B 2FCDA 2QACA 1QX7A 3PM2A 1XO5A 3FE6A 1DJHA 1TUJA 2COLB 2BE6A 1OE9B 2KI6D 2ZKMX 3C1VA 1F54A 2L98A 3EVRA 1OSAA 1QX5B 1SYMA 2OTGC 1K90D 3CR5X 3JTDC 1A75B 4INWA 5HLOA 1J7OA 1IJ6A 1G8IA 3EK8A 4CFQA 1GGZA 1TCFA 1WLMA 5D7FA 3SG6A 1M39A 1NPQA 1OMDA 1TIZA 2KHNA 2LE9B 2BAPA 1KFXL 4C0LA 1EXRA 1NX1A 1JUOA 3S0GA 3PJIA 1B4CA 3PALA 2K7OA 4GAOA 4GGNA 2LVKA 3K1EA 1CMFA 1H4BA 5KSZA 1PALA 2P6BB 5CSIA 3D74A 3K21A 5HKYA 2JWWA 1V1FA 2JC2A 3FWBA 1SBJA 1CMGA 2YGUA 3O4YA 1SRAA 3FWCA 3OB2B 3EK4A 5DICA 3KO0A 1F4QA 1AUIB 1UHIA 1LVCD 1PRWA 1Y1AA 4C0KA 4C0JA 3O78A 1TOPA 4A4CA 1SCMB 3PM8A 1ODBA 2WORA 2ERBA 3S0BA 1NSHA 2BE4A 3D0YB 4MVFA 1JFJA 2KPHA 2MBXA 1CFFA 1XK4C 2LCPA 4I5KA 4D1EA 1H8BA 1BG1A 2JPTA 3CR2A 5CSFA 1LXFC 2WCBA 4ICBA 5CSNA 1F70A 2GTEA 2KFFA 1C3YA 3I5FB 2LVIA 5FI7A 1N65A 2KFGA 4ORBB 3SIAA 2LNKA 5AERA 3EVUA 3ZNIA 2ZN8A 2KI6C 4MRYA 2H8VA 3LCPC 5I2QA 1JFKA 1CNPA 1WDCB 3VGOA 2H61C 5D3OA 3NSOA 2WNDA 1WLZA 5PALA 4F0ZB 3CR4X 1UHNA 3AAJA 1XYDA 1DGVA 2AAOA 3KHEA 1B47A 2ISDA 1S6JA 2KQ6A 3OB1B 3KF9A 3CZTX 2QDIA 2WOSA 1SY9A 1YX7A 1V1GA
chains in the Genus database with same CATH topology
1IGVA 5IBWA 1OQPA 2HPSA 1C7WA 2M29A 1L2OB 1UHHA 3MSEB 1NYAA 2JTZA 1JF2A 1S1EA 3LK1A 1TN4A 4N5XA 4TNCA 1JWDA 1SK6D 1B8RA 1SCMC 4Q04A 2BECA 3TDUA 2LANA 1KFUS 2LAPA 4YGCB 2IS9A 4QJ3B 4PE4A 4YI9A 1RWYA 2I94A 1CLMA 1B9AA 1KQVA 1ALVA 5HKZA 5I2OA 1DF0A 2CNPA 1BT6A 2KI4B 1QLKA 1SL7A 4HRGA 1KFXS 4QJ5B 1CFCA 1UHKA 2ZRTA 4DRWA 2PSRA 2SASA 1MXEA 1WDCC 1WRKA 3EVVA 3OHMB 1A2XA 2KQYA 3AAKA 1DGUA 2K61A 2JU0A 3CTNA 3BUWB 1DJYA 1ZUZA 1PSRA 3NSKA 1QLSA 1TTXA 3SG2A 2LLUA 4OR9B 3SG5A 1Y1XA 3M0WA 4XYNA 2EGDA 4GGFA 2HF5A 4I5NB 2KOTA 3ZWHA 2Y4QA 1M46A 1IWQA 2MHHA 2CTNA 4M2PA 2L4IA 3AKBA 4IL1A 3GOFA 1W7IB 2BBMA 1MF8B 4MN0A 1OZSA 4DIRA 2MRDA 5DKNA 1RTP1 2EC6B 3FIAA 2M8UA 2HETA 2HQWA 4AQIA 1XFVO 5J3XA 1BJFA 4M2OA 1KFUL 2MA2A 1J7PA 4YGBB 4YRUA 2JOJA 1AJ4A 4P5OE 2FOTA 3BOWA 4U8DA 2KI4C 4XJKA 1S5GY 1ZACA 1RROA 2JXLA 4MBEA 5AXIA 3I5HB 2ZNDA 3DF0A 1K9KA 5G08A 2LUXA 1NX3A 2F8PA 4HRHA 2NLNA 1IJ5A 1VRKA 2L4HA 2FCEA 1L7ZA 1MHOA 1AHRA 4JPZB 2M49B 4PDZA 1B8LA 2JNXA 3SG3A 3WHTB 1KQMC 1TNQA 2K8MB 1U5IA 4L9MA 2KSPA 3I5IC 3VRPA 4PHJA 2WCFA 1NCYA 2ZNEA 2LV7A 1FPWA 1YUTA 2K7BA 2Y5IA 1KSOA 1SNLA 2JZIA 4CIDA 2PRUA 5HKWA 2E30A 2O5GA 3BUNB 1Q80A 5D69A 3VRRA 3WXAA 1QV0A 2JT3A 2LM5A 2Y1MA 2M9GA 2EC6C 5I2LA 4DCKA 2K0JA 4WQ2A 3JVTB 1DTLA 4CPVA 1YX8A 1EJ3A 1C07A 5GQQC 2F3ZA 3TZ1A 1WRLA 1S6IA 3SIBA 3BYAA 1K96A 1K93D 1UP5A 1HT9A 5AEQA 1DF0B 1YTZC 5AANA 2M1KB 3O2PA 3LLEA 1B1GA 2E6WA 2K7DA 4DS7A 2K2FA 3I5HC 3O6BA 2G2BA 1LKJA 1M45A 2BBNA 2LP2A 2OPOA 3BUMB 1KK7Y 1CDMA 4JQ0D 2Q91A 2CCMA 2KGRA 2Q4UA 3EKHA 1RECA 3BUOB 2BCAA 1XVJA 1NIWA 1QV1A 4WQ3A 3PN7B 2PALA 1YVHA 2JNFA 5CSJA 4MRXA 1DJXA 2LMVA 1IKUA 5CPVA 2LHLA 1OOJA 2KAXA 2KBMA 3DVJA 1PSBA 1DJIA 1SR6B 2M0RA 2CBLA 1IRJA 1NUBA 2MLEC 2PMYA 2AMIA 3VRQA 4E68A 2M3WA 1J55A 4OCIA 2JT0A 4YGEB 5ER4X 4MEWA 4AQJA 3FS7A 2JRFA 1SMGA 4NDDA 2BL0B 2D8NA 3DVMA 1EH2A 4NDBA 4MZLA 2JQ6A 1YR5A 1FW4A 2LVJA 3I5FC 2NCOA 3CGAA 1F4OA 2KYFA 3JVTC 2OS8B 1NCXA 1GJYA 4MZKA 3QRXA 4YI8A 1KK8B 1UUSA 3HX4A 2F2OA 5HYDA 1QIVA 3AKAA 3BOWB 3BQ3A 1W7JB 1N0YA 3NSIA 1S6CA 2H2KA 4GNKB 3OP0A 5JJGA 4I5LB 2RGIA 1QX2A 3CS1A 4XJKB 1BF5A 1YUUA 4ZCUA 1Y1UA 2Y1NA 1F71A 1M63B 3GK4X 1DMOA 1J7RA 2CXJA 1DJZA 1G33A 1SPYA 3DF0B 4MSPA 1DVIA 2JULA 1S26D 1NP8A 3JTDB 2HQ8A 1JC2A 4NDCA 1L2OC 2KAVA 3F45A 3PN7C 2NXQA 1BOCA 3WHUB 4ETOA 1U5IB 3KEVA 4GGFC 1D1OA 3WNXB 3SG4A 3TDZA 2JXCA 4N1FA 1AK8A 2BKHB 1KSMA 1CFDA 1XFUO 2GGZA 4GPLB 4R1EA 5ER5A 4ORAB 2KYCA 2BL0C 1KCYA 5KU1A 1LA0A 4PCWA 4PHMA 2NCPA 1BR1B 1BLQA 2MJWB 2G9BA 3BXKA 2F33A 3A8RA 1XFWO 1K94A 4BY4A 1RJVA 1JSAA 2R2IA 2L0PA 2OS8C 3GK2A 2LMTA 2L50A 1QVIY 1R6PA 2KDHA 1K9PA 4ORCB 1KK8C 1OMVA 3GK1A 1CDPA 4BY5A 1YURA 1CM4A 4OKHA 3IF7A 2LUCA 3EKJA 4OVNF 1DJWA 2ZFDA 1KK7Z 2I18A 3NSLA 4GUKA 3SJSA 2ZN9A 1B7TY 4CLNA 1GGWA 1CM1A 1PVBA 1E8AA 1K9UA 1EG3A 1XFYO 2JTTA 1CLBA 1ZOTB 4GBAA 2GV5A 3PSRA 1NX0A 1B8CA 1QATA 1QXPA 2LLSA 