2BE6A

2.0 a crystal structure of the cav1.2 iq domain-ca/cam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
141
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Calmodulin 2
publication title Insights into voltage-gated calcium channel regulation from the structure of the Ca(V)1.2 IQ domain-Ca(2+)/calmodulin complex
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 141
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A02
2LHLA 1MXLC 1CKKA 1F4QA 2HETA 1A2XA 1B8LA 4QJ5B 2COLB 3LK1A 1SCMB 5CSNA 1SR6B 1YUTA 3LCPC 3EKJA 4ORBB 5AXIA 2R2IA 5CSFA 3PLFB 1S36A 1XVJA 5BPJA 1B47A 2Y4QA 2L4HA 3QRXA 3M0WA 1AK8A 2JT3A 2JT8A 1XFXO 2L51A 3CR2A 3CTNA 3K21A 5CSIA 1JBAA 1KQMB 1CM1A 2EC6B 1K9UA 1U5IA 1AHRA 1EG4A 1MR8A 2K0JA 3O78A 4YGAA 2LUXA 1W7IB 1B7TZ 3FWBA 3TUYC 2LUCA 5JOLA 1LXFC 4OCIA 4BY5A 1DT7B 1SK6D 5AEQA 1K96A 1IWQA 2CCMA 2K7OA 1C7WA 1F54A 1NIWA 1J1DA 4GUKA 1K2HA 3I5GC 1L2OB 2LMTA 2KI4B 2KNEA 1IGVA 2OS8C 3VRPA 2HQWA 5B8IB 1NWDA 2FCEA 4C0LA 2WORA 2E30A 1K8UA 1SPYA 2Y5IA 4C0JA 1CMFA 2K2FA 1XO5A 2KFFA 1MQ1A 1C7VA 3IF7A 4ORCB 1CDPA 4E68A 3KPXA 3OP0A 1BJFA 1UHIA 1ZMZA 1UHNA 1EXRA 2M3WA 2NZ0A 1QS7A 5I2OA 2V53A 1Y1UA 3IQOA 1KFUL 1OMVA 3F45A 2WCFA 2L2EA 1HQVA 1MXEA 2KGRA 1S6JA 1S1EA 1YX8A 1CM4A 2WCEA 2O5GA 4GGNA 4M2OA 1CB1A 1Y0VH 3NXAA 1JF2A 2HF5A 1LA0A 1GQMA 3VRRA 2I18A 1IH0A 1WRKA 3AKBA 3I5IC 2LVIA 4IL1A 1J7OA 3JVTC 1QATA 4GPLB 2EHBA 2PRUA 4F0ZB 1DJZA 1ALVA 4BY4A 4MEWA 4L9MA 2HQ8A 3GK1A 2KI6D 1YRUB 4NQGA 1FF1A 4QJ4B 3KHEA 4HRHA 3BUXB 3VGOA 2F3ZA 3O6BA 1NCZA 1UHKA 1XYDA 1QLKA 2ZKMX 2MHHA 1EL4A 3EVRA 2D8NA 1U5IB 2LVKA 1M46A 1BMOA 2BKIB 2BE4A 4GNKB 3FWCA 1KWOC 2MRDA 1DVIA 1IRJA 2KAVA 2M7NA 1H4BA 1F4OA 5G08A 1SCVA 3VRNA 4I5LB 2K7CA 2M8UA 2CXJA 4AQIA 2I2RE 2JTZA 3TZ1A 3BYAA 4YI8A 1S26D 1V1GA 3EKHA 4Q04A 1FBVA 4PHJA 2LVJA 1Q80A 1UHJA 1RWYA 2BBNA 1UWOA 1UUSA 1OMRA 3SG7A 2CNPA 3PN7B 3D10A 3TS5B 1A03A 1QIWA 2JU0A 2CBLA 2KFGA 3PATA 4MRYA 3C1VA 3GOFA 1XFVO 3KEVA 1GJYA 1K9KA 5AFPA 2BCAA 1IJ6A 2ZRSA 3I5HB 1JFKA 4A4BA 4DS7A 2AUCA 1SY9A 2MAZA 2JNXA 4XJKA 3RM1A 1M39A 2WNDA 1PRWA 2GGMA 4MN0A 3ICBA 1F70A 3OB2B 1Y6WA 2LLSA 3DVEA 4YBHB 1J55A 1BF5A 4PE0A 4FTGA 2JXCA 2JWWA 4I5JA 1PK0D 2CT9A 3LL8B 1S6IA 1R6PA 1ODBA 1D1OA 5AERA 1B8RA 1PVBA 4CFQA 1DMOA 3NSKA 1TIZA 5F6TA 2JT0A 1TN4A 1LINA 1AVSA 2M97A 3BQ3A 4WQ2A 1PVAA 1S5GZ 4AQJA 2F2OA 4MRXA 1N0YA 1WRZA 4D1EA 1CFDA 2AAOA 4NDBA 2KYFA 2Y1NA 3SJSA 1XFUO 1JFJA 4P2YB 1PALA 2Y1MA 1QX2A 1OQPA 2GV5A 4U8DA 3WNXB 1QLSA 1CTRA 1ZFSA 1KK8B 1NYAA 5I2LA 4GGFC 1QXPA 1UP5A 4MSPA 2LE9B 5HLOA 3E3RA 4MZLA 1TNPA 2K2AA 4PALA 2TN4A 4C0KA 1BOCA 4I5KA 4YI9A 1OSAA 4PDZA 4I5NB 1J7QA 1IJ5A 1K9PA 1PSRA 2ZNDA 4N5XA 1SCMC 1K94A 1WDCB 1SR6C 2F3YA 1LA3A 1V1FA 1ZOTB 1EJ3A 4JPZB 3GK2A 1A4PA 4PHKA 1QV0A 3NSOA 1S5GY 1M45A 4XJKB 3EK4A 3VRQA 2HPSA 3I5FB 1E8AA 4MZJA 1PULA 2QPTA 1QV1A 2JZIA 4GFTA 3O2PA 4HREE 1AJ4A 1DGUA 1KQMC 2EC6C 4ZCVA 1GGZA 2E6WA 4GBAA 1FI6A 3GK4X 4MBEA 2LP3A 1SW8A 1KSOA 2JPTA 2JC2A 1NCYA 1FW4A 1B7TY 1PSBA 2FOTA 2DOQA 3SG4A 5HYDA 1ZUZA 4GAOA 3DF0A 2WC8A 4DCKA 2KQ6A 2OTGB 1JUOA 2H61C 1W7JB 3DVMA 3PFVA 2PVBA 1DJXA 1L2OC 1QASA 4MLWA 5GQQC 5HLVA 2KI4C 3BOWA 1XK4C 4A4CA 3JTDB 1MHOA 5DKQA 5KTYA 1DJGA 1RECA 5I2QA 2K8MB 3MSEB 1N2DA 2LMUA 1AUIB 2LAPA 1OOJA 5KSZA 1TTXA 4OVNF 2P6BB 3CWGA 2PALA 1BLQA 1JF0A 3EK8A 3LLEA 1TNWA 4PE7A 1NX1A 2M1KB 2JQ6A 1TCFA 4PHMA 1WY9A 1TNXA 1CFFA 2PMYA 4UPGA 3WHUB 2BBMA 1KFUS 2L50A 2M9GA 1QIVA 4R1EA 1NP8A 1M63B 3FS7A 2LM5A 3O4YA 4OR9B 2KSPA 1YX7A 1Y1XA 2LNKA 2BL0B 1KSMA 2L0PA 3BUOB 1K93D 1QX7A 4N1GA 3NSLA 2NXQA 4NDCA 1ZACA 1XFZO 3CR5X 1GGWA 1NCXA 1G4YR 1CLBA 2AMIA 2KQYA 1WLMA 4HSZA 2JXLA 4PCWA 2PSRA 1JWDA 1QVIZ 1TOPA 1RFJA 4USLA 2LMVA 1OE9B 3PSRA 3OB1B 3AKAA 4WRIA 1CLMA 2RGIA 3TDIA 2WCBA 1DJIA 4OKHA 1JC2A 2OPOA 2M7LA 1CLLA 3NSIA 4QJ3B 2L98A 2ZNEA 1Y1AA 1XA5A 3CLNA 2F33A 2F8PA 2A4JA 5J3XA 2LP2A 5TNCA 2KBIA 3OHMB 1QJTA 3DF0B 3KF9A 2KFHA 2CTNA 1J7RA 5AANA 4YGEB 4DRWA 3WHTB 1YUUA 1IQ3A 3CGAA 5CPVA 3BOWB 1TRFA 4PE4A 4YGCB 2Q91A 3KO0A 1CDNA 1SYMA 3RLZA 2JOJA 4AOMA 2JRFA 3TDZA 4CIDA 3PN7C 3TS5C 3TDUA 1AP4A 3ZNIA 3SG5A 3TUYB 4PHNA 5ER4X 2KDHA 2KAYA 1QVIY 5HKZA 5ER5A 2H2KA 1KCYA 3LK0A 1B9AA 3I5HC 1F55A 1SL8A 2G2BA 2FJUB 2LCPA 3I5GB 4N1FA 2MLFC 4CLNA 2OS8B 3EVUA 3SG2A 4XYNA 1OZOA 2I7AA 2LC5A 2LVVA 1J1EA 3VROA 2ZN9A 1DJWA 4PE1A 1OMDA 2BCBA 1SKTA 1YVHA 1CFPA 2Q4UA 1OZSA 3BXKA 3SIAA 3A8RA 2KI6C 4DUQA 1C07A 4M2PA 1K95A 3IQQA 2ZFDA 5IBWA 1L7ZA 1EH2A 3SG6A 1KQVA 2G9BA 4CFRA 2KGBC 4YGBB 1X02A 4HRGA 2KYCA 1TCOB 2QACA 2K7DA 1S6CA 1KK7Z 1UHHA 1CDMA 4ETOA 4NDDA 1DJHA 2MJWB 1A75B 2GGZA 3I5IB 4YGDB 2F2PA 2M0RA 1SL9A 2K7BA 3JVTB 5HKWA 5K89A 4DIRA 3SIBA 1DGVA 2LLTA 2M49B 1HT9A 2L4IA 4JQ0D 2O60A 3PM8A 1AJ5A 2BE6A 1DF0B 1KK8C 1G33A 2WOSA 1RK9A 1YTZC 2NCPA 5HKYA 1NX3A 1SL7A 3BUMB 2B1UA 5D7FA 1IG5A 4OV2A 1WRLA 1J7PA 1F71A 1KWOB 1TNQA 1BG1A 1RTP1 1WDCC 1CMGA 1UURA 2FCDA 1SRAA 3SG3A 2LLUA 1CFCA 1KK7Y 2NLNA 5CSJA 2SCPA 2IS9A 2BCXA 1YRTB 3I5FC 2ISDA 2BKHB 1CDLA 1B4CA 1LKJA 1BR4B 3BUWB 5DKNA 5JJGA 1JSAA 4GGFA 1NUBA 3WXAA 1IKUA 1KFXL 1WLZA 3D0YA 4FQOA 1M31A 1BR1B 2KBMA 3HCMA 1CNPA 1IQ5A 1RJVA 5DKRA 3BUNB 1NX0A 2MBXA 5D69A 2MLEC 1EG3A 2BECA 2LANA 2OTGC 1RROA 2VRGA 4WQ3A 3FIAA 3A4UB 2KOTA 1B1GA 2JTTA 1F8HA 2PASA 3JTDC 1SBJA 4P5OE 1S3PA 2JULA 3DD4A 2I94A 2NCOA 1YUSA 2MA2A 2KAXA 1NPQA 4YRUA 3ZWHA 1NX2A 3DVJA 4M2QA 1B8CA 3EK7A 1ALWA 1A75A 1R2UA 3HX4A 1FI5A 2M1UA 2H61A 3OX6A 2ZRTA 3H4SE 1NSHA 1VRKA 1SMGA 1BU3A 1XFWO 4ZCUA 1MF8B 5PALA 4CPVA 1MUXA 1G8IA 1XK4A 1YURA 3AAJA 2BL0C 1KFXS 4JWQA 1DF0A 4ICBA 4MVFA 1QX5B 3CZTX 1YVLA 1A29A 2L5XB 1BT6A 1YR5A 3DVKA 5KU1A 1DJYA 1QTXA 2ZN8A 2LHIA 5I8NA 4MZKA 1K90D 3OX5A 3CR4X 1FPWA 1LVCD 2JNFA 2LV7A 3EVVA 2SASA 4TNCA 2K61A 3PALA 1N65A 1DTLA 1MWNA 2KHNA 4ORAB 1BODA 5FYXA 1XFYO 1SNLA 2EGDA 3CS1A 1H8BA 2M29A 3AAKA 3D0YB
