2BE6A

2.0 a crystal structure of the cav1.2 iq domain-ca/cam complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
141
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin 2
publication title Insights into voltage-gated calcium channel regulation from the structure of the Ca(V)1.2 IQ domain-Ca(2+)/calmodulin complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 51
structure length 141
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be6A02
2NXQA 4GAOA 3D0YA 5KTYA 5G08A 2D8NA 4CLNA 3OX5A 3TDUA 1LKJA 1DF0B 4XJKB 1NCXA 1IJ6A 1ALVA 1CLLA 1XA5A 1DGVA 1J1DA 2JTZA 2F3ZA 2BL0B 1DT7B 1OE9B 3VROA 2MLFC 2PVBA 3LL8B 4GGFA 4DCKA 2F3YA 1AVSA 3I5HB 1TIZA 1MQ1A 3CGAA 1TCFA 1CDLA 1CLBA 1K93D 1XYDA 2LCPA 4YRUA 2KOTA 2LP2A 2KAXA 3SG4A 1PSRA 1Y1XA 2JZIA 3EKJA 1MWNA 1S26D 3JVTB 4CIDA 3EK7A 2BCXA 2Q4UA 2QACA 1KFUS 4P2YB 5ER5A 1JFKA 5AEQA 1WDCC 1YUTA 1AJ4A 3BUNB 3CZTX 1H8BA 4C0JA 1CFPA 1BOCA 3VRPA 1J7QA 4AOMA 4FQOA 1QXPA 2L4HA 2FOTA 1XO5A 1CM4A 1SCMC 4N1FA 1NPQA 2KI4B 4MZLA 3GK2A 1NIWA 1UUSA 4YGDB 1E8AA 1MXEA 1S6CA 2LUXA 1YRTB 1NCZA 4QJ5B 1FW4A 1ALWA 1OSAA 2I7AA 3NXAA 5ER4X 2JT8A 1U5IA 1NX1A 1DJZA 2LMUA 1K9UA 2CT9A 1SR6B 2G2BA 2RGIA 3CR5X 4PE0A 3VRNA 1FI5A 2CBLA 2M1UA 2O60A 2KBMA 3GOFA 3SG7A 1KK8B 1BU3A 1MHOA 2H2KA 4A4CA 3OB2B 3NSIA 1BF5A 2M9GA 1YTZC 3DD4A 1UHNA 2LC5A 4MEWA 4YGBB 3TS5B 3AAKA 1IKUA 2KQYA 5JJGA 2KAYA 1AUIB 1QVIZ 2Q91A 5PALA 2JXLA 4P5OE 1NCYA 1J7OA 3TUYC 1AJ5A 1XK4A 1SNLA 4PALA 1LA0A 4PE1A 4M2PA 3PFVA 3OHMB 3GK4X 3I5GC 2LLTA 3IQQA 2L0PA 2K61A 1A03A 1JC2A 1KSMA 1WLZA 4TNCA 1WRZA 1IWQA 2Y5IA 3O78A 2K7CA 1KWOB 1ZUZA 3CTNA 2EC6B 2LAPA 1EG4A 3KF9A 3PALA 1L2OB 1F55A 4PE7A 1OQPA 1OMRA 2LLUA 2NCOA 3BYAA 3SJSA 1CLMA 1UHIA 2BL0C 1WRKA 1Q80A 4MVFA 4PCWA 3EVVA 3IF7A 2M7LA 3I5HC 4F0ZB 1OZOA 2F2PA 3K21A 4WQ3A 2K7DA 1QV0A 3C1VA 2K7BA 1UHHA 2EHBA 1B9AA 1CDMA 4USLA 3E3RA 1NP8A 2I94A 2P6BB 3JVTC 2BBNA 2JNFA 2PRUA 4E68A 1S5GY 1SBJA 1RTP1 2KFFA 1QATA 4ORAB 5CSIA 5DKRA 1EL4A 1UP5A 3LK1A 1KFXS 4ORCB 4C0KA 1SYMA 1YURA 1R2UA 2SASA 1XFVO 2HQ8A 2AAOA 1RFJA 2BECA 2JWWA 2PSRA 3EK8A 1NWDA 2KI6C 2KI4C 1TNWA 1JUOA 1KK7Y 1NSHA 4N5XA 3CR4X 3AKAA 4PHKA 2K7OA 5K89A 1HT9A 2ZKMX 3WHTB 1G4YR 1SL9A 1WRLA 2O5GA 1IQ3A 2F2OA 1JF0A 1RJVA 1UHKA 4N1GA 4NDCA 4YGCB 1SR6C 5D69A 4CPVA 1CKKA 1F8HA 1IH0A 1KFUL 2LV7A 1PSBA 3OX6A 3TS5C 3M0WA 1N0YA 1D1OA 1BJFA 1YUSA 1CDPA 4GPLB 4ICBA 1BLQA 4XYNA 2JTTA 2MLEC 1R6PA 2FCDA 4L9MA 1EJ3A 2GV5A 2NLNA 2KNEA 2A4JA 1DMOA 3TDZA 2BCBA 2AMIA 5BPJA 2KDHA 1WLMA 4ORBB 1M46A 4OKHA 3BQ3A 1TOPA 3H4SE 4JWQA 1QX5B 2HQWA 4DUQA 1F54A 3I5IB 2G9BA 1JSAA 5F6TA 3LCPC 1KWOC 3SG3A 5CSNA 3WXAA 1Y0VH 2LVKA 1JF2A 3BUXB 3HCMA 1KK7Z 2BE4A 1L2OC 2HF5A 2L2EA 4MZKA 2QPTA 1CNPA 1B7TY 1RK9A 2M3WA 2WCFA 3BOWA 4PDZA 1GGWA 1PK0D 1IG5A 1W7IB 1OMVA 4NDDA 3DF0A 1A75B 1F70A 1L7ZA 1RWYA 2PASA 1DTLA 1XFYO 2KQ6A 3BUMB 1RECA 1C7WA 1TN4A 1EG3A 3D0YB 3DVEA 1AHRA 3VRQA 5I8NA 5I2OA 3F45A 4NQGA 3DVJA 2KBIA 2LUCA 5B8IB 1FF1A 4DS7A 1SY9A 3DVMA 1OOJA 5DKQA 5HYDA 1CMGA 1BODA 1Y1UA 2L50A 2LNKA 1S6IA 1XVJA 2I18A 3CLNA 4MRXA 2OTGB 4WQ2A 4ZCVA 4YI9A 2JU0A 3A8RA 2DOQA 4D1EA 1FPWA 3CWGA 1LXFC 1SK6D 2WCEA 1K90D 2BKIB 2R2IA 5AANA 1QIVA 1K9PA 5CSJA 2LMVA 1CMFA 1M31A 3NSLA 1F4QA 1DJGA 2M7NA 5DKNA 1ODBA 2ZRTA 1KQMB 4MN0A 4MRYA 2JULA 1QS7A 4OR9B 1KFXL 2COLB 5I2LA 1OZSA 3HX4A 1HQVA 2OS8B 1X02A 1XFUO 2AUCA 1V1GA 2JT0A 1Y1AA 2KGRA 2M0RA 2M49B 2V53A 5AFPA 1QV1A 2MBXA 1XFXO 3PATA 2KFGA 2M29A 3OP0A 4PHJA 1QX7A 4DIRA 1M45A 2CCMA 1U5IB 2KAVA 2JQ6A 1PULA 2NZ0A 4OVNF 2KI6D 3A4UB 1LVCD 4I5LB 1S1EA 3TDIA 2KSPA 4XJKA 3I5IC 3PM8A 1K95A 2K8MB 5FYXA 1IQ5A 1B8RA 1TNQA 2WCBA 3IQOA 4HREE 2L51A 2L5XB 1IGVA 1ZFSA 2H61C 1TTXA 2JC2A 1KQVA 1RROA 1XFWO 3VRRA 2WOSA 5CSFA 1B4CA 4I5NB 5HLVA 4BY5A 1JWDA 1NX3A 2BKHB 4MZJA 1SRAA 3EVRA 1PALA 1CB1A 4PHNA 2EGDA 4WRIA 2LE9B 3KO0A 1CFDA 4HRHA 1QLSA 2F8PA 4DRWA 1QJTA 2KYFA 2WC8A 3ZWHA 4GGNA 4HSZA 3AAJA 1PRWA 1KK8C 2JXCA 2E30A 2LVJA 4R1EA 1DJWA 2ZN9A 2WNDA 3SIAA 2OPOA 1CFCA 1AK8A 1WY9A 3FWBA 4GGFC 3O6BA 3BUOB 3EK4A 1K8UA 2LHIA 2OTGC 3I5FB 2LHLA 2MJWB 1Y6WA 1YUUA 5JOLA 1K94A 1S5GZ 5TNCA 4YBHB 1NX2A 2KHNA 1QIWA 2M8UA 2E6WA 3PN7B 2JNXA 1KCYA 3BUWB 1BMOA 1V1FA 3OB1B 1CDNA 3WNXB 2ZNEA 2LVVA 3EKHA 2LMTA 4CFRA 1KQMC 2LLSA 1QTXA 1AP4A 2SCPA 2FCEA 3D10A 1PVAA 2EC6C 3FWCA 1UWOA 4UPGA 2VRGA 1UHJA 2OS8C 4YI8A 1TCOB 1DJYA 3RLZA 1G33A 4JQ0D 1FI6A 1YX8A 1MUXA 3PLFB 1B8CA 1GQMA 1QVIY 1B1GA 5HKZA 1QX2A 1K2HA 1MXLC 1YVHA 2HPSA 4M2OA 3ZNIA 2CXJA 1VRKA 3CR2A 4AQJA 5AXIA 3NSKA 1H4BA 1B47A 4MLWA 3WHUB 1DJXA 1OMDA 3KEVA 1DJHA 1W7JB 5AERA 2JPTA 1S6JA 1FBVA 1CTRA 1K96A 1MF8B 2BBMA 2ZFDA 4I5KA 1DVIA 1SL7A 4JPZB 4BY4A 1CFFA 2KGBC 1N65A 1J7PA 1GJYA 1A2XA 2ZRSA 2K2AA 2L98A 3AKBA 1XK4C 4MBEA 5D7FA 1BR4B 2CTNA 3GK1A 5J3XA 2BCAA 3JTDB 3QRXA 1S3PA 3SG6A 4HRGA 4AQIA 1BG1A 2GGZA 1SMGA 2TN4A 1LA3A 1B8LA 4PE4A 2CNPA 2MRDA 1SW8A 2K2FA 2M97A 2JT3A 1B7TZ 2I2RE 1DGUA 4FTGA 2L4IA 1BT6A 4GUKA 4NDBA 4PHMA 4OCIA 4OV2A 1ZACA 1JBAA 5KSZA 1EH2A 2JRFA 3SG2A 1J7RA 3BOWB 1NYAA 4GNKB 3VGOA 1UURA 5CPVA 2MHHA 4ZCUA 4Q04A 1BR1B 3EVUA 3I5FC 3DF0B 1JFJA 1LINA 3KPXA 3SG5A 4CFQA 4C0LA 2LVIA 2M1KB 1N2DA 3PSRA 3PN7C 1YVLA 5HKYA 1G8IA 4U8DA 1MR8A 1WDCB 1DF0A 3MSEB 2KFHA 1DJIA 3KHEA 2JOJA 2PMYA 1SPYA 4GBAA 2MA2A 1QASA 1M39A 3FS7A 1KSOA 2IS9A 2LP3A 5HKWA 1GGZA 1SL8A 1YRUB 2Y1MA 3FIAA 1SCMB 4I5JA 2GGMA 1IRJA 1ZOTB 1C07A 1F71A 1A4PA 2HETA 1NUBA 4MSPA 2F33A 2Y4QA 4A4BA 2Y1NA 2K0JA 1SKTA 1NX0A 2KYCA 1TNPA 1C7VA 4ETOA 2WORA 2BE6A 1PVBA 3CS1A 3LLEA 3O4YA 5HLOA 1IJ5A 1F4OA 1A29A 2PALA 1XFZO 4M2QA 1ZMZA 5I2QA 2LANA 4QJ3B 1K9KA 2ZN8A 4YGAA 1CM1A 2LM5A 3TZ1A 2H61A 3BXKA 3LK0A 4QJ4B 1J1EA 1SCVA 1TNXA 1TRFA 3NSOA 3TUYB 5KU1A 1S36A 2ZNDA 3SIBA 5IBWA 4YGEB 5GQQC 3DVKA 1J55A 1A75A 1M63B 1QLKA 2ISDA 4IL1A 3I5GB 1EXRA 1YX7A 2FJUB 3RM1A 2B1UA 1YR5A 2NCPA 3O2PA 3ICBA 3JTDC 2MAZA 4GFTA