2JT8A 4M2QA 1DT7B 1TNWA 4FQOA 4DUQA 3EK7A 2MAZA 2M7NA 1NWDA 2KGBC 5DKRA 1RK9A 1UHJA 2I2RE 3KPXA 2PASA 2SCPA 3BUXB 2KBIA 5HLVA 1RFJA 2V53A 1LINA 3NXAA 4FTGA 1M31A 1DJGA 1J1EA 3TUYB 5BPJA 2K2AA 1SW8A 1IQ5A 3LK0A 2TN4A 1MWNA 1AP4A 3DVKA 2F3YA 4HSZA 1WY9A 4YGDB 1XK4A 1CLLA 2BCBA 1OZOA 2LLTA 1FF1A 2WC8A 1QJTA 2EHBA 2KFHA 1AJ5A 1NCZA 1FBVA 4N1GA 1IQ3A 4YGAA 1YVLA 1IG5A 2A4JA 3DD4A 3DVEA 4HREE 1TCOB 1TNPA 4PE7A 1IH0A 4JWQA 1EG4A 3I5GB 5FYXA 1F8HA 2CT9A 1MXLC 1MQ1A 1XFXO 3TS5B 1BODA 2L5XB 1C7VA 1TNXA 4GFTA 3RLZA 1KWOB 2FJUB 2H61A 1A75A 2B1UA 1A4PA 1K95A 2NZ0A 5F6TA 2O60A 1FI5A 2M7LA 1WRZA 2QPTA 2LMUA 1CDNA 2MLFC 5B8IB 1JBAA 1R2UA 4MZJA 4WRIA 2K7CA 5K89A 4A4BA 1YUSA 2BCXA 5AFPA 2AUCA 1SCVA 2M97A 1AVSA 1QASA 3LL8B 3OX6A 5TNCA 1JF0A 4CFRA 1S3PA 5I8NA 1ALWA 2KNEA 2DOQA 3TUYC 3IQQA 4ZCVA 3SG7A 1MR8A 2KAYA 1EL4A 3A4UB 3D0YA 1CKKA 1QTXA 1S5GZ 1UWOA 1QVIZ 4P2YB 1F55A 4UPGA 3TDIA 1Y0VH 2WCEA 1A29A 1SKTA 2VRGA 4OV2A 1LA3A 1J7QA 3I5GC 3VROA 2LHIA 3PLFB 1B7TZ 3TS5C 2LP3A 1X02A 4QJ4B 2GGMA 1KWOC 1A03A 2PVBA 1CDLA 3HCMA 1XFZO 3PFVA 4PE1A 2OTGB 1MUXA 2F2PA 3CWGA 1K8UA 4NQGA 4I5JA 1CTRA 5JOLA 5KTYA 1N2DA 1CFPA 2I7AA 3OX5A 1SR6C 1FI6A 1UURA 2LC5A 1TRFA 4USLA 1OMRA 5DKQA 4YBHB 4AOMA 2LVVA 1XA5A 3ICBA 3VRNA 1BU3A 1KQMB 4PE0A 2L2EA 4PHKA 1Y6WA 1J1DA 1QS7A 1S36A 3I5IB 1PK0D 1K2HA 2ZRSA 1CB1A 1BMOA 1SL9A 1PVAA 3D10A 1GQMA 1YRUB 1PULA 1G4YR 3RM1A 1ZMZA 2BKIB 1NX2A 3PATA 1QIWA 3IQOA 1YRTB 2L51A 1ZFSA 3CLNA 4MLWA 1SL8A 1HQVA 2M1UA 3E3RA 4PHNA 4PALA 3H4SE 1BR4B 2FCDA 2QACA 1QX7A 1XO5A 1DJHA 2COLB 2BE6A 1OE9B 2KI6D 2ZKMX 3C1VA 1F54A 2L98A 3EVRA 1OSAA 1QX5B 1SYMA 2OTGC 1K90D 3CR5X 3JTDC 1A75B 5HLOA 1J7OA 1IJ6A 1G8IA 3EK8A 4CFQA 1GGZA 1TCFA 1WLMA 5D7FA 3SG6A 1M39A 1NPQA 1OMDA 1TIZA 2KHNA 2LE9B 4C0LA 1KFXL 1EXRA 1NX1A 1JUOA 1B4CA 3PALA 2K7OA 4GAOA 4GGNA 2LVKA 1CMFA 1H4BA 5KSZA 1PALA 2P6BB 5CSIA 3K21A 5HKYA 2JWWA 1V1FA 2JC2A 3FWBA 1SBJA 1CMGA 3O4YA 1SRAA 3FWCA 3OB2B 3EK4A 3KO0A 1F4QA 1AUIB 1UHIA 1LVCD 1PRWA 1Y1AA 4C0KA 4C0JA 3O78A 1TOPA 4A4CA 1SCMB 3PM8A 1ODBA 2WORA 1NSHA 2BE4A 3D0YB 4MVFA 1JFJA 2MBXA 1CFFA 1XK4C 2LCPA 4I5KA 4D1EA 1H8BA 1BG1A 2JPTA 3CR2A 5CSFA 1LXFC 2WCBA 4ICBA 5CSNA 1F70A 2KFFA 3I5FB 2LVIA 1N65A 2KFGA 4ORBB 3SIAA 2LNKA 5AERA 3EVUA 3ZNIA 2ZN8A 2KI6C 4MRYA 3LCPC 5I2QA 1JFKA 1CNPA 1WDCB 3VGOA 2H61C 3NSOA 2WNDA 1WLZA 5PALA 4F0ZB 3CR4X 1UHNA 3AAJA 1XYDA 1DGVA 2AAOA 3KHEA 1B47A 2ISDA 1S6JA 2KQ6A 3OB1B 3KF9A 3CZTX 2WOSA 1SY9A 1YX7A 1V1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGV A;  5IBW A;  1OQP A;  2HPS A;  1C7W A;  2M29 A;  1L2O B;  1UHH A;  3MSE B;  1NYA A;  2JTZ A;  1JF2 A;  1S1E A;  3LK1 A;  1TN4 A;  4N5X A;  4TNC A;  1JWD A;  1SK6 D;  1B8R A;  1SCM C;  4Q04 A;  2BEC A;  3TDU A;  2LAN A;  1KFU S;  2LAP A;  4YGC B;  2IS9 A;  4QJ3 B;  4PE4 A;  4YI9 A;  1RWY A;  2I94 A;  1CLM A;  1B9A A;  1KQV A;  1ALV A;  5HKZ A;  5I2O A;  1DF0 A;  2CNP A;  1BT6 A;  2KI4 B;  1QLK A;  1SL7 A;  4HRG A;  1KFX S;  4QJ5 B;  1CFC A;  1UHK A;  2ZRT A;  4DRW A;  2PSR A;  2SAS A;  1MXE A;  1WDC C;  1WRK A;  3EVV A;  3OHM B;  1A2X A;  2KQY A;  3AAK A;  1DGU A;  2K61 A;  2JU0 A;  3CTN A;  3BUW B;  1DJY A;  1ZUZ A;  1PSR A;  3NSK A;  1QLS A;  1TTX A;  3SG2 A;  2LLU A;  4OR9 B;  3SG5 A;  1Y1X A;  3M0W A;  4XYN A;  2EGD A;  4GGF A;  2HF5 A;  4I5N B;  2KOT A;  3ZWH A;  2Y4Q A;  1M46 A;  1IWQ A;  2MHH A;  2CTN A;  4M2P A;  2L4I A;  3AKB A;  4IL1 A;  3GOF A;  1W7I B;  2BBM A;  1MF8 B;  4MN0 A;  1OZS A;  4DIR A;  2MRD A;  5DKN A;  1RTP 1;  2EC6 B;  3FIA A;  2M8U A;  2HET A;  2HQW A;  4AQI A;  1XFV O;  5J3X A;  1BJF A;  4M2O A;  1KFU L;  2MA2 A;  1J7P A;  4YGB B;  4YRU A;  2JOJ A;  1AJ4 A;  4P5O E;  2FOT A;  3BOW A;  4U8D A;  2KI4 C;  4XJK A;  1S5G Y;  1ZAC A;  1RRO A;  2JXL A;  4MBE A;  5AXI A;  3I5H B;  2ZND A;  3DF0 A;  1K9K A;  5G08 A;  2LUX A;  1NX3 A;  2F8P A;  4HRH A;  2NLN A;  1IJ5 A;  1VRK A;  2L4H A;  2FCE A;  1L7Z A;  1MHO A;  1AHR A;  4JPZ B;  2M49 B;  4PDZ A;  1B8L A;  2JNX A;  3SG3 