chains in the Genus database with same CATH superfamily
2LHLA 1MXLC 1CKKA 1F4QA 2HETA 1A2XA 1B8LA 3DXLA 2COLB 4QJ5B 3L4AA 3LK1A 1SCMB 5CSNA 1SR6B 1YUTA 3LCPC 3EKJA 4ORBB 5AXIA 2R2IA 5CSFA 3PLFB 1S36A 3D74A 1XVJA 2JPOA 1B47A 2Y4QA 2L4HA 3QRXA 5BPJA 3M0WA 1AK8A 3CZ2A 2JT3A 2JT8A 1XFXO 2ERBA 2L51A 3CR2A 3CTNA 3K21A 5CSIA 1JBAA 1KQMB 1CM1A 2EC6B 1K9UA 1U5IA 3BJHA 1AHRA 1EG4A 1MR8A 2K0JA 3BFBA 3O78A 4YGAA 2LUXA 1W7IB 1B7TZ 3FWBA 3TUYC 2LUCA 5JOLA 1LXFC 3OGNA 4OCIA 4BY5A 1DT7B 1SK6D 5AEQA 2WCJA 1K96A 1IWQA 2CCMA 2K7OA 1C7WA 1F54A 1NIWA 1J1DA 4GUKA 1K2HA 3I5GC 1L2OB 2LMTA 2KI4B 2KNEA 1IGVA 2OS8C 3VRPA 2HQWA 5B8IB 1NWDA 3FE9A 2FCEA 4C0LA 2WORA 2E30A 1K8UA 1SPYA 2Y5IA 4C0JA 1CMFA 2K2FA 1XO5A 3VB1A 2KFFA 1MQ1A 1C7VA 3IF7A 4ORCB 1CDPA 4E68A 1XFRA 3KPXA 4INWA 3OP0A 1BJFA 1UHIA 1ZMZA 1UHNA 1EXRA 2M3WA 2NZ0A 1QS7A 5I2OA 2V53A 3D77A 1Y1UA 3IQOA 1KFUL 1OMVA 3F45A 2WCFA 2L2EA 1HQVA 1MXEA 2KGRA 1S6JA 1S1EA 1YX8A 1CM4A 1OOFA 2WCEA 2O5GA 4GGNA 4M2OA 1CB1A 1Y0VH 5HL1A 3NXAA 1JF2A 2HF5A 1LA0A 1GQMA 3VRRA 2I18A 1IH0A 3BFAA 1WRKA 3AKBA 3I5IC 2LVIA 4IL1A 1J7OA 3SS4A 3DYEA 3JVTC 1QATA 4GPLB 2EHBA 2PRUA 3Q8IA 5FI7A 4F0ZB 1DJZA 1ALVA 4BY4A 4MEWA 4L9MA 2HQ8A 3GK1A 2KI6D 1YRUB 4NQGA 1FF1A 4QJ4B 3KHEA 4HRHA 1TWOA 3BUXB 3VGOA 2F3ZA 3O6BA 1NCZA 1UHKA 1XYDA 1QLKA 2ZKMX 1OOIX 1TUJA 1OW4A 1EL4A 2MHHA 3EVRA 2D8NA 1U5IB 2LVKA 1M46A 1BMOA 3CZ1A 1C3ZA 2BKIB 2BE4A 4GNKB 3FWCA 1KWOC 2MRDA 1DVIA 1IRJA 2KAVA 2M7NA 2FJYA 1H4BA 1F4OA 5G08A 1SCVA 3VRNA 4I5LB 2K7CA 2M8UA 2CXJA 4AQIA 2I2RE 5FI6A 2JTZA 3TZ1A 3BYAA 4YI8A 1S26D 1V1GA 3EKHA 4Q04A 1FBVA 4PHJA 2LVJA 1Q80A 1UHJA 3D76A 1RWYA 2BBNA 1UWOA 1UUSA 1OMRA 3SG7A 2CNPA 3PN7B 3D10A 3TS5B 1A03A 1QIWA 2JU0A 2CBLA 2KFGA 3PATA 4INXA 4MRYA 3C1VA 3GOFA 1XFVO 2QEBA 1TUZA 3KEVA 1GJYA 1K9KA 3IVTA 2BCAA 5AFPA 1IJ6A 2ZRSA 3CDNA 3B7AA 1JFKA 3I5HB 4A4BA 4DS7A 3FE6A 2AUCA 1SY9A 2MAZA 5DICA 2JNXA 4XJKA 3RM1A 1M39A 2WNDA 1PRWA 2GGMA 4MN0A 2L5YA 3ICBA 1F70A 3OB2B 1Y6WA 2LLSA 3DVEA 4YBHB 1J55A 3D73A 1BF5A 4PE0A 4FTGA 2JXCA 2JWWA 4I5JA 1PK0D 2CT9A 3LL8B 1S6IA 1R6PA 1ODBA 3L4LA 1D1OA 5AERA 1B8RA 1PVBA 4CFQA 4F7FA 1DMOA 1ORGA 3NSKA 1TIZA 5F6TA 2JT0A 1TN4A 3DZTA 1LINA 1AVSA 2M97A 3BQ3A 3FE8A 4WQ2A 1PVAA 1S5GZ 4AQJA 2F2OA 4MRXA 1N0YA 1WRZA 4D1EA 1CFDA 2AAOA 3UNWA 4NDBA 2KYFA 2Y1NA 3SJSA 1XFUO 1JFJA 4P2YB 1PALA 2Y1MA 1QX2A 1OQPA 2GV5A 4U8DA 3WNXB 1QLSA 1CTRA 3S0AA 1ZFSA 1KK8B 1NYAA 5I2LA 2WCKA 4GGFC 1QXPA 1UP5A 3R1VA 4MSPA 2LE9B 4JD9A 5HLOA 5D3OA 3E3RA 4MZLA 1TNPA 2K2AA 4PALA 2TN4A 4C0KA 1BOCA 4I5KA 4YI9A 1OSAA 4PDZA 4I5NB 1J7QA 1IJ5A 1K9PA 1PSRA 2ZNDA 4N5XA 1SCMC 1K94A 1WDCB 1SR6C 2F3YA 2QEHA 3O4XA 3R1PA 3PJIA 1LA3A 1V1FA 1ZOTB 2QEVA 2BNXA 1EJ3A 4JPZB 3GK2A 1A4PA 4PHKA 1QV0A 2GTEA 1S5GY 1M45A 3BFHA 3NSOA 4XJKB 3EK4A 3VRQA 2HPSA 3I5FB 1E8AA 4MZJA 1PULA 2QPTA 1QV1A 2JZIA 4GFTA 3O2PA 4HREE 1AJ4A 1DGUA 1KQMC 2EC6C 5EL2A 1GGZA 4ZCVA 2E6WA 4GBAA 1FI6A 2QEOA 3GK4X 4MBEA 2LP3A 1SW8A 1KSOA 2JPTA 2JC2A 1NCYA 1FW4A 1B7TY 1PSBA 2FOTA 2DOQA 3SG4A 5HYDA 3D75A 1ZUZA 4GAOA 3DF0A 2WC8A 4DCKA 2KQ6A 2OTGB 4KYNA 1JUOA 2H61C 1W7JB 3DVMA 3PFVA 2PVBA 4OZDA 1DJXA 1L2OC 1QASA 4MLWA 5GQQC 5HLVA 2KI4C 3BOWA 1XK4C 1P28A 4A4CA 3JTDB 1MHOA 5DKQA 5KTYA 1DJGA 1RECA 5I2QA 2K8MB 3MSEB 1N2DA 3B86A 2LMUA 3NHTA 1AUIB 2LAPA 1OOJA 5KSZA 1GM0A 1TTXA 4FQTA 2P6BB 3CWGA 2PALA 4OVNF 1BLQA 2P70A 1C3YA 1JF0A 3EK8A 3LLEA 1TNWA 4PE7A 3V2LA 2WC5A 1NX1A 2M1KB 2JQ6A 1TCFA 4PHMA 1WY9A 1TNXA 1CFFA 2PMYA 4UPGA 3WHUB 2BBMA 1KFUS 4IJ7A 2L50A 2M9GA 1QIVA 4R1EA 1NP8A 1M63B 3FS7A 2LM5A 3O4YA 4OR9B 2KSPA 3RZSA 1YX7A 1Y1XA 2LNKA 2BL0B 1KSMA 2L0PA 3BUOB 1K93D 1QX7A 4N1GA 3NSLA 2NXQA 4NDCA 1ZACA 1XFZO 3CR5X 1GGWA 1NCXA 3K1EA 1G4YR 1CLBA 2WCMA 2AMIA 2KQYA 1WLMA 4HSZA 2JXLA 3QMEA 2PSRA 4PCWA 1JWDA 1QVIZ 1TOPA 1RFJA 4USLA 2LMVA 1OE9B 3PSRA 3OB1B 3AKAA 3CABA 4WRIA 1CLMA 2RGIA 3TDIA 2WCBA 1DJIA 4OKHA 1JC2A 2OPOA 2M7LA 1CLLA 3NSIA 4QJ3B 2L98A 2ZNEA 1Y1AA 1XA5A 3CLNA 2F33A 2F8PA 2A4JA 3NGVA 2LP2A 5J3XA 5TNCA 3SS5A 2KBIA 3OHMB 1QJTA 3DF0B 3KF9A 2KFHA 2BAPA 2CTNA 2WCLA 1J7RA 5AANA 4YGEB 4DRWA 1DELA 3WHTB 1YUUA 1IQ3A 3CGAA 5CPVA 3BOWB 1TRFA 4PE4A 4YGCB 2KLDA 2Q91A 3KO0A 1CDNA 1SYMA 3RLZA 2WC6A 2JOJA 2PQLA 3B6XA 4AOMA 2JRFA 3TDZA 4CIDA 3PN7C 4PT1A 5I94A 3TS5C 3TDUA 3S0DA 1AP4A 3ZNIA 3SG5A 3TUYB 4PHNA 5ER4X 2KDHA 2KAYA 1QVIY 5HKZA 5ER5A 2H2KA 3R72A 1KCYA 3CZ0A 3LK0A 1B9AA 3I5HC 1F55A 1SL8A 2G2BA 2FJUB 2LCPA 3S0BA 3I5GB 4N1FA 1QWVA 2MLFC 4CLNA 2OS8B 3EVUA 3SG2A 4XYNA 1OZOA 2I7AA 2LC5A 2LVVA 1J1EA 3VROA 2ZN9A 3B88A 1DJWA 4PE1A 1OMDA 3S0FA 2BCBA 1SKTA 3UO9A 1YVHA 1CFPA 2KLEA 1OZSA 2Q4UA 3BXKA 3A8RA 2KI6C 3SIAA 4DUQA 1C07A 4M2PA 1K95A 3IQQA 2ZFDA 5IBWA 1L7ZA 1EH2A 3SG6A 1KQVA 2G9BA 2L2CA 2KGBC 4CFRA 4YGBB 1X02A 1DEKA 4HRGA 2KYCA 1TCOB 2QACA 2K7DA 1S6CA 1KK7Z 1UHHA 3D78A 1CDMA 5FI2A 3SS3A 4ETOA 1DC1A 3N7HA 4NDDA 1DJHA 1W9ZA 1DQEA 2MJWB 1A75B 2GGZA 3I5IB 3S0GA 4YGDB 3R1OA 2F2PA 2M0RA 1SL9A 2K7BA 3JVTB 5HKWA 5K89A 2PYQA 4DIRA 3SIBA 