chains in the Genus database with same CATH superfamily
2NXQA 3O4XA 3D0YA 4GAOA 5KTYA 5G08A 2D8NA 4CLNA 3OX5A 3TDUA 1LKJA 1TWOA 1DF0B 4XJKB 1NCXA 1IJ6A 1ALVA 1CLLA 1XA5A 1DGVA 1J1DA 2JTZA 2F3ZA 2BL0B 1DT7B 1OE9B 2WC5A 3VROA 2MLFC 2PVBA 3LL8B 1W9ZA 4GGFA 4DCKA 2F3YA 1AVSA 3I5HB 1TIZA 1MQ1A 3CGAA 1TCFA 2QEHA 1CDLA 3UO9A 1CLBA 1K93D 1XYDA 2LCPA 3S0BA 4YRUA 2KOTA 2LP2A 3DXLA 2KAXA 3SG4A 1PSRA 1Y1XA 2JZIA 3EKJA 1MWNA 1S26D 3JVTB 4CIDA 4F7FA 3EK7A 2BCXA 5FI6A 2Q4UA 2QACA 1KFUS 4P2YB 5ER5A 1JFKA 5AEQA 1WDCC 3NHTA 1YUTA 1AJ4A 2KPHA 3BUNB 3CZTX 4C0JA 1CFPA 1BOCA 3VRPA 1J7QA 1H8BA 4AOMA 4FQOA 1QXPA 2L4HA 2FOTA 1XO5A 1CM4A 1SCMC 4N1FA 1NPQA 2KI4B 2QEBA 3GK2A 1NIWA 1UUSA 4MZLA 4YGDB 1E8AA 1MXEA 1QWVA 1S6CA 3BFAA 2LUXA 2WC6A 3D74A 1YRTB 1NCZA 4QJ5B 1FW4A 2PYQA 1ALWA 1OSAA 3V2LA 2I7AA 3NXAA 5I94A 5ER4X 2JT8A 1U5IA 1NX1A 1DJZA 2LMUA 1K9UA 2CT9A 1SR6B 2G2BA 2RGIA 3CR5X 4PE0A 3OGNA 3VRNA 1FI5A 2CBLA 2M1UA 2O60A 2KBMA 3GOFA 3D73A 1KK8B 1BU3A 1LS8A 1MHOA 2H2KA 3OB2B 3NSIA 3SG7A 1BF5A 2M9GA 1YTZC 3DD4A 1UHNA 2LC5A 2FJYA 4INWA 4MEWA 4YGBB 3TS5B 3AAKA 1IKUA 2KQYA 5JJGA 2KAYA 1AUIB 1QVIZ 2Q91A 5PALA 2JXLA 4P5OE 1NCYA 3FE9A 1J7OA 3TUYC 1AJ5A 1XK4A 1SNLA 4PALA 1LA0A 4PE1A 3L4LA 3OBVA 4M2PA 3PFVA 3OHMB 3GK4X 3I5GC 2LLTA 2BNXA 3IQQA 2L0PA 3SS5A 2K61A 1A03A 1JC2A 1KSMA 1WLZA 4TNCA 1WRZA 1IWQA 2Y5IA 3O78A 2K7CA 1KWOB 1ZUZA 3CTNA 1OOHA 2EC6B 2LAPA 1EG4A 3KF9A 3PALA 1L2OB 3DY9A 4PE7A 1OQPA 1OMRA 1F55A 2LLUA 2NCOA 3BYAA 4OZDA 5FI2A 3SJSA 1CLMA 1UHIA 2BL0C 1WRKA 1Q80A 4MVFA 3CABA 4PCWA 3EVVA 3IF7A 2M7LA 2H8VA 3I5HC 1OZOA 2F2PA 3K21A 4JKTA 4WQ3A 4F0ZB 2K7DA 1QV0A 3C1VA 2K7BA 1UHHA 2EHBA 1B9AA 1CDMA 4USLA 3E3RA 1NP8A 3BFBA 2I94A 2P6BB 3JVTC 2BBNA 3BFHA 2JNFA 2PRUA 4E68A 1S5GY 1SBJA 1RTP1 2KFFA 1QATA 4ORAB 5CSIA 5DKRA 1EL4A 1UP5A 2WCKA 3LK1A 1KFXS 4ORCB 3B6XA 1SYMA 1YURA 3FE8A 4C0KA 1R2UA 5EL2A 2SASA 1XFVO 2HQ8A 2AAOA 1RFJA 2BECA 2JWWA 2PSRA 3EK8A 1NWDA 2KI6C 2KI4C 1TNWA 1JUOA 1KK7Y 1NSHA 4N5XA 3CR4X 3AKAA 4PHKA 2K7OA 4PT1A 5K89A 1HT9A 2ZKMX 3WHTB 1G4YR 1SL9A 1WRLA 2O5GA 1IQ3A 2F2OA 3CDNA 1JF0A 1RJVA 1DEKA 1UHKA 4N1GA 4NDCA 4YGCB 1SR6C 5D69A 4CPVA 1CKKA 1F8HA 1IH0A 1KFUL 2LV7A 1PSBA 3OX6A 4KYNA 3TS5C 2WCJA 3M0WA 1N0YA 1D1OA 1BJFA 1YUSA 1CDPA 4GPLB 4ICBA 1BLQA 4XYNA 1Z4HA 3CZ1A 2JTTA 2MLEC 1R6PA 2FCDA 4L9MA 1EJ3A 2K60A 2GV5A 2NLNA 1TUJA 2KNEA 2A4JA 1DMOA 3TDZA 1IIOA 2BCBA 3R1VA 2AMIA 1DC1A 5BPJA 2KDHA 1WLMA 4ORBB 1M46A 4OKHA 3BQ3A 1TOPA 3H4SE 4JWQA 1QX5B 2HQWA 3B87A 4DUQA 3I5IB 1F54A 2G9BA 3CZ0A 1JSAA 5F6TA 3LCPC 1KWOC 3SG3A 5CSNA 3WXAA 1Y0VH 2LVKA 1JF2A 2WCHA 3BUXB 3HCMA 1KK7Z 2BE4A 1L2OC 2HF5A 2L2EA 4MZKA 2QPTA 1CNPA 2JPOA 1B7TY 1RK9A 2M3WA 2WCFA 3BOWA 4PDZA 1GGWA 1PK0D 1IG5A 2KLEA 3S0EA 2L2CA 3NHIA 1W7IB 1OMVA 4NDDA 3DF0A 1A75B 1F70A 1L7ZA 1RWYA 2PASA 1DTLA 1XFYO 4FQTA 2KLDA 2KQ6A 3BUMB 1RECA 3L47A 1C7WA 1TN4A 2GTEA 1EG3A 3D0YB 1C3ZA 3DVEA 1AHRA 3N7HA 3VRQA 5I8NA 5I2OA 3F45A 4JD9A 4NQGA 3DVJA 2KBIA 2LUCA 5B8IB 1FF1A 4DS7A 1SY9A 3DVMA 1OOJA 5DKQA 5HYDA 1CMGA 1BODA 1Y1UA 2L50A 2LNKA 1S6IA 1XVJA 2I18A 3CLNA 3K1EA 2OTGB 4MRXA 4WQ2A 4ZCVA 1SSEB 4YI9A 2JU0A 3A8RA 2DOQA 4D1EA 1FPWA 3CWGA 1LXFC 1SK6D 2WCEA 1GM0A 1K90D 2BKIB 2R2IA 5AANA 3CYZA 1QIVA 1K9PA 5CSJA 2LMVA 2QEOA 1CMFA 1M31A 3NSLA 1F4QA 1DJGA 2M7NA 5DKNA 1ODBA 2ZRTA 3EG5B 1KQMB 4A4CA 4MN0A 1DELA 4MRYA 2JULA 1QS7A 4OR9B 1KFXL 2COLB 5I2LA 1OZSA 3HX4A 1HQVA 2OS8B 1X02A 1XFUO 2AUCA 1V1GA 2JT0A 1Y1AA 2KGRA 2M0RA 2M49B 2V53A 5AFPA 1QV1A 4INXA 2MBXA 1XFXO 3PATA 3D75A 2KFGA 2M29A 3L4AA 3OP0A 1QX7A 1XFRA 4PHJA 4DIRA 1M45A 2CCMA 1U5IB 2KAVA 2JQ6A 1PULA 2NZ0A 3D77A 4OVNF 2KI6D 3A4UB 1LVCD 2P70A 1S1EA 4I5LB 2KSPA 4XJKA 3TDIA 3I5IC 3PM8A 1K95A 2BAPA 2K8MB 3DZTA 5FYXA 1IQ5A 1B8RA 1TNQA 2WCBA 3IQOA 3R72A 2L51A 2L5XB 4HREE 1IGVA 1ZFSA 2H61C 1TTXA 3DYEA 2JC2A 1KQVA 1RROA 1XFWO 3VRRA 2WOSA 5CSFA 1B4CA 3B88A 4I5NB 5HLVA 4BY5A 1JWDA 1NX3A 2BKHB 4MZJA 1SRAA 3EVRA 3R1PA 1PALA 1CB1A 4PHNA 2EGDA 4WRIA 2LE9B 3KO0A 1OOGA 1Z2CB 1CFDA 2WCLA 4HRHA 1QLSA 2F8PA 4DRWA 1QJTA 5HL1A 2KYFA 2WC8A 3ZWHA 4GGNA 4HSZA 3AAJA 1PRWA 1KK8C 2JXCA 3QMEA 2E30A 2LVJA 1OW4A 4R1EA 1DJWA 2ZN9A 2WNDA 3SIAA 2OPOA 3S0AA 1CFCA 3S0FA 4IJ7A 1ORGA 1T14A 1AK8A 1WY9A 3FWBA 4GGFC 3VB1A 3O6BA 3BUOB 3EK4A 1K8UA 2LHIA 2OTGC 3I5FB 3FE6A 2LHLA 2MJWB 1Y6WA 3S0DA 1YUUA 5JOLA 1K94A 1S5GZ 5TNCA 4YBHB 1NX2A 2KHNA 1QIWA 2M8UA 2E6WA 3PN7B 2JNXA 1KCYA 2QDIA 1DQEA 3S0GA 3BUWB 1BMOA 1V1FA 3OB1B 1CDNA 3WNXB 2ZNEA 2LVVA 3EKHA 2LMTA 4CFRA 1KQMC 2LLSA 1QTXA 1AP4A 2SCPA 2FCEA 3D10A 1PVAA 2EC6C 3FWCA 1UWOA 4UPGA 2VRGA 2PQLA 1UHJA 2OS8C 4YI8A 1TCOB 1DJYA 3RLZA 1G33A 3CZ2A 4JQ0D 1FI6A 1YX8A 1MUXA 3PLFB 1B8CA 1GQMA 1QVIY 1B1GA 5HKZA 1QX2A 1K2HA 1MXLC 1YVHA 2HPSA 4M2OA 3ZNIA 2CXJA 1VRKA 3CR2A 4AQJA 5AXIA 3NSKA 1H4BA 1B47A 4MLWA 3SS4A 3WHUB 1DJXA 1OMDA 3KEVA 1DJHA 1W7JB 5AERA 2JPTA 1S6JA 1FBVA 1CTRA 1K96A 1MF8B 2BBMA 2ZFDA 4I5KA 1DVIA 1SL7A 4JPZB 4BY4A 1CFFA 2ERBA 1N65A 2KGBC 5D3OA 1J7PA 