A;  3WHT B;  1KQM C;  1TNQ A;  2K8M B;  1U5I A;  4L9M A;  2KSP A;  3I5I C;  3VRP A;  4PHJ A;  2WCF A;  1NCY A;  2ZNE A;  2LV7 A;  1FPW A;  1YUT A;  2K7B A;  2Y5I A;  1KSO A;  1SNL A;  2JZI A;  4CID A;  2PRU A;  5HKW A;  2E30 A;  2O5G A;  3BUN B;  1Q80 A;  5D69 A;  3VRR A;  3WXA A;  1QV0 A;  2JT3 A;  2LM5 A;  2Y1M A;  2M9G A;  2EC6 C;  5I2L A;  4DCK A;  2K0J A;  4WQ2 A;  3JVT B;  1DTL A;  4CPV A;  1YX8 A;  1EJ3 A;  1C07 A;  5GQQ C;  2F3Z A;  3TZ1 A;  1WRL A;  1S6I A;  3SIB A;  3BYA A;  1K96 A;  1K93 D;  1UP5 A;  1HT9 A;  5AEQ A;  1DF0 B;  1YTZ C;  5AAN A;  2M1K B;  3O2P A;  3LLE A;  1B1G A;  2E6W A;  2K7D A;  4DS7 A;  2K2F A;  3I5H C;  3O6B A;  2G2B A;  1LKJ A;  1M45 A;  2BBN A;  2LP2 A;  2OPO A;  3BUM B;  1KK7 Y;  1CDM A;  4JQ0 D;  2Q91 A;  2CCM A;  2KGR A;  2Q4U A;  3EKH A;  1REC A;  3BUO B;  2BCA A;  1XVJ A;  1NIW A;  1QV1 A;  4WQ3 A;  3PN7 B;  2PAL A;  1YVH A;  2JNF A;  5CSJ A;  4MRX A;  1DJX A;  2LMV A;  1IKU A;  5CPV A;  2LHL A;  1OOJ A;  2KAX A;  2KBM A;  3DVJ A;  1PSB A;  1DJI A;  1SR6 B;  2M0R A;  2CBL A;  1IRJ A;  1NUB A;  2MLE C;  2PMY A;  2AMI A;  3VRQ A;  4E68 A;  2M3W A;  1J55 A;  4OCI A;  2JT0 A;  4YGE B;  5ER4 X;  4MEW A;  4AQJ A;  3FS7 A;  2JRF A;  1SMG A;  4NDD A;  2BL0 B;  2D8N A;  3DVM A;  1EH2 A;  4NDB A;  4MZL A;  2JQ6 A;  1YR5 A;  1FW4 A;  2LVJ A;  3I5F C;  2NCO A;  3CGA A;  1F4O A;  2KYF A;  3JVT C;  2OS8 B;  1NCX A;  1GJY A;  4MZK A;  3QRX A;  4YI8 A;  1KK8 B;  1UUS A;  3HX4 A;  2F2O A;  5HYD A;  1QIV A;  3AKA A;  3BOW B;  3BQ3 A;  1W7J B;  1N0Y A;  3NSI A;  1S6C A;  2H2K A;  4GNK B;  3OP0 A;  5JJG A;  4I5L B;  2RGI A;  1QX2 A;  3CS1 A;  4XJK B;  1BF5 A;  1YUU A;  4ZCU A;  1Y1U A;  2Y1N A;  1F71 A;  1M63 B;  3GK4 X;  1DMO A;  1J7R A;  2CXJ A;  1DJZ A;  1G33 A;  1SPY A;  3DF0 B;  4MSP A;  1DVI A;  2JUL A;  1S26 D;  1NP8 A;  3JTD B;  2HQ8 A;  1JC2 A;  4NDC A;  1L2O C;  2KAV A;  3F45 A;  3PN7 C;  2NXQ A;  1BOC A;  3WHU B;  4ETO A;  1U5I B;  3KEV A;  4GGF C;  1D1O A;  3WNX B;  3SG4 A;  3TDZ A;  2JXC A;  4N1F A;  1AK8 A;  2BKH B;  1KSM A;  1CFD A;  1XFU O;  2GGZ A;  4GPL B;  4R1E A;  5ER5 A;  4ORA B;  2KYC A;  2BL0 C;  1KCY A;  5KU1 A;  1LA0 A;  4PCW A;  4PHM A;  2NCP A;  1BR1 B;  1BLQ A;  2MJW B;  2G9B A;  3BXK A;  2F33 A;  3A8R A;  1XFW O;  1K94 A;  4BY4 A;  1RJV A;  1JSA A;  2R2I A;  2L0P A;  2OS8 C;  3GK2 A;  2LMT A;  2L50 A;  1QVI Y;  1R6P A;  2KDH A;  1K9P A;  4ORC B;  1KK8 C;  1OMV A;  3GK1 A;  1CDP A;  4BY5 A;  1YUR A;  1CM4 A;  4OKH A;  3IF7 A;  2LUC A;  3EKJ A;  4OVN F;  1DJW A;  2ZFD A;  1KK7 Z;  2I18 A;  3NSL A;  4GUK A;  3SJS A;  2ZN9 A;  1B7T Y;  4CLN A;  1GGW A;  1CM1 A;  1PVB A;  1E8A A;  1K9U A;  1EG3 A;  1XFY O;  2JTT A;  1CLB A;  1ZOT B;  4GBA A;  2GV5 A;  3PSR A;  1NX0 A;  1B8C A;  1QAT A;  1QXP A;  2LLS A;  2JT8 A;  4M2Q A;  1DT7 B;  1TNW A;  4FQO A;  4DUQ A;  3EK7 A;  2MAZ A;  2M7N A;  1NWD A;  2KGB C;  5DKR A;  1RK9 A;  1UHJ A;  2I2R E;  3KPX A;  2PAS A;  2SCP A;  3BUX B;  2KBI A;  5HLV A;  1RFJ A;  2V53 A;  1LIN A;  3NXA A;  4FTG A;  1M31 A;  1DJG A;  1J1E A;  3TUY B;  5BPJ A;  2K2A A;  1SW8 A;  1IQ5 A;  3LK0 A;  2TN4 A;  1MWN A;  1AP4 A;  3DVK A;  2F3Y A;  4HSZ A;  1WY9 A;  4YGD B;  1XK4 A;  1CLL A;  2BCB A;  1OZO A;  2LLT A;  1FF1 A;  2WC8 A;  1QJT A;  2EHB A;  2KFH A;  1AJ5 A;  1NCZ A;  1FBV A;  4N1G A;  1IQ3 A;  4YGA A;  1YVL A;  1IG5 A;  2A4J A;  3DD4 A;  3DVE A;  4HRE E;  1TCO B;  1TNP A;  4PE7 A;  1IH0 A;  4JWQ A;  1EG4 A;  3I5G B;  5FYX A;  1F8H A;  2CT9 A;  1MXL C;  1MQ1 A;  1XFX O;  3TS5 B;  1BOD A;  2L5X B;  1C7V A;  1TNX A;  4GFT A;  3RLZ A;  1KWO B;  2FJU B;  2H61 A;  1A75 A;  2B1U A;  1A4P A;  1K95 A;  2NZ0 A;  5F6T A;  2O60 A;  1FI5 A;  2M7L A;  1WRZ A;  2QPT A;  2LMU A;  1CDN A;  2MLF C;  5B8I B;  1JBA A;  1R2U A;  4MZJ A;  4WRI A;  2K7C A;  5K89 A;  4A4B A;  1YUS A;  2BCX A;  5AFP A;  2AUC A;  1SCV A;  2M97 A;  1AVS A;  1QAS A;  3LL8 B;  3OX6 A;  5TNC A;  1JF0 A;  4CFR A;  1S3P A;  5I8N