1DGVA 3NHIA 2LLTA 3OBVA 2M49B 1HT9A 2L4IA 4JQ0D 2O60A 3PM8A 4JKTA 1IIOA 1AJ5A 2BE6A 1DF0B 1OOGA 1KK8C 1G33A 3L47A 2WOSA 2YGUA 1RK9A 1YTZC 2NCPA 5HKYA 1NX3A 1SL7A 2QDIA 3BUMB 2B1UA 5D7FA 1IG5A 2K60A 4OV2A 1WRLA 1J7PA 1OOHA 1F71A 1KWOB 1TNQA 1BG1A 1RTP1 1WDCC 1CMGA 1UURA 2FCDA 1SRAA 3SG3A 2LLUA 1CFCA 1KK7Y 2NLNA 5CSJA 2SCPA 2IS9A 2BCXA 1YRTB 3I5FC 2ISDA 2BKHB 1CDLA 1B4CA 1LKJA 1BR4B 3BUWB 5DKNA 5JJGA 1JSAA 4GGFA 1Z2CB 1NUBA 3WXAA 1SSEB 1KFXL 1IKUA 1WLZA 3D0YA 4FQOA 1M31A 1BR1B 2KBMA 3HCMA 1CNPA 1IQ5A 1RJVA 5DKRA 3BUNB 1NX0A 2MBXA 5D69A 2MLEC 1EG3A 2BECA 2LANA 2OTGC 1RROA 2VRGA 2P71A 4WQ3A 3FIAA 3B87A 3A4UB 2KOTA 1B1GA 2JTTA 1F8HA 2PASA 3JTDC 1SBJA 3EG5B 4P5OE 1S3PA 2JULA 3DD4A 2WCHA 2I94A 2NCOA 1YUSA 2MA2A 2KAXA 1NPQA 4YRUA 3ZWHA 1NX2A 3DVJA 4M2QA 1B8CA 3EK7A 1ALWA 1A75A 1R2UA 3HX4A 1FI5A 2M1UA 2H61A 3OX6A 1LS8A 2ZRTA 3H4SE 1NSHA 1VRKA 1SMGA 1BU3A 1XFWO 3PM2A 4ZCUA 1MF8B 5PALA 3S0EA 1MUXA 4CPVA 1G8IA 1XK4A 1YURA 3AAJA 2BL0C 2KPHA 1KFXS 4JWQA 1DF0A 4ICBA 4MVFA 1QX5B 3CZTX 1YVLA 1A29A 2L5XB 1BT6A 1YR5A 3DVKA 5KU1A 1DJYA 1QTXA 2ZN8A 2LHIA 5I8NA 4MZKA 1K90D 3OX5A 3CR4X 1FPWA 1LVCD 2JNFA 3DY9A 2LV7A 3EVVA 2SASA 4TNCA 2K61A 3PALA 1N65A 1DTLA 1MWNA 3CYZA 2H8VA 2KHNA 4ORAB 1BODA 5FYXA 1XFYO 1SNLA 2EGDA 1Z4HA 1T14A 3CS1A 1H8BA 2M29A 3AAKA 3D0YB
chains in the Genus database with same CATH topology
2LHLA 1MXLC 1CKKA 1F4QA 2HETA 1A2XA 1B8LA 4QJ5B 2COLB 3LK1A 1SCMB 5CSNA 1SR6B 1YUTA 3LCPC 3EKJA 4ORBB 5AXIA 2R2IA 5CSFA 3PLFB 1S36A 1XVJA 5BPJA 1B47A 2Y4QA 2L4HA 3QRXA 3M0WA 1AK8A 2JT3A 2JT8A 1XFXO 2L51A 3CR2A 3CTNA 3K21A 5CSIA 1JBAA 1KQMB 1CM1A 2EC6B 1K9UA 1U5IA 1AHRA 1EG4A 1MR8A 2K0JA 3O78A 4YGAA 2LUXA 1W7IB 1B7TZ 3FWBA 3TUYC 2LUCA 5JOLA 1LXFC 4OCIA 4BY5A 1DT7B 1SK6D 5AEQA 1K96A 1IWQA 2CCMA 2K7OA 1C7WA 1F54A 1NIWA 1J1DA 4GUKA 1K2HA 3I5GC 1L2OB 2LMTA 2KI4B 2KNEA 1IGVA 2OS8C 3VRPA 2HQWA 5B8IB 1NWDA 2FCEA 4C0LA 2WORA 2E30A 1K8UA 1SPYA 2Y5IA 4C0JA 1CMFA 2K2FA 1XO5A 2KFFA 1MQ1A 1C7VA 3IF7A 4ORCB 1CDPA 4E68A 3KPXA 3OP0A 1BJFA 1UHIA 1ZMZA 1UHNA 1EXRA 2M3WA 2NZ0A 1QS7A 5I2OA 2V53A 1Y1UA 3IQOA 1KFUL 1OMVA 3F45A 2WCFA 2L2EA 1HQVA 1MXEA 2KGRA 1S6JA 1S1EA 1YX8A 1CM4A 2WCEA 2O5GA 4GGNA 4M2OA 1CB1A 1Y0VH 3NXAA 1JF2A 2HF5A 1LA0A 1GQMA 3VRRA 2I18A 1IH0A 1WRKA 3AKBA 3I5IC 2LVIA 4IL1A 1J7OA 3JVTC 1QATA 4GPLB 2EHBA 2PRUA 4F0ZB 1DJZA 1ALVA 4BY4A 4MEWA 4L9MA 2HQ8A 3GK1A 2KI6D 1YRUB 4NQGA 1FF1A 4QJ4B 3KHEA 4HRHA 3BUXB 3VGOA 2F3ZA 3O6BA 1NCZA 1UHKA 1XYDA 1QLKA 2ZKMX 2MHHA 1EL4A 3EVRA 2D8NA 1U5IB 2LVKA 1M46A 1BMOA 2BKIB 2BE4A 4GNKB 3FWCA 1KWOC 2MRDA 1DVIA 1IRJA 2KAVA 2M7NA 1H4BA 1F4OA 5G08A 1SCVA 3VRNA 4I5LB 2K7CA 2M8UA 2CXJA 4AQIA 2I2RE 2JTZA 3TZ1A 3BYAA 4YI8A 1S26D 1V1GA 3EKHA 4Q04A 1FBVA 4PHJA 2LVJA 1Q80A 1UHJA 1RWYA 2BBNA 1UWOA 1UUSA 1OMRA 3SG7A 2CNPA 3PN7B 3D10A 3TS5B 1A03A 1QIWA 2JU0A 2CBLA 2KFGA 3PATA 4MRYA 3C1VA 3GOFA 1XFVO 3KEVA 1GJYA 1K9KA 5AFPA 2BCAA 1IJ6A 2ZRSA 3I5HB 1JFKA 4A4BA 4DS7A 2AUCA 1SY9A 2MAZA 2JNXA 4XJKA 3RM1A 1M39A 2WNDA 1PRWA 2GGMA 4MN0A 3ICBA 1F70A 3OB2B 1Y6WA 2LLSA 3DVEA 4YBHB 1J55A 1BF5A 4PE0A 4FTGA 2JXCA 2JWWA 4I5JA 1PK0D 2CT9A 3LL8B 1S6IA 1R6PA 1ODBA 1D1OA 5AERA 1B8RA 1PVBA 4CFQA 1DMOA 3NSKA 1TIZA 5F6TA 2JT0A 1TN4A 1LINA 1AVSA 2M97A 3BQ3A 4WQ2A 1PVAA 1S5GZ 4AQJA 2F2OA 4MRXA 1N0YA 1WRZA 4D1EA 1CFDA 2AAOA 4NDBA 2KYFA 2Y1NA 3SJSA 1XFUO 1JFJA 4P2YB 1PALA 2Y1MA 1QX2A 1OQPA 2GV5A 4U8DA 3WNXB 1QLSA 1CTRA 1ZFSA 1KK8B 1NYAA 5I2LA 4GGFC 1QXPA 1UP5A 4MSPA 2LE9B 5HLOA 3E3RA 4MZLA 1TNPA 2K2AA 4PALA 2TN4A 4C0KA 1BOCA 4I5KA 4YI9A 1OSAA 4PDZA 4I5NB 1J7QA 1IJ5A 1K9PA 1PSRA 2ZNDA 4N5XA 1SCMC 1K94A 1WDCB 1SR6C 2F3YA 1LA3A 1V1FA 1ZOTB 1EJ3A 4JPZB 3GK2A 1A4PA 4PHKA 1QV0A 3NSOA 1S5GY 1M45A 4XJKB 3EK4A 3VRQA 2HPSA 3I5FB 1E8AA 4MZJA 1PULA 2QPTA 1QV1A 2JZIA 4GFTA 3O2PA 4HREE 1AJ4A 1DGUA 1KQMC 2EC6C 4ZCVA 1GGZA 2E6WA 4GBAA 1FI6A 3GK4X 4MBEA 2LP3A 1SW8A 1KSOA 2JPTA 2JC2A 1NCYA 1FW4A 1B7TY 1PSBA 2FOTA 2DOQA 3SG4A 5HYDA 1ZUZA 4GAOA 3DF0A 2WC8A 4DCKA 2KQ6A 2OTGB 1JUOA 2H61C 1W7JB 3DVMA 3PFVA 2PVBA 1DJXA 1L2OC 1QASA 4MLWA 5GQQC 5HLVA 2KI4C 3BOWA 1XK4C 4A4CA 3JTDB 1MHOA 5DKQA 5KTYA 1DJGA 1RECA 5I2QA 2K8MB 3MSEB 1N2DA 2LMUA 1AUIB 2LAPA 1OOJA 5KSZA 1TTXA 4OVNF 2P6BB 3CWGA 2PALA 1BLQA 1JF0A 3EK8A 3LLEA 1TNWA 4PE7A 1NX1A 2M1KB 2JQ6A 1TCFA 4PHMA 1WY9A 1TNXA 1CFFA 2PMYA 4UPGA 3WHUB 2BBMA 1KFUS 2L50A 2M9GA 1QIVA 4R1EA 1NP8A 1M63B 3FS7A 2LM5A 3O4YA 4OR9B 2KSPA 1YX7A 1Y1XA 2LNKA 2BL0B 1KSMA 2L0PA 3BUOB 1K93D 1QX7A 4N1GA 3NSLA 2NXQA 4NDCA 1ZACA 1XFZO 3CR5X 1GGWA 1NCXA 1G4YR 1CLBA 2AMIA 2KQYA 1WLMA 4HSZA 2JXLA 4PCWA 2PSRA 1JWDA 1QVIZ 1TOPA 1RFJA 4USLA 2LMVA 1OE9B 3PSRA 3OB1B 3AKAA 4WRIA 1CLMA 2RGIA 3TDIA 2WCBA 1DJIA 4OKHA 1JC2A 2OPOA 2M7LA 1CLLA 3NSIA 4QJ3B 2L98A 2ZNEA 1Y1AA 1XA5A 3CLNA 2F33A 2F8PA 2A4JA 5J3XA 2LP2A 5TNCA 2KBIA 3OHMB 1QJTA 3DF0B 3KF9A 2KFHA 2CTNA 1J7RA 5AANA 4YGEB 4DRWA 3WHTB 1YUUA 1IQ3A 3CGAA 5CPVA 3BOWB 1TRFA 4PE4A 4YGCB 2Q91A 3KO0A 1CDNA 1SYMA 3RLZA 2JOJA 4AOMA 2JRFA 3TDZA 4CIDA 3PN7C 3TS5C 3TDUA 1AP4A 3ZNIA 3SG5A 3TUYB 4PHNA 5ER4X 2KDHA 2KAYA 1QVIY 5HKZA 5ER5A 2H2KA 1KCYA 3LK0A 1B9AA 3I5HC 1F55A 1SL8A 2G2BA 2FJUB 2LCPA 3I5GB 4N1FA 2MLFC 4CLNA 2OS8B 3EVUA 3SG2A 4XYNA 1OZOA 2I7AA 2LC5A 2LVVA 1J1EA 3VROA 2ZN9A 1DJWA 4PE1A 1OMDA 2BCBA 1SKTA 1YVHA 1CFPA 2Q4UA 1OZSA 3BXKA 3SIAA 3A8RA 2KI6C 4DUQA 1C07A 4M2PA 1K95A 3IQQA 2ZFDA 5IBWA 1L7ZA 1EH2A 3SG6A 1KQVA 2G9BA 4CFRA 2KGBC 