1GJYA 1A2XA 2ZRSA 2WCMA 3NGVA 2K2AA 2L98A 2QEVA 3AKBA 1XK4C 4MBEA 5D7FA 1BR4B 2CTNA 3GK1A 3D78A 5J3XA 2BCAA 3JTDB 3QRXA 1S3PA 3SG6A 4HRGA 4AQIA 1BG1A 2GGZA 3UNWA 1SMGA 2TN4A 1OOIX 1LA3A 3B7AA 1B8LA 4PE4A 5DICA 3SS3A 2CNPA 2MRDA 1SW8A 1C3YA 2K2FA 2M97A 2JT3A 1B7TZ 2I2RE 1DGUA 4FTGA 2L4IA 1BT6A 4GUKA 4NDBA 4PHMA 4OCIA 4OV2A 1ZACA 1JBAA 5KSZA 1EH2A 2JRFA 3SG2A 1J7RA 3PJIA 3BOWB 1NYAA 4GNKB 3VGOA 1UURA 5CPVA 2MHHA 4ZCUA 3RZSA 4Q04A 1BR1B 3EVUA 3I5FC 3DF0B 2L5YA 1JFJA 1OOFA 1LINA 3KPXA 3SG5A 4CFQA 4C0LA 2LVIA 2M1KB 1N2DA 3PSRA 3PN7C 1YVLA 5HKYA 3BJHA 1G8IA 4U8DA 1MR8A 1WDCB 5FI7A 1DF0A 3MSEB 2KFHA 1DJIA 3KHEA 2JOJA 2PMYA 1SPYA 4GBAA 2MA2A 1QASA 1M39A 3FS7A 1KSOA 2IS9A 2LP3A 5HKWA 1GGZA 1SL8A 1YRUB 2Y1MA 3FIAA 1SCMB 4I5JA 3R1OA 2GGMA 1IRJA 1ZOTB 1C07A 1F71A 1A4PA 2HETA 1NUBA 4MSPA 2F33A 2Y4QA 4A4BA 2Y1NA 2K0JA 2P71A 1SKTA 1NX0A 2KYCA 1P28A 1TNPA 2YGUA 1C7VA 4ETOA 2WORA 2BE6A 1PVBA 3CS1A 3LLEA 3O4YA 5HLOA 1IJ5A 1F4OA 1A29A 3PM2A 2PALA 1TUZA 1XFZO 4M2QA 3Q8IA 1ZMZA 3B86A 2LANA 4QJ3B 5I2QA 1K9KA 2ZN8A 4YGAA 1CM1A 2LM5A 3TZ1A 2H61A 3BXKA 3LK0A 4QJ4B 3IVTA 1J1EA 1SCVA 1TNXA 1TRFA 3NSOA 3TUYB 5KU1A 1S36A 2ZNDA 3SIBA 5IBWA 4YGEB 5GQQC 3DVKA 1J55A 1A75A 1M63B 1QLKA 2ISDA 4IL1A 3I5GB 1EXRA 1YX7A 2FJUB 3RM1A 2B1UA 1YR5A 2NCPA 3O2PA 3ICBA 3JTDC 2MAZA 4GFTA 3D76A
chains in the Genus database with same CATH topology
2NXQA 4GAOA 3D0YA 5KTYA 5G08A 2D8NA 4CLNA 3OX5A 3TDUA 1LKJA 1DF0B 4XJKB 1NCXA 1IJ6A 1ALVA 1CLLA 1XA5A 1DGVA 1J1DA 2JTZA 2F3ZA 2BL0B 1DT7B 1OE9B 3VROA 2MLFC 2PVBA 3LL8B 4GGFA 4DCKA 2F3YA 1AVSA 3I5HB 1TIZA 1MQ1A 3CGAA 1TCFA 1CDLA 1CLBA 1K93D 1XYDA 2LCPA 4YRUA 2KOTA 2LP2A 2KAXA 3SG4A 1PSRA 1Y1XA 2JZIA 3EKJA 1MWNA 1S26D 3JVTB 4CIDA 3EK7A 2BCXA 2Q4UA 2QACA 1KFUS 4P2YB 5ER5A 1JFKA 5AEQA 1WDCC 1YUTA 1AJ4A 3BUNB 3CZTX 1H8BA 4C0JA 1CFPA 1BOCA 3VRPA 1J7QA 4AOMA 4FQOA 1QXPA 2L4HA 2FOTA 1XO5A 1CM4A 1SCMC 4N1FA 1NPQA 2KI4B 4MZLA 3GK2A 1NIWA 1UUSA 4YGDB 1E8AA 1MXEA 1S6CA 2LUXA 1YRTB 1NCZA 4QJ5B 1FW4A 1ALWA 1OSAA 2I7AA 3NXAA 5ER4X 2JT8A 1U5IA 1NX1A 1DJZA 2LMUA 1K9UA 2CT9A 1SR6B 2G2BA 2RGIA 3CR5X 4PE0A 3VRNA 1FI5A 2CBLA 2M1UA 2O60A 2KBMA 3GOFA 3SG7A 1KK8B 1BU3A 1MHOA 2H2KA 4A4CA 3OB2B 3NSIA 1BF5A 2M9GA 1YTZC 3DD4A 1UHNA 2LC5A 4MEWA 4YGBB 3TS5B 3AAKA 1IKUA 2KQYA 5JJGA 2KAYA 1AUIB 1QVIZ 2Q91A 5PALA 2JXLA 4P5OE 1NCYA 1J7OA 3TUYC 1AJ5A 1XK4A 1SNLA 4PALA 1LA0A 4PE1A 4M2PA 3PFVA 3OHMB 3GK4X 3I5GC 2LLTA 3IQQA 2L0PA 2K61A 1A03A 1JC2A 1KSMA 1WLZA 4TNCA 1WRZA 1IWQA 2Y5IA 3O78A 2K7CA 1KWOB 1ZUZA 3CTNA 2EC6B 2LAPA 1EG4A 3KF9A 3PALA 1L2OB 1F55A 4PE7A 1OQPA 1OMRA 2LLUA 2NCOA 3BYAA 3SJSA 1CLMA 1UHIA 2BL0C 1WRKA 1Q80A 4MVFA 4PCWA 3EVVA 3IF7A 2M7LA 3I5HC 4F0ZB 1OZOA 2F2PA 3K21A 4WQ3A 2K7DA 1QV0A 3C1VA 2K7BA 1UHHA 2EHBA 1B9AA 1CDMA 4USLA 3E3RA 1NP8A 2I94A 2P6BB 3JVTC 2BBNA 2JNFA 2PRUA 4E68A 1S5GY 1SBJA 1RTP1 2KFFA 1QATA 4ORAB 5CSIA 5DKRA 1EL4A 1UP5A 3LK1A 1KFXS 4ORCB 4C0KA 1SYMA 1YURA 1R2UA 2SASA 1XFVO 2HQ8A 2AAOA 1RFJA 2BECA 2JWWA 2PSRA 3EK8A 1NWDA 2KI6C 2KI4C 1TNWA 1JUOA 1KK7Y 1NSHA 4N5XA 3CR4X 3AKAA 4PHKA 2K7OA 5K89A 1HT9A 2ZKMX 3WHTB 1G4YR 1SL9A 1WRLA 2O5GA 1IQ3A 2F2OA 1JF0A 1RJVA 1UHKA 4N1GA 4NDCA 4YGCB 1SR6C 5D69A 4CPVA 1CKKA 1F8HA 1IH0A 1KFUL 2LV7A 1PSBA 3OX6A 3TS5C 3M0WA 1N0YA 1D1OA 1BJFA 1YUSA 1CDPA 4GPLB 4ICBA 1BLQA 4XYNA 2JTTA 2MLEC 1R6PA 2FCDA 4L9MA 1EJ3A 2GV5A 2NLNA 2KNEA 2A4JA 1DMOA 3TDZA 2BCBA 2AMIA 5BPJA 2KDHA 1WLMA 4ORBB 1M46A 4OKHA 3BQ3A 1TOPA 3H4SE 4JWQA 1QX5B 2HQWA 4DUQA 1F54A 3I5IB 2G9BA 1JSAA 5F6TA 3LCPC 1KWOC 3SG3A 5CSNA 3WXAA 1Y0VH 2LVKA 1JF2A 3BUXB 3HCMA 1KK7Z 2BE4A 1L2OC 2HF5A 2L2EA 4MZKA 2QPTA 1CNPA 1B7TY 1RK9A 2M3WA 2WCFA 3BOWA 4PDZA 1GGWA 1PK0D 1IG5A 1W7IB 1OMVA 4NDDA 3DF0A 1A75B 1F70A 1L7ZA 1RWYA 2PASA 1DTLA 1XFYO 2KQ6A 3BUMB 1RECA 1C7WA 1TN4A 1EG3A 3D0YB 3DVEA 1AHRA 3VRQA 5I8NA 5I2OA 3F45A 4NQGA 3DVJA 2KBIA 2LUCA 5B8IB 1FF1A 4DS7A 1SY9A 3DVMA 1OOJA 5DKQA 5HYDA 1CMGA 1BODA 1Y1UA 2L50A 2LNKA 1S6IA 1XVJA 2I18A 3CLNA 4MRXA 2OTGB 4WQ2A 4ZCVA 4YI9A 2JU0A 3A8RA 2DOQA 4D1EA 1FPWA 3CWGA 1LXFC 1SK6D 2WCEA 1K90D 2BKIB 2R2IA 5AANA 1QIVA 1K9PA 5CSJA 2LMVA 1CMFA 1M31A 3NSLA 1F4QA 1DJGA 2M7NA 5DKNA 1ODBA 2ZRTA 1KQMB 4MN0A 4MRYA 2JULA 1QS7A 4OR9B 1KFXL 2COLB 5I2LA 1OZSA 3HX4A 1HQVA 2OS8B 1X02A 1XFUO 2AUCA 1V1GA 2JT0A 1Y1AA 2KGRA 2M0RA 2M49B 2V53A 5AFPA 1QV1A 2MBXA 1XFXO 3PATA 2KFGA 2M29A 3OP0A 4PHJA 1QX7A 4DIRA 1M45A 2CCMA 1U5IB 2KAVA 2JQ6A 1PULA 2NZ0A 4OVNF 2KI6D 3A4UB 1LVCD 4I5LB 1S1EA 3TDIA 2KSPA 4XJKA 3I5IC 3PM8A 1K95A 2K8MB 5FYXA 1IQ5A 1B8RA 1TNQA 2WCBA 3IQOA 4HREE 2L51A 2L5XB 1IGVA 1ZFSA 2H61C 1TTXA 2JC2A 1KQVA 1RROA 1XFWO 3VRRA 2WOSA 5CSFA 1B4CA 4I5NB 5HLVA 4BY5A 1JWDA 1NX3A 2BKHB 4MZJA 1SRAA 3EVRA 1PALA 1CB1A 4PHNA 2EGDA 4WRIA 2LE9B 3KO0A 1CFDA 4HRHA 1QLSA 2F8PA 4DRWA 1QJTA 2KYFA 2WC8A 3ZWHA 4GGNA 4HSZA 3AAJA 1PRWA 1KK8C 2JXCA 2E30A 2LVJA 4R1EA 1DJWA 2ZN9A 2WNDA 3SIAA 2OPOA 1CFCA 1AK8A 1WY9A 3FWBA 4GGFC 3O6BA 3BUOB 3EK4A 1K8UA 2LHIA 2OTGC 3I5FB 2LHLA 2MJWB 1Y6WA 1YUUA 5JOLA 1K94A 1S5GZ 5TNCA 4YBHB 1NX2A 2KHNA 1QIWA 2M8UA 2E6WA 3PN7B 2JNXA 1KCYA 3BUWB 1BMOA 1V1FA 3OB1B 1CDNA 3WNXB 2ZNEA 2LVVA 3EKHA 2LMTA 4CFRA 1KQMC 2LLSA 1QTXA 1AP4A 2SCPA 2FCEA 3D10A 1PVAA 2EC6C 3FWCA 1UWOA 4UPGA 2VRGA 1UHJA 2OS8C 4YI8A 1TCOB 1DJYA 3RLZA 1G33A 4JQ0D 1FI6A 1YX8A 1MUXA 3PLFB 1B8CA 1GQMA 1QVIY 1B1GA 5HKZA 1QX2A 1K2HA 1MXLC 1YVHA 2HPSA 4M2OA 3ZNIA 2CXJA 1VRKA 3CR2A 4AQJA 