A;  1ALW A;  2KNE A;  2DOQ A;  3TUY C;  3IQQ A;  4ZCV A;  3SG7 A;  1MR8 A;  2KAY A;  1EL4 A;  3A4U B;  3D0Y A;  1CKK A;  1QTX A;  1S5G Z;  1UWO A;  1QVI Z;  4P2Y B;  1F55 A;  4UPG A;  3TDI A;  1Y0V H;  2WCE A;  1A29 A;  1SKT A;  2VRG A;  4OV2 A;  1LA3 A;  1J7Q A;  3I5G C;  3VRO A;  2LHI A;  3PLF B;  1B7T Z;  3TS5 C;  2LP3 A;  1X02 A;  4QJ4 B;  2GGM A;  1KWO C;  1A03 A;  2PVB A;  1CDL A;  3HCM A;  1XFZ O;  3PFV A;  4PE1 A;  2OTG B;  1MUX A;  2F2P A;  3CWG A;  1K8U A;  4NQG A;  4I5J A;  1CTR A;  5JOL A;  5KTY A;  1N2D A;  1CFP A;  2I7A A;  3OX5 A;  1SR6 C;  1FI6 A;  1UUR A;  2LC5 A;  1TRF A;  4USL A;  1OMR A;  5DKQ A;  4YBH B;  4AOM A;  2LVV A;  1XA5 A;  3ICB A;  3VRN A;  1BU3 A;  1KQM B;  4PE0 A;  2L2E A;  4PHK A;  1Y6W A;  1J1D A;  1QS7 A;  1S36 A;  3I5I B;  1PK0 D;  1K2H A;  2ZRS A;  1CB1 A;  1BMO A;  1SL9 A;  1PVA A;  3D10 A;  1GQM A;  1YRU B;  1PUL A;  1G4Y R;  3RM1 A;  1ZMZ A;  2BKI B;  1NX2 A;  3PAT A;  1QIW A;  3IQO A;  1YRT B;  2L51 A;  1ZFS A;  3CLN A;  4MLW A;  1SL8 A;  1HQV A;  2M1U A;  3E3R A;  4PHN A;  4PAL A;  3H4S E;  1BR4 B;  2FCD A;  2QAC A;  1QX7 A;  1XO5 A;  1DJH A;  2COL B;  2BE6 A;  1OE9 B;  2KI6 D;  2ZKM X;  3C1V A;  1F54 A;  2L98 A;  3EVR A;  1OSA A;  1QX5 B;  1SYM A;  2OTG C;  1K90 D;  3CR5 X;  3JTD C;  1A75 B;  5HLO A;  1J7O A;  1IJ6 A;  1G8I A;  3EK8 A;  4CFQ A;  1GGZ A;  1TCF A;  1WLM A;  5D7F A;  3SG6 A;  1M39 A;  1NPQ A;  1OMD A;  1TIZ A;  2KHN A;  2LE9 B;  4C0L A;  1KFX L;  1EXR A;  1NX1 A;  1JUO A;  1B4C A;  3PAL A;  2K7O A;  4GAO A;  4GGN A;  2LVK A;  1CMF A;  1H4B A;  5KSZ A;  1PAL A;  2P6B B;  5CSI A;  3K21 A;  5HKY A;  2JWW A;  1V1F A;  2JC2 A;  3FWB A;  1SBJ A;  1CMG A;  3O4Y A;  1SRA A;  3FWC A;  3OB2 B;  3EK4 A;  3KO0 A;  1F4Q A;  1AUI B;  1UHI A;  1LVC D;  1PRW A;  1Y1A A;  4C0K A;  4C0J A;  3O78 A;  1TOP A;  4A4C A;  1SCM B;  3PM8 A;  1ODB A;  2WOR A;  1NSH A;  2BE4 A;  3D0Y B;  4MVF A;  1JFJ A;  2MBX A;  1CFF A;  1XK4 C;  2LCP A;  4I5K A;  4D1E A;  1H8B A;  1BG1 A;  2JPT A;  3CR2 A;  5CSF A;  1LXF C;  2WCB A;  4ICB A;  5CSN A;  1F70 A;  2KFF A;  3I5F B;  2LVI A;  1N65 A;  2KFG A;  4ORB B;  3SIA A;  2LNK A;  5AER A;  3EVU A;  3ZNI A;  2ZN8 A;  2KI6 C;  4MRY A;  3LCP C;  5I2Q A;  1JFK A;  1CNP A;  1WDC B;  3VGO A;  2H61 C;  3NSO A;  2WND A;  1WLZ A;  5PAL A;  4F0Z B;  3CR4 X;  1UHN A;  3AAJ A;  1XYD A;  1DGV A;  2AAO A;  3KHE A;  1B47 A;  2ISD A;  1S6J A;  2KQ6 A;  3OB1 B;  3KF9 A;  3CZT X;  2WOS A;  1SY9 A;  1YX7 A;  1V1G A; 
#chains in the Genus database with same CATH topology
 1IGV A;  5IBW A;  1OQP A;  2HPS A;  1C7W A;  1OOF A;  2M29 A;  1L2O B;  1UHH A;  3MSE B;  1NYA A;  2JTZ A;  3D75 A;  1JF2 A;  4OZD A;  1S1E A;  3LK1 A;  1TN4 A;  4N5X A;  4TNC A;  1JWD A;  1SK6 D;  1B8R A;  1SCM C;  4Q04 A;  2BEC A;  3TDU A;  2LAN A;  1KFU S;  2LAP A;  4YGC B;  2IS9 A;  4QJ3 B;  4PE4 A;  3BFB A;  2WC5 A;  5HL1 A;  4YI9 A;  1RWY A;  2I94 A;  1CLM A;  3CAB A;  3CYZ A;  1B9A A;  1KQV A;  1ALV A;  5HKZ A;  5I2O A;  1DF0 A;  2CNP A;  1BT6 A;  3R72 A;  2KI4 B;  1QLK A;  1SL7 A;  4HRG A;  1KFX S;  3DYE A;  4QJ5 B;  1UHK A;  1CFC A;  1IIO A;  2ZRT A;  4DRW A;  2PSR A;  2SAS A;  1MXE A;  1WDC C;  1WRK A;  3EVV A;  3OHM B;  1A2X A;  2KQY A;  3AAK A;  2BNX A;  2KLD A;  1DGU A;  2K61 A;  2JU0 A;  3CTN A;  3BUW B;  2WCJ A;  1DJY A;  1ZUZ A;  1PSR A;  3NSK A;  3R1V A;  4JKT A;  1QLS A;  1TTX A;  3SG2 A;  2LLU A;  4OR9 B;  5EL2 A;  3SG5 A;  1Y1X A;  3V2L A;  3M0W A;  4XYN A;  2QEO A;  2EGD A;  4GGF A;  2HF5 A;  4I5N B;  2KOT A;  3ZWH A;  2Y4Q A;  1M46 A;  1IWQ A;  2MHH A;  2CTN A;  4M2P A;  1OOH A;  2L4I A;  3AKB A;  3B7A A;  4IL1 A;  3GOF A;  1W7I B;  2BBM A;  2L5Y A;  1MF8 B;  4MN0 A;  1OZS A;  4DIR A;  1C3Z A;  2MRD A;  5DKN A;  3SS3 A;  1RTP 1;  2EC6 B;  3SS5 A;  3FIA A;  2M8U A;  2HET A;  2HQW A;  4AQI A;  1XFV O;  5J3X A;  1BJF A;  4M2O A;  1KFU L;  1LS8 A;  2MA2 A;  1J7P A;  4YGB B;  4YRU A;  2JOJ A;  1AJ4 A;  4P5O E;  2FOT