4YGBB 1X02A 4HRGA 2KYCA 1TCOB 2QACA 2K7DA 1S6CA 1KK7Z 1UHHA 1CDMA 4ETOA 4NDDA 1DJHA 2MJWB 1A75B 2GGZA 3I5IB 4YGDB 2F2PA 2M0RA 1SL9A 2K7BA 3JVTB 5HKWA 5K89A 4DIRA 3SIBA 1DGVA 2LLTA 2M49B 1HT9A 2L4IA 4JQ0D 2O60A 3PM8A 1AJ5A 2BE6A 1DF0B 1KK8C 1G33A 2WOSA 1RK9A 1YTZC 2NCPA 5HKYA 1NX3A 1SL7A 3BUMB 2B1UA 5D7FA 1IG5A 4OV2A 1WRLA 1J7PA 1F71A 1KWOB 1TNQA 1BG1A 1RTP1 1WDCC 1CMGA 1UURA 2FCDA 1SRAA 3SG3A 2LLUA 1CFCA 1KK7Y 2NLNA 5CSJA 2SCPA 2IS9A 2BCXA 1YRTB 3I5FC 2ISDA 2BKHB 1CDLA 1B4CA 1LKJA 1BR4B 3BUWB 5DKNA 5JJGA 1JSAA 4GGFA 1NUBA 3WXAA 1IKUA 1KFXL 1WLZA 3D0YA 4FQOA 1M31A 1BR1B 2KBMA 3HCMA 1CNPA 1IQ5A 1RJVA 5DKRA 3BUNB 1NX0A 2MBXA 5D69A 2MLEC 1EG3A 2BECA 2LANA 2OTGC 1RROA 2VRGA 4WQ3A 3FIAA 3A4UB 2KOTA 1B1GA 2JTTA 1F8HA 2PASA 3JTDC 1SBJA 4P5OE 1S3PA 2JULA 3DD4A 2I94A 2NCOA 1YUSA 2MA2A 2KAXA 1NPQA 4YRUA 3ZWHA 1NX2A 3DVJA 4M2QA 1B8CA 3EK7A 1ALWA 1A75A 1R2UA 3HX4A 1FI5A 2M1UA 2H61A 3OX6A 2ZRTA 3H4SE 1NSHA 1VRKA 1SMGA 1BU3A 1XFWO 4ZCUA 1MF8B 5PALA 4CPVA 1MUXA 1G8IA 1XK4A 1YURA 3AAJA 2BL0C 1KFXS 4JWQA 1DF0A 4ICBA 4MVFA 1QX5B 3CZTX 1YVLA 1A29A 2L5XB 1BT6A 1YR5A 3DVKA 5KU1A 1DJYA 1QTXA 2ZN8A 2LHIA 5I8NA 4MZKA 1K90D 3OX5A 3CR4X 1FPWA 1LVCD 2JNFA 2LV7A 3EVVA 2SASA 4TNCA 2K61A 3PALA 1N65A 1DTLA 1MWNA 2KHNA 4ORAB 1BODA 5FYXA 1XFYO 1SNLA 2EGDA 3CS1A 1H8BA 2M29A 3AAKA 3D0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHL A;  1MXL C;  1CKK A;  1F4Q A;  2HET A;  1A2X A;  1B8L A;  4QJ5 B;  2COL B;  3LK1 A;  1SCM B;  5CSN A;  1SR6 B;  1YUT A;  3LCP C;  3EKJ A;  4ORB B;  5AXI A;  2R2I A;  5CSF A;  3PLF B;  1S36 A;  1XVJ A;  5BPJ A;  1B47 A;  2Y4Q A;  2L4H A;  3QRX A;  3M0W A;  1AK8 A;  2JT3 A;  2JT8 A;  1XFX O;  2L51 A;  3CR2 A;  3CTN A;  3K21 A;  5CSI A;  1JBA A;  1KQM B;  1CM1 A;  2EC6 B;  1K9U A;  1U5I A;  1AHR A;  1EG4 A;  1MR8 A;  2K0J A;  3O78 A;  4YGA A;  2LUX A;  1W7I B;  1B7T Z;  3FWB A;  3TUY C;  2LUC A;  5JOL A;  1LXF C;  4OCI A;  4BY5 A;  1DT7 B;  1SK6 D;  5AEQ A;  1K96 A;  1IWQ A;  2CCM A;  2K7O A;  1C7W A;  1F54 A;  1NIW A;  1J1D A;  4GUK A;  1K2H A;  3I5G C;  1L2O B;  2LMT A;  2KI4 B;  2KNE A;  1IGV A;  2OS8 C;  3VRP A;  2HQW A;  5B8I B;  1NWD A;  2FCE A;  4C0L A;  2WOR A;  2E30 A;  1K8U A;  1SPY A;  2Y5I A;  4C0J A;  1CMF A;  2K2F A;  1XO5 A;  2KFF A;  1MQ1 A;  1C7V A;  3IF7 A;  4ORC B;  1CDP A;  4E68 A;  3KPX A;  3OP0 A;  1BJF A;  1UHI A;  1ZMZ A;  1UHN A;  1EXR A;  2M3W A;  2NZ0 A;  1QS7 A;  5I2O A;  2V53 A;  1Y1U A;  3IQO A;  1KFU L;  1OMV A;  3F45 A;  2WCF A;  2L2E A;  1HQV A;  1MXE A;  2KGR A;  1S6J A;  1S1E A;  1YX8 A;  1CM4 A;  2WCE A;  2O5G A;  4GGN A;  4M2O A;  1CB1 A;  1Y0V H;  3NXA A;  1JF2 A;  2HF5 A;  1LA0 A;  1GQM A;  3VRR A;  2I18 A;  1IH0 A;  1WRK A;  3AKB A;  3I5I C;  2LVI A;  4IL1 A;  1J7O A;  3JVT C;  1QAT A;  4GPL B;  2EHB A;  2PRU A;  4F0Z B;  1DJZ A;  1ALV A;  4BY4 A;  4MEW A;  4L9M A;  2HQ8 A;  3GK1 A;  2KI6 D;  1YRU B;  4NQG A;  1FF1 A;  4QJ4 B;  3KHE A;  4HRH A;  3BUX B;  3VGO A;  2F3Z A;  3O6B A;  1NCZ A;  1UHK A;  1XYD A;  1QLK A;  2ZKM X;  2MHH A;  1EL4 A;  3EVR A;  2D8N A;  1U5I B;  2LVK A;  1M46 A;  1BMO A;  2BKI B;  2BE4 A;  4GNK B;  3FWC A;  1KWO C;  2MRD A;  1DVI A;  1IRJ A;  2KAV A;  2M7N A;  1H4B A;  1F4O A;  5G08 A;  1SCV A;  3VRN A;  4I5L B;  2K7C A;  2M8U A;  2CXJ A;  4AQI A;  2I2R E;  2JTZ A;  3TZ1 A;  3BYA A;  4YI8 A;  1S26 D;  1V1G A;  3EKH A;  4Q04 A;  1FBV A;  4PHJ A;  2LVJ A;  1Q80 A;  1UHJ A;  1RWY A;  2BBN A;  1UWO A;  1UUS A;  1OMR A;  3SG7 A;  2CNP A;  3PN7 B;  3D10 A;  3TS5 B;  1A03 A;  1QIW A;  2JU0 A;  2CBL A;  2KFG A;  3PAT A;  4MRY A;  3C1V A;  3GOF A;  1XFV O;  3KEV A;  1GJY A;  1K9K A;  5AFP A;  2BCA A;  1IJ6 A;  2ZRS A;  3I5H B;  1JFK A;  4A4B A;  4DS7 A;  2AUC A;  1SY9 A;  2MAZ A;  2JNX A;  4XJK A;  3RM1 A;  1M39 A;  2WND A;  1PRW A;  2GGM A;  4MN0 A;  3ICB A;  1F70 A;  3OB2 B;  1Y6W A;  2LLS A;  3DVE A;  4YBH B;  1J55 A;  1BF5 A;  4PE0 A;  4FTG A;  2JXC A;  2JWW A;  4I5J A;  1PK0 D;  2CT9 A;  3LL8 B;  1S6I A;  1R6P A;  1ODB A;  1D1O A;  5AER A;  1B8R A;  1PVB A;  4CFQ A;  1DMO A;  3NSK A;  1TIZ A;  5F6T A;  2JT0 A;  1TN4 A;  1LIN A;  1AVS A;  2M97 A;  3BQ3 A;  4WQ2 A;  1PVA A;  1S5G Z;  4AQJ A;  2F2O A;  4MRX A;  1N0Y A;  1WRZ A;  4D1E A;  1CFD A;  2AAO A;  4NDB A;  2KYF A;  2Y1N A;  3SJS A;  1XFU O;  1JFJ A;  4P2Y B;  1PAL A;  2Y1M A;  1QX2 A;  1OQP A;  2GV5 A;  4U8D A;  3WNX B;  1QLS A;  1CTR A;  1ZFS A;  1KK8 B;  1NYA A;  5I2L A;  4GGF C;  1QXP A;  1UP5 A;  4MSP A;  2LE9 B;  5HLO A;  3E3R A;  4MZL A;  1TNP A;  2K2A A;  4PAL A;  2TN4 A;  4C0K A;  1BOC A;  4I5K A;  4YI9 A;  1OSA A;  4PDZ A;  4I5N B;  1J7Q A;  1IJ5 A;  1K9P A;  1PSR A;  2ZND A;  4N5X A;  1SCM C;  1K94 A;  1WDC B;  1SR6 C;  2F3Y A;  1LA3 A;  1V1F A;  1ZOT B;  1EJ3 A;  4JPZ B;  3GK2 A;  1A4P A;  4PHK A;  1QV0 A;  3NSO A;  1S5G Y;  1M45 A;  4XJK B;  3EK4 A;  3VRQ A;  2HPS A;  3I5F B;  1E8A A;  4MZJ A;  1PUL A;  2QPT A;  1QV1 A;  2JZI A;  4GFT A;  3O2P A;  4HRE E;  1AJ4 A;  1DGU A;  1KQM C;  2EC6 C;  4ZCV A;  1GGZ A;  2E6W A;  4GBA A;  1FI6 A;  3GK4 X;  4MBE A;  2LP3 A;  1SW8 A;  1KSO A;  2JPT A;  2JC2 A;  1NCY A;  1FW4 A;  1B7T Y;  1PSB A;  2FOT A;  2DOQ A;  3SG4 A;  5HYD A;  1ZUZ A;  4GAO A;  3DF0 A;  2WC8 A;  4DCK A;  2KQ6 A;  2OTG B;  1JUO A;  2H61 C;  1W7J B;  3DVM A;  3PFV A;  2PVB A;  1DJX A;  1L2O C;  1QAS A;  