5AXIA 3NSKA 1H4BA 1B47A 4MLWA 3WHUB 1DJXA 1OMDA 3KEVA 1DJHA 1W7JB 5AERA 2JPTA 1S6JA 1FBVA 1CTRA 1K96A 1MF8B 2BBMA 2ZFDA 4I5KA 1DVIA 1SL7A 4JPZB 4BY4A 1CFFA 2KGBC 1N65A 1J7PA 1GJYA 1A2XA 2ZRSA 2K2AA 2L98A 3AKBA 1XK4C 4MBEA 5D7FA 1BR4B 2CTNA 3GK1A 5J3XA 2BCAA 3JTDB 3QRXA 1S3PA 3SG6A 4HRGA 4AQIA 1BG1A 2GGZA 1SMGA 2TN4A 1LA3A 1B8LA 4PE4A 2CNPA 2MRDA 1SW8A 2K2FA 2M97A 2JT3A 1B7TZ 2I2RE 1DGUA 4FTGA 2L4IA 1BT6A 4GUKA 4NDBA 4PHMA 4OCIA 4OV2A 1ZACA 1JBAA 5KSZA 1EH2A 2JRFA 3SG2A 1J7RA 3BOWB 1NYAA 4GNKB 3VGOA 1UURA 5CPVA 2MHHA 4ZCUA 4Q04A 1BR1B 3EVUA 3I5FC 3DF0B 1JFJA 1LINA 3KPXA 3SG5A 4CFQA 4C0LA 2LVIA 2M1KB 1N2DA 3PSRA 3PN7C 1YVLA 5HKYA 1G8IA 4U8DA 1MR8A 1WDCB 1DF0A 3MSEB 2KFHA 1DJIA 3KHEA 2JOJA 2PMYA 1SPYA 4GBAA 2MA2A 1QASA 1M39A 3FS7A 1KSOA 2IS9A 2LP3A 5HKWA 1GGZA 1SL8A 1YRUB 2Y1MA 3FIAA 1SCMB 4I5JA 2GGMA 1IRJA 1ZOTB 1C07A 1F71A 1A4PA 2HETA 1NUBA 4MSPA 2F33A 2Y4QA 4A4BA 2Y1NA 2K0JA 1SKTA 1NX0A 2KYCA 1TNPA 1C7VA 4ETOA 2WORA 2BE6A 1PVBA 3CS1A 3LLEA 3O4YA 5HLOA 1IJ5A 1F4OA 1A29A 2PALA 1XFZO 4M2QA 1ZMZA 5I2QA 2LANA 4QJ3B 1K9KA 2ZN8A 4YGAA 1CM1A 2LM5A 3TZ1A 2H61A 3BXKA 3LK0A 4QJ4B 1J1EA 1SCVA 1TNXA 1TRFA 3NSOA 3TUYB 5KU1A 1S36A 2ZNDA 3SIBA 5IBWA 4YGEB 5GQQC 3DVKA 1J55A 1A75A 1M63B 1QLKA 2ISDA 4IL1A 3I5GB 1EXRA 1YX7A 2FJUB 3RM1A 2B1UA 1YR5A 2NCPA 3O2PA 3ICBA 3JTDC 2MAZA 4GFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXQ A;  4GAO A;  3D0Y A;  5KTY A;  5G08 A;  2D8N A;  4CLN A;  3OX5 A;  3TDU A;  1LKJ A;  1DF0 B;  4XJK B;  1NCX A;  1IJ6 A;  1ALV A;  1CLL A;  1XA5 A;  1DGV A;  1J1D A;  2JTZ A;  2F3Z A;  2BL0 B;  1DT7 B;  1OE9 B;  3VRO A;  2MLF C;  2PVB A;  3LL8 B;  4GGF A;  4DCK A;  2F3Y A;  1AVS A;  3I5H B;  1TIZ A;  1MQ1 A;  3CGA A;  1TCF A;  1CDL A;  1CLB A;  1K93 D;  1XYD A;  2LCP A;  4YRU A;  2KOT A;  2LP2 A;  2KAX A;  3SG4 A;  1PSR A;  1Y1X A;  2JZI A;  3EKJ A;  1MWN A;  1S26 D;  3JVT B;  4CID A;  3EK7 A;  2BCX A;  2Q4U A;  2QAC A;  1KFU S;  4P2Y B;  5ER5 A;  1JFK A;  5AEQ A;  1WDC C;  1YUT A;  1AJ4 A;  3BUN B;  3CZT X;  1H8B A;  4C0J A;  1CFP A;  1BOC A;  3VRP A;  1J7Q A;  4AOM A;  4FQO A;  1QXP A;  2L4H A;  2FOT A;  1XO5 A;  1CM4 A;  1SCM C;  4N1F A;  1NPQ A;  2KI4 B;  4MZL A;  3GK2 A;  1NIW A;  1UUS A;  4YGD B;  1E8A A;  1MXE A;  1S6C A;  2LUX A;  1YRT B;  1NCZ A;  4QJ5 B;  1FW4 A;  1ALW A;  1OSA A;  2I7A A;  3NXA A;  5ER4 X;  2JT8 A;  1U5I A;  1NX1 A;  1DJZ A;  2LMU A;  1K9U A;  2CT9 A;  1SR6 B;  2G2B A;  2RGI A;  3CR5 X;  4PE0 A;  3VRN A;  1FI5 A;  2CBL A;  2M1U A;  2O60 A;  2KBM A;  3GOF A;  3SG7 A;  1KK8 B;  1BU3 A;  1MHO A;  2H2K A;  4A4C A;  3OB2 B;  3NSI A;  1BF5 A;  2M9G A;  1YTZ C;  3DD4 A;  1UHN A;  2LC5 A;  4MEW A;  4YGB B;  3TS5 B;  3AAK A;  1IKU A;  2KQY A;  5JJG A;  2KAY A;  1AUI B;  1QVI Z;  2Q91 A;  5PAL A;  2JXL A;  4P5O E;  1NCY A;  1J7O A;  3TUY C;  1AJ5 A;  1XK4 A;  1SNL A;  4PAL A;  1LA0 A;  4PE1 A;  4M2P A;  3PFV A;  3OHM B;  3GK4 X;  3I5G C;  2LLT A;  3IQQ A;  2L0P A;  2K61 A;  1A03 A;  1JC2 A;  1KSM A;  1WLZ A;  4TNC A;  1WRZ A;  1IWQ A;  2Y5I A;  3O78 A;  2K7C A;  1KWO B;  1ZUZ A;  3CTN A;  2EC6 B;  2LAP A;  1EG4 A;  3KF9 A;  3PAL A;  1L2O B;  1F55 A;  4PE7 A;  1OQP A;  1OMR A;  2LLU A;  2NCO A;  3BYA A;  3SJS A;  1CLM A;  1UHI A;  2BL0 C;  1WRK A;  1Q80 A;  4MVF A;  4PCW A;  3EVV A;  3IF7 A;  2M7L A;  3I5H C;  4F0Z B;  1OZO A;  2F2P A;  3K21 A;  4WQ3 A;  2K7D A;  1QV0 A;  3C1V A;  2K7B A;  1UHH A;  2EHB A;  1B9A A;  1CDM A;  4USL A;  3E3R A;  1NP8 A;  2I94 A;  2P6B B;  3JVT C;  2BBN A;  2JNF A;  2PRU A;  4E68 A;  1S5G Y;  1SBJ A;  1RTP 1;  2KFF A;  1QAT A;  4ORA B;  5CSI A;  5DKR A;  1EL4 A;  1UP5 A;  3LK1 A;  1KFX S;  4ORC B;  4C0K A;  1SYM A;  1YUR A;  1R2U A;  2SAS A;  1XFV O;  2HQ8 A;  2AAO A;  1RFJ A;  2BEC A;  2JWW A;  2PSR A;  3EK8 A;  1NWD A;  2KI6 C;  2KI4 C;  1TNW A;  1JUO A;  1KK7 Y;  1NSH A;  4N5X A;  3CR4 X;  3AKA A;  4PHK A;  2K7O A;  5K89 A;  1HT9 A;  2ZKM X;  3WHT B;  1G4Y R;  1SL9 A;  1WRL A;  2O5G A;  1IQ3 A;  2F2O A;  1JF0 A;  1RJV A;  1UHK A;  4N1G A;  4NDC A;  4YGC B;  1SR6 C;  5D69 A;  4CPV A;  1CKK A;  1F8H A;  1IH0 A;  1KFU L;  2LV7 A;  1PSB A;  3OX6 A;  3TS5 C;  3M0W A;  1N0Y A;  1D1O A;  1BJF A;  1YUS A;  1CDP A;  4GPL B;  4ICB A;  1BLQ A;  4XYN A;  2JTT A;  2MLE C;  1R6P A;  2FCD A;  4L9M A;  1EJ3 A;  2GV5 A;  2NLN A;  2KNE A;  2A4J A;  1DMO A;  3TDZ A;  2BCB A;  2AMI A;  5BPJ A;  2KDH A;  1WLM A;  4ORB B;  1M46 A;  4OKH A;  3BQ3 A;  1TOP A;  3H4S E;  4JWQ A;  1QX5 B;  2HQW A;  4DUQ A;  1F54 A;  3I5I B;  2G9B A;  1JSA A;  5F6T A;  3LCP C;  1KWO C;  3SG3 A;  5CSN A;  3WXA A;  1Y0V H;  2LVK A;  1JF2 A;  3BUX B;  3HCM A;  1KK7 Z;  2BE4 A;  1L2O C;  2HF5 A;  2L2E A;  4MZK A;  2QPT A;  1CNP A;  1B7T Y;  1RK9 A;  2M3W A;  2WCF A;  3BOW A;  4PDZ A;  1GGW A;  1PK0 D;  1IG5 A;  1W7I B;  1OMV A;  4NDD A;  3DF0 A;  1A75 B;  1F70 A;  1L7Z A;  1RWY A;  2PAS A;  1DTL A;  1XFY O;  2KQ6 A;  3BUM B;  1REC A;  1C7W A;  1TN4 A;  1EG3 A;  3D0Y B;  3DVE A;  1AHR A;  3VRQ A;  5I8N A;  5I2O A;  3F45 A;  4NQG A;  3DVJ A;  2KBI A;  2LUC A;  5B8I B;  1FF1 A;  4DS7 A;  1SY9 A;  3DVM A;  1OOJ A;  5DKQ A;  5HYD A;  1CMG A;  1BOD A;  1Y1U A;  2L50 A;  2LNK A;  1S6I A;  1XVJ A;  2I18 A;  3CLN A;  4MRX A;  2OTG B;  4WQ2 A;  4ZCV A;  4YI9 A;  2JU0 A;  3A8R A;  2DOQ A;  4D1E A;  1FPW A;  3CWG A;  1LXF C;  1SK6 D;  2WCE A;  1K90 D;  2BKI B;  2R2I A;  5AAN A;  1QIV A;  1K9P A;  5CSJ A;  2LMV A;  1CMF A;  1M31 A;  3NSL A;  1F4Q A;  1DJG A;  2M7N A;  5DKN A;  1ODB A;  2ZRT A;  1KQM B;  4MN0 A;  4MRY A;  2JUL A;  1QS7 A;  4OR9 B;  1KFX L;  2COL B;  5I2L A;  1OZS A;  3HX4 A;  1HQV A;  2OS8 B;  1X02 A;  1XFU O;  2AUC A;  1V1G A;  2JT0 A;  1Y1A A;  2KGR A;  2M0R A;  2M49 B;  2V53 A;  5AFP A;  1QV1 A;  2MBX A;  1XFX O;  3PAT A;  2KFG A;  2M29 A;  3OP0 A;  4PHJ A;  1QX7 A;  4DIR A;  1M45 A;  2CCM A;  1U5I B;  2KAV A;  2JQ6 A;  1PUL A;  2NZ0 A;  4OVN F;  2KI6 D;  3A4U B;  1LVC D;  4I5L B;  1S1E A;  3TDI A;  2KSP A;  4XJK A;  3I5I C;  3PM8 A;  1K95 A;  2K8M B;  5FYX A;  1IQ5 A;  1B8R A;  1TNQ A;  2WCB A;  3IQO A;  4HRE E;  2L51 A;  2L5X B;  1IGV A;  1ZFS A;  2H61 C;  1TTX A;  2JC2 A;  1KQV A;  1RRO A;  1XFW O;  3VRR A;  2WOS A;  5CSF A;  1B4C A;  4I5N B;  5HLV A;  4BY5 A;  1JWD A;  1NX3 A;  2BKH B;  4MZJ A;  1SRA A;  3EVR A;  1PAL A;  1CB1 A;  4PHN A;  2EGD A;  4WRI A;  2LE9 B;  3KO0 A;  1CFD A;  4HRH A;  1QLS A;  2F8P A;  4DRW A;  1QJT A;  2KYF A;  2WC8 A;  3ZWH A;  4GGN A;  4HSZ A;  3AAJ A;  1PRW A;  1KK8 C;  2JXC A;  2E30 A;  2LVJ A;  4R1E A;  1DJW A;  2ZN9 A;  2WND A;  3SIA A;  2OPO A;  1CFC A;  1AK8 A;  1WY9 A;  3FWB A;  4GGF C;  3O6B A;  3BUO B;  3EK4 A;  1K8U A;  2LHI A;  2OTG C;  3I5F B;  2LHL A;  2MJW B;  1Y6W A;  1YUU A;  5JOL A;  1K94 A;  1S5G Z;  5TNC A;  4YBH B;  1NX2 A;  2KHN A;  1QIW A;  2M8U A;  2E6W A;  3PN7 B;  2JNX A;  1KCY A;  3BUW B;  1BMO A;  1V1F A;  3OB1 B;  1CDN A;  3WNX B;  2ZNE A;  2LVV A;  3EKH A;  2LMT A;  4CFR A;  1KQM C;  2LLS A;  1QTX A;  1AP4 A;  2SCP A;  2FCE A;  3D10 A;  1PVA A;  2EC6 C;  3FWC A;  1UWO A;  4UPG A;  2VRG A;  1UHJ A;  2OS8 C;  4YI8 A;  1TCO B;  1DJY A;  3RLZ A;  1G33 A;  4JQ0 D;  1FI6 A;  1YX8 A;  1MUX A;  3PLF B;  1B8C A;  1GQM A;  1QVI Y;  1B1G A;  5HKZ A;  1QX2 A;  1K2H A;  1MXL C;  1YVH A;  2HPS A;  4M2O A;  3ZNI A;  2CXJ A;  1VRK A;  3CR2 A;  4AQJ A;  5AXI A;  3NSK A;  1H4B A;  1B47 A;  4MLW A;  3WHU B;  1DJX A;  1OMD A;  3KEV A;  1DJH A;  1W7J B;  5AER A;  2JPT A;  1S6J A;  1FBV A;  1CTR A;  1K96 A;  1MF8 B;  2BBM A;  2ZFD A;  4I5K A;  1DVI A;  1SL7 A;  4JPZ B;  4BY4 A;  1CFF A;  2KGB C;  1N65 A;  1J7P A;  1GJY A;  1A2X A;  2ZRS A;  2K2A A;  2L98 A;  3AKB A;  1XK4 C;  4MBE A;  5D7F A;  1BR4 B;  2CTN A;  3GK1 A;  5J3X A;  2BCA A;  3JTD B;  3QRX A;  1S3P A;  3SG6 A;  4HRG A;  4AQI A;  1BG1 A;  2GGZ A;  1SMG A;  2TN4 A;  1LA3 A;  1B8L A;  4PE4 A;  2CNP A;  2MRD A;  1SW8 A;  2K2F A;  2M97 A;  2JT3 A;  1B7T Z;  2I2R E;  1DGU A;  4FTG A;  2L4I A;  1BT6 A;  4GUK A;  4NDB A;  4PHM A;  4OCI A;  4OV2 A;  1ZAC A;  1JBA A;  5KSZ A;  1EH2 A;  2JRF A;  3SG2 A;  1J7R A;  3BOW B;  1NYA A;  4GNK B;  3VGO A;  1UUR A;  5CPV A;  2MHH A;  4ZCU A;  4Q04 A;  1BR1 B;  3EVU A;  3I5F C;  3DF0 B;  1JFJ A;  1LIN A;  3KPX A;  3SG5 A;  4CFQ A;  4C0L A;  2LVI A;  2M1K B;  1N2D A;  3PSR A;  3PN7 C;  1YVL A;  5HKY A;  1G8I A;  4U8D A;  1MR8 A;  1WDC B;  1DF0 A;  3MSE B;  2KFH A;  1DJI A;  3KHE A;  2JOJ A;  2PMY A;  1SPY A;  4GBA A;  2MA2 A;  1QAS A;  1M39 A;  3FS7 A;  1KSO A;  2IS9 A;  2LP3 A;  5HKW A;  1GGZ A;  1SL8 A;  1YRU B;  2Y1M A;  3FIA A;  1SCM B;  4I5J A;  2GGM A;  1IRJ A;  1ZOT B;  1C07 A;  1F71 A;  1A4P A;  2HET A;  1NUB A;  4MSP A;  2F33 A;  2Y4Q A;  4A4B A;  2Y1N A;  2K0J A;  1SKT A;  1NX0 A;  2KYC A;  1TNP A;  1C7V A;  4ETO A;  2WOR A;  2BE6 A;  1PVB A;  3CS1 A;  3LLE A;  3O4Y A;  5HLO A;  1IJ5 A;  1F4O A;  1A29 A;  2PAL A;  1XFZ O;  4M2Q A;  1ZMZ A;  5I2Q A;  2LAN A;  4QJ3 B;  1K9K A;  2ZN8 A;  4YGA A;  1CM1 A;  2LM5 A;  3TZ1 A;  2H61 A;  3BXK A;  3LK0 A;  4QJ4 B;  1J1E A;  1SCV A;  1TNX A;  1TRF A;  3NSO A;  3TUY B;  5KU1 A;  1S36 A;  2ZND A;  3SIB A;  5IBW A;  4YGE B;  5GQQ C;  3DVK A;  1J55 A;  1A75 A;  1M63 B;  1QLK A;  2ISD A;  4IL1 A;  3I5G B;  1EXR A;  1YX7 A;  2FJU B;  3RM1 A;  2B1U A;  1YR5 A;  2NCP A;  3O2P A;  3ICB A;  3JTD C;  2MAZ A;  4GFT A; 
#chains in the Genus database with same CATH topology
 2NXQ A;  3O4X A;  3D0Y A;  4GAO A;  5KTY A;  5G08 A;  2D8N A;  4CLN A;  3OX5 A;  3TDU A;  1LKJ A;  1TWO A;  1DF0 B;  4XJK B;  1NCX A;  1IJ6 A;  1ALV A;  1CLL A;  1XA5 A;  1DGV A;  1J1D A;  2JTZ A;  2F3Z A;  2BL0 B;  1DT7 B;  1OE9 B;  2WC5 A;  3VRO A;  2MLF C;  2PVB A;  3LL8 B;  1W9Z A;  4GGF A;  4DCK A;  2F3Y A;  1AVS A;  3I5H B;  1TIZ A;  1MQ1 A;  3CGA A;  1TCF A;  2QEH A;  1CDL A;  3UO9 A;  1CLB A;  1K93 D;  1XYD A;  2LCP A;  3S0B A;  4YRU A;  2KOT A;  2LP2 A;  3DXL A;  2KAX A;  3SG4 A;  1PSR A;  1Y1X A;  2JZI A;  3EKJ A;  1MWN A;  1S26 D;  3JVT B;  4CID A;  4F7F A;  3EK7 A;  2BCX A;  5FI6 A;  2Q4U A;  2QAC A;  1KFU S;  4P2Y B;  5ER5 A;  1JFK A;  5AEQ A;  1WDC C;  3NHT A;  1YUT A;  1AJ4 A;  2KPH A;  3BUN B;  3CZT X;  4C0J A;  1CFP A;  1BOC A;  3VRP A;  1J7Q A;  1H8B A;  4AOM A;  4FQO A;  1QXP A;  2L4H A;  2FOT A;  1XO5 A;  1CM4 A;  1SCM C;  4N1F A;  1NPQ A;  2KI4 B;  2QEB A;  3GK2 A;  1NIW A;  1UUS A;  4MZL A;  4YGD B;  1E8A A;  1MXE A;  1QWV A;  1S6C A;  3BFA A;  2LUX A;  2WC6 A;  3D74 A;  1YRT B;  1NCZ A;  4QJ5 B;  1FW4 A;  2PYQ A;  1ALW A;  1OSA A;  3V2L A;  2I7A A;  3NXA A;  5I94 A;  5ER4 X;  2JT8 A;  1U5I A;  1NX1 A;  1DJZ A;  2LMU A;  1K9U A;  2CT9 A;  1SR6 B;  2G2B A;  2RGI A;  3CR5 X;  4PE0 A;  3OGN