A;  2JPO A;  3BOW A;  4U8D A;  4INX A;  2KI4 C;  4XJK A;  1S5G Y;  1ZAC A;  3DZT A;  1RRO A;  2JXL A;  4MBE A;  1P28 A;  3EG5 B;  3I5H B;  5AXI A;  2ZND A;  3DF0 A;  1K9K A;  5G08 A;  2LUX A;  1NX3 A;  2F8P A;  4HRH A;  2NLN A;  1IJ5 A;  1VRK A;  2L4H A;  2FCE A;  1L7Z A;  1MHO A;  1AHR A;  4JPZ B;  2M49 B;  4PDZ A;  3RZS A;  1B8L A;  2JNX A;  3SG3 A;  3WHT B;  1KQM C;  3NHI A;  1TNQ A;  2K8M B;  1U5I A;  4L9M A;  2KSP A;  3I5I C;  1OW4 A;  3S0D A;  3VRP A;  4PHJ A;  2WCF A;  1NCY A;  2ZNE A;  2LV7 A;  1FPW A;  1YUT A;  2K7B A;  2Y5I A;  1KSO A;  1SNL A;  5FI2 A;  2JZI A;  3R1P A;  4CID A;  2PRU A;  4FQT A;  5HKW A;  2E30 A;  2O5G A;  3BUN B;  1Q80 A;  5D69 A;  3VRR A;  3WXA A;  1QV0 A;  2JT3 A;  2LM5 A;  2Y1M A;  3D78 A;  2M9G A;  1OOI X;  2EC6 C;  5I2L A;  4DCK A;  1OOG A;  2K0J A;  3B87 A;  4WQ2 A;  3JVT B;  1DTL A;  4CPV A;  1YX8 A;  1EJ3 A;  1C07 A;  5GQQ C;  2F3Z A;  3OGN A;  1WRL A;  3TZ1 A;  1S6I A;  3SIB A;  3BYA A;  1K96 A;  4F7F A;  2QEH A;  1K93 D;  1UP5 A;  1HT9 A;  5AEQ A;  1DF0 B;  1YTZ C;  5AAN A;  2M1K B;  3NHT A;  3O2P A;  3LLE A;  3D73 A;  1B1G A;  2E6W A;  2K7D A;  4DS7 A;  2K2F A;  3I5H C;  3O6B A;  2G2B A;  1LKJ A;  1M45 A;  2BBN A;  2LP2 A;  2OPO A;  3S0E A;  3BUM B;  1KK7 Y;  1CDM A;  4JQ0 D;  2Q91 A;  2CCM A;  2KGR A;  2Q4U A;  3EKH A;  1REC A;  3BUO B;  2BCA A;  1XVJ A;  1NIW A;  1QV1 A;  4WQ3 A;  3PN7 B;  2PAL A;  1YVH A;  1SSE B;  2JNF A;  5CSJ A;  4MRX A;  1DJX A;  2LMV A;  1IKU A;  5CPV A;  2LHL A;  1OOJ A;  2KAX A;  2KBM A;  3DVJ A;  1PSB A;  1DJI A;  1SR6 B;  2M0R A;  2CBL A;  1IRJ A;  1NUB A;  2MLE C;  2PMY A;  2AMI A;  3BJH A;  3DXL A;  3VRQ A;  2M3W A;  1J55 A;  2FJY A;  4OCI A;  5FI6 A;  2JT0 A;  4YGE B;  5ER4 X;  4MEW A;  4AQJ A;  3FS7 A;  2JRF A;  1SMG A;  4NDD A;  2BL0 B;  2D8N A;  3DVM A;  1EH2 A;  4NDB A;  4MZL A;  2JQ6 A;  4JD9 A;  1YR5 A;  1FW4 A;  2LVJ A;  2QEV A;  3I5F C;  3R1O A;  2NCO A;  3CGA A;  1F4O A;  2KYF A;  2WCK A;  3S0A A;  3JVT C;  2OS8 B;  1NCX A;  1GJY A;  4MZK A;  3QRX A;  4YI8 A;  3VB1 A;  1KK8 B;  1UUS A;  2WCL A;  2WCM A;  2F2O A;  3HX4 A;  5HYD A;  1QIV A;  3AKA A;  3BOW B;  3BQ3 A;  1W7J B;  1N0Y A;  3NSI A;  1S6C A;  2H2K A;  4GNK B;  3UNW A;  3OP0 A;  5JJG A;  4I5L B;  2RGI A;  1QX2 A;  3CS1 A;  4XJK B;  1BF5 A;  1YUU A;  4ZCU A;  1Y1U A;  2Y1N A;  1F71 A;  1M63 B;  3GK4 X;  1DMO A;  1J7R A;  2CXJ A;  1DJZ A;  1G33 A;  1SPY A;  3D76 A;  3DF0 B;  4MSP A;  1DVI A;  2JUL A;  1S26 D;  1NP8 A;  3BFA A;  2HQ8 A;  3JTD B;  3OBV A;  1JC2 A;  4NDC A;  1L2O C;  2KAV A;  3CZ1 A;  2K60 A;  3F45 A;  4E68 A;  3PN7 C;  2NXQ A;  1BOC A;  3WHU B;  4ETO A;  1U5I B;  3IVT A;  3KEV A;  4GGF C;  1D1O A;  3WNX B;  3SG4 A;  3TDZ A;  2JXC A;  4N1F A;  1AK8 A;  1XFR A;  2BKH B;  3L47 A;  1KSM A;  1CFD A;  1XFU O;  2GGZ A;  4GPL B;  4R1E A;  3UO9 A;  5ER5 A;  4ORA B;  2KYC A;  2BL0 C;  1KCY A;  5KU1 A;  1LA0 A;  4PCW A;  1DEK A;  2NCP A;  4PHM A;  1BR1 B;  1BLQ A;  2MJW B;  2G9B A;  3B86 A;  2F33 A;  3BXK A;  3A8R A;  1XFW O;  1K94 A;  4BY4 A;  1RJV A;  1JSA A;  2R2I A;  2L0P A;  2OS8 C;  3GK2 A;  2LMT A;  3SS4 A;  2L50 A;  1QVI Y;  1R6P A;  2KDH A;  1K9P A;  4ORC B;  1KK8 C;  1OMV A;  2P71 A;  3CZ2 A;  1CDP A;  3GK1 A;  4BY5 A;  1YUR A;  1CM4 A;  4IJ7 A;  3IF7 A;  4OKH A;  2LUC A;  3EKJ A;  4OVN F;  3B88 A;  1DJW A;  2ZFD A;  1KK7 Z;  2I18 A;  3NSL A;  4GUK A;  3SJS A;  2ZN9 A;  1B7T Y;  3FE9 A;  4CLN A;  1GGW A;  1CM1 A;  3BFH A;  1PVB A;  1E8A A;  1K9U A;  1EG3 A;  1XFY O;  2JTT A;  1TUZ A;  2L2C A;  1CLB A;  1ZOT B;  4GBA A;  2GV5 A;  3PSR A;  3DY9 A;  1NX0 A;  1B8C A;  1QAT A;  1QXP A;  2LLS A;  2JT8 A;  4M2Q A;  1DT7 B;  1TNW A;  4FQO A;  4DUQ A;  3EK7 A;  2MAZ A;  2M7N A;  1NWD A;  2KGB C;  5DKR A;  1RK9 A;  1UHJ A;  2I2R E;  3KPX A;  2PAS A;  2SCP A;  1Z4H A;  2KBI A;  3BUX B;  3CZ0 A;  1RFJ A;  2P70 A;  2V53 A;  5HLV A;  1LIN A;  2QEB A;  3NXA A;  4FTG A;  1M31 A;  1DJG A;  1J1E A;  3TUY B;  5BPJ A;  2K2A A;  1SW8 A;  1IQ5 A;  1QWV A;  2PQL A;  3LK0 A;  2TN4 A;  1MWN A;  1AP4 A;  3DVK A;  2F3Y A;  4HSZ A;  1ORG A;  1WY9 A;  4YGD B;  1XK4 A;  1CLL A;  2BCB A;  1OZO A;  2LLT A;  1FF1 A;  2WC8 A;  1QJT A;  2EHB A;  2KFH A;  1AJ5 A;  1NCZ A;  1FBV A;  4N1G A;  1IQ3 A;  4YGA A;  1YVL A;  1IG5 A;  2A4J A;  3DD4 A;  3DVE A;  4HRE E;  1TCO B;  1TNP A;  4PE7 A;  1IH0 A;  4JWQ A;  2KLE A;  1EG4 A;  3I5G B;  5FYX A;  3Q8I A;  4PT1 A;  1MXL C;  2CT9 A;  1MQ1 A;  1XFX O;  3TS5 B;  1BOD A;  1F8H A;  2L5X B;  1C7V A;  1TNX A;  4GFT A;  3RLZ A;  1KWO B;  3NGV A;  2FJU B;  2H61 A;  3L4A A;  1A75 A;  2B1U A;  1A4P A;  1K95 A;  2NZ0 A;  5F6T A;  2O60 A;  1FI5 A;  2M7L A;  1WRZ A;  2QPT A;  2LMU A;  1CDN A;  2MLF C;  5B8I B;  1JBA A;  4KYN A;  1DQE A;  1R2U A;  4MZJ A;  4WRI A;  2K7C A;  5K89 A;  4A4B A;  1T14 A;  1YUS A;  2BCX A;  5AFP A;  2AUC A;  1SCV A;  2M97 A;  2WC6 A;  1AVS A;  1QAS A;  3LL8 B;  3OX6 A;  5TNC A;  1JF0 A;  4CFR A;  1S3P A;  5I8N A;  1ALW A;  2KNE A;  2DOQ A;  3TUY C;  3IQQ A;  4ZCV A;  3SG7 A;  1MR8 A;  2KAY A;  1EL4 A;  3A4U B;  3D0Y A;  1CKK A;  1QTX A;  1S5G Z;  1UWO A;  1QVI Z;  4P2Y B;  1F55 A;  3L4L A;  4UPG A;  3TDI A;  1Y0V H;  2WCE A;  1A29 A;  1SKT A;  2VRG A;  1W9Z A;  4OV2 A;  1LA3 A;  2PYQ A;  1J7Q A;  3I5G C;  3VRO A;  2LHI A;  3PLF B;  1B7T Z;  3TS5 C;  2LP3 A;  1X02 A;  3O4X A;  4QJ4 B;  2GGM A;  1KWO C;  1A03 A;  2PVB A;  1CDL A;  1GM0 A;  3HCM A;  1XFZ O;  3PFV A;  4PE1 A;  2OTG B;  1TWO A;  1MUX A;  2F2P A;  3CWG A;  1K8U A;  3FE8 A;  4NQG A;  2WCH A;  3QME A;  4I5J A;  1CTR A;  5JOL A;  5I94 A;  5KTY A;  1N2D A;  1CFP A;  2I7A A;  3OX5 A;  1SR6 C;  1FI6 A;  1UUR A;  2LC5 A;  1TRF A;  1Z2C B;  4USL A;  1OMR A;  5DKQ A;  4YBH B;  4AOM A;  2LVV A;  1XA5 A;  3ICB A;  3VRN A;  1BU3 A;  1KQM B;  4PE0 A;  2L2E A;  4PHK A;  1Y6W A;  1J1D A;  1QS7 A;  1S36 A;  3I5I B;  1PK0 D;  1K2H A;  2ZRS A;  3N7H A;  1CB1 A;  1BMO A;  3D77 A;  1SL9 A;  1PVA A;  3D10 A;  1GQM A;  1YRU B;  1PUL A;  3B6X A;  1G4Y R;  3RM1 A;  1ZMZ A;  2BKI B;  1NX2 A;  3PAT A;  1QIW A;  3IQO A;  1YRT B;  2L51 A;  1ZFS A;  3CLN A;  4MLW A;  1SL8 A;  1HQV A;  1DEL A;  1DC1 A;  2M1U A;  3E3R A;  3CDN A;  4PHN A;  4PAL A;  3S0F A;  3H4S E;  1BR4 B;  2FCD A;  2QAC A;  1QX7 A;  3PM2 A;  1XO5 A;  3FE6 A;  1DJH A;  1TUJ A;  2COL B;  2BE6 A;  1OE9 B;  2KI6 D;  2ZKM X;  3C1V A;  1F54 A;  2L98 A;  3EVR A;  1OSA A;  1QX5 B;  1SYM A;  2OTG C;  1K90 D;  3CR5 X;  3JTD C;  1A75 B;  4INW A;  5HLO A;  1J7O A;  1IJ6 A;  1G8I A;  3EK8 A;  4CFQ A;  1GGZ A;  1TCF A;  1WLM A;  5D7F A;  3SG6 A;  1M39 A;  1NPQ A;  1OMD A;  1TIZ A;  2KHN A;  2LE9 B;  2BAP A;  1KFX L;  4C0L A;  1EXR A;  1NX1 A;  1JUO A;  3S0G A;  3PJI A;  1B4C A;  3PAL A;  2K7O A;  4GAO A;  4GGN A;  2LVK A;  3K1E A;  1CMF A;  1H4B A;  5KSZ A;  1PAL A;  2P6B B;  5CSI A;  3D74 A;  3K21 A;  5HKY A;  2JWW A;  1V1F A;  2JC2 A;  3FWB A;  1SBJ A;  1CMG A;  2YGU A;  3O4Y A;  1SRA A;  3FWC A;  3OB2 B;  3EK4 A;  5DIC A;  3KO0 A;  1F4Q A;  1AUI B;  1UHI A;  1LVC D;  1PRW A;  1Y1A A;  4C0K A;  4C0J A;  3O78 A;  1TOP A;  4A4C A;  1SCM B;  3PM8 A;  1ODB A;  2WOR A;  2ERB A;  3S0B A;  1NSH A;  2BE4 A;  3D0Y B;  4MVF A;  1JFJ A;  2KPH A;  2MBX A;  1CFF A;  1XK4 C;  2LCP A;  4I5K A;  4D1E A;  1H8B A;  1BG1 A;  2JPT A;  3CR2 A;  5CSF A;  1LXF C;  2WCB A;  4ICB A;  5CSN A;  1F70 A;  2GTE A;  2KFF A;  1C3Y A;  3I5F B;  2LVI A;  5FI7 A;  1N65 A;  2KFG A;  4ORB B;  3SIA A;  2LNK A;  5AER A;  3EVU A;  3ZNI A;  2ZN8 A;  2KI6 C;  4MRY A;  2H8V A;  3LCP C;  5I2Q A;  1JFK A;  1CNP A;  1WDC B;  3VGO A;  2H61 C;  5D3O A;  3NSO A;  2WND A;  1WLZ A;  5PAL A;  4F0Z B;  3CR4 X;  1UHN A;  3AAJ A;  1XYD A;  1DGV A;  2AAO A;  3KHE A;  1B47 A;  2ISD A;  1S6J A;  2KQ6 A;  3OB1 B;  3KF9 A;  3CZT X;  2QDI A;  2WOS A;  1SY9 A;  1YX7 A;  1V1G A; 
#chains in the Genus database with same CATH homology