4MLW A;  5GQQ C;  5HLV A;  2KI4 C;  3BOW A;  1XK4 C;  4A4C A;  3JTD B;  1MHO A;  5DKQ A;  5KTY A;  1DJG A;  1REC A;  5I2Q A;  2K8M B;  3MSE B;  1N2D A;  2LMU A;  1AUI B;  2LAP A;  1OOJ A;  5KSZ A;  1TTX A;  4OVN F;  2P6B B;  3CWG A;  2PAL A;  1BLQ A;  1JF0 A;  3EK8 A;  3LLE A;  1TNW A;  4PE7 A;  1NX1 A;  2M1K B;  2JQ6 A;  1TCF A;  4PHM A;  1WY9 A;  1TNX A;  1CFF A;  2PMY A;  4UPG A;  3WHU B;  2BBM A;  1KFU S;  2L50 A;  2M9G A;  1QIV A;  4R1E A;  1NP8 A;  1M63 B;  3FS7 A;  2LM5 A;  3O4Y A;  4OR9 B;  2KSP A;  1YX7 A;  1Y1X A;  2LNK A;  2BL0 B;  1KSM A;  2L0P A;  3BUO B;  1K93 D;  1QX7 A;  4N1G A;  3NSL A;  2NXQ A;  4NDC A;  1ZAC A;  1XFZ O;  3CR5 X;  1GGW A;  1NCX A;  1G4Y R;  1CLB A;  2AMI A;  2KQY A;  1WLM A;  4HSZ A;  2JXL A;  4PCW A;  2PSR A;  1JWD A;  1QVI Z;  1TOP A;  1RFJ A;  4USL A;  2LMV A;  1OE9 B;  3PSR A;  3OB1 B;  3AKA A;  4WRI A;  1CLM A;  2RGI A;  3TDI A;  2WCB A;  1DJI A;  4OKH A;  1JC2 A;  2OPO A;  2M7L A;  1CLL A;  3NSI A;  4QJ3 B;  2L98 A;  2ZNE A;  1Y1A A;  1XA5 A;  3CLN A;  2F33 A;  2F8P A;  2A4J A;  5J3X A;  2LP2 A;  5TNC A;  2KBI A;  3OHM B;  1QJT A;  3DF0 B;  3KF9 A;  2KFH A;  2CTN A;  1J7R A;  5AAN A;  4YGE B;  4DRW A;  3WHT B;  1YUU A;  1IQ3 A;  3CGA A;  5CPV A;  3BOW B;  1TRF A;  4PE4 A;  4YGC B;  2Q91 A;  3KO0 A;  1CDN A;  1SYM A;  3RLZ A;  2JOJ A;  4AOM A;  2JRF A;  3TDZ A;  4CID A;  3PN7 C;  3TS5 C;  3TDU A;  1AP4 A;  3ZNI A;  3SG5 A;  3TUY B;  4PHN A;  5ER4 X;  2KDH A;  2KAY A;  1QVI Y;  5HKZ A;  5ER5 A;  2H2K A;  1KCY A;  3LK0 A;  1B9A A;  3I5H C;  1F55 A;  1SL8 A;  2G2B A;  2FJU B;  2LCP A;  3I5G B;  4N1F A;  2MLF C;  4CLN A;  2OS8 B;  3EVU A;  3SG2 A;  4XYN A;  1OZO A;  2I7A A;  2LC5 A;  2LVV A;  1J1E A;  3VRO A;  2ZN9 A;  1DJW A;  4PE1 A;  1OMD A;  2BCB A;  1SKT A;  1YVH A;  1CFP A;  2Q4U A;  1OZS A;  3BXK A;  3SIA A;  3A8R A;  2KI6 C;  4DUQ A;  1C07 A;  4M2P A;  1K95 A;  3IQQ A;  2ZFD A;  5IBW A;  1L7Z A;  1EH2 A;  3SG6 A;  1KQV A;  2G9B A;  4CFR A;  2KGB C;  4YGB B;  1X02 A;  4HRG A;  2KYC A;  1TCO B;  2QAC A;  2K7D A;  1S6C A;  1KK7 Z;  1UHH A;  1CDM A;  4ETO A;  4NDD A;  1DJH A;  2MJW B;  1A75 B;  2GGZ A;  3I5I B;  4YGD B;  2F2P A;  2M0R A;  1SL9 A;  2K7B A;  3JVT B;  5HKW A;  5K89 A;  4DIR A;  3SIB A;  1DGV A;  2LLT A;  2M49 B;  1HT9 A;  2L4I A;  4JQ0 D;  2O60 A;  3PM8 A;  1AJ5 A;  2BE6 A;  1DF0 B;  1KK8 C;  1G33 A;  2WOS A;  1RK9 A;  1YTZ C;  2NCP A;  5HKY A;  1NX3 A;  1SL7 A;  3BUM B;  2B1U A;  5D7F A;  1IG5 A;  4OV2 A;  1WRL A;  1J7P A;  1F71 A;  1KWO B;  1TNQ A;  1BG1 A;  1RTP 1;  1WDC C;  1CMG A;  1UUR A;  2FCD A;  1SRA A;  3SG3 A;  2LLU A;  1CFC A;  1KK7 Y;  2NLN A;  5CSJ A;  2SCP A;  2IS9 A;  2BCX A;  1YRT B;  3I5F C;  2ISD A;  2BKH B;  1CDL A;  1B4C A;  1LKJ A;  1BR4 B;  3BUW B;  5DKN A;  5JJG A;  1JSA A;  4GGF A;  1NUB A;  3WXA A;  1IKU A;  1KFX L;  1WLZ A;  3D0Y A;  4FQO A;  1M31 A;  1BR1 B;  2KBM A;  3HCM A;  1CNP A;  1IQ5 A;  1RJV A;  5DKR A;  3BUN B;  1NX0 A;  2MBX A;  5D69 A;  2MLE C;  1EG3 A;  2BEC A;  2LAN A;  2OTG C;  1RRO A;  2VRG A;  4WQ3 A;  3FIA A;  3A4U B;  2KOT A;  1B1G A;  2JTT A;  1F8H A;  2PAS A;  3JTD C;  1SBJ A;  4P5O E;  1S3P A;  2JUL A;  3DD4 A;  2I94 A;  2NCO A;  1YUS A;  2MA2 A;  2KAX A;  1NPQ A;  4YRU A;  3ZWH A;  1NX2 A;  3DVJ A;  4M2Q A;  1B8C A;  3EK7 A;  1ALW A;  1A75 A;  1R2U A;  3HX4 A;  1FI5 A;  2M1U A;  2H61 A;  3OX6 A;  2ZRT A;  3H4S E;  1NSH A;  1VRK A;  1SMG A;  1BU3 A;  1XFW O;  4ZCU A;  1MF8 B;  5PAL A;  4CPV A;  1MUX A;  1G8I A;  1XK4 A;  1YUR A;  3AAJ A;  2BL0 C;  1KFX S;  4JWQ A;  1DF0 A;  4ICB A;  4MVF A;  1QX5 B;  3CZT X;  1YVL A;  1A29 A;  2L5X B;  1BT6 A;  1YR5 A;  3DVK A;  5KU1 A;  1DJY A;  1QTX A;  2ZN8 A;  2LHI A;  5I8N A;  4MZK A;  1K90 D;  3OX5 A;  3CR4 X;  1FPW A;  1LVC D;  2JNF A;  2LV7 A;  3EVV A;  2SAS A;  4TNC A;  2K61 A;  3PAL A;  1N65 A;  1DTL A;  1MWN A;  2KHN A;  4ORA B;  1BOD A;  5FYX A;  1XFY O;  1SNL A;  2EGD A;  3CS1 A;  1H8B A;  2M29 A;  3AAK A;  3D0Y B; 
#chains in the Genus database with same CATH topology
 2LHL A;  1MXL C;  1CKK A;  1F4Q A;  2HET A;  1A2X A;  1B8L A;  3DXL A;  2COL B;  4QJ5 B;  3L4A A;  3LK1 A;  1SCM B;  5CSN A;  1SR6 B;  1YUT A;  3LCP C;  3EKJ A;  4ORB B;  5AXI A;  2R2I A;  5CSF A;  3PLF B;  1S36 A;  3D74 A;  1XVJ A;  2JPO A;  1B47 A;  2Y4Q A;  2L4H A;  3QRX A;  5BPJ A;  3M0W A;  1AK8 A;  3CZ2 A;  2JT3 A;  2JT8 A;  1XFX O;  2ERB A;  2L51 A;  3CR2 A;  3CTN A;  3K21 A;  5CSI A;  1JBA A;  1KQM B;  1CM1 A;  2EC6 B;  1K9U A;  1U5I A;  3BJH A;  1AHR A;  1EG4 A;  1MR8 A;  2K0J A;  3BFB A;  3O78 A;  4YGA A;  2LUX A;  1W7I B;  1B7T Z;  3FWB A;  3TUY C;  2LUC A;  5JOL A;  1LXF C;  3OGN A;  4OCI A;  4BY5 A;  1DT7 B;  1SK6 D;  5AEQ A;  2WCJ A;  1K96 A;  1IWQ A;  2CCM A;  2K7O A;  1C7W A;  1F54 A;  1NIW A;  1J1D A;  4GUK A;  1K2H A;  3I5G C;  1L2O B;  2LMT A;  2KI4 B;  2KNE A;  1IGV A;  2OS8 C;  3VRP A;  2HQW A;  5B8I B;  1NWD A;  3FE9 A;  2FCE A;  4C0L A;  2WOR A;  2E30 A;  1K8U A;  1SPY A;  2Y5I A;  4C0J A;  1CMF A;  2K2F A;  1XO5 A;  3VB1 A;  2KFF A;  1MQ1 A;  1C7V A;  3IF7 A;  4ORC B;  1CDP A;  4E68 A;  1XFR A;  3KPX A;  4INW A;  3OP0 A;  1BJF A;  1UHI A;  1ZMZ A;  1UHN A;  1EXR A;  2M3W A;  2NZ0 A;  1QS7 A;  5I2O A;  2V53 A;  3D77 A;  1Y1U A;  3IQO A;  1KFU L;  1OMV A;  3F45 A;  2WCF A;  2L2E A;  1HQV A;  1MXE