A;  3VRN A;  1FI5 A;  2CBL A;  2M1U A;  2O60 A;  2KBM A;  3GOF A;  3D73 A;  1KK8 B;  1BU3 A;  1LS8 A;  1MHO A;  2H2K A;  3OB2 B;  3NSI A;  3SG7 A;  1BF5 A;  2M9G A;  1YTZ C;  3DD4 A;  1UHN A;  2LC5 A;  2FJY A;  4INW A;  4MEW A;  4YGB B;  3TS5 B;  3AAK A;  1IKU A;  2KQY A;  5JJG A;  2KAY A;  1AUI B;  1QVI Z;  2Q91 A;  5PAL A;  2JXL A;  4P5O E;  1NCY A;  3FE9 A;  1J7O A;  3TUY C;  1AJ5 A;  1XK4 A;  1SNL A;  4PAL A;  1LA0 A;  4PE1 A;  3L4L A;  3OBV A;  4M2P A;  3PFV A;  3OHM B;  3GK4 X;  3I5G C;  2LLT A;  2BNX A;  3IQQ A;  2L0P A;  3SS5 A;  2K61 A;  1A03 A;  1JC2 A;  1KSM A;  1WLZ A;  4TNC A;  1WRZ A;  1IWQ A;  2Y5I A;  3O78 A;  2K7C A;  1KWO B;  1ZUZ A;  3CTN A;  1OOH A;  2EC6 B;  2LAP A;  1EG4 A;  3KF9 A;  3PAL A;  1L2O B;  3DY9 A;  4PE7 A;  1OQP A;  1OMR A;  1F55 A;  2LLU A;  2NCO A;  3BYA A;  4OZD A;  5FI2 A;  3SJS A;  1CLM A;  1UHI A;  2BL0 C;  1WRK A;  1Q80 A;  4MVF A;  3CAB A;  4PCW A;  3EVV A;  3IF7 A;  2M7L A;  2H8V A;  3I5H C;  1OZO A;  2F2P A;  3K21 A;  4JKT A;  4WQ3 A;  4F0Z B;  2K7D A;  1QV0 A;  3C1V A;  2K7B A;  1UHH A;  2EHB A;  1B9A A;  1CDM A;  4USL A;  3E3R A;  1NP8 A;  3BFB A;  2I94 A;  2P6B B;  3JVT C;  2BBN A;  3BFH A;  2JNF A;  2PRU A;  4E68 A;  1S5G Y;  1SBJ A;  1RTP 1;  2KFF A;  1QAT A;  4ORA B;  5CSI A;  5DKR A;  1EL4 A;  1UP5 A;  2WCK A;  3LK1 A;  1KFX S;  4ORC B;  3B6X A;  1SYM A;  1YUR A;  3FE8 A;  4C0K A;  1R2U A;  5EL2 A;  2SAS A;  1XFV O;  2HQ8 A;  2AAO A;  1RFJ A;  2BEC A;  2JWW A;  2PSR A;  3EK8 A;  1NWD A;  2KI6 C;  2KI4 C;  1TNW A;  1JUO A;  1KK7 Y;  1NSH A;  4N5X A;  3CR4 X;  3AKA A;  4PHK A;  2K7O A;  4PT1 A;  5K89 A;  1HT9 A;  2ZKM X;  3WHT B;  1G4Y R;  1SL9 A;  1WRL A;  2O5G A;  1IQ3 A;  2F2O A;  3CDN A;  1JF0 A;  1RJV A;  1DEK A;  1UHK A;  4N1G A;  4NDC A;  4YGC B;  1SR6 C;  5D69 A;  4CPV A;  1CKK A;  1F8H A;  1IH0 A;  1KFU L;  2LV7 A;  1PSB A;  3OX6 A;  4KYN A;  3TS5 C;  2WCJ A;  3M0W A;  1N0Y A;  1D1O A;  1BJF A;  1YUS A;  1CDP A;  4GPL B;  4ICB A;  1BLQ A;  4XYN A;  1Z4H A;  3CZ1 A;  2JTT A;  2MLE C;  1R6P A;  2FCD A;  4L9M A;  1EJ3 A;  2K60 A;  2GV5 A;  2NLN A;  1TUJ A;  2KNE A;  2A4J A;  1DMO A;  3TDZ A;  1IIO A;  2BCB A;  3R1V A;  2AMI A;  1DC1 A;  5BPJ A;  2KDH A;  1WLM A;  4ORB B;  1M46 A;  4OKH A;  3BQ3 A;  1TOP A;  3H4S E;  4JWQ A;  1QX5 B;  2HQW A;  3B87 A;  4DUQ A;  3I5I B;  1F54 A;  2G9B A;  3CZ0 A;  1JSA A;  5F6T A;  3LCP C;  1KWO C;  3SG3 A;  5CSN A;  3WXA A;  1Y0V H;  2LVK A;  1JF2 A;  2WCH A;  3BUX B;  3HCM A;  1KK7 Z;  2BE4 A;  1L2O C;  2HF5 A;  2L2E A;  4MZK A;  2QPT A;  1CNP A;  2JPO A;  1B7T Y;  1RK9 A;  2M3W A;  2WCF A;  3BOW A;  4PDZ A;  1GGW A;  1PK0 D;  1IG5 A;  2KLE A;  3S0E A;  2L2C A;  3NHI A;  1W7I B;  1OMV A;  4NDD A;  3DF0 A;  1A75 B;  1F70 A;  1L7Z A;  1RWY A;  2PAS A;  1DTL A;  1XFY O;  4FQT A;  2KLD A;  2KQ6 A;  3BUM B;  1REC A;  3L47 A;  1C7W A;  1TN4 A;  2GTE A;  1EG3 A;  3D0Y B;  1C3Z A;  3DVE A;  1AHR A;  3N7H A;  3VRQ A;  5I8N A;  5I2O A;  3F45 A;  4JD9 A;  4NQG A;  3DVJ A;  2KBI A;  2LUC A;  5B8I B;  1FF1 A;  4DS7 A;  1SY9 A;  3DVM A;  1OOJ A;  5DKQ A;  5HYD A;  1CMG A;  1BOD A;  1Y1U A;  2L50 A;  2LNK A;  1S6I A;  1XVJ A;  2I18 A;  3CLN A;  3K1E A;  2OTG B;  4MRX A;  4WQ2 A;  4ZCV A;  1SSE B;  4YI9 A;  2JU0 A;  3A8R A;  2DOQ A;  4D1E A;  1FPW A;  3CWG A;  1LXF C;  1SK6 D;  2WCE A;  1GM0 A;  1K90 D;  2BKI B;  2R2I A;  5AAN A;  3CYZ A;  1QIV A;  1K9P A;  5CSJ A;  2LMV A;  2QEO A;  1CMF A;  1M31 A;  3NSL A;  1F4Q A;  1DJG A;  2M7N A;  5DKN A;  1ODB A;  2ZRT A;  3EG5 B;  1KQM B;  4A4C A;  4MN0 A;  1DEL A;  4MRY A;  2JUL A;  1QS7 A;  4OR9 B;  1KFX L;  2COL B;  5I2L A;  1OZS A;  3HX4 A;  1HQV A;  2OS8 B;  1X02 A;  1XFU O;  2AUC A;  1V1G A;  2JT0 A;  1Y1A A;  2KGR A;  2M0R A;  2M49 B;  2V53 A;  5AFP A;  1QV1 A;  4INX A;  2MBX A;  1XFX O;  3PAT A;  3D75 A;  2KFG A;  2M29 A;  3L4A A;  3OP0 A;  1QX7 A;  1XFR A;  4PHJ A;  4DIR A;  1M45 A;  2CCM A;  1U5I B;  2KAV A;  2JQ6 A;  1PUL A;  2NZ0 A;  3D77 A;  4OVN F;  2KI6 D;  3A4U B;  1LVC D;  2P70 A;  1S1E A;  4I5L B;  2KSP A;  4XJK A;  3TDI A;  3I5I C;  3PM8 A;  1K95 A;  2BAP A;  2K8M B;  3DZT A;  5FYX A;  1IQ5 A;  1B8R A;  1TNQ A;  2WCB A;  3IQO A;  3R72 A;  2L51 A;  2L5X B;  4HRE E;  1IGV A;  1ZFS A;  2H61 C;  1TTX A;  3DYE A;  2JC2 A;  1KQV A;  1RRO A;  1XFW O;  3VRR A;  2WOS A;  5CSF A;  1B4C A;  3B88 A;  4I5N B;  5HLV A;  4BY5 A;  1JWD A;  1NX3 A;  2BKH B;  4MZJ A;  1SRA A;  3EVR A;  3R1P A;  1PAL A;  1CB1 A;  4PHN A;  2EGD A;  4WRI A;  2LE9 B;  3KO0 A;  1OOG A;  1Z2C B;  1CFD A;  2WCL A;  4HRH A;  1QLS A;  2F8P A;  4DRW A;  1QJT A;  5HL1 A;  2KYF A;  2WC8 A;  3ZWH A;  4GGN A;  4HSZ A;  3AAJ A;  1PRW A;  1KK8 C;  2JXC A;  3QME A;  2E30 A;  2LVJ A;  1OW4 A;  4R1E A;  1DJW A;  2ZN9 A;  2WND A;  3SIA A;  2OPO A;  3S0A A;  1CFC A;  3S0F A;  4IJ7 A;  1ORG A;  1T14 A;  1AK8 A;  1WY9 A;  3FWB A;  4GGF C;  3VB1 A;  3O6B A;  3BUO B;  3EK4 A;  1K8U A;  2LHI A;  2OTG C;  3I5F B;  3FE6 A;  2LHL A;  2MJW B;  1Y6W A;  3S0D A;  1YUU A;  5JOL A;  1K94 A;  1S5G Z;  5TNC A;  4YBH B;  1NX2 A;  2KHN A;  1QIW A;  2M8U A;  2E6W A;  3PN7 B;  2JNX A;  1KCY A;  2QDI A;  1DQE A;  3S0G A;  3BUW B;  1BMO A;  1V1F A;  3OB1 B;  1CDN A;  3WNX B;  2ZNE A;  2LVV A;  3EKH A;  2LMT A;  4CFR A;  1KQM C;  2LLS A;  1QTX A;  1AP4 A;  2SCP A;  2FCE A;  3D10 