 1IGV A;  5IBW A;  1OQP A;  2HPS A;  1C7W A;  2M29 A;  1L2O B;  1UHH A;  3MSE B;  1NYA A;  2JTZ A;  1JF2 A;  1S1E A;  3LK1 A;  1TN4 A;  4N5X A;  4TNC A;  1JWD A;  1SK6 D;  1B8R A;  1SCM C;  4Q04 A;  2BEC A;  3TDU A;  2LAN A;  1KFU S;  2LAP A;  4YGC B;  2IS9 A;  4QJ3 B;  4PE4 A;  4YI9 A;  1RWY A;  2I94 A;  1CLM A;  1B9A A;  1KQV A;  1ALV A;  5HKZ A;  5I2O A;  1DF0 A;  2CNP A;  1BT6 A;  2KI4 B;  1QLK A;  1SL7 A;  4HRG A;  1KFX S;  4QJ5 B;  1CFC A;  1UHK A;  2ZRT A;  4DRW A;  2PSR A;  2SAS A;  1MXE A;  1WDC C;  1WRK A;  3EVV A;  3OHM B;  1A2X A;  2KQY A;  3AAK A;  1DGU A;  2K61 A;  2JU0 A;  3CTN A;  3BUW B;  1DJY A;  1ZUZ A;  1PSR A;  3NSK A;  1QLS A;  1TTX A;  3SG2 A;  2LLU A;  4OR9 B;  3SG5 A;  1Y1X A;  3M0W A;  4XYN A;  2EGD A;  4GGF A;  2HF5 A;  4I5N B;  2KOT A;  3ZWH A;  2Y4Q A;  1M46 A;  1IWQ A;  2MHH A;  2CTN A;  4M2P A;  2L4I A;  3AKB A;  4IL1 A;  3GOF A;  1W7I B;  2BBM A;  1MF8 B;  4MN0 A;  1OZS A;  4DIR A;  2MRD A;  5DKN A;  1RTP 1;  2EC6 B;  3FIA A;  2M8U A;  2HET A;  2HQW A;  4AQI A;  1XFV O;  5J3X A;  1BJF A;  4M2O A;  1KFU L;  2MA2 A;  1J7P A;  4YGB B;  4YRU A;  2JOJ A;  1AJ4 A;  4P5O E;  2FOT A;  3BOW A;  4U8D A;  2KI4 C;  4XJK A;  1S5G Y;  1ZAC A;  1RRO A;  2JXL A;  4MBE A;  5AXI A;  3I5H B;  2ZND A;  3DF0 A;  1K9K A;  5G08 A;  2LUX A;  1NX3 A;  2F8P A;  4HRH A;  2NLN A;  1IJ5 A;  1VRK A;  2L4H A;  2FCE A;  1L7Z A;  1MHO A;  1AHR A;  4JPZ B;  2M49 B;  4PDZ A;  1B8L A;  2JNX A;  3SG3 A;  3WHT B;  1KQM C;  1TNQ A;  2K8M B;  1U5I A;  4L9M A;  2KSP A;  3I5I C;  3VRP A;  4PHJ A;  2WCF A;  1NCY A;  2ZNE A;  2LV7 A;  1FPW A;  1YUT A;  2K7B A;  2Y5I A;  1KSO A;  1SNL A;  2JZI A;  4CID A;  2PRU A;  5HKW A;  2E30 A;  2O5G A;  3BUN B;  1Q80 A;  5D69 A;  3VRR A;  3WXA A;  1QV0 A;  2JT3 A;  2LM5 A;  2Y1M A;  2M9G A;  2EC6 C;  5I2L A;  4DCK A;  2K0J A;  4WQ2 A;  3JVT B;  1DTL A;  4CPV A;  1YX8 A;  1EJ3 A;  1C07 A;  5GQQ C;  2F3Z A;  3TZ1 A;  1WRL A;  1S6I A;  3SIB A;  3BYA A;  1K96 A;  1K93 D;  1UP5 A;  1HT9 A;  5AEQ A;  1DF0 B;  1YTZ C;  5AAN A;  2M1K B;  3O2P A;  3LLE A;  1B1G A;  2E6W A;  2K7D A;  4DS7 A;  2K2F A;  3I5H C;  3O6B A;  2G2B A;  1LKJ A;  1M45 A;  2BBN A;  2LP2 A;  2OPO A;  3BUM B;  1KK7 Y;  1CDM A;  4JQ0 D;  2Q91 A;  2CCM A;  2KGR A;  2Q4U A;  3EKH A;  1REC A;  3BUO B;  2BCA A;  1XVJ A;  1NIW A;  1QV1 A;  4WQ3 A;  3PN7 B;  2PAL A;  1YVH A;  2JNF A;  5CSJ A;  4MRX A;  1DJX A;  2LMV A;  1IKU A;  5CPV A;  2LHL A;  1OOJ A;  2KAX A;  2KBM A;  3DVJ A;  1PSB A;  1DJI A;  1SR6 B;  2M0R A;  2CBL A;  1IRJ A;  1NUB A;  2MLE C;  2PMY A;  2AMI A;  3VRQ A;  4E68 A;  2M3W A;  1J55 A;  4OCI A;  2JT0 A;  4YGE B;  5ER4 X;  4MEW A;  4AQJ A;  3FS7 A;  2JRF A;  1SMG A;  4NDD A;  2BL0 B;  2D8N A;  3DVM A;  1EH2 A;  4NDB A;  4MZL A;  2JQ6 A;  1YR5 A;  1FW4 A;  2LVJ A;  3I5F C;  2NCO A;  3CGA A;  1F4O A;  2KYF A;  3JVT C;  2OS8 B;  1NCX A;  1GJY A;  4MZK A;  3QRX A;  4YI8 A;  1KK8 B;  1UUS A;  3HX4 A;  2F2O A;  5HYD A;  1QIV A;  3AKA A;  3BOW B;  3BQ3 A;  1W7J B;  1N0Y A;  3NSI A;  1S6C A;  2H2K A;  4GNK B;  3OP0 A;  5JJG A;  4I5L B;  2RGI A;  1QX2 A;  3CS1 A;  4XJK B;  1BF5 A;  1YUU A;  4ZCU A;  1Y1U A;  2Y1N A;  1F71 A;  1M63 B;  3GK4 X;  1DMO A;  1J7R A;  2CXJ A;  1DJZ A;  1G33 A;  1SPY A;  3DF0 B;  4MSP A;  1DVI A;  2JUL A;  1S26 D;  1NP8 A;  3JTD B;  2HQ8 A;  1JC2 A;  4NDC A;  1L2O C;  2KAV A;  3F45 A;  3PN7 C;  2NXQ A;  1BOC A;  3WHU B;  4ETO A;  1U5I B;  3KEV A;  4GGF C;  1D1O A;  3WNX B;  3SG4 A;  3TDZ A;  2JXC A;  4N1F A;  1AK8 A;  2BKH B;  1KSM A;  1CFD A;  1XFU O;  2GGZ A;  4GPL B;  4R1E A;  5ER5 A;  4ORA B;  2KYC A;  2BL0 C;  1KCY A;  5KU1 A;  1LA0 A;  4PCW A;  4PHM A;  2NCP A;  1BR1 B;  1BLQ A;  2MJW B;  2G9B A;  3BXK A;  2F33 A;  3A8R A;  1XFW O;  1K94 A;  4BY4 A;  1RJV A;  1JSA A;  2R2I A;  2L0P A;  2OS8 C;  3GK2 A;  2LMT A;  2L50 A;  1QVI Y;  1R6P A;  2KDH A;  1K9P A;  4ORC B;  1KK8 C;  1OMV A;  3GK1 A;  1CDP A;  4BY5 A;  1YUR A;  1CM4 A;  4OKH A;  3IF7 A;  2LUC A;  3EKJ A;  4OVN F;  1DJW A;  2ZFD