A;  2KGR A;  1S6J A;  1S1E A;  1YX8 A;  1CM4 A;  1OOF A;  2WCE A;  2O5G A;  4GGN A;  4M2O A;  1CB1 A;  1Y0V H;  5HL1 A;  3NXA A;  1JF2 A;  2HF5 A;  1LA0 A;  1GQM A;  3VRR A;  2I18 A;  1IH0 A;  3BFA A;  1WRK A;  3AKB A;  3I5I C;  2LVI A;  4IL1 A;  1J7O A;  3SS4 A;  3DYE A;  3JVT C;  1QAT A;  4GPL B;  2EHB A;  2PRU A;  3Q8I A;  5FI7 A;  4F0Z B;  1DJZ A;  1ALV A;  4BY4 A;  4MEW A;  4L9M A;  2HQ8 A;  3GK1 A;  2KI6 D;  1YRU B;  4NQG A;  1FF1 A;  4QJ4 B;  3KHE A;  4HRH A;  1TWO A;  3BUX B;  3VGO A;  2F3Z A;  3O6B A;  1NCZ A;  1UHK A;  1XYD A;  1QLK A;  2ZKM X;  1OOI X;  1TUJ A;  1OW4 A;  1EL4 A;  2MHH A;  3EVR A;  2D8N A;  1U5I B;  2LVK A;  1M46 A;  1BMO A;  3CZ1 A;  1C3Z A;  2BKI B;  2BE4 A;  4GNK B;  3FWC A;  1KWO C;  2MRD A;  1DVI A;  1IRJ A;  2KAV A;  2M7N A;  2FJY A;  1H4B A;  1F4O A;  5G08 A;  1SCV A;  3VRN A;  4I5L B;  2K7C A;  2M8U A;  2CXJ A;  4AQI A;  2I2R E;  5FI6 A;  2JTZ A;  3TZ1 A;  3BYA A;  4YI8 A;  1S26 D;  1V1G A;  3EKH A;  4Q04 A;  1FBV A;  4PHJ A;  2LVJ A;  1Q80 A;  1UHJ A;  3D76 A;  1RWY A;  2BBN A;  1UWO A;  1UUS A;  1OMR A;  3SG7 A;  2CNP A;  3PN7 B;  3D10 A;  3TS5 B;  1A03 A;  1QIW A;  2JU0 A;  2CBL A;  2KFG A;  3PAT A;  4INX A;  4MRY A;  3C1V A;  3GOF A;  1XFV O;  2QEB A;  1TUZ A;  3KEV A;  1GJY A;  1K9K A;  3IVT A;  2BCA A;  5AFP A;  1IJ6 A;  2ZRS A;  3CDN A;  3B7A A;  1JFK A;  3I5H B;  4A4B A;  4DS7 A;  3FE6 A;  2AUC A;  1SY9 A;  2MAZ A;  5DIC A;  2JNX A;  4XJK A;  3RM1 A;  1M39 A;  2WND A;  1PRW A;  2GGM A;  4MN0 A;  2L5Y A;  3ICB A;  1F70 A;  3OB2 B;  1Y6W A;  2LLS A;  3DVE A;  4YBH B;  1J55 A;  3D73 A;  1BF5 A;  4PE0 A;  4FTG A;  2JXC A;  2JWW A;  4I5J A;  1PK0 D;  2CT9 A;  3LL8 B;  1S6I A;  1R6P A;  1ODB A;  3L4L A;  1D1O A;  5AER A;  1B8R A;  1PVB A;  4CFQ A;  4F7F A;  1DMO A;  1ORG A;  3NSK A;  1TIZ A;  5F6T A;  2JT0 A;  1TN4 A;  3DZT A;  1LIN A;  1AVS A;  2M97 A;  3BQ3 A;  3FE8 A;  4WQ2 A;  1PVA A;  1S5G Z;  4AQJ A;  2F2O A;  4MRX A;  1N0Y A;  1WRZ A;  4D1E A;  1CFD A;  2AAO A;  3UNW A;  4NDB A;  2KYF A;  2Y1N A;  3SJS A;  1XFU O;  1JFJ A;  4P2Y B;  1PAL A;  2Y1M A;  1QX2 A;  1OQP A;  2GV5 A;  4U8D A;  3WNX B;  1QLS A;  1CTR A;  3S0A A;  1ZFS A;  1KK8 B;  1NYA A;  5I2L A;  2WCK A;  4GGF C;  1QXP A;  1UP5 A;  3R1V A;  4MSP A;  2LE9 B;  4JD9 A;  5HLO A;  5D3O A;  3E3R A;  4MZL A;  1TNP A;  2K2A A;  4PAL A;  2TN4 A;  4C0K A;  1BOC A;  4I5K A;  4YI9 A;  1OSA A;  4PDZ A;  4I5N B;  1J7Q A;  1IJ5 A;  1K9P A;  1PSR A;  2ZND A;  4N5X A;  1SCM C;  1K94 A;  1WDC B;  1SR6 C;  2F3Y A;  2QEH A;  3O4X A;  3R1P A;  3PJI A;  1LA3 A;  1V1F A;  1ZOT B;  2QEV A;  2BNX A;  1EJ3 A;  4JPZ B;  3GK2 A;  1A4P A;  4PHK A;  1QV0 A;  2GTE A;  1S5G Y;  1M45 A;  3BFH A;  3NSO A;  4XJK B;  3EK4 A;  3VRQ A;  2HPS A;  3I5F B;  1E8A A;  4MZJ A;  1PUL A;  2QPT A;  1QV1 A;  2JZI A;  4GFT A;  3O2P A;  4HRE E;  1AJ4 A;  1DGU A;  1KQM C;  2EC6 C;  5EL2 A;  1GGZ A;  4ZCV A;  2E6W A;  4GBA A;  1FI6 A;  2QEO A;  3GK4 X;  4MBE A;  2LP3 A;  1SW8 A;  1KSO A;  2JPT A;  2JC2 A;  1NCY A;  1FW4 A;  1B7T Y;  1PSB A;  2FOT A;  2DOQ A;  3SG4 A;  5HYD A;  3D75 A;  1ZUZ A;  4GAO A;  3DF0 A;  2WC8 A;  4DCK A;  2KQ6 A;  2OTG B;  4KYN A;  1JUO A;  2H61 C;  1W7J B;  3DVM A;  3PFV A;  2PVB A;  4OZD A;  1DJX A;  1L2O C;  1QAS A;  4MLW A;  5GQQ C;  5HLV A;  2KI4 C;  3BOW A;  1XK4 C;  1P28 A;  4A4C A;  3JTD B;  1MHO A;  5DKQ A;  5KTY A;  1DJG A;  1REC A;  5I2Q A;  2K8M B;  3MSE B;  1N2D A;  3B86 A;  2LMU A;  3NHT A;  1AUI B;  2LAP A;  1OOJ A;  5KSZ A;  1GM0 A;  1TTX A;  4FQT A;  2P6B B;  3CWG A;  2PAL A;  4OVN F;  1BLQ A;  2P70 A;  1C3Y A;  1JF0 A;  3EK8 A;  3LLE A;  1TNW A;  4PE7 A;  3V2L A;  2WC5 A;  1NX1 A;  2M1K B;  2JQ6 A;  1TCF A;  4PHM A;  1WY9 A;  1TNX A;  1CFF A;  2PMY A;  4UPG A;  3WHU B;  2BBM A;  1KFU S;  4IJ7 A;  2L50 A;  2M9G A;  1QIV A;  4R1E A;  1NP8 A;  1M63 B;  3FS7 A;  2LM5 A;  3O4Y A;  4OR9 B;  2KSP A;  3RZS A;  1YX7 A;  1Y1X A;  2LNK A;  2BL0 B;  1KSM A;  2L0P A;  3BUO B;  1K93 D;  1QX7 A;  4N1G A;  3NSL A;  2NXQ A;  4NDC A;  1ZAC A;  1XFZ O;  3CR5 X;  1GGW A;  1NCX A;  3K1E A;  1G4Y R;  1CLB A;  2WCM A;  2AMI A;  2KQY A;  1WLM A;  4HSZ A;  2JXL A;  3QME A;  2PSR A;  4PCW A;  1JWD A;  1QVI Z;  1TOP A;  1RFJ A;  4USL A;  2LMV A;  1OE9 B;  3PSR A;  3OB1 B;  3AKA A;  3CAB A;  4WRI A;  1CLM A;  2RGI A;  3TDI A;  2WCB A;  1DJI A;  4OKH A;  1JC2 A;  2OPO A;  2M7L A;  1CLL A;  3NSI A;  4QJ3 B;  2L98 A;  2ZNE A;  1Y1A A;  1XA5 A;  3CLN A;  2F33 A;  2F8P A;  2A4J A;  3NGV A;  2LP2 A;  5J3X A;  5TNC A;  3SS5 A;  2KBI A;  3OHM B;  1QJT A;  3DF0 B;  3KF9 A;  2KFH A;  2BAP A;  2CTN A;  2WCL A;  1J7R A;  5AAN A;  4YGE B;  4DRW A;  1DEL A;  3WHT B;  1YUU A;  1IQ3 A;  3CGA A;  5CPV A;  3BOW B;  1TRF A;  4PE4 A;  4YGC B;  2KLD A;  2Q91 A;  3KO0 A;  1CDN A;  1SYM A;  3RLZ A;  2WC6 A;  2JOJ A;  2PQL A;  3B6X A;  4AOM A;  2JRF A;  3TDZ A;  4CID A;  3PN7 C;  4PT1 A;  5I94 A;  3TS5 C;  3TDU A;  3S0D A;  1AP4 A;  3ZNI A;  3SG5 A;  3TUY B;  4PHN A;  5ER4 X;  2KDH A;  2KAY A;  1QVI Y;  5HKZ A;  5ER5 A;  2H2K A;  3R72 A;  1KCY A;  3CZ0 A;  3LK0 A;  1B9A A;  3I5H C;  1F55 A;  1SL8 A;  2G2B A;  2FJU B;  2LCP A;  3S0B A;  3I5G B;  4N1F A;  1QWV A;  2MLF C;  4CLN A;  2OS8 B;  3EVU A;  3SG2 A;  4XYN A;  1OZO A;  2I7A A;  2LC5 A;  2LVV A;  1J1E A;  3VRO A;  2ZN9 A;  3B88 A;  