A;  1PVA A;  2EC6 C;  3FWC A;  1UWO A;  4UPG A;  2VRG A;  2PQL A;  1UHJ A;  2OS8 C;  4YI8 A;  1TCO B;  1DJY A;  3RLZ A;  1G33 A;  3CZ2 A;  4JQ0 D;  1FI6 A;  1YX8 A;  1MUX A;  3PLF B;  1B8C A;  1GQM A;  1QVI Y;  1B1G A;  5HKZ A;  1QX2 A;  1K2H A;  1MXL C;  1YVH A;  2HPS A;  4M2O A;  3ZNI A;  2CXJ A;  1VRK A;  3CR2 A;  4AQJ A;  5AXI A;  3NSK A;  1H4B A;  1B47 A;  4MLW A;  3SS4 A;  3WHU B;  1DJX A;  1OMD A;  3KEV A;  1DJH A;  1W7J B;  5AER A;  2JPT A;  1S6J A;  1FBV A;  1CTR A;  1K96 A;  1MF8 B;  2BBM A;  2ZFD A;  4I5K A;  1DVI A;  1SL7 A;  4JPZ B;  4BY4 A;  1CFF A;  2ERB A;  1N65 A;  2KGB C;  5D3O A;  1J7P A;  1GJY A;  1A2X A;  2ZRS A;  2WCM A;  3NGV A;  2K2A A;  2L98 A;  2QEV A;  3AKB A;  1XK4 C;  4MBE A;  5D7F A;  1BR4 B;  2CTN A;  3GK1 A;  3D78 A;  5J3X A;  2BCA A;  3JTD B;  3QRX A;  1S3P A;  3SG6 A;  4HRG A;  4AQI A;  1BG1 A;  2GGZ A;  3UNW A;  1SMG A;  2TN4 A;  1OOI X;  1LA3 A;  3B7A A;  1B8L A;  4PE4 A;  5DIC A;  3SS3 A;  2CNP A;  2MRD A;  1SW8 A;  1C3Y A;  2K2F A;  2M97 A;  2JT3 A;  1B7T Z;  2I2R E;  1DGU A;  4FTG A;  2L4I A;  1BT6 A;  4GUK A;  4NDB A;  4PHM A;  4OCI A;  4OV2 A;  1ZAC A;  1JBA A;  5KSZ A;  1EH2 A;  2JRF A;  3SG2 A;  1J7R A;  3PJI A;  3BOW B;  1NYA A;  4GNK B;  3VGO A;  1UUR A;  5CPV A;  2MHH A;  4ZCU A;  3RZS A;  4Q04 A;  1BR1 B;  3EVU A;  3I5F C;  3DF0 B;  2L5Y A;  1JFJ A;  1OOF A;  1LIN A;  3KPX A;  3SG5 A;  4CFQ A;  4C0L A;  2LVI A;  2M1K B;  1N2D A;  3PSR A;  3PN7 C;  1YVL A;  5HKY A;  3BJH A;  1G8I A;  4U8D A;  1MR8 A;  1WDC B;  5FI7 A;  1DF0 A;  3MSE B;  2KFH A;  1DJI A;  3KHE A;  2JOJ A;  2PMY A;  1SPY A;  4GBA A;  2MA2 A;  1QAS A;  1M39 A;  3FS7 A;  1KSO A;  2IS9 A;  2LP3 A;  5HKW A;  1GGZ A;  1SL8 A;  1YRU B;  2Y1M A;  3FIA A;  1SCM B;  4I5J A;  3R1O A;  2GGM A;  1IRJ A;  1ZOT B;  1C07 A;  1F71 A;  1A4P A;  2HET A;  1NUB A;  4MSP A;  2F33 A;  2Y4Q A;  4A4B A;  2Y1N A;  2K0J A;  2P71 A;  1SKT A;  1NX0 A;  2KYC A;  1P28 A;  1TNP A;  2YGU A;  1C7V A;  4ETO A;  2WOR A;  2BE6 A;  1PVB A;  3CS1 A;  3LLE A;  3O4Y A;  5HLO A;  1IJ5 A;  1F4O A;  1A29 A;  3PM2 A;  2PAL A;  1TUZ A;  1XFZ O;  4M2Q A;  3Q8I A;  1ZMZ A;  3B86 A;  2LAN A;  4QJ3 B;  5I2Q A;  1K9K A;  2ZN8 A;  4YGA A;  1CM1 A;  2LM5 A;  3TZ1 A;  2H61 A;  3BXK A;  3LK0 A;  4QJ4 B;  3IVT A;  1J1E A;  1SCV A;  1TNX A;  1TRF A;  3NSO A;  3TUY B;  5KU1 A;  1S36 A;  2ZND A;  3SIB A;  5IBW A;  4YGE B;  5GQQ C;  3DVK A;  1J55 A;  1A75 A;  1M63 B;  1QLK A;  2ISD A;  4IL1 A;  3I5G B;  1EXR A;  1YX7 A;  2FJU B;  3RM1 A;  2B1U A;  1YR5 A;  2NCP A;  3O2P A;  3ICB A;  3JTD C;  2MAZ A;  4GFT A;  3D76 A; 
#chains in the Genus database with same CATH homology
 2NXQ A;  4GAO A;  3D0Y A;  5KTY A;  5G08 A;  2D8N A;  4CLN A;  3OX5 A;  3TDU A;  1LKJ A;  1DF0 B;  4XJK B;  1NCX A;  1IJ6 A;  1ALV A;  1CLL A;  1XA5 A;  1DGV A;  1J1D A;  2JTZ A;  2F3Z A;  2BL0 B;  1DT7 B;  1OE9 B;  3VRO A;  2MLF C;  2PVB A;  3LL8 B;  4GGF A;  4DCK A;  2F3Y A;  1AVS A;  3I5H B;  1TIZ A;  1MQ1 A;  3CGA A;  1TCF A;  1CDL A;  1CLB A;  1K93 D;  1XYD A;  2LCP A;  4YRU A;  2KOT A;  2LP2 A;  2KAX A;  3SG4 A;  1PSR A;  1Y1X A;  2JZI A;  3EKJ A;  1MWN A;  1S26 D;  3JVT B;  4CID A;  3EK7 A;  2BCX A;  2Q4U A;  2QAC A;  1KFU S;  4P2Y B;  5ER5 A;  1JFK A;  5AEQ A;  1WDC C;  1YUT A;  1AJ4 A;  3BUN B;  3CZT X;  1H8B A;  4C0J A;  1CFP A;  1BOC A;  3VRP A;  1J7Q A;  4AOM A;  4FQO A;  1QXP A;  2L4H A;  2FOT A;  1XO5 A;  1CM4 A;  1SCM C;  4N1F A;  1NPQ A;  2KI4 B;  4MZL A;  3GK2 A;  1NIW A;  1UUS A;  4YGD B;  1E8A A;  1MXE A;  1S6C A;  2LUX A;  1YRT B;  1NCZ A;  4QJ5 B;  1FW4 A;  1ALW A;  1OSA A;  2I7A A;  3NXA A;  5ER4 X;  2JT8 A;  1U5I A;  1NX1 A;  1DJZ A;  2LMU A;  1K9U A;  2CT9 A;  1SR6 B;  2G2B A;  2RGI A;  3CR5 X;  4PE0 A;  3VRN A;  1FI5 A;  2CBL A;  2M1U A;  2O60 A;  2KBM A;  3GOF A;  3SG7 A;  1KK8 B;  1BU3 A;  1MHO A;  2H2K A;  4A4C A;  3OB2 B;  3NSI A;  1BF5 A;  2M9G A;  1YTZ C;  3DD4 A;  1UHN A;  2LC5 A;  4MEW A;  4YGB B;  3TS5 B;  3AAK A;  1IKU A;  2KQY A;  5JJG A;  2KAY A;  1AUI B;  1QVI Z;  2Q91 A;  5PAL A;  2JXL A;  4P5O E;  1NCY A;  1J7O A;  3TUY C;  1AJ5 A;  1XK4 A;  1SNL A;  4PAL A;  1LA0 A;  4PE1 A;  4M2P A;  3PFV A;  3OHM B;  3GK4 X;  3I5G C;  2LLT A;  3IQQ A;  2L0P A;  2K61 A;  1A03 A;  1JC2 A;  1KSM A;  1WLZ A;  4TNC A;  1WRZ A;  1IWQ A;  2Y5I A;  3O78 A;  2K7C A;  1KWO B;  1ZUZ A;  3CTN A;  2EC6 B;  2LAP A;  1EG4 A;  3KF9 A;  3PAL A;  1L2O B;  1F55 A;  4PE7 A;  1OQP A;  1OMR A;  2LLU A;  2NCO A;  3BYA A;  3SJS A;  1CLM A;  1UHI A;  2BL0 C;  1WRK A;  1Q80 A;  4MVF A;  4PCW A;  3EVV A;  3IF7 A;  2M7L A;  3I5H C;  4F0Z B;  1OZO A;  2F2P A;  3K21 A;  4WQ3 A;  2K7D A;  1QV0 A;  3C1V A;  2K7B A;  1UHH A;  2EHB A;  1B9A A;  1CDM A;  4USL A;  3E3R A;  1NP8 A;  2I94 A;  2P6B B;  3JVT C;  2BBN A;  2JNF A;  2PRU A;  4E68 A;  1S5G Y;  1SBJ A;  1RTP 1;  2KFF A;  1QAT A;  4ORA B;  5CSI A;  5DKR A;  1EL4 A;  1UP5 A;  3LK1 A;  1KFX S;  4ORC B;  4C0K A;  1SYM A;  1YUR A;  1R2U A;  2SAS A;  1XFV O;  2HQ8 A;  2AAO A;  1RFJ A;  2BEC A;  2JWW A;  2PSR A;  3EK8 A;  1NWD A;  2KI6 C;  2KI4 C;  1TNW A;  1JUO A;  1KK7 Y;  1NSH A;  4N5X A;  3CR4 X;  3AKA A;  4PHK A;  2K7O A;  5K89 A;  1HT9 A;  2ZKM X;  3WHT B;  1G4Y R;  1SL9 A;  1WRL A;  2O5G A;  1IQ3 A;  2F2O A;  1JF0 A;  1RJV A;  1UHK A;  4N1G A;  4NDC A;  4YGC B;  1SR6 