A;  1KK7 Z;  2I18 A;  3NSL A;  4GUK A;  3SJS A;  2ZN9 A;  1B7T Y;  4CLN A;  1GGW A;  1CM1 A;  1PVB A;  1E8A A;  1K9U A;  1EG3 A;  1XFY O;  2JTT A;  1CLB A;  1ZOT B;  4GBA A;  2GV5 A;  3PSR A;  1NX0 A;  1B8C A;  1QAT A;  1QXP A;  2LLS A;  2JT8 A;  4M2Q A;  1DT7 B;  1TNW A;  4FQO A;  4DUQ A;  3EK7 A;  2MAZ A;  2M7N A;  1NWD A;  2KGB C;  5DKR A;  1RK9 A;  1UHJ A;  2I2R E;  3KPX A;  2PAS A;  2SCP A;  3BUX B;  2KBI A;  5HLV A;  1RFJ A;  2V53 A;  1LIN A;  3NXA A;  4FTG A;  1M31 A;  1DJG A;  1J1E A;  3TUY B;  5BPJ A;  2K2A A;  1SW8 A;  1IQ5 A;  3LK0 A;  2TN4 A;  1MWN A;  1AP4 A;  3DVK A;  2F3Y A;  4HSZ A;  1WY9 A;  4YGD B;  1XK4 A;  1CLL A;  2BCB A;  1OZO A;  2LLT A;  1FF1 A;  2WC8 A;  1QJT A;  2EHB A;  2KFH A;  1AJ5 A;  1NCZ A;  1FBV A;  4N1G A;  1IQ3 A;  4YGA A;  1YVL A;  1IG5 A;  2A4J A;  3DD4 A;  3DVE A;  4HRE E;  1TCO B;  1TNP A;  4PE7 A;  1IH0 A;  4JWQ A;  1EG4 A;  3I5G B;  5FYX A;  1F8H A;  2CT9 A;  1MXL C;  1MQ1 A;  1XFX O;  3TS5 B;  1BOD A;  2L5X B;  1C7V A;  1TNX A;  4GFT A;  3RLZ A;  1KWO B;  2FJU B;  2H61 A;  1A75 A;  2B1U A;  1A4P A;  1K95 A;  2NZ0 A;  5F6T A;  2O60 A;  1FI5 A;  2M7L A;  1WRZ A;  2QPT A;  2LMU A;  1CDN A;  2MLF C;  5B8I B;  1JBA A;  1R2U A;  4MZJ A;  4WRI A;  2K7C A;  5K89 A;  4A4B A;  1YUS A;  2BCX A;  5AFP A;  2AUC A;  1SCV A;  2M97 A;  1AVS A;  1QAS A;  3LL8 B;  3OX6 A;  5TNC A;  1JF0 A;  4CFR A;  1S3P A;  5I8N A;  1ALW A;  2KNE A;  2DOQ A;  3TUY C;  3IQQ A;  4ZCV A;  3SG7 A;  1MR8 A;  2KAY A;  1EL4 A;  3A4U B;  3D0Y A;  1CKK A;  1QTX A;  1S5G Z;  1UWO A;  1QVI Z;  4P2Y B;  1F55 A;  4UPG A;  3TDI A;  1Y0V H;  2WCE A;  1A29 A;  1SKT A;  2VRG A;  4OV2 A;  1LA3 A;  1J7Q A;  3I5G C;  3VRO A;  2LHI A;  3PLF B;  1B7T Z;  3TS5 C;  2LP3 A;  1X02 A;  4QJ4 B;  2GGM A;  1KWO C;  1A03 A;  2PVB A;  1CDL A;  3HCM A;  1XFZ O;  3PFV A;  4PE1 A;  2OTG B;  1MUX A;  2F2P A;  3CWG A;  1K8U A;  4NQG A;  4I5J A;  1CTR A;  5JOL A;  5KTY A;  1N2D A;  1CFP A;  2I7A A;  3OX5 A;  1SR6 C;  1FI6 A;  1UUR A;  2LC5 A;  1TRF A;  4USL A;  1OMR A;  5DKQ A;  4YBH B;  4AOM A;  2LVV A;  1XA5 A;  3ICB A;  3VRN A;  1BU3 A;  1KQM B;  4PE0 A;  2L2E A;  4PHK A;  1Y6W A;  1J1D A;  1QS7 A;  1S36 A;  3I5I B;  1PK0 D;  1K2H A;  2ZRS A;  1CB1 A;  1BMO A;  1SL9 A;  1PVA A;  3D10 A;  1GQM A;  1YRU B;  1PUL A;  1G4Y R;  3RM1 A;  1ZMZ A;  2BKI B;  1NX2 A;  3PAT A;  1QIW A;  3IQO A;  1YRT B;  2L51 A;  1ZFS A;  3CLN A;  4MLW A;  1SL8 A;  1HQV A;  2M1U A;  3E3R A;  4PHN A;  4PAL A;  3H4S E;  1BR4 B;  2FCD A;  2QAC A;  1QX7 A;  1XO5 A;  1DJH A;  2COL B;  2BE6 A;  1OE9 B;  2KI6 D;  2ZKM X;  3C1V A;  1F54 A;  2L98 A;  3EVR A;  1OSA A;  1QX5 B;  1SYM A;  2OTG C;  1K90 D;  3CR5 X;  3JTD C;  1A75 B;  5HLO A;  1J7O A;  1IJ6 A;  1G8I A;  3EK8 A;  4CFQ A;  1GGZ A;  1TCF A;  1WLM A;  5D7F A;  3SG6 A;  1M39 A;  1NPQ A;  1OMD A;  1TIZ A;  2KHN A;  2LE9 B;  4C0L A;  1KFX L;  1EXR A;  1NX1 A;  1JUO A;  1B4C A;  3PAL A;  2K7O A;  4GAO A;  4GGN A;  2LVK A;  1CMF A;  1H4B A;  5KSZ A;  1PAL A;  2P6B B;  5CSI A;  3K21 A;  5HKY A;  2JWW A;  1V1F A;  2JC2 A;  3FWB A;  1SBJ A;  1CMG A;  3O4Y A;  1SRA A;  3FWC A;  3OB2 B;  3EK4 A;  3KO0 A;  1F4Q A;  1AUI B;  1UHI A;  1LVC D;  1PRW A;  1Y1A A;  4C0K A;  4C0J A;  3O78 A;  1TOP A;  4A4C A;  1SCM B;  3PM8 A;  1ODB A;  2WOR A;  1NSH A;  2BE4 A;  3D0Y B;  4MVF A;  1JFJ A;  2MBX A;  1CFF A;  1XK4 C;  2LCP A;  4I5K A;  4D1E A;  1H8B A;  1BG1 A;  2JPT A;  3CR2 A;  5CSF A;  1LXF C;  2WCB A;  4ICB A;  5CSN A;  1F70 A;  2KFF A;  3I5F B;  2LVI A;  1N65 A;  2KFG A;  4ORB B;  3SIA A;  2LNK A;  5AER A;  3EVU A;  3ZNI A;  2ZN8 A;  2KI6 C;  4MRY A;  3LCP C;  5I2Q A;  1JFK A;  1CNP A;  1WDC B;  3VGO A;  2H61 C;  3NSO A;  2WND A;  1WLZ A;  5PAL A;  4F0Z B;  3CR4 X;  1UHN A;  3AAJ A;  1XYD A;  1DGV A;  2AAO A;  3KHE A;  1B47 A;  2ISD A;  1S6J A;  2KQ6 A;  3OB1 B;  3KF9 A;  3CZT X;  2WOS A;  1SY9 A;  1YX7 A;  1V1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...