1DJW A;  4PE1 A;  1OMD A;  3S0F A;  2BCB A;  1SKT A;  3UO9 A;  1YVH A;  1CFP A;  2KLE A;  1OZS A;  2Q4U A;  3BXK A;  3A8R A;  2KI6 C;  3SIA A;  4DUQ A;  1C07 A;  4M2P A;  1K95 A;  3IQQ A;  2ZFD A;  5IBW A;  1L7Z A;  1EH2 A;  3SG6 A;  1KQV A;  2G9B A;  2L2C A;  2KGB C;  4CFR A;  4YGB B;  1X02 A;  1DEK A;  4HRG A;  2KYC A;  1TCO B;  2QAC A;  2K7D A;  1S6C A;  1KK7 Z;  1UHH A;  3D78 A;  1CDM A;  5FI2 A;  3SS3 A;  4ETO A;  1DC1 A;  3N7H A;  4NDD A;  1DJH A;  1W9Z A;  1DQE A;  2MJW B;  1A75 B;  2GGZ A;  3I5I B;  3S0G A;  4YGD B;  3R1O A;  2F2P A;  2M0R A;  1SL9 A;  2K7B A;  3JVT B;  5HKW A;  5K89 A;  2PYQ A;  4DIR A;  3SIB A;  1DGV A;  3NHI A;  2LLT A;  3OBV A;  2M49 B;  1HT9 A;  2L4I A;  4JQ0 D;  2O60 A;  3PM8 A;  4JKT A;  1IIO A;  1AJ5 A;  2BE6 A;  1DF0 B;  1OOG A;  1KK8 C;  1G33 A;  3L47 A;  2WOS A;  2YGU A;  1RK9 A;  1YTZ C;  2NCP A;  5HKY A;  1NX3 A;  1SL7 A;  2QDI A;  3BUM B;  2B1U A;  5D7F A;  1IG5 A;  2K60 A;  4OV2 A;  1WRL A;  1J7P A;  1OOH A;  1F71 A;  1KWO B;  1TNQ A;  1BG1 A;  1RTP 1;  1WDC C;  1CMG A;  1UUR A;  2FCD A;  1SRA A;  3SG3 A;  2LLU A;  1CFC A;  1KK7 Y;  2NLN A;  5CSJ A;  2SCP A;  2IS9 A;  2BCX A;  1YRT B;  3I5F C;  2ISD A;  2BKH B;  1CDL A;  1B4C A;  1LKJ A;  1BR4 B;  3BUW B;  5DKN A;  5JJG A;  1JSA A;  4GGF A;  1Z2C B;  1NUB A;  3WXA A;  1SSE B;  1KFX L;  1IKU A;  1WLZ A;  3D0Y A;  4FQO A;  1M31 A;  1BR1 B;  2KBM A;  3HCM A;  1CNP A;  1IQ5 A;  1RJV A;  5DKR A;  3BUN B;  1NX0 A;  2MBX A;  5D69 A;  2MLE C;  1EG3 A;  2BEC A;  2LAN A;  2OTG C;  1RRO A;  2VRG A;  2P71 A;  4WQ3 A;  3FIA A;  3B87 A;  3A4U B;  2KOT A;  1B1G A;  2JTT A;  1F8H A;  2PAS A;  3JTD C;  1SBJ A;  3EG5 B;  4P5O E;  1S3P A;  2JUL A;  3DD4 A;  2WCH A;  2I94 A;  2NCO A;  1YUS A;  2MA2 A;  2KAX A;  1NPQ A;  4YRU A;  3ZWH A;  1NX2 A;  3DVJ A;  4M2Q A;  1B8C A;  3EK7 A;  1ALW A;  1A75 A;  1R2U A;  3HX4 A;  1FI5 A;  2M1U A;  2H61 A;  3OX6 A;  1LS8 A;  2ZRT A;  3H4S E;  1NSH A;  1VRK A;  1SMG A;  1BU3 A;  1XFW O;  3PM2 A;  4ZCU A;  1MF8 B;  5PAL A;  3S0E A;  1MUX A;  4CPV A;  1G8I A;  1XK4 A;  1YUR A;  3AAJ A;  2BL0 C;  2KPH A;  1KFX S;  4JWQ A;  1DF0 A;  4ICB A;  4MVF A;  1QX5 B;  3CZT X;  1YVL A;  1A29 A;  2L5X B;  1BT6 A;  1YR5 A;  3DVK A;  5KU1 A;  1DJY A;  1QTX A;  2ZN8 A;  2LHI A;  5I8N A;  4MZK A;  1K90 D;  3OX5 A;  3CR4 X;  1FPW A;  1LVC D;  2JNF A;  3DY9 A;  2LV7 A;  3EVV A;  2SAS A;  4TNC A;  2K61 A;  3PAL A;  1N65 A;  1DTL A;  1MWN A;  3CYZ A;  2H8V A;  2KHN A;  4ORA B;  1BOD A;  5FYX A;  1XFY O;  1SNL A;  2EGD A;  1Z4H A;  1T14 A;  3CS1 A;  1H8B A;  2M29 A;  3AAK A;  3D0Y B; 
#chains in the Genus database with same CATH homology
 2LHL A;  1MXL C;  1CKK A;  1F4Q A;  2HET A;  1A2X A;  1B8L A;  4QJ5 B;  2COL B;  3LK1 A;  1SCM B;  5CSN A;  1SR6 B;  1YUT A;  3LCP C;  3EKJ A;  4ORB B;  5AXI A;  2R2I A;  5CSF A;  3PLF B;  1S36 A;  1XVJ A;  5BPJ A;  1B47 A;  2Y4Q A;  2L4H A;  3QRX A;  3M0W A;  1AK8 A;  2JT3 A;  2JT8 A;  1XFX O;  2L51 A;  3CR2 A;  3CTN A;  3K21 A;  5CSI A;  1JBA A;  1KQM B;  1CM1 A;  2EC6 B;  1K9U A;  1U5I A;  1AHR A;  1EG4 A;  1MR8 A;  2K0J A;  3O78 A;  4YGA A;  2LUX A;  1W7I B;  1B7T Z;  3FWB A;  3TUY C;  2LUC A;  5JOL A;  1LXF C;  4OCI A;  4BY5 A;  1DT7 B;  1SK6 D;  5AEQ A;  1K96 A;  1IWQ A;  2CCM A;  2K7O A;  1C7W A;  1F54 A;  1NIW A;  1J1D A;  4GUK A;  1K2H A;  3I5G C;  1L2O B;  2LMT A;  2KI4 B;  2KNE A;  1IGV A;  2OS8 C;  3VRP A;  2HQW A;  5B8I B;  1NWD A;  2FCE A;  4C0L A;  2WOR A;  2E30 A;  1K8U A;  1SPY A;  2Y5I A;  4C0J A;  1CMF A;  2K2F A;  1XO5 A;  2KFF A;  1MQ1 A;  1C7V A;  3IF7 A;  4ORC B;  1CDP A;  4E68 A;  3KPX A;  3OP0 A;  1BJF A;  1UHI A;  1ZMZ A;  1UHN A;  1EXR A;  2M3W A;  2NZ0 A;  1QS7 A;  5I2O A;  2V53 A;  1Y1U A;  3IQO A;  1KFU L;  1OMV A;  3F45 A;  2WCF A;  2L2E A;  1HQV A;  1MXE A;  2KGR A;  1S6J A;  1S1E A;  1YX8 A;  1CM4 A;  2WCE A;  2O5G A;  4GGN A;  4M2O A;  1CB1 A;  1Y0V H;  3NXA A;  1JF2 A;  2HF5 A;  1LA0 A;  1GQM A;  3VRR A;  2I18 A;  1IH0 A;  1WRK A;  3AKB A;  3I5I C;  2LVI A;  4IL1 A;  1J7O A;  3JVT C;  1QAT A;  4GPL B;  2EHB A;  2PRU A;  4F0Z B;  1DJZ A;  1ALV A;  4BY4 A;  4MEW A;  4L9M A;  2HQ8 A;  3GK1 A;  2KI6 D;  1YRU B;  4NQG A;  1FF1 A;  4QJ4 B;  3KHE A;  4HRH A;  3BUX B;  3VGO A;  2F3Z A;  3O6B A;  1NCZ A;  1UHK A;  1XYD A;  1QLK A;  2ZKM X;  2MHH A;  1EL4 A;  3EVR A;  2D8N A;  1U5I B;  2LVK A;  1M46 A;  1BMO A;  2BKI B;  2BE4 A;  4GNK B;  3FWC A;  1KWO C;  2MRD A;  1DVI A;  1IRJ A;  2KAV A;  2M7N A;  1H4B A;  1F4O A;  5G08 A;  1SCV A;  3VRN A;  4I5L B;  2K7C A;  2M8U A;  2CXJ A;  4AQI A;  2I2R E;  2JTZ A;  3TZ1 A;  3BYA A;  4YI8 A;  1S26 D;  1V1G A;  3EKH A;  4Q04 A;  1FBV A;  4PHJ A;  2LVJ A;  1Q80 A;  1UHJ A;  1RWY A;  2BBN A;  1UWO A;  1UUS A;  1OMR A;  3SG7 A;  2CNP A;  3PN7 B;  3D10 A;  3TS5 B;  1A03 A;  1QIW A;  2JU0 A;  2CBL A;  2KFG A;  3PAT A;  4MRY A;  3C1V A;  3GOF A;  1XFV O;  3KEV A;  1GJY A;  1K9K A;  5AFP A;  2BCA A;  1IJ6 A;  2ZRS A;  3I5H B;  1JFK A;  4A4B A;  4DS7 A;  2AUC A;  1SY9 A;  2MAZ A;  2JNX A;  4XJK A;  3RM1 A;  1M39 A;  2WND A;  1PRW A;  2GGM A;  4MN0 A;  3ICB A;  1F70 A;  3OB2 B;  1Y6W A;  2LLS A;  3DVE A;  4YBH B;  1J55 A;  1BF5 A;  4PE0 A;  4FTG A;  2JXC A;  2JWW A;  4I5J A;  1PK0 D;  2CT9 A;  3LL8 B;  1S6I A;  1R6P A;  1ODB A;  1D1O A;  5AER A;  1B8R A;  1PVB A;  