C;  5D69 A;  4CPV A;  1CKK A;  1F8H A;  1IH0 A;  1KFU L;  2LV7 A;  1PSB A;  3OX6 A;  3TS5 C;  3M0W A;  1N0Y A;  1D1O A;  1BJF A;  1YUS A;  1CDP A;  4GPL B;  4ICB A;  1BLQ A;  4XYN A;  2JTT A;  2MLE C;  1R6P A;  2FCD A;  4L9M A;  1EJ3 A;  2GV5 A;  2NLN A;  2KNE A;  2A4J A;  1DMO A;  3TDZ A;  2BCB A;  2AMI A;  5BPJ A;  2KDH A;  1WLM A;  4ORB B;  1M46 A;  4OKH A;  3BQ3 A;  1TOP A;  3H4S E;  4JWQ A;  1QX5 B;  2HQW A;  4DUQ A;  1F54 A;  3I5I B;  2G9B A;  1JSA A;  5F6T A;  3LCP C;  1KWO C;  3SG3 A;  5CSN A;  3WXA A;  1Y0V H;  2LVK A;  1JF2 A;  3BUX B;  3HCM A;  1KK7 Z;  2BE4 A;  1L2O C;  2HF5 A;  2L2E A;  4MZK A;  2QPT A;  1CNP A;  1B7T Y;  1RK9 A;  2M3W A;  2WCF A;  3BOW A;  4PDZ A;  1GGW A;  1PK0 D;  1IG5 A;  1W7I B;  1OMV A;  4NDD A;  3DF0 A;  1A75 B;  1F70 A;  1L7Z A;  1RWY A;  2PAS A;  1DTL A;  1XFY O;  2KQ6 A;  3BUM B;  1REC A;  1C7W A;  1TN4 A;  1EG3 A;  3D0Y B;  3DVE A;  1AHR A;  3VRQ A;  5I8N A;  5I2O A;  3F45 A;  4NQG A;  3DVJ A;  2KBI A;  2LUC A;  5B8I B;  1FF1 A;  4DS7 A;  1SY9 A;  3DVM A;  1OOJ A;  5DKQ A;  5HYD A;  1CMG A;  1BOD A;  1Y1U A;  2L50 A;  2LNK A;  1S6I A;  1XVJ A;  2I18 A;  3CLN A;  4MRX A;  2OTG B;  4WQ2 A;  4ZCV A;  4YI9 A;  2JU0 A;  3A8R A;  2DOQ A;  4D1E A;  1FPW A;  3CWG A;  1LXF C;  1SK6 D;  2WCE A;  1K90 D;  2BKI B;  2R2I A;  5AAN A;  1QIV A;  1K9P A;  5CSJ A;  2LMV A;  1CMF A;  1M31 A;  3NSL A;  1F4Q A;  1DJG A;  2M7N A;  5DKN A;  1ODB A;  2ZRT A;  1KQM B;  4MN0 A;  4MRY A;  2JUL A;  1QS7 A;  4OR9 B;  1KFX L;  2COL B;  5I2L A;  1OZS A;  3HX4 A;  1HQV A;  2OS8 B;  1X02 A;  1XFU O;  2AUC A;  1V1G A;  2JT0 A;  1Y1A A;  2KGR A;  2M0R A;  2M49 B;  2V53 A;  5AFP A;  1QV1 A;  2MBX A;  1XFX O;  3PAT A;  2KFG A;  2M29 A;  3OP0 A;  4PHJ A;  1QX7 A;  4DIR A;  1M45 A;  2CCM A;  1U5I B;  2KAV A;  2JQ6 A;  1PUL A;  2NZ0 A;  4OVN F;  2KI6 D;  3A4U B;  1LVC D;  4I5L B;  1S1E A;  3TDI A;  2KSP A;  4XJK A;  3I5I C;  3PM8 A;  1K95 A;  2K8M B;  5FYX A;  1IQ5 A;  1B8R A;  1TNQ A;  2WCB A;  3IQO A;  4HRE E;  2L51 A;  2L5X B;  1IGV A;  1ZFS A;  2H61 C;  1TTX A;  2JC2 A;  1KQV A;  1RRO A;  1XFW O;  3VRR A;  2WOS A;  5CSF A;  1B4C A;  4I5N B;  5HLV A;  4BY5 A;  1JWD A;  1NX3 A;  2BKH B;  4MZJ A;  1SRA A;  3EVR A;  1PAL A;  1CB1 A;  4PHN A;  2EGD A;  4WRI A;  2LE9 B;  3KO0 A;  1CFD A;  4HRH A;  1QLS A;  2F8P A;  4DRW A;  1QJT A;  2KYF A;  2WC8 A;  3ZWH A;  4GGN A;  4HSZ A;  3AAJ A;  1PRW A;  1KK8 C;  2JXC A;  2E30 A;  2LVJ A;  4R1E A;  1DJW A;  2ZN9 A;  2WND A;  3SIA A;  2OPO A;  1CFC A;  1AK8 A;  1WY9 A;  3FWB A;  4GGF C;  3O6B A;  3BUO B;  3EK4 A;  1K8U A;  2LHI A;  2OTG C;  3I5F B;  2LHL A;  2MJW B;  1Y6W A;  1YUU A;  5JOL A;  1K94 A;  1S5G Z;  5TNC A;  4YBH B;  1NX2 A;  2KHN A;  1QIW A;  2M8U A;  2E6W A;  3PN7 B;  2JNX A;  1KCY A;  3BUW B;  1BMO A;  1V1F A;  3OB1 B;  1CDN A;  3WNX B;  2ZNE A;  2LVV A;  3EKH A;  2LMT A;  4CFR A;  1KQM C;  2LLS A;  1QTX A;  1AP4 A;  2SCP A;  2FCE A;  3D10 A;  1PVA A;  2EC6 C;  3FWC A;  1UWO A;  4UPG A;  2VRG A;  1UHJ A;  2OS8 C;  4YI8 A;  1TCO B;  1DJY A;  3RLZ A;  1G33 A;  4JQ0 D;  1FI6 A;  1YX8 A;  1MUX A;  3PLF B;  1B8C A;  1GQM A;  1QVI Y;  1B1G A;  5HKZ A;  1QX2 A;  1K2H A;  1MXL C;  1YVH A;  2HPS A;  4M2O A;  3ZNI A;  2CXJ A;  1VRK A;  3CR2 A;  4AQJ A;  5AXI A;  3NSK A;  1H4B A;  1B47 A;  4MLW A;  3WHU B;  1DJX A;  1OMD A;  3KEV A;  1DJH A;  1W7J B;  5AER A;  2JPT A;  1S6J A;  1FBV A;  1CTR A;  1K96 A;  1MF8 B;  2BBM A;  2ZFD A;  4I5K A;  1DVI A;  1SL7 A;  4JPZ B;  4BY4 A;  1CFF A;  2KGB C;  1N65 A;  1J7P A;  1GJY A;  1A2X A;  2ZRS A;  2K2A A;  2L98 A;  3AKB A;  1XK4 C;  4MBE A;  5D7F A;  1BR4 B;  2CTN A;  3GK1 A;  5J3X A;  2BCA A;  3JTD B;  3QRX A;  1S3P A;  3SG6 A;  4HRG A;  4AQI A;  1BG1 A;  2GGZ A;  1SMG A;  2TN4 A;  1LA3 A;  1B8L A;  4PE4 A;  2CNP A;  2MRD A;  1SW8 A;  2K2F A;  2M97 A;  2JT3 A;  1B7T Z;  2I2R E;  1DGU A;  4FTG A;  2L4I A;  1BT6 A;  4GUK A;  4NDB A;  4PHM A;  4OCI A;  4OV2 A;  1ZAC A;  1JBA A;  5KSZ A;  1EH2 A;  2JRF A;  3SG2 A;  1J7R A;  3BOW B;  1NYA A;  4GNK B;  3VGO A;  1UUR A;  5CPV A;  2MHH A;  4ZCU A;  4Q04 A;  1BR1 B;  3EVU A;  3I5F C;  3DF0 B;  1JFJ A;  1LIN A;  3KPX A;  3SG5 A;  4CFQ A;  4C0L A;  2LVI A;  2M1K B;  1N2D A;  3PSR A;  3PN7 C;  1YVL A;  5HKY A;  1G8I A;  4U8D A;  1MR8 A;  1WDC B;  1DF0 A;  3MSE B;  2KFH A;  1DJI A;  3KHE A;  2JOJ A;  2PMY A;  1SPY A;  4GBA A;  2MA2 A;  1QAS A;  1M39 A;  3FS7 A;  1KSO A;  2IS9 A;  2LP3 A;  5HKW A;  1GGZ A;  1SL8 A;  1YRU B;  2Y1M A;  3FIA A;  1SCM B;  4I5J A;  2GGM A;  1IRJ A;  1ZOT B;  1C07 A;  1F71 A;  1A4P A;  2HET A;  1NUB A;  4MSP A;  2F33 A;  2Y4Q A;  4A4B A;  2Y1N A;  2K0J A;  1SKT A;  1NX0 A;  2KYC A;  1TNP A;  1C7V A;  4ETO A;  2WOR A;  2BE6 A;  1PVB A;  3CS1 A;  3LLE A;  3O4Y A;  5HLO A;  1IJ5 A;  1F4O A;  1A29 A;  2PAL A;  1XFZ O;  4M2Q A;  1ZMZ A;  5I2Q A;  2LAN A;  4QJ3 B;  1K9K A;  2ZN8 A;  4YGA A;  1CM1 A;  2LM5 A;  3TZ1 A;  2H61 A;  3BXK A;  3LK0 A;  4QJ4 B;  1J1E A;  1SCV A;  1TNX A;  1TRF A;  3NSO A;  3TUY B;  5KU1 A;  1S36 A;  2ZND A;  3SIB A;  5IBW A;  4YGE B;  5GQQ C;  3DVK A;  1J55 A;  1A75 A;  1M63 B;  1QLK A;  2ISD A;  4IL1 A;  3I5G B;  1EXR A;  1YX7 A;  2FJU B;  3RM1 A;  2B1U A;  1YR5 A;  2NCP A;  3O2P A;  3ICB A;  3JTD C;  2MAZ A;  4GFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...