4CFQ A;  1DMO A;  3NSK A;  1TIZ A;  5F6T A;  2JT0 A;  1TN4 A;  1LIN A;  1AVS A;  2M97 A;  3BQ3 A;  4WQ2 A;  1PVA A;  1S5G Z;  4AQJ A;  2F2O A;  4MRX A;  1N0Y A;  1WRZ A;  4D1E A;  1CFD A;  2AAO A;  4NDB A;  2KYF A;  2Y1N A;  3SJS A;  1XFU O;  1JFJ A;  4P2Y B;  1PAL A;  2Y1M A;  1QX2 A;  1OQP A;  2GV5 A;  4U8D A;  3WNX B;  1QLS A;  1CTR A;  1ZFS A;  1KK8 B;  1NYA A;  5I2L A;  4GGF C;  1QXP A;  1UP5 A;  4MSP A;  2LE9 B;  5HLO A;  3E3R A;  4MZL A;  1TNP A;  2K2A A;  4PAL A;  2TN4 A;  4C0K A;  1BOC A;  4I5K A;  4YI9 A;  1OSA A;  4PDZ A;  4I5N B;  1J7Q A;  1IJ5 A;  1K9P A;  1PSR A;  2ZND A;  4N5X A;  1SCM C;  1K94 A;  1WDC B;  1SR6 C;  2F3Y A;  1LA3 A;  1V1F A;  1ZOT B;  1EJ3 A;  4JPZ B;  3GK2 A;  1A4P A;  4PHK A;  1QV0 A;  3NSO A;  1S5G Y;  1M45 A;  4XJK B;  3EK4 A;  3VRQ A;  2HPS A;  3I5F B;  1E8A A;  4MZJ A;  1PUL A;  2QPT A;  1QV1 A;  2JZI A;  4GFT A;  3O2P A;  4HRE E;  1AJ4 A;  1DGU A;  1KQM C;  2EC6 C;  4ZCV A;  1GGZ A;  2E6W A;  4GBA A;  1FI6 A;  3GK4 X;  4MBE A;  2LP3 A;  1SW8 A;  1KSO A;  2JPT A;  2JC2 A;  1NCY A;  1FW4 A;  1B7T Y;  1PSB A;  2FOT A;  2DOQ A;  3SG4 A;  5HYD A;  1ZUZ A;  4GAO A;  3DF0 A;  2WC8 A;  4DCK A;  2KQ6 A;  2OTG B;  1JUO A;  2H61 C;  1W7J B;  3DVM A;  3PFV A;  2PVB A;  1DJX A;  1L2O C;  1QAS A;  4MLW A;  5GQQ C;  5HLV A;  2KI4 C;  3BOW A;  1XK4 C;  4A4C A;  3JTD B;  1MHO A;  5DKQ A;  5KTY A;  1DJG A;  1REC A;  5I2Q A;  2K8M B;  3MSE B;  1N2D A;  2LMU A;  1AUI B;  2LAP A;  1OOJ A;  5KSZ A;  1TTX A;  4OVN F;  2P6B B;  3CWG A;  2PAL A;  1BLQ A;  1JF0 A;  3EK8 A;  3LLE A;  1TNW A;  4PE7 A;  1NX1 A;  2M1K B;  2JQ6 A;  1TCF A;  4PHM A;  1WY9 A;  1TNX A;  1CFF A;  2PMY A;  4UPG A;  3WHU B;  2BBM A;  1KFU S;  2L50 A;  2M9G A;  1QIV A;  4R1E A;  1NP8 A;  1M63 B;  3FS7 A;  2LM5 A;  3O4Y A;  4OR9 B;  2KSP A;  1YX7 A;  1Y1X A;  2LNK A;  2BL0 B;  1KSM A;  2L0P A;  3BUO B;  1K93 D;  1QX7 A;  4N1G A;  3NSL A;  2NXQ A;  4NDC A;  1ZAC A;  1XFZ O;  3CR5 X;  1GGW A;  1NCX A;  1G4Y R;  1CLB A;  2AMI A;  2KQY A;  1WLM A;  4HSZ A;  2JXL A;  4PCW A;  2PSR A;  1JWD A;  1QVI Z;  1TOP A;  1RFJ A;  4USL A;  2LMV A;  1OE9 B;  3PSR A;  3OB1 B;  3AKA A;  4WRI A;  1CLM A;  2RGI A;  3TDI A;  2WCB A;  1DJI A;  4OKH A;  1JC2 A;  2OPO A;  2M7L A;  1CLL A;  3NSI A;  4QJ3 B;  2L98 A;  2ZNE A;  1Y1A A;  1XA5 A;  3CLN A;  2F33 A;  2F8P A;  2A4J A;  5J3X A;  2LP2 A;  5TNC A;  2KBI A;  3OHM B;  1QJT A;  3DF0 B;  3KF9 A;  2KFH A;  2CTN A;  1J7R A;  5AAN A;  4YGE B;  4DRW A;  3WHT B;  1YUU A;  1IQ3 A;  3CGA A;  5CPV A;  3BOW B;  1TRF A;  4PE4 A;  4YGC B;  2Q91 A;  3KO0 A;  1CDN A;  1SYM A;  3RLZ A;  2JOJ A;  4AOM A;  2JRF A;  3TDZ A;  4CID A;  3PN7 C;  3TS5 C;  3TDU A;  1AP4 A;  3ZNI A;  3SG5 A;  3TUY B;  4PHN A;  5ER4 X;  2KDH A;  2KAY A;  1QVI Y;  5HKZ A;  5ER5 A;  2H2K A;  1KCY A;  3LK0 A;  1B9A A;  3I5H C;  1F55 A;  1SL8 A;  2G2B A;  2FJU B;  2LCP A;  3I5G B;  4N1F A;  2MLF C;  4CLN A;  2OS8 B;  3EVU A;  3SG2 A;  4XYN A;  1OZO A;  2I7A A;  2LC5 A;  2LVV A;  1J1E A;  3VRO A;  2ZN9 A;  1DJW A;  4PE1 A;  1OMD A;  2BCB A;  1SKT A;  1YVH A;  1CFP A;  2Q4U A;  1OZS A;  3BXK A;  3SIA A;  3A8R A;  2KI6 C;  4DUQ A;  1C07 A;  4M2P A;  1K95 A;  3IQQ A;  2ZFD A;  5IBW A;  1L7Z A;  1EH2 A;  3SG6 A;  1KQV A;  2G9B A;  4CFR A;  2KGB C;  4YGB B;  1X02 A;  4HRG A;  2KYC A;  1TCO B;  2QAC A;  2K7D A;  1S6C A;  1KK7 Z;  1UHH A;  1CDM A;  4ETO A;  4NDD A;  1DJH A;  2MJW B;  1A75 B;  2GGZ A;  3I5I B;  4YGD B;  2F2P A;  2M0R A;  1SL9 A;  2K7B A;  3JVT B;  5HKW A;  5K89 A;  4DIR A;  3SIB A;  1DGV A;  2LLT A;  2M49 B;  1HT9 A;  2L4I A;  4JQ0 D;  2O60 A;  3PM8 A;  1AJ5 A;  2BE6 A;  1DF0 B;  1KK8 C;  1G33 A;  2WOS A;  1RK9 A;  1YTZ C;  2NCP A;  5HKY A;  1NX3 A;  1SL7 A;  3BUM B;  2B1U A;  5D7F A;  1IG5 A;  4OV2 A;  1WRL A;  1J7P A;  1F71 A;  1KWO B;  1TNQ A;  1BG1 A;  1RTP 1;  1WDC C;  1CMG A;  1UUR A;  2FCD A;  1SRA A;  3SG3 A;  2LLU A;  1CFC A;  1KK7 Y;  2NLN A;  5CSJ A;  2SCP A;  2IS9 A;  2BCX A;  1YRT B;  3I5F C;  2ISD A;  2BKH B;  1CDL A;  1B4C A;  1LKJ A;  1BR4 B;  3BUW B;  5DKN A;  5JJG A;  1JSA A;  4GGF A;  1NUB A;  3WXA A;  1IKU A;  1KFX L;  1WLZ A;  3D0Y A;  4FQO A;  1M31 A;  1BR1 B;  2KBM A;  3HCM A;  1CNP A;  1IQ5 A;  1RJV A;  5DKR A;  3BUN B;  1NX0 A;  2MBX A;  5D69 A;  2MLE C;  1EG3 A;  2BEC A;  2LAN A;  2OTG C;  1RRO A;  2VRG A;  4WQ3 A;  3FIA A;  3A4U B;  2KOT A;  1B1G A;  2JTT A;  1F8H A;  2PAS A;  3JTD C;  1SBJ A;  4P5O E;  1S3P A;  2JUL A;  3DD4 A;  2I94 A;  2NCO A;  1YUS A;  2MA2 A;  2KAX A;  1NPQ A;  4YRU A;  3ZWH A;  1NX2 A;  3DVJ A;  4M2Q A;  1B8C A;  3EK7 A;  1ALW A;  1A75 A;  1R2U A;  3HX4 A;  1FI5 A;  2M1U A;  2H61 A;  3OX6 A;  2ZRT A;  3H4S E;  1NSH A;  1VRK A;  1SMG A;  1BU3 A;  1XFW O;  4ZCU A;  1MF8 B;  5PAL A;  4CPV A;  1MUX A;  1G8I A;  1XK4 A;  1YUR A;  3AAJ A;  2BL0 C;  1KFX S;  4JWQ A;  1DF0 A;  4ICB A;  4MVF A;  1QX5 B;  3CZT X;  1YVL A;  1A29 A;  2L5X B;  1BT6 A;  1YR5 A;  3DVK A;  5KU1 A;  1DJY A;  1QTX A;  2ZN8 A;  2LHI A;  5I8N A;  4MZK A;  1K90 D;  3OX5 A;  3CR4 X;  1FPW A;  1LVC D;  2JNF A;  2LV7 A;  3EVV A;  2SAS A;  4TNC A;  2K61 A;  3PAL A;  1N65 A;  1DTL A;  1MWN A;  2KHN A;  4ORA B;  1BOD A;  5FYX A;  1XFY O;  1SNL A;  2EGD A;  3CS1 A;  1H8B A;  2M29 A;  3AAK A;  3D0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...